3QUEA

Human p38 map kinase in complex with skepinone-l
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
349
structure length
343
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Skepinone-L is a selective p38 mitogen-activated protein kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 106
structure length 343
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3queA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3queA01
1OL7A 4EKKA 2X2MA 4QP4A 1DM2A 3PVUA 2OBJA 2PVKA 3WI6A 2NPQA 5K3YA 5D41A 5AX9A 3ZRMA 4USFA 1PJKA 2OJJA 2GNHA 4H39A 4Z3VA 2I0HA 4H3BA 2V7AA 3BKBA 3D5WA 2BDWA 4C35A 4NKAA 4ENXA 4FE2A 1FPUA 3FMDA 3QKKA 4JIKA 2UZBA 5CVHA 3TI1A 3PUPA 2VX0A 5BQ0A 3E93A 3DK6A 1BL7A 1ERKA 1OB3A 4WSYA 5F1ZA 2WMVA 3U4WA 4ZZOA 2F7EE 2OXDA 4FTJA 3QA8A 5JGDA 3K5VA 2PSQA 3FI3A 2YM6A 4U42A 4YJPA 4M66A 1W82A 5E90A 3RALA 4D9TA 1ZAOA 2YERA 3K5UA 4QTEA 4LI5A 3ULZA 3FZTA 2YIXA 3UOLA 4A4XA 3KN5A 4C8BA 5AIKA 3QD3A 3IONA 1NY3A 2C0OA 2QG7A 2EB3A 5JRSA 2QO2A 5B2KA 3NUXA 2QOHA 4BCGA 5IUHA 4CSVA 2AUHA 4EBVA 3O23A 5AV1A 3ORIA 2P33A 3LXLA 4RVKA 2BIKB 2Y6OA 3HX4A 4NEUA 4O7SA 3V5QA 4BCMA 3BQCA 4EEVA 2OLCA 4HGLA 4DH3A 4IAIA 2HWOA 3P0MA 4I5CA 3F5PA 4KKHA 4KRCA 2PYWA 1PW2A 2GTNA 4FNWA 2YLEA 4GYGA 4AA0A 4QMLA 3UIMA 4UX9A 5AR4A 3QKLA 4PDYA 3V5PA 4XJ0A 2GNJA 2O0UA 2VTMA 5K0KA 4JL9A 4FV6A 2W5HA 3PXFA 4W9XA 1RDQE 3C9WA 2WAJA 3UPZA 1UU9A 3C4CA 3MB6A 4DEIA 5FRIA 3UOKA 2REIA 4EQUA 2HWPA 3ZC6A 3HYHA 5HNGA 4ACCA 2W05A 3CJGA 4NZWB 2WPAA 2WFYA 4CRLA 3BGZA 1YWRA 5F20A 2RGPA 4HCUA 3UIUA 1T45A 2VNYA 2ZV8A 4W4VA 5HOAA 3WIGA 3P4KA 3OY1A 4DFYA 5AA8A 4XMOA 3R1NA 5BPYA 1PF8A 4NUSA 1V1KA 3ID6C 2YFXA 1NVQA 4F9AA 2WMUA 3EZRA 4R6VA 2X0GA 3P86A 3RWPA 3ZM9A 2GS6A 4Z9LA 3Q5ZA 5E8YA 5EW3A 3MSSA 3PJ3A 4EHZA 1FVVA 2O2UA 5HE3A 4QNYA 3R7OA 2ZJWA 4IJ9A 2VTSA 3DGKA 4PMMA 1UNHA 4RQKA 3H9RA 4FNYA 2BDFA 3O2MA 3FDNA 5L2SA 4YJUA 5IQCA 4FSMA 1ZY5A 4RG0A 5KX8A 2DQ7X 2CCHA 3H30A 3D5VA 3NNXA 5LJJA 3GCUA 3QRUA 4E20A 3NRMA 4NWMA 4JIAA 3VW6A 5KCVA 5GIPE 3T9TA 3QBNA 4OT5A 4C36A 2XK4A 5TKDA 3REPA 3L8PA 1QPCA 2R3JA 3K2LA 3NUNA 1A9UA 2PWLA 3QA0A 4D58A 4O7LA 1OM1A 3PVBA 1FBNA 2C6EA 1PHKA 3WZUA 2CGUA 3OT3A 4ALWA 3QTUA 4C62A 2W9ZB 4UWYA 5IA4A 3NYXA 4DLJA 2HIWA 5AMNA 4E8AA 2HXLA 4LUEA 2JKKA 3OP5A 3F3VA 3MVHA 4FIJA 1WBNA 4O0SA 3FMHA 1XBAA 4DH7A 4HYUA 2X7FA 3ELJA 3R0TA 3HMIA 2QCSA 4GS6A 4BKYA 4ZXTA 4BYJA 1HOWA 2QOFA 4B8LA 3U6JA 3N4TA 2B9JA 4G9RA 3RPRA 3CY2A 3EQRA 5AM6A 2IVTA 2WKMA 4FL3A 4U40A 4ZIMA 1FOTA 3MH1A 3PXZA 4XBUA 4DCAA 2XIXA 5M06A 1UU3A 4QP2A 5JN2A 2VWZA 3PFQA 3TZMA 3RBWA 4AT4A 4GW8A 2JAMA 1IRKA 3VS0A 3DQXA 5HESA 4UZDA 4EC9A 4EOQA 1ZMUA 4X6RA 1SVHA 2JFMA 4R7BA 2B1PA 1XBCA 3DA6A 4ZSGA 3UP7A 4N6YA 4RX7A 3VS6A 4BIBA 5CEIA 3TXOA 4YTFA 1Q8UA 3U9CA 3NYOA 2BFYA 3H4JA 3MPMA 4GK4A 4BKJA 3CQWA 3H0YA 1WCCA 3DFAA 3F9NA 4LRKA 4QPSA 4C4IA 3VUIA 3Q4TA 5IKWA 5A4QA 1AQ1A 4XX9A 5I3RA 5IH5A 4BZDA 4K33A 4DEBA 5TE0A 2WOUA 1Z57A 2VWVA 3KULA 5JQ5A 2OZAA 4DINA 2Z7LA 2GHMA 3ROCA 3RPYA 4GUEA 3ZMMA 5HZNA 3UNJA 1NXKA 3QZIA 5KUPA 3QRTA 3TDWA 2VGPA 2XM9A 3C5UA 3DPKA 4G2FA 3UYTA 4CMTA 4D28A 4FTAA 3Q9ZA 5EQYA 3LM0A 2OI4X 5H9BA 4M14A 1OGUA 1OKWA 2VTPA 4MEDA 4O7TA 5B0XA 4CFFA 2WTDA 1M2PA 2OIQA 2NRUA 4AZSA 3O7LB 2XUUA 3PA5A 4C4FA 2IZRA 4ZS4A 2PVHA 3FSKA 4G1WA 2I0YA 4DFLA 2V7OA 4RIYB 4NM0A 1CKPA 2H8HA 4B6LA 2I0VA 5D11A 3MIAA 5AWMA 4O86A 4IVCA 3T9IA 2GSFA 3NNUA 2ITTA 4F6SA 1U59A 2C5XA 3HMMA 3UVQA 2ZDTA 4UXQA 4FL1A 1PRYA 2XKDA 5DWRA 4DAWA 5B7VA 3F2NA 5IUIA 4FT0A 3QALE 5EKOA 4S32A 4M0YA 4R3PA 2BAJA 4L9IA 5E91A 2W7XA 4ERKA 3ORPA 1FVTA 1T46A 3QTWA 4CD0A 3TNWA 2OXXA 2ITYA 4D2TA 3P1AA 3HRFA 3UODA 3U54A 3FLSA 2JIVA 2ONLA 4MQ1A 5BUIA 4QMWA 3WE8A 4S34A 2C6DA 3GFEA 3H9OA 4UV0A 5LVMA 3VUMA 4FZAB 2UVZA 4A06A 4ANQA 1TVOA 3IGOA 3L8SA 4X3FA 2WO6A 4D4VA 2V55A 4E93A 4W4YA 5FM3A 5KHXA 3QTSA 2JDVA 3II5A 3QFVA 4U81A 1Y6BA 2IVUA 2ZB0A 5L2TA 1ZOGA 1JAMA 2WZJA 4M69A 5EOBA 1UU8A 3OF0A 3V8WA 4C0TA 1H24A 3BV2A 5AM7A 4R78A 2P2IA 4ZJJA 3SD0A 3QZFA 3ZC5A 4ORKA 5CI7A 3G0FA 4IFGA 3NYVA 4DG0E 4GIIA 4QP6A 1R39A 4UMTA 3GU5A 3LQ3A 1REJA 4EH4A 1BX6A 4YZNA 3FSFA 1GIHA 1H1SA 3QQJA 4AN3A 4NT4A 4ZLZA 5HO7A 4L3LA 4AZWA 3EMGA 3TTJA 3LQ8A 1E9HA 3LZBA 2NO3A 3W33A 4JOAA 3SOCA 3U9NA 3QUEA 4YMJA 4MXCA 1OKZA 4QYFA 4EWQA 2R5TA 3A62A 4TW9A 3OXIA 1ZRZA 2UV2A 4F6WA 5CAVA 1MQ4A 4E1ZA 2CKQA 3W2OA 3R8UA 4FKUA 5BVFA 3A60A 2PULA 4Q9SA 5BVNA 3ZS5A 3PIZA 3BYVA 5GHVA 4DA5A 1SVGA 3C13A 4FR4A 4P2KA 4YNOA 4EC8A 5F95A 2HELA 4MXXA 4J99A 3L1SA 4RT7A 4AOIA 2C3IB 3ATTA 2R3QA 2R3GA 5AP1A 3SOAA 2O3PA 4IWDA 4XEYA 4D5HA 5JH6A 3O71A 4G17A 5T68A 3ETAA 5EQEA 4FKVA 2AC5A 5DR2A 4B9DA 4TWNA 3DZOA 3BYMA 1M2QA 2XEZA 4FX3A 4O27B 2ITPA 1DS5A 4JT3A 2RKUA 2CN8A 5IQDA 2GS2A 3EOCA 4Z7HA 2DYLA 4BDGA 4PTEA 4EZ7A 5IISA 3GI3A 1ZZLA 2H34A 2BAQA 4G6LA 1YHSA 3OBJA 2UZOA 4FF8A 5FP5A 4ZP5A 5IA3A 5KMOA 4M97A 1YDRE 3N4VA 5GZ8A 5ICPA 2YM7A 4ZY6A 3DKGA 3QTXA 2UW9A 4YC8A 3PPJA 4HZRA 2WTCA 2XF0A 3TUBA 3BHHA 4L7SA 4FK3A 4O82A 4W4XA 5EW9A 3ZUTA 4E5WA 2QU6A 5CS6A 5ANOA 4CCBA 3PSBA 4NH1A 4J96A 3UPXA 4WG3A 2Y9QA 3BYUA 3OCGA 5H8GA 2Y6MA 3DDPA 3RAIA 3N4UA 3BHVA 3FI8A 4BHNA 3NEWA 4WG5A 4A9SA 3EN6A 4IBMA 4OTFA 3NPCA 1VYZA 5LVPA 5IEVA 1KSWA 4I0RA 1BUHA 3GENA 4PMTA 3HP5A 3UZPA 5I9YA 2XIZA 5AP5A 5A3XA 3UP2A 3BLRA 2XM8A 1XWSA 5FEDA 5C8MA 1CKIA 5DI1A 4J8NA 3C4FA 3QGWA 5AUWA 5KKRB 4CG8A 1W83A 3FXWA 2R7IA 3LFSA 3D15A 3IKAA 4ZTSA 5DT4A 3BBWA 3RM6A 1PKGA 2W5BA 3JVRA 3DCVA 1YI4A 2W96B 3AMYA 4IAFA 4AP7A 2ZVAA 4GUBA 4LOOA 1BI8A 4X7QA 5CSWA 4OBOA 2PUIA 3COMA 4LL0A 2RFDA 3TV7A 4F99A 2WU7A 3MH3A 4L46A 2E9OA 4FIFA 5DPVA 2UZWE 4M15A 2HK5A 3OUNB 3Q04A 4IAAA 5ACKA 2WEIA 4YGAA 5HORA 5ITAA 3V8SA 3CQEA 4YZDA 1OL5A 2X1NA 5FQDC 1YI3A 1DAWA 2XIYA 4LUDA 3LMGA 4MYGA 2JKOA 2Z7SA 3B8RA 3DFCB 4RPVA 4A9UA 3FMEA 5FP6A 3SDJA 3LCKA 3MV5A 4E6AA 1XH9A 2FYSA 3PDTA 3EQPA 4MD7E 2UW8A 4ZJIA 3CEKA 2QLUA 4TXCA 2WIHA 3FLYA 4FKPA 4FV8A 4IDTA 2BAKA 4YLLA 2UW6A 3R00A 4AN9A 3ZYAA 5JFSA 1R0EA 3P79A 3FV8A 4UB7A 5BVOA 2A0CX 3HUCA 4GU6A 5FXQA 3QHWA 3ZXZA 2VO7A 4UXLA 4HVHA 3UYSA 3R7EA 3KC3A 4GU9A 4GKIA 2BRBA 3LW0A 3ITZA 4BVUA 3NCZA 4OBQA 3B2TA 3FHRA 5EI2A 5HD7A 3D4QA 2GDOA 1JLUE 4R7IA 2JEDA 2XYNA 3M1SA 4EOOA 5AAEA 3ZBFA 2ZMCA 3KB7A 3RZFA 3EQBA 4IE9A 3RHXA 1OKYA 2Q0NA 4FIHA 2XK8A 5E1SA 5AUTA 2EXMA 5ANIA 3QAME 2C6IA 5CU2A 5FBOA 4D2PA 2HW7A 5BYZA 3SA0A 3R73A 2IPXA 1J7LA 3COHA 4YHJA 3E3PA 4H1JA 4XRLA 3FEGA 4Q5HA 4YJQA 1JKTA 3RM7A 2C6OA 2FSLX 3NGAA 4F1TA 4Y85A 2ZAZA 4EONA 1DI8A 5K4IA 1H28A 4RGJA 4ASZA 3ZLWA 4YC6A 3EFLA 3F3TA 2W0JA 3KCKA 3QQKA 3VIDA 2PVLA 2YIQA 5M4UA 3DS6A 3O8TA 4YBJA 2BRNA 2VRXA 2YN8A 3F3WA 3MYGA 4II5A 4LMUA 4YTHA 1H1WA 3VC4A 5FXRA 5KMMA 3HNGA 4I22A 3D83A 2R7BA 3BIZA 3OROA 2ZM4A 4EZ3A 4O7ZA 1PXNA 5JGAA 4IQ6A 3E7OA 4K2RA 4W8EA 3DAEA 3KK9A 2XBAA 5AV2A 1YW2A 4DTBA 4RVMA 2P0CA 3RK5A 3ZRLA 4EK8A 2UW0A 4LRMA 2YDIA 2PVNA 3LJ2A 4YLJA 2ZMDA 3W18A 3HV4A 2DWBA 4F1OA 3MVMA 2GTMA 3NW7A 4QQJA 3SX9A 4CCUA 4O2ZA 3Q53A 2X81A 3TV6A 3GXLA 5K5NA 4IX4A 2B9HA 5LARA 4EUUA 3RCDA 3ZDUA 3MA3A 4CV8A 3KRLA 3VS3A 3C51A 3HDMA 4K11A 3S3IA 2O65A 1ZYDA 4C33A 4H3QA 4U45A 4IB0A 1H1PA 5IMXA 5M55A 3NIEA 3W1FA 2B0QA 2J0MB 1JKLA 4IM3A 3S00A 5E7RA 2OIBA 3ZFMA 3R2BA 2QD9A 2PUUA 2R3KA 3ENMA 3GFWA 3QRIA 4IB3A 4BCPA 4CT2A 5HU3A 1CM8A 2O63A 3KXHA 2XH5A 3M11A 3U51A 4TN6A 4WBOA 3ORNA 1OMWA 5CEPA 2ACXA 4UYAA 1YOLA 4XHKB 3NZ0A 1RE8A 3ULIA 4CVAA 4XCUA 3ACJA 3PIYA 4U3ZA 2BRHA 3EYGA 3PSCA 1UVRA 1Y57A 2JBPA 2BTRA 3AMAA 3MDYA 4ID7A 4FV9A 4NJDA 3VWAA 2CNUA 2ZV7A 4WNOA 2H9VA 3ZLSA 3R30A 4JR3A 4JS8A 4FGRA 4L45A 1ZMWA 3VUTA 4ZTNA 3TDVA 1DAYA 4FTTA 4ALUA 5JQ8A 2VO6A 2BCJA 4FYOA 4DEGA 5CAPA 4TYHA 3WARA 2W4JA 4L6QA 4BC6A 1UA2A 2VZ6A 4NFNA 2JKQA 4AG8A 3K3IA 2Y7JA 4EH3A 5DE2A 5IA2A 4C34A 3PXYA 2JFLA 2E2BA 4GJ3A 4CMUA 5HO8A 1F3MC 4BDBA 3LLAA 1A48A 3LFDA 3PPKA 4DT9A 4XS2A 3F5UA 2J51A 3EIDA 2HXQA 1H26A 2JKMA 1YVJA 4EZ5A 4JQ7A 3U87A 5IDNA 3FE3A 4QPMA 5C26A 3DNEA 4FT3A 4M12A 3UIBA 4CFXA 4EH2A 4UMPA 3ZU7A 3FAAA 3U55A 4O0YA 2Y4IB 2ITOA 2P3GX 3GVUA 3WIKA 1KE9A 3HVCA 3O8UA 4EJNA 2GNFA 2R3PA 3FMLA 3I6UA 3OD6X 4XP3A 4FSNA 3G9LX 3TNHA 3ZSIA 2PVMA 1APME 4K18A 4GVJA 3NYNA 4TT7A 3OFMA 3I5NA 3RTPA 4FUYA 2ITUA 5DBXA 3HAMA 4JAJA 3DXQA 2VTAA 2ZYBA 4Y72A 3AC1A 4CLJA 3TUDA 4XG6A 5HI2A 5DFPA 4FSQA 2PZIA 1MUOA 4BTFA 2R3IA 4GG5A 3GP0A 2VWXA 4U7ZA 2Z02A 2NP8A 2GPHA 4RX5A 3OWJA 1PMVA 5CQUA 2ITNA 2UUEA 3CE3A 2BPMA 4D1ZA 4KD1A 4R77A 3EL8A 4MH7A 4X2JA 3LFCA 3VS4A 3ROYA 2JDRA 4M8TA 4FTLA 1YI6A 4IX6A 4N4SA 1VJYA 3LIJA 4IZYA 3D7TB 4KBAA 4RIXA 3SHEA 4AW2A 3AC5A 3DKFA 4MNFA 4D2RA 1IASA 1Z5MA 1IA8A 3PZEA 5JGBA 4E5BA 3A2CA 2BR1A 3ZO4A 3R04A 3Q60A 4GT3A 4QD6A 3E64A 3FI2A 4QMVA 2X9FA 3KRRA 4RC3A 3FYKX 3WF6A 5EDRA 1YOJA 4MD9E 3DBEA 4IM2A 5CANA 2VX1A 4MK0A 2BHHA 3EQIA 3FLWA 3GC0A 4YSJA 3O17A 3DQWA 2JD5A 2UZLA 4FTQA 5BUJA 3KEXA 4FKWA 3IS5A 1QPDA 4JJRA 4CTBA 4OTWA 4FYNA 4DYMA 2OU7A 1M2RA 5GJFA 3RKBA 2G9XA 2GNLA 2OJFE 4GFGA 4CG9A 3BLHA 3ORKA 5IH4A 1OPLA 2WQNA 3UO6A 3O96A 2A19B 5E1EA 2C6MA 3G90X 3P7AA 4GK2A 2OH4A 4C61A 1PYXA 4LOPA 4YJTA 3WYYA 1SM2A 4AT5A 4AE9A 4F0FA 4I6HA 4NW5A 5DA3A 2XNMA 5HIEA 1OKVA 2X8EA 5I9WA 4X6QC 4UWBA 3TKUA 2HYYA 2VU3A 2WQMA 4BTKA 4ZS0A 5AUYA 3W2SA 1ZYJA 1K3AA 2VTIA 4CFUA 4DBNA 5L4QA 3D5XA 3H3CA 4X2FA 3I0QA 5AP7A 4DF3A 2YA9A 3C4XA 2PZYA 2FH9A 2C3KA 4HCTA 3VJOA 5FEEA 2GS7A 2W1GA 3UOHA 4QMZA 2YHVA 4TKSA 4D55A 5LOHA 3O0GA 3KF7A 5EI8A 4RC2A 1WMKA 3VS1A 4TL0A 4YTIA 3KA0A 4NYEA 3OC1A 2KULA 5EYDA 4EQMA 2VO0A 3QQHA 4FUXA 2PE0A 3TIYA 5HEZA 4BL1A 4OTHA 4PX6A 4RLKA 3I7BA 4YNEA 5F9EA 5B2MA 2C5OA 5M56A 4NFMA 3CCNA 2JIUA 1EH4A 4K6ZA 4KUJA 5BYLA 4K77A 4ARKA 1Q99A 3QLFA 5A6OA 3RWQA 4RA4A 5LVOA 4RIWB 3QZHA 3CBLA 3C5IA 3LXKA 4L68A 2JGZA 4U3YA 3TV4A 2A4LA 2X39A 3BCEA 3NNWA 4J1RA 3UO5A 4EOKA 5I9XA 3LMIA 1YRPA 3GBZA 5F4NA 4I5PA 3VBXA 5JFXA 3DT1A 3D5UA 4DGMA 4FSTA 2VTJA 3GB2A 4LL5A 4C59A 4AXAA 4F1MA 1J3HA 4I23A 2PPQA 3LM5A 3V04A 4EOPA 2PZRA 4FSWA 1UU7A 4WBBB 4B8MA 4E5AX 3Q3BA 5CWZA 3W55A 2XZSA 3AC3A 2HY0A 4XUFA 3LFBA 4CZUA 4ASXA 3MW1A 3LCSA 5BVWA 3T8OA 2YAAA 5L6OA 1GIIA 1CSNA 4TWPA 3TL8A 3CD8A 5FUTA 4IB5A 1MRVA 4PPBA 4WSQA 4Z16A 1OUKA 3PJCA 3PVWA 4H58A 4KKEA 2QLQA 4MBJA 5ACBC 3TZ9A 4S30A 4F7JA 3A8XA 3AD6A 5L2IA 4CNHA 5M57A 4O84A 4QTCA 4MQ2A 3R7UA 3SC1A 4C38A 4I94A 5DH3A 4G3DA 4BZOA 5LCJA 4RMZA 2VO3A 5CF5A 4GJ2A 3AG9A 1JWHA 4PP7A 5AA9A 4LQMA 5T6KA 4PP9A 4XG9A 4DGGA 2UZEA 4Y8DA 3R6XA 4TYIA 4O1OA 3ZUVA 3GU4A 3NUYA 4NW6A 4BDHA 4OTQA 4YZ9A 2J5FA 4L44A 3MY0A 2HZ4A 2UW3A 4FG8A 3FZOA 5ETCA 3R8LA 4E3CA 4L01A 3SRVB 5J79A 5GIOE 2W99B 5IPJA 4BTJA 3W8LA 4ZK5A 4JLCA 4EQCA 1O6KA 3QWKA 4HNFA 5A4TA 1UNLA 1IG1A 2QKRA 3ZSHA 4EUTA 5EM6A 3RPSA 2WOTA 4UMRA 1RQQA 2B9IA 4RFYA 5M51A 3UBDA 2PK9A 3UMWA 4CT1A 4QMUA 3IDPA 4Y5HA 5CZIA 3NX8A 5E8ZA 1Z9XA 3S4QA 3DTCA 5GZAA 4XV3A 4RVLA 3IQ7A 4L53A 1TQMA 4JDKA 4I6BA 4FZFB 4WT6A 2OJIA 4PDSA 5CU6A 4JVGA 4IVAA 5AUUA 4FOBA 4LV5A 4NM7A 1Q97A 2J4ZA 4FC0A 4FKIA 4A9TA 3VF8A 2OF2A 2QU5A 4D9UA 2WMQA 3ZOSA 2V22A 3Q32A 3FMJA 2PY3A 2VUWA 3GU6A 1ZYLA 3ZZEA 4R3CA 2QO7A 1URWA 2PE1A 2OF4A 1O6LA 4XP0A 3GGFA 5EHOA 3RAHA 3L9NA 3RGFA 1OIQA 3ZLYA 4QQCA 3QKMA 1J1CA 4XOYA 3CXWA 2BZIB 4IX3A 3A99A 5CF4A 2ETRA 4QMMA 5JKGA 4IX5A 3V5JA 1YWNA 3FLNC 1PY5A 2XNNA 2F7XE 4L8MA 4UEUA 4RIYA 3PLSA 5AJQA 3FXXA 3VBYA 3KRJA 1U54B 4ZMEA 2XJ2A 4FV5A 5DNRA 2IW8A 5M07A 2W1EA 4RRVA 3VAPA 5I9VA 4HYHA 1PXKA 1TKIA 4OTPA 3D9VA 5C01A 3MBLA 4OR5A 2WMRA 5J7BA 4FEUA 5DYJA 4U9AA 5DLSA 5ETFA 3TG1A 4FKLA 2XK7A 4PRJA 1OECA 3FY2A 5EM7A 5E92A 1M17A 4LMNA 4XV9A 1ATPE 4IC7A 2G15A 2GQGA 3FZRA 3ALNA 3I60A 4FVQA 1KV2A 1M14A 4R3RA 5CT7A 2J6MA 3VNTA 4BZNA 2VTNA 3NVKI 2W1CA 1V0BA 2ITVA 2C6TA 4U8ZA 1Q5KA 2JAVA 2R3RA 3BHTA 3DTWA 4DEHA 4NJ3A 5GJDA 2AYPA 3VS7A 4JG8A 5HTCA 4KIKB 1R1WA 3HZTA 4ANBA 2E9PA 1SZMA 1YXUA 4AGUA 1PMEA 1W98A 2G01A 4BDCA 4KB8A 4LV8A 5AP3A 4C37A 3SG8A 1YOMA 1XH6A 1WAKA 1ND4A 4CLIA 3EN4A 5HLWA 3MVLA 1H07A 2ZV9A 4PV0A 3O51A 4FI1A 3CTQA 3RZBA 3OXZA 4I3ZA 3HV3A 4DTKA 3WZKA 3VRZA 3N9XA 4FOCA 3ZXTA 4E4LA 3CR0A 4FICA 2XK6A 3CS9A 4YC3A 3MFTA 3MVJA 2GMXA 2YAKA 2OSCA 3I79A 4FL2A 4BCNA 4HNIA 5C8NA 4F9BA 4FKRA 3W2PA 1QPEA 2P2HA 3VQUA 3ZLXA 2EVAA 5JZNA 2C5VA 3OCTA 3DV3A 1PMUA 3DKCA 2FVDA 4ZLOA 5B2LA 3MJ1A 3LFNA 2BILB 3FMNA 2WTKC 3LMHA 3Q6UA 4RVTA 3Q52A 4FODA 3PY3A 3DLSA 4HZSA 4EOSA 2I1MA 4CFMA 1X8BA 4AGWA 2JBOA 3IDCA 4WUNA 2R0UA 1G8SA 3E8CA 2UVXA 4X0MA 2BRGA 3RPVA 2DUVA 4CQEA 4FTIA 5CF8A 2ITXA 3F3ZA 3WF9A 4EH6A 4EYMA 4BBMA 2YEXA 5M4IA 4YHTA 2JLDA 2IJMA 3DBQA 2YZLA 4D0XA 2YDJA 1P14A 4QT1A 4DEEA 2B55A 4RJ3A 5KBRA 4XLIA 4CFVA 1KE7A 2R3HA 4WRGA 3FMKA 3IOPA 4FV3A 5DN3A 4MXYA 4N70A 3V8TA 4AW5A 3GOPA 3BEGA 2Y4PA 3LFFA 4NM3A 2IZUA 5FD2A 2WTKB 4X21A 3EN9A 3PIXA 3NDMA 2W1FA 4MKCA 1J91A 1OIUA 2ERKA 3MTLA 3Q6WA 4FV1A 4ZTLA 3FLQA 2F9GA 2XJ0A 3UNZA 1LPUA 5EKNA 1CMKE 4KIQA 5HG8A 3FMMA 5CSXA 4BFMA 4EORA 3C0IA 4WNKA 1FMKA 4FNZA 3VBWA 3CTHA 3E63A 4W9WA 5CZHA 2VTOA 3RK9A 2RG6A 4O38A 4PF4A 4TZRA 4YTCA 1J1BA 2X7GA 3EN5A 3EFJA 4RWIA 3OT8A 3KKVA 3Q96A 5D7VA 3UO4A 2VNWA 1OIYA 1SYKA 3FYJX 3HLLA 3RVGA 5DOSA 1OL1A 3ZONA 4GMYA 3R83A 5HVJA 5IMEA 1E1VA 4AA4A 4UWCA 2XNOA 4DGOA 3NIZA 4O2PA 3GC7A 4E4MA 4FTUA 3QQUA 2BUJA 4DEDA 4DT8A 4OT6A 5J9LA 4MWIA 1H08A 5HHWA 4HVSA 4M0ZA 4BCOA 3V5LA 1MP8A 3HEGA 3VHKA 2OO8X 3TZ7A 2QOIA 3P9JA 5IQGA 2G2IA 2FGIA 3PG3A 4FV0A 5L6PA 2XRWA 4BICA 4XG8A 1P5EA 5IEYA 1MRYA 3CGOA 3IK3A 5FG8A 5BMMA 4DFZE 4GIHA 4APCA 3DJ6A 2OH0E 3OTUA 5E8UA 5ETIA 4B7TA 4E4NA 3LFQA 4RA5A 1PYEA 4E7WA 1Q8YA 3O7LD 1MRUA 2XJ1A 3KXZA 2JDSA 3MWUA 3FL4A 4MNEB 4QYEA 4YP8A 4AZVA 3B8QA 1URCA 5ANDA 1XH8A 3R7YA 5KNJA 5HCYA 4ACHA 4HVGA 4AZEA 2JDOA 2YM3A 1YDSE 4J71A 4XH6A 3V5TA 5CVGA 2SRCA 3R8MA 4QMOA 2QO9A 4FSYA 4EK5A 5HG5A 5J5TA 3NS9A 4I6FA 3MPAA 5HX8A 5HG9A 1HCLA 2EXCX 5LMAA 5KKRC 3QCQA 4WG4A 2DS1A 4GCJA 2PL0A 4CYIA 3PP1A 4CQGA 4F65A 3V51A 4YZBA 3AC4A 3MIYA 2QOKA 4OTDA 3SG9A 1ZYCA 4ZAUA 5C4KA 4J52A 1ZZ2A 1JSTA 5DMZA 2XCKA 4A4OA 1Y8YA 1UWJA 3BU6A 4M67A 1JOWB 5J87A 4RJ6A 4DFUA 3DZQA 5KMNA 5L8KA 4I24A 4QMXA 4FVRA 3OOGA 5AP6A 5EOLA 2J5EA 4O96A 2F7ZE 3MN3A 5KZIA 3CTJA 4CFWA 4GH2A 3SVVA 4AWIA 2G2FA 3LPBA 5AX3A 2UW5A 3D2IA 5IQFA 2W5AA 3FHIA 2VTLA 4FEQA 1I44A 5C03A 4F7NA 4FGBA 2A2AA 5JFVA 1AGWA 2VV9A 3OWPA 4YPSA 4I21A 2X6DA 1J7UA 5TT7A 3HV6A 4Y46A 4DBXA 1I09A 3SXSA 4BIEA 4PUZA 4EHVA 1QCFA 1QPJA 4AX8A 4I93A 4CMOA 5BVEA 3S2PA 5KMJA 2CKPA 1VYWA 3LFEA 5CEOA 3BYOA 1LR4A 4IFCA 3GCSA 5BYYA 3M2WA 3BELA 2CN5A 5EH0A 1PXJA 4JQEA 1DI9A 1ZXEA 1NW1A 4HVIA 4F63A 2XKCA 3AMBA 2WGJA 4QP7A 3KK8A 3W2QA 1LP4A 4FG9A 1WBOA 2RL5A 2UZNA 3KVXA 3WOWA 2R64A 1WZYA 4BBEA 3QU0A 1ZOHA 2Z60A 4FKTA 4PMPA 5HNBA 4LGGA 4W4WA 5LVNA 4N57A 4JAIA 3DJ7A 4TWOA 5EFQA 4P90A 1B38A 3VS5A 3COIA 2ETKA 4G16A 1JSUA 3EHAA 5HGIA 3PE2A 4I4FA 4IMYA 3JY0A 2HENA 4ZTRA 4IWQA 1ZY4A 4ASDA 1KE5A 2J9MA 4YO6A 2X8DA 5L2QA 4C4EA 4EYJA 2XMYA 5BMSA 5J9YA 2XRUA 3FQHA 2C68A 3EKNA 3LCTA 4IB1A 3UMXA 3VVHA 2PUNA 4BCFA 4MF0A 2RG5A 4I41A 2HZIA 1OVEA 3G33A 4K8AA 4BI0A 1JKKA 1FQ1B 1H4LA 4XG3A 5E8VA 1SMHA 3ZHPC 2BKZA 2YM4A 4R1VA 2PMLX 2ZV2A 4GV1A 3TM0A 5DIAA 3CP9A 3MH0A 2XNPA 3QX4A 5E8SA 2PHKA 3L8VA 4KBCA 4A4LA 4APPA 1NA7A 3GOKA 1ZOEA 5KZ0A 3ZEWA 1Y6AA 4YJSA 5CYIA 1Q3WA 4RFZA 3PYYA 4ZSLA 3D2KA 3HP2A 5H8BA 4XBRA 1PKDA 4OTGA 3MI9A 4GSBA 5CAQA 4WKQA 3VO3A 3QRKA 5CU0A 4BDFA 4BWPA 2F49A 1YQJA 2PVFA 4L7FA 3H0ZA 2OZOA 2UZDA 3I81A 5LCKA 3RCJA 1XBBA 1BYGA 2G1TA 3BEAA 2WMBA 4AZFA 5K9IA 2OXYA 4RJ5A 5AADA 1FVRA 5CXZA 2QR7A 1L3RE 4HYIA 5AV0A 3MS9A 4V01A 3FZSA 2X2KA 3NSZA 1GNGA 4IVDA 4L42A 4PPAA 4YJRA 4MWHA 1YXTA 1BL6A 4NK9A 3ZRKA 3U6HA 3ANRA 5LVLA 3HV7A 5EDPA 2J50A 2CJMA 4QMNA 2Z7QA 3FKLA 4DHFA 1H8FA 4UMUA 4TTHB 3ENHA 4EOMA 3LE6A 4D2SA 1IA9A 2X4ZA 3BU3A 3QTIA 4FMQA 4QYHA 4RJ8A 4FT9A 4IW0A 3FQEA 4ACDA 4KINA 2WTJA 3FPQA 4CKIA 2P55A 2WMTA 2GQRA 3A7IA 4BRXA 3UGCA 1PMNA 4J98A 5H3QA 4B4LA 2CPKE 4F0GA 1K2PA 1GOLA 5H2UA 3R1QA 3F88A 5HKMA 5J9ZA 3RAKA 3ZEPA 3PLAE 4FEVA 2C4GA 3R9HA 3E3BX 5DT3A 1JBPE 3PG1A 3QTZA 4V05A 2ITZA 4XG2A 5CSVA 2YLFA 4O83A 1WFCA 1IAHA 2PU8A 5D9HA 3DXPA 2Y8OA 3TJCA 4R7HA 3U8WA 4ITJA 4NIFA 1PXIA 5CEQA 4DG2E 5HTIA 3WF7A 5EM8A 3AGMA 4IZ7A 3ZZWA 2UZTA 3IW8A 4X2KA 5DEYA 4FA2A 4J53A 2Y4IC 4QQ5A 2W4KA 2IW9A 3TNQB 3E8DA 4C3FA 1JKSA 2OG8A 2XYUA 3CY3A 1R3CA 2YDKA 3N51A 3WE4A 4ANSA 4DCEA 2YACA 1MQBA 3KGAA 4KAOA 3Q2MA 2WNTA 5D1JA 2EUFB 3NCGA 3R9NA 5AR3A 4BDJA 5FWKK 5GJGA 5C9CA 3RP9A 1GZ8A 4DITA 1OPJA 2GFSA 4LG4A 4IAZA 4PWNA 3QTRA 3D7TA 1SNXA 3IW4A 4ANLA 3OOMA 5IQAA 2R3FA 4H36A 1FGKA 3OWLA 3MFUA 5E8TA 3DK7A 3D94A 3MJ2A 4J95A 4M3QA 5EYKA 3HV5A 5IQBA 4WNPA 2KTYA 1OITA 4F6UA 4TY1A 5IG1A 3A8WA 1BKXA 3E92A 3G0EA 4D4RA 4G5PA 5AUXA 5LWNA 3LXNA 4FV2A 5IEXA 5IUGA 3P7CA 3TT0A 4ERWA 2PTKA 2QODA 3HRCA 3BHUA 5HIDA 4NL0A 3VBTA 2EWAA 3A7FA 1XQZA 2AC3A 2QONA 3H9FA 3MH2A 5BUEA 3BYSA 5IZFA 4B99A 4U41A 4KSPA 5FM2A 3Q5IA 4Y73A 3OHTA 4LFIA 4BI1A 5A54A 4U5JA 1JVPP 3KFAA 3PA3A 5CEMA 2WMWA 4YUQA 1W7HA 4N6ZA 5EHLA 1U5QA 1S9IA 4S31A 2ETMA 3BBTB 4QTBA 4XG7A 2V62A 3ZO3A 4IJPA 4AFJA 4CRSA 3ZCLA 4CKRA 2IWIA 4G5JA 3D0EA 5LXMA 3EQHA 3FBVA 3OMVA 4WIHA 5DRBA 4BI2A 2HW6A 3EKKA 1M7QA 2A1AB 2ITWA 3CKXA 3OCSA 1Y91A 2BRMA 4X3JA 2HOGA 4JRNA 1ZMVA 4PL4A 2XNBA 3G2FA 5IA0A 3VJNA 4BR3A 4H3PA 4U97A 3WZEA 3TIZA 3HA8A 4DTAA 3JS2A 2W06A 2GCDA 5AEPA 4C02A 2B52A 4E4XA 3PXQA 1M52A 1WVWA 5EDQA 2UZVA 4ANOA 4YPDA 3ORZA 3MESA 5A4LA 3BPRA 3HGKA 3R8VA 4FSZA 3JUHA 4R8QA 4D1SA 4MXOA 4HJOA 2PMIA 2JC6A 5BNJA 3BE9A 4K0YA 4FV4A 4CEGA 1UKIA 4FZDB 4EOIA 4CTCA 4OTIA 4UALA 4V0GB 3GEQA 4G3CA 4ACGA 3NNVA 4H05A 1A06A 3KXNA 4EBWA 2RFSA 5KMKA 3RINA 5EG3A 5E8WA 4JI9A 5JK3A 2OGVA 4M68A 3R71A 4WOVA 2VAGA 1B6CB 4QYGA 4RIWA 4ANMA 3TEIA 2BMCA 1XKKA 3PPZA 3EJ1A 3PP0A 4GK3A 4U79A 2Q0BA 2VWWA 2XCHA 5HBJA 2WQBA 3L9MA 4D4SA 3TZ8A 3QC9A 2IZTA 3ET7A 3WF8A 5K5XA 2WTWA 3OXTA 3EYHA 4BWKA 1O9UA 3SGCA 3AT4A 3PWYA 3EFKA 4WHZA 2QR8A 4FK6A 2O64A 3IW6A 3NW5A 2VWUA 4L3PA 4XLVA 3KU2A 4MHAA 4RJ4A 4ACMA 2ERZE 3FL5A 2CNVA 4O0XA 4Q2AA 4PTCA 4Y95A 2XNGA 4F9CA 4GFOA 3IPHA 2HZ0A 5C1QB 2EXEA 3G5DA 4C4GA 4E26A 5BVKA 4USDA 1YHWA 4ZY4A 4WRSA 1RJBA 4IM0A 4F64A 1HCKA 3V6RA 2XBJA 5GZ9A 2RFNA 1F5QA 4ITHA 3W2CA 5HTBA 3AD5A 1P4FA 3POOA 3S0OA 3CKWA 4MF1A 3PZHA 3HKOA 5I9UA 5KHWA 3E8NA 4AT3A 3BX5A 3OZ6A 2WMXA 4QP9A 3THBA 2XEYA 4O22A 2GU8A 4I5MA 4ZTMA 2PE2A 3CQUA 5CVFA 5I5ZA 3WBLA 2WELA 3KF4A 5ANKA 5K4JA 5HE2A 5HBEA 3F2AA 5CTPA 3QX2A 4X2GA 3ZDIA 5LMKC 4QNAA 4LYNA 4AFEA 5A4EA 2WB8A 5JEBA 5CI6A 4O6EA 4HPUE 4F7SA 5CENA 5DT0A 2CHLA 1WBPA 3TUCA 3BV3A 3R63A 4I0SA 5DHJA 3F7WA 4O7YA 1IEPA 4O0TA 5KE0A 2F2UA 3SRVA 1SVEA 4AAAA 3EL7A 3I0OA 2W1ZA 4FT5A 4MBLA 4RX8A 4AUAA 1O6YA 2Z8CA 2YIWA 3G6GA 4IDVA 2ZM1A 3FJQE 4C58A 2Z7RA 3LQ5A 5LWMA 1AD5A 2VWYA 1G8AA 2BZJA 3LFAA 4I1ZA 3I1AA 4GVAA 2QC6A 4AU8A 1QL6A 4BDAA 5A9UA 1GZOA 4FZ7A 3LCDA 2X2LA 5JMSA 5FBNC 2XA4A 2FA2A 4LM5A 1Q8WA 3U4UA 4DFXE 5FTGA 2IW6A 2BKKA 5L6WL 5AAFA 3G15A 5KMLA 4F9YA 4K9YA 3BWFA 3R8ZA 4YU2A 5G1XA 1Q24A 5CLPA 4L00A 1VR2A 2R2PA 4NM5A 5FXSA 4O7RA 5I0BA 1R78A 1L8TA 1W84A 2WEVA 3R22A 5EYCA 1U4DA 4E6CA 3DAKA 5DEWA 4K1BA 4AQCA 5IQIA 3QLGA 4WO5A 3TCPA 2YITA 2VGOA 4CXAA 5HIBA 3VN9A 3QYWA 2LGCA 4BN1A 4DG3E 2HAKA 3ORLA 3C0GA 1LUFA 1JNKA 4AACA 4QPAA 1V0OA 3DJ5A 3UOJA 3MY1A 1GZKA 2OIDA 3TWJA 3D7ZA 4UYNA 4O7WA 3QQFA 4FTNA 1XR1A 3F5GA 5E8XA 4DGNA 4PNIA 4AGCA 3ERKA 3QUPA 3LXPA 3EH9A 5H8EA 1U54A 2FO0A 3CJFA 3QF9A 1H27A 4C2WA 2JIIA 5HBHA 4EH5A 2E9VA 5L8JA 1KOAA 3TTIA 3HMPA 4DC2A 2CCIA 2W4OA 2IZSA 1H01A 1BI7A 3LCOA 3SV0A 4D5KA 2W9FB 1Q3DA 3IW5A 4YBKA 1XH7A 1ZYSA 2PVJA 4IWOA 4ZOGA 4CZTA 4KKGA 3TACA 4AE6A 4E6QA 3DBFA 4BCIA 2P4IA 3PJ2A 3Q9XA 4M84A 3C7QA 4NU1A 2B9FA 2W17A 2YCQA 4KIOA 2C0TA 3H10A 3GC8A 4BBFA 3DB6A 4U80A 4KIKA 5CALA 4GFMA 2E9UA 4TWCA 1KE6A 2CLXA 2QOBA 3NW6A 3HECA 3OBGA 3P5KA 4BGGA 2BALA 3FC1X 3E7VA 3JYAA 3L9LA 2YWPA 4IWPA 4C2VA 1P4OA 3I5ZA 5KBQA 3E5AA 4IVBA 4JR7A 5HVKA 3HAVA 2YISA 3S95A 4ZZNA 4BY9E 1REKA 3WILA 4ZSEA 5IQEA 4BHZA 5CNOA 4FBXA 3R9DA 4NKSA 2I7QA 1FGIA 4RWKA 5M53A 4M13A 3Q9YA 4H1MA 5L3AA 1NVSA 1JQHA 3OCBA 5IU2A 2B53A 3PE1A 3ZUUA 3ZBXA 1TQIA 5FTOA 5G6VA 4EH9A 3UIXA 2QG5A 4ZZMA 3MTFA 3EQCA 4IC8A 5DGZA 2OJGA 4U6RA 4UMQA 3F69A 2VTTA 3VBVA 4C3RA 1TQPA 2WXVA 3P23A 4IXPA 4RWJA 4YHFA 2VTQA 2WTIA 4RWLA 3UNKA 3QHRA 3W8QA 2X7OA 5DRDA 4DEAA 3UG2A 5IF1A 5FLFA 4BTMA 4CZYB 4ITIA 3PY0A 3MFSA 5JFWA 4TYJA 1LEWA 5FEQA 4D4YA 1KV1A 2Y0AA 3LJ1A 4JDJA 3UVPA 3UJGA 1YXXA 1WBWA 3ODYX 3PXRA 2BDJA 3Q4UA 5AR7A 4JQ8A 3LVPA 1UKHA 5LMBA 3QWJA 3ZFXA 3FKNA 5IA1A 2FSMX 1PXLA 4O91A 1Q4LA 3B2WA 3F3UA 3L9PA 2CGXA 3CPCA 3QL8A 5DVRA 4KA3A 2IVVA 2QQ7A 2WIPA 4U43A 3ZFYA 4RIOA 3ATSA 2IO6A 2UZUE 2BTSA 4QMPA 4DFBA 2Z2WA 3RPOA 4FEWA 3QZGA 4EK6A 2PVRA 2CLQA 3FC2A 3DAJA 4YJVA 3UVRA 3NVMB 5EW8A 3TNPC 3W32A 3GQLA 4ENYA 4XV2A 4HW7A 5JZJA 1VZOA 4KS8A 3BRBA 4GL9A 4JXFA 4OGRA 4D2VA 4RLLA 4RC4A 4PQNA 2LAVA 4KNBA 3V5WA 3AD4A 3CGFA 4KWPA 4P5QA 3LHJA 4QP3A 2ZDUA 3UC3A 3R9OA 1S9JA 3KMUA 5D10A 2J7TA 4DGLC 5HCXA 2ESMA 2PZPA 4RSSA 4M7IA 4U44A 3KMMA 1WVYA 4GG7A 4I6QA 3NR9A 3R7VA 2OK1A 3VUDA 4HVDA 5L8LA 1U46A 1ZARA 5M4CA 3ORXA 3NAXA 4BF2A 4FIEA 3VULA 3T3VA 2QI8A 4P4CA 1KWPA 1YXVA 1QMZA 4J7BA 5DR6A 1VEBA 5IQHA 3E8EA 2ZB1A 2BZHB 5AP0A 2OFUA 3G9NA 2QHMA 3GT8A 4HGSA 3RNYA 3FKOA 3NUUA 1BLXA 1G3NA 4LOQA 2BROA 4I0TA 3F2RA 4YJNA 2WU6A 4BDEA 3UZRA 4MX9A 2OW3A 3QYZA 5EK7A 4BCHA 3DBDA 3KULB 2CGWA 5HNIX 3ACKA 2OZAB 3HDNA 2CSNA 3I6WA 5BVDA 4FNXA 2VTHA 1PXPA 3DOGA 1XO2B 3Q9WA 4BCJA 2RFEA 2PUPA 3FY0A 4CYJA 3LJ0A 5C4LA 1KUTA 5IDPA 5LQFA 3BI6A 3P78A 4O0RA 4KS7A 4PDOA 4JDIA 4MNEA 4G3FA 4XOZA 4G6NA 2RSVA 2V0DA 4P5ZA 4AOTA 3EQDA 4DE4A 3HL7A 4IZ5A 2Q83A 2C6KA 2ONLC 1OBGA 3CLYA 2EU9A 2JDTA 3A4OX 3BWJA 3KN6A 4KIPA 2GHGA 5CU4A 2YJRA 2GNGA 3SQQA 1W8CA 2QVSE 5AFVA 4X3FC 4FSRA 3PVGA 4ZTQA 1OBDA 4N0SA 4O0WA 4EK3A 4XG4A 2VN9A 2UW7A 4GEOA 3KREA 3A7JA 3V3VA 4HCVA 4LRJA 4XV1A 4OBPA 4JX7A 2B7AA 3C50A 3DK3A 1Q61A 4F08A 3HMOA 2R3MA 5GINE 4Q5EA 4RFMA 4FG7A 4C4JA 3CD3A 2C1AA 1FMOE 4F4PA 4DLIA 1OUYA 4EOLA 1OI9A 3FQSA 4D1XA 4AS0A 1UV5A 4MCVA 4HYSA 2H6DA 4TYGA 2GHLA 4O7NA 3QCYA 4C4HA 1G5SA 4NTTA 4IHPA 5C8KA 3VW8A 5AUZA 4PY1A 2GFCA 2BZKB 4NTSA 3EFWA 4X3FB 3RNIA 5K0XA 1GIJA 4HGEA 1SNUA 2XVDA 3KMWA 5AIRA 4A9RA 3KQ7A 2R3OA 2RIOA 2VWIA 4EI4A 3VUGA 4G34A 4KSQA 4W8DA 1YKRA 1IR3A 4M69B 5EQPA 4UY9A 1WVXA 2XKFA 3NUPA 3NLBA 3KCFA 4YURA 3CIKA 3ZH8A 4D2WA 5I4NA 2GQSA 2WMAA 3DY7A 5CSHA 3GUBA 2WQOA 2J90A 4L3JA 4QTDA 3I7CA 4RBLA 4JBQA 4X2NA 1Y8GA 4EH8A 4JG7A 3POZA 1H1RA 4QMQA 3D14A 4C7TA 5M08A 3E87A 4CV9A 3MGYA 2PVYA 3VBQA 5E4HA 2PZ5A 2BFXA 2G2HA 2B54A 2XP2A 4HOKA 4CFNA 1GJOA 2YZAA 1NT2A 4AW1A 1OZ1A 3OEZA 2C6LA 4JX3A 4O81A 3RJCA 4QMYA 3FUPA 1H0WA 4PL3A 3SAYA 4IEBA 5KMIA 3DDQA 2YCRA 3BQRA 1OIRA 3T3UA 3FWQA 2I40A 2H96A 2W1DA 4FIIA 4KABA 3RI1A 3WF5A 2OJ9A 4BCKA 5CSPA 3EWHA 3M42A 4TYEA 3SXRA 4FTMA 3JXWA 4FSUA 3GNIB 1GY3A 4FIGA 4Y83A 2FUMA 3CSVA 3BE2A 4RZVA 3SW7A 3JR1A 5CNNA 4KBKA 4YLKA 5AR2A 4C57A 3SKCA 3AC2A 1XHAA 3OVVA 3DU8A 4G31A 3JY9A 4EOJA 5L2WA 5TF9A 4WD5A 5CEKA 3F61A 3VF9A 2IG7A 1YDTE 4BGQA 3GCVA 3FI4A 2V5QA 5CX9A 3JVSA 4E73A 5J1WA 3TNIA 3R21A 4Q9ZA 2NRYA 4JG6A 3EQFA 2R3NA 2R3LA 5AP2A 1J7IA 4GKHA 2FSOX 2QOQA 3AQVA 1XH5A 2QURA 3EQGA 4L67A 4D0WA 4P7EA 2QKWB 4MBIA 5T3QA 1CDKA 2C3JA 4LGHA 5KO1A 2CKEA 1JPAA 2FB8A 4G3EA 4Z55A 4AF3A 5FTQA 3TKIA 3F82A 3RK7A 3F66A 4A9YA 5E9EA 4LGDA 1KOBA 2QHNA 3QD2B 4EJ7A 1E1XA 4FKQA 3R9RA 3HRBA 3C0HA 3SLSA 4Y5QA 3VHEA 2J0JA 3V6SA 3LKMA 3PRFA 4FTKA 4BDDA 2O5KA 5AR5A 5CU3A 2QOOA 3MY5A 1OL2A 2GNIA 3WZJA 4O6LA 4F70A 4I20A 4Z7GA 3NWWA 3UQCA 1R0PA 3VQHA 4B0GA 3BU5A 4IZAA 3UDBA 2I6LA 5HLPA 4QOXA 4BIDA 3A61A 4MXZA 4TRLA 1Q8TA 2A27A 3DNDA 3NUSA 3O8PA 4QYYA 3TKHA 3MPTA 5FDXA 2R9SA 5FDPA 4RX9A 2JITA 4A07A 4PTGA 1Q8ZA 5ANEA 2RF9A 5TO8A 2I0EA 4EHGA 4EKLA 2BIYA 2CMWA 3C1XA 4HGTA 4F9WA 2J0LA 2YIRA 4OAVB 3ZO2A 5I3OA 4QQTA 3QXPA 4JRVA 3PA4A 3BLQA 4S33A 3G6HA 2PMOX 4MTAA 3CC6A 3IW7A 4S2ZA 5IA5A 4HPTE 5J95A 2C69A 1F0QA 3C4EA 5EYMA 2CGVA 4OLIA 4AZTA 4RQVA 4DH1A 3L8XA 2XIKA 4UN0C 4FKOA 5CY3A 5JSMA 3O50A 4DN5A 3NUAA 5CAUA 3BHYA 1CKJA 4WA9A 1WBSA 5A14A 2BVAA 2YIYA 2YABA 3ZSGA 3OW4A 1H0VA 2PMNX 3OUKA 3OWKA 3SXFA 3ZTXA 3OY3A 1STCE 4OAUC 3KRWA 1UWHA 3MB7A 3MFRA 4JBVA 4ONAA 3DBCA 4F09A 3IDBA 4ZSAA 4IIRA 1KE8A 5BX0A 3K3JA 4BDIA 3SW4A 3KXMA 4QMTA 1K9AA 3BGQA 3QXOA 4RZWA 2XNEA 3TJDA 3R02A 1P2AA 3DKOA 4XYFA 4QTAA 3HMNA 4I4EA 3UE4A 5D12A 4TPTA 4J97A 5M09A 3COKA 2XS0A 3NAYA 3W16A 2X6EA 4OW8A 2O8YA 2XKEA 3PJ8A 5CF6A 4FKGA 3FZ1A 1OL6A 4RJ7A 4FTRA 4QO9A 3WYXA 5J7HA 3C4ZA 5HQ0A 5HG7A 2FSTX 4O1PA 1BMKA 4ZMFA 1XJDA 3EZVA 5EM5A 3W10A 2C30A 4J8MA 2XK9A 2ZOQA 5CXHA 3QRJA 3VUKA 5ANJA 1PXMA 5F94A 2C1BA 1ZWSA 1V0PA 2OWBA 3DB8A 5HVYA 5GNKA 3QTQA 5M4FA 4ZTHA 3QD4A 2X8IA 3JPVA 3KL8A 2F57A 4R5YA 5DR9A 5JRQA 1M7NA 5J1VA 1YXSA 5AAGA 4DH8A 4PNKA 4FTOA 4IANA 5EHYA 2WMSA 3FLZA 3EB0A 3ORMA 3RHKA 4UZHA 4EL9A 4TNBA 3UQFA 4JNWA 3E88A 2IVSA 2W1HA 3VUHA 2WHBA 2X9EA 3HA6A 4QRCA 3WZDA 3AOXA 3DXNA 2CDZA 3VS2A 5A6NA 1Q41A 4BWXA 2UVYA 1LEZA 5DG5A 2BHEA 4GYIA 3LLTA 2C5YA 2YM8A 4PL5A 3QD0A 5CASA 2OKRA 4ASEA 3BZ3A 3LAUA 3ZM4A 4YJOA 4ANNA 4KRDA 2YWVA 3K54A 4XP2A 4QMSA 1Q62A 3E62A 5HCZA 2HY81 2OICA 2XIRA 2YCSA 4JDHA 3S1HA 4MXAA 2IN6A 2C3LA 3FPMA 3IG7A 3RAWA 2ITQA 3PJ1A 3IO7A 2B4SB 3QQGA 5HX6A 4O21A 3KY2A 4FKJA 4WNMA 5HICA 3R1SA 3AXWA 2XB7A 3A4PA 4DH5A 3KVWA 2C0IA 4EWHA 3QUDA 3ANQA 3DLZA 1H25A 3C4WA 5JT2A 4C3PA 3LOKA 4IH8A 2XK3A 3I4BA 3UZTA 2YJSA 1FINA 2J0KA 3UG1A 4O0VA 4AN2A 3PWDA 5AUVA 2VWBA 5HE0A 2W1IA 4R1YA 4G9CA 4V0GA 3R7GA 4QP1A 1WBTA 4FV7A 4JBPA 2C5NA 2YM5A 2HZNA 5C27A 5I9ZA 2CKOA 4XRJA 3F6XA 2WD1A 3PY1A 4WUAA 2F2CB 2E9NA 4U0IA 3PRIA 1CTPE 4FVPA 3UC4A 4BB4A 1H00A 2WQEA 5AV3A 1OPKA 4ZLYA 4V04A 3QQLA 3W2RA 1RW8A 3BGPA 3CPBA 4NIFB 2EB2A 4YZMA 4ZEGA 3IECA 5ANGA 4GRBA 3OG7A 5AP4A 4YZCA 3FZPA 1JSVA 3Q4CA 5HE1A 5D7AA 4QP8A 4DFNA 3TN8A 3GCPA 3OEFX 4USEA 5FGKA 3F5XA 3QC4A 4XNEA 3PTGA 3GC9A 3GQIA 4F0IA 1ZLTA 4PPCA 1NVRA 2QNJA 4MD8E 4TYHB 3P7BA 4G6OA 3VRYA 4BCQA 5AV4A 4ALVA 5HU9A 1WBVA 3ODZX 4PMSA 4O0UA 2X4FA 5J8IA 3QGYA 4BKZA 2R0IA 4R5SA 4IAYA 4NSTA 2HCKA 1B39A 1W0XC 3ORTA 3R01A 3F7ZA 5CQWA 3AT3A 3UQGA 3FXZA 2VTRA 2J0IA 3A7HA 4G3GA 2UW4A 1U5RA 2J2IB 3OW3A 3P08A 3R28A 4AGDA 1UNGA 5CAOA 3KXXA 4MVFA 3QCXA 4TNDA 4EK4A 3EN7A 5A4CA 5J5SA 4L52A 2C47A 3U6IA 3AC8A 3NMUF 2F4JA 2WTVA 4I92A 3IOKA 4CGAA 2QOLA 4BDKA 2CNQA 2NNWB 4UBAA 5AR8A 1PXOA 2VD5A 5TR6A 4OUCA 3QCSA 3OTVA 4F7LA 3GU7A 4ZY5A 3AGLA 4FT7A 3R7IA 3IGGA 4FTCA 3KRXA 2OFVA 4BYIA 5EI6A 4YSMA 3AT2A 3KXGA 5A46A 5IH6A 1IAJA 3V01A 4BGHA 4AW0A 3MA6A 4CKJA 1H1QA 2QOCA 4EH7A 3G51A 4FEXA 3R1YA 3Q4ZA 3R2YA 4L43A 4MAOA 3GCQA 4GT5A 1GZNA 4A7CA 2VX3A 4NCTA 3ALOA 3PSDA 4IACA 2R4BA 4AA5A 5M44A 5HD4A 3A7GA 4E6DA 4I5HA 3UTOA 4FKSA 4IAKA 4PDPA 3RMFA 5HLNA 4ZJVA 1GAGA 2ZM3A 4IADA 4GT4A 3R8PA 4YR8A 1XH4A 4ZSJA 3Q2JA 5ETAA 3PXKA 4RIXB 5LMKA 5TOZA 4YO4A 4AOJA 2YCFA 5CT0A 4OTRA 4EHEA 1YHVA 3ZO1A 3HUBA 1YWVA 3OS3A 4JBOA 4FZ6A 3GU8A 4NCTC 4O7VA 5HO6A
chains in the Genus database with same CATH superfamily
1OL7A 4EKKA 2X2MA 4QP4A 1DM2A 3PVUA 2OBJA 2PVKA 3WI6A 2NPQA 5K3YA 5D41A 5AX9A 3ZRMA 4USFA 1PJKA 2OJJA 2GNHA 4H39A 4Z3VA 2I0HA 4H3BA 2V7AA 3BKBA 3D5WA 2BDWA 4C35A 4NKAA 4ENXA 4FE2A 1FPUA 1G8KA 3FMDA 3QKKA 4JIKA 2UZBA 5CVHA 3TI1A 3PUPA 2VX0A 5BQ0A 3E93A 3DK6A 1BL7A 1ERKA 1OB3A 4WSYA 5F1ZA 2WMVA 3U4WA 4ZZOA 2F7EE 2OXDA 4FTJA 3QA8A 5JGDA 3K5VA 2PSQA 3FI3A 2YM6A 4U42A 4YJPA 4M66A 1W82A 5E90A 3RALA 4D9TA 1ZAOA 2YERA 3K5UA 4QTEA 4LI5A 3ULZA 3FZTA 2YIXA 3UOLA 4A4XA 3KN5A 4C8BA 5AIKA 3QD3A 3IONA 1NY3A 2C0OA 2QG7A 2EB3A 5JRSA 2QO2A 5B2KA 3NUXA 2QOHA 4BCGA 5IUHA 4CSVA 2AUHA 4EBVA 3O23A 5AV1A 3ORIA 2P33A 3LXLA 4RVKA 2BIKB 2Y6OA 3HX4A 4NEUA 4O7SA 3V5QA 4BCMA 3BQCA 4EEVA 2OLCA 4HGLA 4DH3A 4IAIA 2XANA 2HWOA 3P0MA 4I5CA 3F5PA 4KKHA 4KRCA 2PYWA 1PW2A 2GTNA 4FNWA 2YLEA 4GYGA 4AA0A 4QMLA 4BJJA 3UIMA 4UX9A 5AR4A 3QKLA 4PDYA 3V5PA 4XJ0A 2GNJA 2O0UA 2VTMA 5K0KA 4JL9A 4FV6A 2W5HA 3PXFA 4W9XA 1RDQE 3C9WA 2WAJA 3UPZA 1UU9A 3C4CA 3MB6A 4DEIA 5FRIA 3UOKA 2REIA 4EQUA 2HWPA 3ZC6A 3HYHA 5HNGA 4ACCA 2W05A 3CJGA 4NZWB 2WPAA 2WFYA 4CRLA 3BGZA 1YWRA 5F20A 1TZDA 2RGPA 4HCUA 3UIUA 1T45A 2VNYA 2ZV8A 4W4VA 5HOAA 3WIGA 3P4KA 3OY1A 4DFYA 5AA8A 4XMOA 3BLAA 3R1NA 5BPYA 1PF8A 4NUSA 1V1KA 3ID6C 2YFXA 1NVQA 4F9AA 2WMUA 3EZRA 4R6VA 2X0GA 3P86A 3RWPA 3ZM9A 2GS6A 4Z9LA 3Q5ZA 5E8YA 5EW3A 3MSSA 3PJ3A 4EHZA 1FVVA 2O2UA 5HE3A 4QNYA 3R7OA 2ZJWA 4IJ9A 2VTSA 3DGKA 4PMMA 1UNHA 4RQKA 3H9RA 4FNYA 2BDFA 3O2MA 3FDNA 5L2SA 4YJUA 5IQCA 4FSMA 1ZY5A 4RG0A 5KX8A 2DQ7X 2CCHA 3H30A 3D5VA 3NNXA 5LJJA 3GCUA 3QRUA 4E20A 3NRMA 4NWMA 4JIAA 3VW6A 5KCVA 5GIPE 3T9TA 3QBNA 4OT5A 4C36A 2XK4A 5TKDA 3REPA 3L8PA 1QPCA 2R3JA 3K2LA 3NUNA 1A9UA 2PWLA 3QA0A 4D58A 4O7LA 1OM1A 3PVBA 1FBNA 3PUFC 2C6EA 1PHKA 3WZUA 2CGUA 3OT3A 4ALWA 4F78A 3QTUA 4C62A 2W9ZB 4O4BB 4UWYA 5IA4A 3NYXA 4DLJA 2HIWA 5AMNA 4E8AA 2HXLA 4LUEA 2JKKA 3OP5A 3F3VA 3MVHA 4FIJA 1WBNA 4O0SA 3FMHA 1XBAA 4DH7A 4HYUA 2X7FA 3ELJA 3R0TA 3HMIA 2QCSA 4GS6A 4BKYA 4ZXTA 4BYJA 1HOWA 2QOFA 4B8LA 3U6JA 2X0OA 3N4TA 2B9JA 4G9RA 3RPRA 3CY2A 3EQRA 5AM6A 2IVTA 2WKMA 4FL3A 4U40A 4ZIMA 1FOTA 3MH1A 3PXZA 4XBUA 4DCAA 2XIXA 5M06A 1UU3A 4QP2A 5JN2A 2VWZA 3PFQA 3TZMA 3RBWA 4AT4A 4GW8A 2JAMA 1IRKA 3VS0A 3DQXA 5HESA 4UZDA 4EC9A 4EOQA 1ZMUA 4X6RA 1SVHA 2JFMA 4R7BA 2B1PA 1XBCA 3DA6A 4ZSGA 3UP7A 4N6YA 4RX7A 3VS6A 4BIBA 5CEIA 3TXOA 4YTFA 1Q8UA 3U9CA 3NYOA 2BFYA 3H4JA 3MPMA 4GK4A 4BKJA 3CQWA 3H0YA 1WCCA 3DFAA 3F9NA 4LRKA 4QPSA 4C4IA 3VUIA 3Q4TA 5IKWA 5A4QA 1AQ1A 4XX9A 5I3RA 5IH5A 4BZDA 4K33A 4DEBA 5TE0A 2WOUA 1Z57A 2VWVA 3KULA 5JQ5A 2OZAA 4DINA 2Z7LA 2GHMA 3ROCA 3RPYA 4GUEA 3ZMMA 5HZNA 3UNJA 1NXKA 3QZIA 5KUPA 3QRTA 3TDWA 2VGPA 2XM9A 3C5UA 3DPKA 4G2FA 3UYTA 4CMTA 4D28A 4FTAA 3Q9ZA 5EQYA 3LM0A 2OI4X 5H9BA 4M14A 1OGUA 1OKWA 2VTPA 4MEDA 4O7TA 5B0XA 4CFFA 2WTDA 1M2PA 2OIQA 2NRUA 4AZSA 3O7LB 2XUUA 3PA5A 4C4FA 2IZRA 4ZS4A 2PVHA 3FSKA 4G1WA 2I0YA 4DFLA 2V7OA 4RIYB 4NM0A 1CKPA 2H8HA 4B6LA 2I0VA 5D11A 3MIAA 5AWMA 4O86A 4IVCA 3T9IA 2GSFA 3NNUA 2ITTA 4F6SA 1U59A 2C5XA 3HMMA 3UVQA 2ZDTA 4UXQA 4FL1A 1PRYA 2XKDA 5DWRA 4DAWA 5B7VA 3F2NA 5IUIA 4FT0A 3QALE 5EKOA 4S32A 4M0YA 4R3PA 2BAJA 4L9IA 5E91A 2W7XA 4ERKA 2AEGA 3ORPA 1FVTA 1T46A 3QTWA 4CD0A 3TNWA 2OXXA 2ITYA 4D2TA 3P1AA 3HRFA 3UODA 3U54A 3FLSA 2JIVA 2ONLA 4MQ1A 5BUIA 4QMWA 3WE8A 4S34A 2C6DA 3GFEA 3H9OA 4UV0A 5LVMA 3VUMA 4FZAB 1G8JA 2UVZA 4A06A 4ANQA 1TVOA 3IGOA 3L8SA 4X3FA 2WO6A 4D4VA 2V55A 4E93A 4W4YA 5FM3A 5KHXA 3QTSA 2JDVA 3II5A 3QFVA 4U81A 1Y6BA 2IVUA 2ZB0A 5L2TA 1ZOGA 3W0MA 3W0RA 1JAMA 2WZJA 4M69A 5EOBA 1UU8A 3OF0A 3V8WA 4C0TA 1H24A 3BV2A 5AM7A 4R78A 2P2IA 4ZJJA 3SD0A 3QZFA 3ZC5A 4ORKA 5CI7A 3G0FA 4IFGA 3NYVA 4DG0E 4GIIA 4QP6A 1R39A 4UMTA 3GU5A 3LQ3A 1REJA 4EH4A 1BX6A 4YZNA 3FSFA 1GIHA 1H1SA 3QQJA 4AN3A 4NT4A 4ZLZA 5HO7A 4L3LA 4AZWA 3EMGA 3TTJA 3LQ8A 1E9HA 3LZBA 2NO3A 3W33A 4JOAA 3SOCA 3U9NA 3QUEA 4YMJA 4MXCA 1OKZA 4QYFA 4EWQA 2R5TA 3A62A 4TW9A 3OXIA 1ZRZA 2UV2A 4F6WA 5CAVA 1MQ4A 4E1ZA 2CKQA 3W2OA 3R8UA 4FKUA 5BVFA 3A60A 2PULA 4Q9SA 5BVNA 3ZS5A 3PIZA 3BYVA 5GHVA 4DA5A 1SVGA 3C13A 4FR4A 4P2KA 4YNOA 4EC8A 5F95A 2HELA 4MXXA 4J99A 3L1SA 4RT7A 4AOIA 2C3IB 3ATTA 3W0OA 2R3QA 2R3GA 5AP1A 3SOAA 2O3PA 4IWDA 4XEYA 4D5HA 5JH6A 3O71A 4G17A 5T68A 3ETAA 5EQEA 4FKVA 2AC5A 5DR2A 4B9DA 4TWNA 3DZOA 3BYMA 1M2QA 2XEZA 2AQXA 4FX3A 4O27B 2ITPA 1DS5A 4JT3A 2RKUA 2CN8A 5IQDA 2GS2A 3EOCA 4Z7HA 2DYLA 4BDGA 4PTEA 4EZ7A 5IISA 3GI3A 1ZZLA 4MUQA 2H34A 2BAQA 4G6LA 1YHSA 3OBJA 2UZOA 4FF8A 5FP5A 4ZP5A 5IA3A 5KMOA 4M97A 1YDRE 3N4VA 5GZ8A 5ICPA 2YM7A 4ZY6A 3DKGA 3QTXA 2UW9A 4YC8A 3PPJA 4HZRA 2WTCA 2XF0A 3TUBA 3BHHA 4L7SA 4FK3A 4O82A 4W4XA 5EW9A 3ZUTA 4E5WA 2QU6A 5CS6A 5ANOA 4CCBA 3PSBA 4NH1A 4J96A 3UPXA 4WG3A 2Y9QA 3BYUA 3OCGA 5H8GA 2Y6MA 3DDPA 3RAIA 3N4UA 3BHVA 3FI8A 4BHNA 3NEWA 4WG5A 4A9SA 3EN6A 4IBMA 4OTFA 3NPCA 1VYZA 5LVPA 5IEVA 1KSWA 4I0RA 1BUHA 3GENA 4PMTA 4I6LA 3HP5A 3UZPA 5I9YA 2XIZA 5AP5A 5A3XA 3UP2A 3BLRA 2XM8A 1XWSA 5FEDA 5C8MA 1CKIA 5DI1A 4J8NA 3C4FA 3QGWA 5AUWA 5KKRB 4CG8A 1W83A 3FXWA 2R7IA 3LFSA 3D15A 3IKAA 4ZTSA 5DT4A 3BBWA 3RM6A 1PKGA 2W5BA 3JVRA 3DCVA 1YI4A 2W96B 3AMYA 4IAFA 4AP7A 2ZVAA 4GUBA 4LOOA 1BI8A 4X7QA 5CSWA 4OBOA 2PUIA 3COMA 4LL0A 2RFDA 3TV7A 4F99A 2WU7A 3MH3A 1W2DA 4L46A 2E9OA 4FIFA 5DPVA 2UZWE 4M15A 2HK5A 3OUNB 3Q04A 4IAAA 5ACKA 2WEIA 4YGAA 5HORA 5ITAA 3V8SA 3CQEA 4YZDA 1OL5A 2X1NA 2X0PA 1YI3A 5FQDC 1DAWA 2XIYA 4LUDA 3LMGA 4MYGA 2JKOA 2Z7SA 3B8RA 3DFCB 4RPVA 4A9UA 3FMEA 5FP6A 2X0QA 3SDJA 3LCKA 3MV5A 4E6AA 1XH9A 2FYSA 3PDTA 3EQPA 4MD7E 2UW8A 4ZJIA 3CEKA 2QLUA 4TXCA 2WIHA 3FLYA 4FKPA 4FV8A 4IDTA 2BAKA 4YLLA 2UW6A 3R00A 4AN9A 3ZYAA 5JFSA 1R0EA 3P79A 3FV8A 4UB7A 5BVOA 2A0CX 3HUCA 4GU6A 5FXQA 3QHWA 3ZXZA 2VO7A 4UXLA 4HVHA 3UYSA 3R7EA 3KC3A 4GU9A 4GKIA 2BRBA 3LW0A 3ITZA 4BVUA 3NCZA 4OBQA 3B2TA 3FHRA 5EI2A 5HD7A 3D4QA 2GDOA 1JLUE 4R7IA 2JEDA 2XYNA 3M1SA 4EOOA 5AAEA 3ZBFA 2ZMCA 3KB7A 3RZFA 3EQBA 4IE9A 3RHXA 1OKYA 2Q0NA 4FIHA 2XK8A 5E1SA 5AUTA 2EXMA 5ANIA 3QAME 2C6IA 5CU2A 5FBOA 4D2PA 2HW7A 5BYZA 3SA0A 3R73A 2IPXA 1J7LA 3COHA 4YHJA 3E3PA 4H1JA 4XRLA 3FEGA 4Q5HA 4YJQA 1JKTA 3RM7A 2C6OA 2FSLX 3NGAA 4F1TA 4Y85A 2ZAZA 4EONA 1DI8A 5K4IA 1H28A 4RGJA 4ASZA 3ZLWA 4YC6A 3EFLA 3F3TA 2W0JA 3KCKA 3QQKA 3VIDA 2PVLA 2YIQA 5M4UA 3DS6A 3O8TA 4YBJA 2BRNA 2VRXA 2YN8A 3F3WA 3MYGA 4II5A 4LMUA 4YTHA 1H1WA 3VC4A 5FXRA 5KMMA 3HNGA 4I22A 3D83A 2R7BA 3BIZA 3OROA 2ZM4A 4EZ3A 4O7ZA 1PXNA 5JGAA 4IQ6A 3E7OA 4K2RA 4W8EA 3DAEA 3KK9A 2XBAA 5AV2A 1YW2A 4DTBA 4RVMA 2P0CA 3RK5A 3ZRLA 4EK8A 2UW0A 4LRMA 2YDIA 2PVNA 3LJ2A 4YLJA 2ZMDA 3W18A 3HV4A 2DWBA 4F1OA 3MVMA 2GTMA 3NW7A 4QQJA 3SX9A 4CCUA 4O2ZA 3Q53A 2X81A 3TV6A 3GXLA 5K5NA 4IX4A 2B9HA 5LARA 4EUUA 3RCDA 3ZDUA 3MA3A 4CV8A 3KRLA 3VS3A 3C51A 3HDMA 4K11A 3S3IA 2O65A 1ZYDA 4C33A 4H3QA 3P5JC 4U45A 4IB0A 1H1PA 5IMXA 5M55A 3NIEA 3W1FA 2B0QA 2J0MB 1JKLA 4IM3A 3S00A 5E7RA 2OIBA 3ZFMA 3R2BA 2QD9A 2PUUA 2R3KA 3ENMA 3GFWA 3QRIA 4IB3A 4BCPA 4CT2A 5HU3A 1CM8A 2O63A 3KXHA 2XH5A 3M11A 3U51A 4TN6A 4WBOA 3ORNA 1OMWA 5CEPA 2ACXA 4UYAA 1YOLA 4XHKB 3NZ0A 1RE8A 3ULIA 4CVAA 4XCUA 3ACJA 3PIYA 4U3ZA 2BRHA 3EYGA 3PSCA 1UVRA 1Y57A 2JBPA 2BTRA 3AMAA 3MDYA 4ID7A 4FV9A 4NJDA 3VWAA 2CNUA 4AXFA 2ZV7A 4WNOA 2H9VA 3ZLSA 3R30A 4JR3A 4JS8A 4FGRA 4L45A 1ZMWA 3VUTA 4ZTNA 3TDVA 3TYKA 1DAYA 4FTTA 4ALUA 5JQ8A 2VO6A 2BCJA 4FYOA 4DEGA 5CAPA 4TYHA 3WARA 2W4JA 4L6QA 4BC6A 1UA2A 2VZ6A 4NFNA 2JKQA 4AG8A 3K3IA 2Y7JA 4EH3A 5DE2A 5IA2A 4C34A 3PXYA 2JFLA 2E2BA 4GJ3A 4CMUA 5HO8A 1F3MC 4BDBA 3LLAA 1A48A 3LFDA 3PPKA 4DT9A 4XS2A 3F5UA 2J51A 3EIDA 2HXQA 1H26A 2JKMA 1YVJA 4EZ5A 4JQ7A 3U87A 5IDNA 3FE3A 4QPMA 5C26A 3DNEA 4FT3A 4M12A 3UIBA 4CFXA 4EH2A 4UMPA 3ZU7A 3FAAA 3U55A 4O0YA 2Y4IB 2ITOA 2P3GX 3GVUA 3WIKA 1KE9A 3HVCA 3O8UA 4EJNA 2GNFA 2R3PA 3FMLA 3I6UA 3OD6X 4XP3A 4FSNA 3G9LX 3TNHA 3ZSIA 2PVMA 1APME 4K18A 4GVJA 3NYNA 4TT7A 3OFMA 3I5NA 3RTPA 4FUYA 2ITUA 5DBXA 3HAMA 4JAJA 3DXQA 2VTAA 2ZYBA 4Y72A 3AC1A 4CLJA 3TUDA 4XG6A 5HI2A 5DFPA 4FSQA 2PZIA 3ML1A 1MUOA 4BTFA 2R3IA 4GG5A 3GP0A 2VWXA 4U7ZA 2Z02A 2NP8A 2GPHA 2A98A 4RX5A 3OWJA 1PMVA 5CQUA 2ITNA 2UUEA 3CE3A 2BPMA 4D1ZA 4KD1A 4R77A 3EL8A 4MH7A 4X2JA 3LFCA 3VS4A 3ROYA 2JDRA 4M8TA 4FTLA 1YI6A 4IX6A 4N4SA 1VJYA 3LIJA 4IZYA 3D7TB 4KBAA 4RIXA 3SHEA 4AW2A 3AC5A 3DKFA 4MNFA 4D2RA 1IASA 1Z5MA 1IA8A 3PZEA 5JGBA 4E5BA 3A2CA 2BR1A 3ZO4A 3R04A 3Q60A 3PFYA 4GT3A 4QD6A 1ST0A 3E64A 3FI2A 4QMVA 2X9FA 3KRRA 4RC3A 3FYKX 3WF6A 5EDRA 1YOJA 4MD9E 3DBEA 4IM2A 5CANA 2VX1A 4MK0A 2BHHA 3EQIA 3FLWA 3GC0A 4YSJA 3O17A 3DQWA 2JD5A 2UZLA 4FTQA 5BUJA 3KEXA 4FKWA 3IS5A 1QPDA 4JJRA 4CTBA 4OTWA 4FYNA 4DYMA 2OU7A 1M2RA 5GJFA 3RKBA 2G9XA 2GNLA 2OJFE 4GFGA 4CG9A 3BLHA 4AQKA 3ORKA 5IH4A 1OPLA 2WQNA 3UO6A 3O96A 2A19B 5E1EA 2C6MA 3G90X 3P7AA 4GK2A 2OH4A 4C61A 1PYXA 4LOPA 4YJTA 3WYYA 1SM2A 4AT5A 4AE9A 4F0FA 4I6HA 4NW5A 5DA3A 2XNMA 5HIEA 1OKVA 2X8EA 5I9WA 4X6QC 4UWBA 3TKUA 2HYYA 2VU3A 2WQMA 4BTKA 4ZS0A 5AUYA 3W2SA 1ZYJA 1K3AA 2VTIA 4CFUA 4DBNA 5L4QA 3D5XA 3H3CA 4X2FA 3I0QA 5AP7A 4DF3A 2YA9A 3C4XA 2PZYA 2FH9A 2C3KA 4HCTA 3VJOA 5FEEA 2GS7A 2W1GA 3UOHA 4QMZA 2YHVA 4TKSA 4D55A 5LOHA 3O0GA 3KF7A 5EI8A 4RC2A 1WMKA 3VS1A 4TL0A 4YTIA 3KA0A 4NYEA 3OC1A 2KULA 5EYDA 4EQMA 2VO0A 3QQHA 4FUXA 2PE0A 3TIYA 5HEZA 4BL1A 4OTHA 3W0QA 4PX6A 4RLKA 3I7BA 4YNEA 5F9EA 3W0PA 5B2MA 2C5OA 5M56A 4NFMA 3CCNA 2JIUA 1EH4A 4K6ZA 4KUJA 5BYLA 4K77A 4ARKA 1Q99A 3QLFA 5A6OA 3RWQA 4RA4A 5LVOA 4RIWB 3QZHA 3CBLA 3C5IA 3LXKA 4L68A 2JGZA 4U3YA 3TV4A 2A4LA 2X39A 3BCEA 3NNWA 4J1RA 3UO5A 4EOKA 5I9XA 3LMIA 1YRPA 3GBZA 5F4NA 4I5PA 3VBXA 5JFXA 3DT1A 3D5UA 4DGMA 4FSTA 2VTJA 3GB2A 4LL5A 4C59A 4AXAA 4F1MA 1J3HA 4I23A 2PPQA 3LM5A 3V04A 4EOPA 2PZRA 4FSWA 1UU7A 4WBBB 4B8MA 4E5AX 3Q3BA 5CWZA 3W55A 2XZSA 3AC3A 2HY0A 4XUFA 3LFBA 4CZUA 1TFFA 4ASXA 3MW1A 3LCSA 5BVWA 3T8OA 2YAAA 5L6OA 1GIIA 1CSNA 4TWPA 3TL8A 3CD8A 5FUTA 4IB5A 1MRVA 4PPBA 4WSQA 3UDSA 4Z16A 1OUKA 3PJCA 4DHJA 3PVWA 4H58A 4KKEA 2QLQA 4MBJA 5ACBC 3TZ9A 4S30A 4F7JA 3A8XA 3AD6A 5L2IA 4CNHA 5M57A 4O84A 4QTCA 4MQ2A 3R7UA 3SC1A 4C38A 4I94A 5DH3A 4G3DA 4BZOA 5LCJA 4RMZA 2VO3A 5CF5A 4GJ2A 3AG9A 1JWHA 4PP7A 5AA9A 4LQMA 5T6KA 4PP9A 4XG9A 4DGGA 2UZEA 4Y8DA 3R6XA 4TYIA 4O1OA 3ZUVA 3GU4A 4FJVA 3NUYA 4NW6A 4BDHA 4OTQA 4YZ9A 2J5FA 4L44A 3MY0A 2HZ4A 2UW3A 4FG8A 3FZOA 5ETCA 3R8LA 4E3CA 4L01A 3SRVB 5J79A 5GIOE 2W99B 5IPJA 4BTJA 3W8LA 4ZK5A 4JLCA 4EQCA 1O6KA 3QWKA 4HNFA 5A4TA 1UNLA 1IG1A 2QKRA 3ZSHA 4EUTA 5EM6A 3RPSA 2WOTA 4UMRA 1RQQA 2B9IA 4RFYA 5M51A 3UBDA 2PK9A 1ST4A 3UMWA 4CT1A 4QMUA 3IDPA 4Y5HA 5CZIA 3NX8A 5E8ZA 1Z9XA 3S4QA 3DTCA 5GZAA 4XV3A 4RVLA 3IQ7A 4L53A 3UDZA 1TQMA 4JDKA 4I6BA 4FZFB 4WT6A 2OJIA 4PDSA 5CU6A 4JVGA 4IVAA 5AUUA 4FOBA 4LV5A 4NM7A 1Q97A 2J4ZA 4FC0A 4FKIA 4A9TA 3VF8A 2OF2A 2QU5A 4D9UA 2WMQA 3ZOSA 2V22A 3Q32A 3FMJA 2PY3A 2VUWA 3GU6A 1ZYLA 3ZZEA 4R3CA 2QO7A 1URWA 2PE1A 2OF4A 1O6LA 4XP0A 3GGFA 5EHOA 3RAHA 3L9NA 3RGFA 1OIQA 3ZLYA 4QQCA 3QKMA 1J1CA 4XOYA 3CXWA 2BZIB 4IX3A 3A99A 5CF4A 2ETRA 4DHZA 4QMMA 5JKGA 4IX5A 3V5JA 1YWNA 3FLNC 4LV7A 1PY5A 2XNNA 2F7XE 4L8MA 4UEUA 4RIYA 3PLSA 5AJQA 3FXXA 3VBYA 3KRJA 1U54B 4ZMEA 2XJ2A 4FV5A 5DNRA 2IW8A 5M07A 2W1EA 4RRVA 3VAPA 5I9VA 4HYHA 1PXKA 1TKIA 4OTPA 3D9VA 5C01A 3MBLA 4OR5A 2WMRA 5J7BA 4FEUA 5DYJA 4U9AA 5DLSA 5ETFA 3TG1A 4FKLA 2XK7A 4PRJA 1OECA 3FY2A 5EM7A 5E92A 1M17A 4LMNA 4XV9A 1ATPE 4IC7A 2G15A 2GQGA 3FZRA 3ALNA 3I60A 4FVQA 1KV2A 1M14A 4R3RA 5CT7A 2J6MA 3VNTA 4BZNA 2VTNA 3NVKI 2W1CA 1V0BA 2ITVA 2C6TA 4U8ZA 1Q5KA 2JAVA 2R3RA 3BHTA 3DTWA 4DEHA 4NJ3A 5GJDA 2AYPA 3VS7A 4JG8A 5HTCA 4KIKB 1R1WA 3HZTA 4ANBA 2E9PA 1SZMA 1YXUA 4AGUA 1PMEA 1W98A 2G01A 4BDCA 4KB8A 4LV8A 5AP3A 4C37A 3SG8A 1YOMA 1XH6A 1WAKA 1ND4A 4CLIA 3EN4A 5HLWA 3MVLA 1H07A 2ZV9A 4PV0A 3O51A 4FI1A 3CTQA 3RZBA 3OXZA 4I3ZA 3HV3A 4DTKA 3WZKA 3VRZA 4DHIB 3N9XA 4FOCA 3ZXTA 4E4LA 3CR0A 4FICA 2XK6A 3CS9A 4YC3A 3MFTA 3MVJA 2GMXA 2YAKA 2OSCA 3I79A 4FL2A 4BCNA 4HNIA 5C8NA 4F9BA 4FKRA 3W2PA 1QPEA 2P2HA 3VQUA 3ZLXA 2EVAA 5JZNA 2C5VA 3OCTA 3DV3A 1PMUA 3DKCA 2FVDA 4ZLOA 5B2LA 3MJ1A 3LFNA 2BILB 3FMNA 2WTKC 3LMHA 3Q6UA 4RVTA 3Q52A 4FODA 3PY3A 3DLSA 4HZSA 4EOSA 2I1MA 4CFMA 1X8BA 4AGWA 2JBOA 3IDCA 4WUNA 2R0UA 1G8SA 3E8CA 2UVXA 4X0MA 2BRGA 3RPVA 2DUVA 4CQEA 4FTIA 5CF8A 2ITXA 3F3ZA 3WF9A 4EH6A 4EYMA 4BBMA 2YEXA 5M4IA 4YHTA 2JLDA 2IJMA 3DBQA 2YZLA 4D0XA 2YDJA 1P14A 4QT1A 4DEEA 2B55A 4RJ3A 5KBRA 4XLIA 4CFVA 1KE7A 2R3HA 4WRGA 3FMKA 3IOPA 4FV3A 5DN3A 4MXYA 4N70A 3V8TA 4AW5A 3GOPA 3BEGA 2Y4PA 3LFFA 4NM3A 2IZUA 5FD2A 2WTKB 4X21A 3EN9A 3PIXA 3NDMA 2W1FA 4MKCA 1J91A 1OIUA 2ERKA 3MTLA 3Q6WA 4FV1A 4ZTLA 3FLQA 2F9GA 2XJ0A 3UNZA 1LPUA 5EKNA 1CMKE 4KIQA 5HG8A 3FMMA 5CSXA 4BFMA 4EORA 3C0IA 4WNKA 1FMKA 4FNZA 3VBWA 3CTHA 3E63A 4W9WA 5CZHA 2VTOA 3RK9A 2RG6A 4O38A 4PF4A 4TZRA 4YTCA 1J1BA 2X7GA 3EN5A 3EFJA 4LDTA 4RWIA 3OT8A 3KKVA 3Q96A 5D7VA 3UO4A 2VNWA 1OIYA 1SYKA 3FYJX 3HLLA 3RVGA 5DOSA 1OL1A 3ZONA 4GMYA 3R83A 5HVJA 5IMEA 3AKJA 1E1VA 4AA4A 4UWCA 2XNOA 4DGOA 3NIZA 4O2PA 3GC7A 4E4MA 4FTUA 3QQUA 2BUJA 4DEDA 4DT8A 4OT6A 5J9LA 4MWIA 1H08A 5HHWA 4HVSA 4M0ZA 4BCOA 3W0NA 3V5LA 1MP8A 3HEGA 3VHKA 2OO8X 3TZ7A 2QOIA 3P9JA 5IQGA 2G2IA 2FGIA 3PG3A 4FV0A 5L6PA 2XRWA 4BICA 4XG8A 1P5EA 5IEYA 1MRYA 3CGOA 3IK3A 5FG8A 5BMMA 4DFZE 4GIHA 4APCA 3DJ6A 2OH0E 3OTUA 5E8UA 5ETIA 4B7TA 4E4NA 3LFQA 4RA5A 1PYEA 4E7WA 1Q8YA 3O7LD 1MRUA 2XJ1A 3KXZA 2JDSA 3MWUA 3FL4A 4MNEB 4QYEA 4YP8A 4AZVA 3B8QA 1URCA 5ANDA 1XH8A 3R7YA 5KNJA 5HCYA 4ACHA 4HVGA 4AZEA 2JDOA 2YM3A 1YDSE 4J71A 4XH6A 3V5TA 5CVGA 2SRCA 3R8MA 4QMOA 2QO9A 4FSYA 4EK5A 5HG5A 5J5TA 3NS9A 4I6FA 3MPAA 5HX8A 5HG9A 1HCLA 2EXCX 5LMAA 5KKRC 3QCQA 4WG4A 2DS1A 4GCJA 2PL0A 4CYIA 3PP1A 4CQGA 4F65A 3V51A 4YZBA 3AC4A 3MIYA 2QOKA 4OTDA 3SG9A 1ZYCA 4ZAUA 5C4KA 4J52A 1ZZ2A 1JSTA 5DMZA 2XCKA 4A4OA <