3QUEA

Human p38 map kinase in complex with skepinone-l
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
349
structure length
343
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Skepinone-L is a selective p38 mitogen-activated protein kinase inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 106
structure length 343
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3queA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3queA01
4X2FA 4Y8DA 3VUHA 4CT2A 3TNIA 3LFEA 1OL5A 3A7GA 4XG2A 3W16A 4P7EA 4W8DA 3TIYA 3ZFMA 4Z7GA 4FIHA 3LW0A 3LZBA 2P0CA 3D83A 3GEQA 5D12A 5DRDA 4DAWA 4AOJA 5GIOE 4M69A 4FT3A 4FA2A 3EMGA 2QOBA 3TJDA 5K5NA 3S2PA 4O7ZA 1XH5A 4FT5A 3H3CA 3RNIA 3GU7A 1XH4A 3QKKA 4AW5A 1PMNA 5AV1A 4H39A 2RFNA 5HVYA 3MVJA 2PE2A 1IASA 3E5AA 4U8ZA 2R3RA 3QCXA 1YOJA 5ANDA 1Q3WA 5M07A 3N4VA 3NMUF 3OVVA 4BBMA 1OECA 5JRQA 1O6YA 4OT5A 1XQZA 3DZOA 2QKRA 2WMWA 4GFOA 3TIZA 3DNDA 3RAIA 3FI3A 4DFZE 1GZOA 4FGRA 4X2GA 4A4XA 3AGLA 2CCIA 4C61A 4OTHA 4JAJA 5I3RA 3UODA 4XJ0A 1IA8A 1F0QA 2VGOA 5EI6A 5KMNA 3BGQA 4I5CA 3DXNA 4Z55A 3TUCA 4OTFA 2PE0A 4U40A 5ETAA 4EOSA 3M11A 4IM3A 5J7HA 4EC9A 4EL9A 2BAJA 4FSRA 1PMUA 3DAJA 4H3BA 1HOWA 3FLWA 1UWJA 2QOOA 5CYIA 2UZOA 2ZV8A 4BN1A 4EHZA 4CGAA 2A0CX 3S00A 4L45A 2IW6A 5IA2A 3LCKA 3D94A 3PRIA 5BPYA 4JX3A 3E88A 2ZM4A 4MXAA 2Z60A 5IA1A 5KHWA 1G3NA 4AXAA 3MFRA 4EONA 4O84A 1PMEA 3UC3A 3ATSA 2W7XA 2X9EA 5CAOA 2PUIA 1VYWA 1KOAA 2YIRA 3W32A 1WVYA 5BUIA 5FXRA 4IB0A 5EW3A 4KABA 3GC8A 4ZY6A 3TNQB 3ODYX 3BBWA 3ORTA 4BF2A 4J52A 4MBJA 4JQ8A 5A6OA 4II5A 4QP3A 2V55A 1TKIA 4PL3A 1XJDA 3R01A 4XG6A 3FXZA 4EQCA 3S1HA 4ZTNA 4ANLA 4BDDA 3ORMA 4OGRA 3A8WA 3KULA 4FV7A 3UO6A 4APCA 3FKNA 3ROCA 2C0OA 1F3MC 1A48A 3BU5A 3E8DA 2EWAA 5FRIA 5C8NA 5M51A 1UA2A 4JOAA 4LOOA 4U97A 3F5XA 4F7NA 2OF4A 3NDMA 2BZHB 1XBBA 2V0DA 4GW8A 3ULZA 2WTCA 4CMOA 1PY5A 5CTPA 3FI8A 3AMYA 3SXRA 4TWPA 4KA3A 4FT0A 4IB1A 3TWJA 1Y6BA 2UZVA 4H05A 3DDQA 2BRMA 4NIFA 3QHRA 4O0UA 4X2JA 5A3XA 4DH5A 3MH0A 3GCUA 3RWQA 3I7CA 4E8AA 5E90A 2J9MA 3H0ZA 5JRSA 2QC6A 4NCTA 4GFGA 4F0GA 3QHWA 4C36A 4BDCA 4U81A 3DKGA 3N9XA 1PXNA 2UZBA 3V5WA 1OBDA 4FUXA 2I40A 3EN7A 1YOLA 4FV2A 3ZYAA 5AX9A 4ITJA 4UMQA 3LM5A 1Q8ZA 5A4LA 4G5PA 4NM7A 3HAVA 4XG3A 1P4FA 3O8PA 2RFDA 4EUTA 5EM5A 3R8MA 2XNBA 4B8LA 4C34A 3QQHA 4FV5A 5M55A 2BZIB 2HCKA 3EQFA 4C57A 5CSVA 3NEWA 5KCVA 5E8VA 4ZY4A 2B54A 5ETCA 2C69A 5DR6A 4D2SA 4G1WA 3NS9A 4A9TA 3AGMA 3P4KA 4UB7A 3BHVA 2QOQA 2Z8CA 2VO0A 3ENMA 5DGZA 4BHNA 5M08A 1KOBA 1WCCA 2Y9QA 1BI7A 1S9IA 3ZO4A 2W96B 3EQRA 2UW9A 3C4CA 4DA5A 1PXPA 1YDRE 4CMUA 3FMDA 3ZS5A 4AOTA 1H26A 3MJ2A 5JT2A 3PIYA 3IQ7A 3GCVA 3RM6A 4OTRA 5D41A 3QD2B 4FTQA 3RCDA 1FBNA 2VTMA 3ULIA 4J53A 4TWCA 5CT0A 2XF0A 3IW8A 4D9UA 4D4VA 4L9IA 2PK9A 4PDYA 5IQDA 2RFSA 1X8BA 5D9HA 5LJJA 4I5HA 4LV8A 1Z9XA 4PUZA 4EH4A 3QZIA 2HELA 5JMSA 3L8XA 3EOCA 3GVUA 2O63A 2ZDTA 3QQJA 3ROYA 3BIZA 2X39A 4A9SA 5BVOA 2YJSA 3VC4A 3EFKA 3HV6A 4TXCA 4ORKA 2WMAA 3E3PA 4JDIA 3OW3A 3OBGA 1GAGA 2JBOA 2LAVA 3TI1A 2IVSA 3OD6X 4FE2A 4AFJA 3AC5A 4C02A 3T9TA 4AS0A 1OPLA 2J0KA 2OFVA 4IHPA 3CKXA 2R4BA 3MB6A 2HWOA 2OIBA 4LFIA 4PDOA 1REJA 2H34A 3FZPA 1ZMUA 4NM0A 4WBOA 4ZSGA 4BTFA 3C5IA 4EK8A 3NNWA 4R3RA 2Z2WA 4ANOA 2VV9A 3EYHA 5IQCA 2XCKA 1QMZA 1Q8YA 1FMKA 2YABA 3IW7A 3WF7A 3ELJA 4YJRA 4PDPA 4FBXA 4RWIA 4Q9ZA 3N4TA 4E20A 2CKEA 3E7VA 5L8JA 3LFCA 3R1SA 1TQMA 4FVPA 4YPDA 5ANOA 5EI2A 2NRUA 2W1GA 3L9LA 3L8SA 2XBJA 5AR4A 3UQFA 5M09A 4XV3A 3WI6A 4JBQA 4S31A 4BVUA 2R0UA 1OIYA 4AZTA 1JKTA 4JR7A 5EDPA 3B2TA 2VTLA 3HUCA 4Z16A 2C68A 4FV3A 4J7BA 2ZV7A 5ANEA 2OLCA 4EOLA 4FT9A 5FGKA 3RZFA 3R2YA 3OUKA 5CAQA 4W9WA 2CGXA 3P1AA 4XV2A 3DK7A 4XYFA 3ZOSA 3EN6A 4BCIA 4IACA 3JY0A 5HO8A 3VW8A 4LG4A 3DK6A 4O22A 5DFPA 4FV8A 4YZMA 5C03A 4U45A 2B52A 3R2BA 3A7JA 4E6QA 4BHZA 1RJBA 3H0YA 4I24A 5DA3A 3DOGA 3HMPA 4O6LA 2YAKA 2HW7A 4AZSA 3F9NA 2R3IA 1CM8A 3JPVA 4GT4A 4IB5A 3TUDA 4O7YA 4RVLA 2J90A 1FVTA 3EL7A 2XKFA 3ZXTA 4E7WA 1JOWB 3TV7A 4L6QA 2PMIA 2QNJA 2V7OA 4WBBB 4KUJA 1EH4A 5M44A 4FSZA 1XH7A 1H07A 4L7SA 4JBVA 5A4EA 4HPUE 3S3IA 4K33A 5H3QA 2EXCX 3HUBA 5AUZA 5LCKA 3TNWA 5KKRC 2GDOA 2VTIA 3PP0A 4IQ6A 1GIIA 5I9VA 2IZRA 4NKSA 4AGUA 4FVQA 1ATPE 1LR4A 3FC2A 2C30A 2R9SA 3GQIA 4G3GA 2C4GA 4W9XA 5DE2A 4FTLA 2BPMA 4GFMA 4QTAA 5I9YA 2ITPA 4DG2E 1ZXEA 4J98A 1XWSA 1B6CB 2W06A 1PW2A 3RVGA 3W18A 3LCSA 3K2LA 3DBCA 4DCEA 4NU1A 3ATTA 2R3HA 2XEZA 4BWXA 1YI6A 1JBPE 3PZHA 4OW8A 1JLUE 1ZAOA 3I81A 4NFMA 4ACCA 1V0PA 5CU0A 4I6BA 1ZYDA 4OR5A 5IMEA 3IDPA 2DWBA 2ZYBA 4HJOA 5FQDC 5LVMA 5EHLA 2W4OA 4C0TA 1WZYA 4G31A 4ZTHA 2C1BA 5FP5A 4JDHA 4PF4A 4U42A 3REPA 2WTKB 3O17A 4L44A 4UMRA 1OGUA 3EYGA 3SC1A 2UZNA 3BZ3A 4TTHB 4XG4A 4EC8A 3LQ3A 5I0BA 1M17A 3OROA 4BDIA 5LOHA 2CN5A 3EQCA 2ACXA 1GZNA 2BHHA 4I6QA 3RPVA 1H00A 4CKIA 4IFCA 3F61A 2IZSA 3ZH8A 3EHAA 4BI0A 2WQNA 4UN0C 5AEPA 1U5RA 5BVWA 3H30A 1IAJA 1YWVA 4DTAA 5J87A 2W1DA 3DU8A 1PYXA 3TT0A 3FZSA 3LFSA 3MVMA 4KIKB 5CQUA 4BCGA 4O0RA 3QA8A 2EB3A 1OVEA 3MPMA 3WZJA 3FUPA 3ET7A 4JXFA 1FMOE 3R6XA 4FG7A 3V8WA 4K18A 2OFUA 4XV9A 4MBIA 4EK6A 3DFAA 4C8BA 3WIKA 5JGBA 2F7XE 1OIUA 2CCHA 3TNPC 4GSBA 4XLVA 5BMSA 4WNOA 5CU4A 5F4NA 4A4OA 5C4KA 3BHTA 2VUWA 3EZVA 3LFQA 3RK5A 5IH4A 3MFUA 4C58A 2B4SB 2XK6A 5IEXA 4XLIA 3R8LA 1GJOA 1Q61A 3DBQA 4FMQA 4R8QA 3G2FA 2B55A 4IDVA 4RA4A 2P3GX 4YC6A 5E1SA 3QKMA 3ENHA 2QCSA 2GNFA 3D14A 4QOXA 4A9RA 3VIDA 4DT9A 3BU3A 5AAFA 4RX5A 1IG1A 3NZ0A 5BVEA 4KWPA 5M4FA 3FMLA 4NJDA 1Y8GA 5BUJA 2G01A 3Q2MA 4GK4A 4EHVA 4EH8A 3TTIA 5IA5A 2YM3A 3TKIA 5HIDA 4QP9A 4Q5EA 2W05A 3HRBA 3DAEA 4M69B 5DH3A 3W1FA 1WBNA 2WXVA 4D28A 3CEKA 1SVGA 4AAAA 3IPHA 4D2WA 4X3FC 2PMLX 1APME 1BMKA 4E4MA 5AR3A 3E62A 2XEYA 3QCQA 3R0TA 3DXPA 3BE2A 4KB8A 2VTAA 4IADA 4UWBA 3PJ3A 5KE0A 4ITIA 4PNIA 4BDAA 2OIDA 2O5KA 4TZRA 4EOJA 2C5XA 3F2RA 3PVWA 4H3PA 2OWBA 3L1SA 4HNIA 3GC7A 3CBLA 3AC3A 3CPCA 4HW7A 5JFWA 2X81A 4DCAA 2W1IA 3QD0A 1ERKA 3FZTA 4FEVA 4ANSA 2DS1A 3R21A 2PVKA 4FZ7A 2J0MB 3V5JA 4D2VA 3HKOA 1DS5A 4RT7A 4OAVB 5IUGA 4QQTA 2OK1A 4UALA 3CXWA 4AACA 4QMLA 4AGCA 4OUCA 5F94A 4DG0E 4EH6A 4EK4A 4J97A 4O27B 4F64A 4AW1A 5J9YA 5IQGA 3LFAA 4XG9A 2HIWA 3FL5A 3B2WA 5HCYA 4O91A 2YA9A 3LJ0A 1AQ1A 4EEVA 1SVEA 2VTNA 3PVUA 4YJQA 4L7FA 3W33A 2UV2A 4JI9A 4U6RA 3VNTA 4QMNA 2J5EA 3L9NA 3OEZA 2YDJA 4BCOA 3BLHA 3CR0A 4Q9SA 4AUAA 3ANQA 3AOXA 5EYCA 5C8MA 5HU9A 3GOPA 4QTBA 3KL8A 5CZIA 1ZY5A 3D5VA 4S2ZA 5H9BA 4FEWA 5KUPA 2R3FA 4G17A 4V0GB 4PPBA 2FH9A 2WHBA 2WB8A 3CY3A 4GG5A 4M0YA 4QMXA 4I22A 3W10A 4CD0A 4RZWA 3D7ZA 3N4UA 2PTKA 5CQWA 2GNJA 3RPSA 3E7OA 3Q60A 2X8DA 3EH9A 4I6FA 4YJVA 3UNJA 3AQVA 2I6LA 4FGBA 3JYAA 3H9FA 3NCGA 2NO3A 3KULB 2PHKA 1W8CA 3E93A 4QMMA 3R9OA 5DYJA 2I7QA 3OC1A 5J95A 3ZFYA 3RKBA 4D1XA 2X0GA 4IMYA 2GNGA 3ODZX 5ANIA 3P9JA 3K5UA 5K4IA 4LMNA 3C0HA 4AW0A 3DB8A 2NPQA 3P7AA 5CZHA 2OH0E 3PDTA 4ZSAA 1RW8A 1U5QA 2F7EE 2X9FA 3MIYA 4RBLA 1YWNA 5AP3A 3WF8A 2B9FA 4FI1A 3BYUA 4D4YA 4Z3VA 1BYGA 3C9WA 2O3PA 2XJ2A 3PY0A 3ORXA 1GY3A 4NIFB 4Y83A 5I3OA 3R8PA 2W1HA 2DYLA 1BLXA 3DKFA 4RFZA 1LEZA 2QQ7A 3OUNB 1J1CA 4R7IA 4TYGA 3FJQE 3QZHA 4U79A 4YLJA 2YLEA 3PJ2A 2CMWA 5KMJA 4TN6A 4NZWB 5HVKA 4WNKA 5AV2A 3HZTA 4E5AX 1R0PA 4E73A 4ASZA 5L4QA 4JR3A 4O0SA 5EKNA 2W4JA 2PZPA 3OOMA 5IUIA 4AQCA 2E9NA 4G3DA 2W0JA 3FSFA 1H25A 3QXOA 3HGKA 3K3IA 2NP8A 3UIMA 4GKIA 2J6MA 5CSPA 2EU9A 2ITTA 2ERKA 3KMWA 4ZSJA 3SOCA 2GS2A 4TYHA 4U3YA 3LLTA 1YRPA 5ANKA 2X7GA 2JKOA 3NYXA 4CKJA 4PP9A 3ZUTA 1WBVA 3KXZA 2WMTA 4BCFA 1BL7A 5AP2A 5BYYA 4E93A 4BI1A 3KGAA 3NIEA 4W4WA 4AZVA 2ZV9A 2WO6A 4D4SA 3NWWA 5CLPA 4GU6A 4MNFA 3P78A 3BV3A 3PWDA 4P90A 1WVXA 4NJ3A 1J7IA 4FKGA 3VBTA 2PZRA 4QYYA 3LQ5A 4AG8A 3RPRA 4AN2A 4IBMA 3RK7A 3L9PA 4I5PA 2GNLA 2X8IA 4ZTMA 1O6KA 4KSPA 3C4FA 4DEBA 2PZYA 2VTRA 2R3OA 1Q41A 5JN2A 2CJMA 3NYOA 4L53A 3ORIA 5L6OA 3V04A 2YM5A 2OICA 4TWNA 4OTDA 5AUTA 4FEXA 2HY0A 4K6ZA 3GC0A 4JIKA 3FMEA 3LXLA 1E1VA 4QMTA 4ID7A 3PA5A 5CT7A 2OH4A 1DM2A 3LJ1A 4QP8A 4ACMA 4KIQA 5IQHA 1YXSA 4XRLA 4DN5A 1CMKE 3GU5A 5KMIA 2WMVA 1CDKA 5IMXA 3PIXA 1Q99A 4H36A 5JFVA 4TYIA 5IA3A 3BRBA 2B9HA 4M84A 4GEOA 4RQKA 1KSWA 2YCSA 5J1VA 5CVFA 4K9YA 4PPCA 5CEOA 3QQUA 2ZB1A 4BI2A 3Q5IA 5AR7A 4KBAA 4HYSA 5M4UA 3HVCA 1JWHA 2F7ZE 3OXTA 3OG7A 3OZ6A 4FG8A 4B8MA 3NVMB 3KK9A 3QWJA 3V6RA 2XJ1A 4ENYA 5AP7A 4BFMA 2PL0A 1LPUA 3TN8A 4EUUA 5D11A 5I9WA 3DK3A 1JKLA 1XH6A 2ETMA 1Q8UA 1OPKA 3BPRA 3C13A 4RJ3A 4UYNA 1W83A 3PVGA 3UZRA 4JVGA 4IE9A 5L8KA 3OBJA 3CTJA 2HWPA 2O64A 2XH5A 3A2CA 4FR4A 4E26A 5HX6A 4DLJA 1PKGA 4L46A 5IEVA 4K1BA 4ASEA 5EYMA 4J95A 2R7IA 3OFMA 1PKDA 4HGSA 1RDQE 2VN9A 4D58A 4TW9A 2XNNA 4U43A 5ETIA 5EQPA 4DYMA 2OSCA 1PXOA 2UW5A 2PVJA 4W4VA 3FWQA 4W4YA 5EK7A 5HKMA 1J3HA 3R7GA 4RWJA 3O2MA 2WU7A 3QUPA 4RC2A 4F1OA 3MVHA 2ESMA 2WTKC 1M14A 4IX3A 2RKUA 4KIOA 4YPSA 3FZOA 3F3ZA 4QP7A 5TKDA 4A9YA 4GCJA 3V6SA 2XJ0A 4FZFB 4U3ZA 3EFWA 3HP2A 4NT4A 3DNEA 4IVCA 2HZ4A 4IM2A 2Z7QA 4ZJJA 3BX5A 4YJSA 4U80A 1VZOA 3ZBXA 5IA4A 4M68A 4OLIA 5K0XA 4F9CA 2XYUA 2F2UA 2OKRA 1OKZA 4AT3A 1PXLA 4NW5A 4F6SA 3VS5A 3BI6A 2ITUA 2YM4A 3LLAA 2W99B 1K9AA 2R5TA 1AGWA 3F6XA 1DAWA 3UQCA 4CCBA 5KNJA 5L2SA 2FSOX 5ANJA 3RAWA 4F9WA 4ALVA 2QU5A 4ANBA 2WPAA 3BEAA 3QZGA 1MP8A 4YLLA 4AP7A 5EW9A 3UZPA 3SG8A 4PL5A 3GOKA 2G1TA 3WILA 5JSMA 4JL9A 4QPSA 4BZNA 2I0VA 5A4TA 2BFYA 1OKVA 3E63A 3GU8A 3NGAA 2BIYA 4IZYA 3GUBA 3JR1A 4OAUC 5KMOA 4OTGA 2C6TA 2Z02A 3AT2A 4GVJA 2BZKB 2JDRA 4N70A 3EFLA 3PXRA 5FBOA 4AE9A 4TWOA 4Y85A 4GYGA 4JLCA 4M13A 3WZKA 2GS7A 2OZOA 4YZDA 4FSNA 3UBDA 5BNJA 4AGWA 4HGEA 4FL2A 3S0OA 2XNMA 2Z7SA 2QG5A 4O1PA 3DGKA 3DXQA 2WQEA 3LPBA 3PRFA 4FSQA 4W4XA 1FGIA 3HA6A 5LMAA 4MXOA 4YUQA 2ITYA 3ALNA 4FZAB 3ACKA 1YXTA 4PMSA 4TYJA 3UVQA 5HI2A 4O7NA 3PLAE 3FY0A 2UZDA 3ORKA 5E7RA 4AA4A 4NTSA 3NUYA 4BKZA 1XHAA 3FDNA 3R7UA 5E1EA 3BYMA 2GU8A 3QTSA 5IF1A 5J9ZA 5HX8A 5EYDA 3DCVA 2WKMA 3F7WA 3E8NA 3O96A 3SDJA 1SNXA 1P4OA 2UW4A 2IZTA 4P5ZA 3R1NA 1P14A 1VEBA 2F9GA 4USDA 3PPZA 4UMUA 4O7LA 3F3VA 3U6IA 1DI9A 1XH8A 4UY9A 5HG5A 4AN9A 5AUYA 1ZOHA 3IS5A 2YITA 2CGVA 5DLSA 1V0BA 2AC3A 3MWUA 5HCZA 3TACA 3MH3A 3QLFA 4X3FB 3PSDA 4XS2A 2DQ7X 3BHHA 3EN5A 3NW6A 4XP3A 5LMKA 3ANRA 4D0WA 2YWPA 4RQVA 3SXFA 3KK8A 3NRMA 4Z9LA 2XNOA 3KB7A 4LOQA 2PMNX 3QTRA 3MS9A 5IEYA 3BQRA 3TJCA 4RIYA 4K2RA 3FI4A 3PJ1A 1RE8A 4ZAUA 1Y6AA 3VBQA 2PVFA 2QO2A 3ZEPA 3MY1A 2Y6OA 4ZOGA 4FUYA 2UVZA 3KC3A 1OIRA 5JZNA 4DE4A 1CKIA 4ZIMA 3KXGA 4IDTA 5F1ZA 2YDKA 3ZUVA 4I0SA 5CF6A 2GQSA 2IVUA 4FV4A 3CD8A 4BWKA 4E6AA 4DFBA 4JQEA 2VWYA 4H1MA 4RMZA 2OGVA 4QP6A 5CALA 1JQHA 5H8GA 5E8WA 1QCFA 5M06A 5HHWA 5CI6A 4CFFA 2OIQA 4FODA 3LXPA 5JKGA 4EOOA 5C26A 2X2KA 4I23A 3UP7A 3OS3A 4D5HA 2QVSE 2UVYA 4FKSA 4UXLA 3MJ1A 4Q5HA 4RIOA 2PUPA 4Z7HA 5LVNA 4YZCA 3W2OA 2NNWB 4XUFA 2PVNA 5ACBC 2J0IA 4HYHA 3TL8A 3NVKI 2YM7A 3Q5ZA 3O8UA 3GP0A 4OBOA 4QMWA 2GNHA 2RG6A 3Q96A 5IQIA 4L8MA 4KBCA 5T68A 3ZRLA 3AT4A 5FEQA 4MH7A 4NKAA 1GNGA 3EQBA 3ZRMA 2EXEA 1UNHA 2RIOA 3FMKA 3I0OA 3DBEA 2JDVA 1FQ1B 1ZZLA 2PZ5A 4YTFA 1KE7A 2PY3A 3HMIA 4TNBA 2VO7A 3PXFA 3I5ZA 2WTWA 3R8VA 4BDHA 2UVXA 2CNUA 2XZSA 2C5NA 4GU9A 4ANMA 3AD5A 3NNUA 4EHGA 4NSTA 4I92A 5A46A 4ZY5A 3VW6A 4BDFA 4C7TA 3GI3A 4NCTC 4AZWA 4DITA 5A9UA 2YCRA 2Y7JA 2H96A 3GQLA 4BTJA 4MQ1A 2C5YA 1QL6A 3QTQA 1ZOGA 2C6IA 2X6DA 5EOLA 5AV3A 2BUJA 5HO6A 5EOBA 3U9NA 4QPAA 5ITAA 1MRYA 5IG1A 3QX2A 3AT3A 1NT2A 3ZC5A 4ACGA 2HXQA 3CP9A 3MY5A 3FY2A 4G2FA 3ZONA 2JLDA 1ZYLA 4HPTE 4BIBA 4IX4A 1NA7A 5HZNA 5EI8A 1BUHA 2WMQA 2PVLA 4LGHA 2OJIA 2BDJA 2HXLA 4QP2A 3ORPA 1QPDA 4FTKA 5EW8A 1IA9A 3VBVA 2QO9A 1UU9A 2LGCA 4O2PA 4O82A 4PTCA 3R9RA 4YNEA 4WNPA 3GCSA 4AU8A 4RVKA 3JUHA 2X7OA 1G8AA 4BCJA 1J7UA 1OL1A 3VBXA 1ZOEA 4XMOA 3LMHA 3FXXA 5TE0A 2BRHA 5CY3A 3Q6UA 3EZRA 2OO8X 4CFXA 4WG5A 3VUKA 4PL4A 4QMYA 4UXQA 3G9NA 4BGQA 1U54A 4O96A 4L01A 4Y5HA 3JS2A 4TYEA 5TOZA 3W2RA 3W8QA 5JK3A 3FE3A 3QQFA 4FKOA 3F5GA 3UOKA 2HYYA 3DKOA 4GJ3A 3MDYA 3R00A 1H1PA 4MXCA 4DFYA 2PUNA 4OTWA 4ZJIA 2IVTA 2QOIA 1IR3A 3PXYA 2UZEA 5AUXA 4ARKA 3LHJA 4OTPA 3RHXA 4F9YA 4BDKA 2H9VA 3OWLA 4LQMA 4I4EA 4I4FA 3G0EA 5L6WL 4J96A 3HL7A 5HBEA 3M1SA 4M8TA 4MD8E 4IH8A 4O86A 1WBSA 2O8YA 5KHXA 3I4BA 2JDSA 4BR3A 4MWHA 2ITOA 4JT3A 1UVRA 3KMUA 4D2TA 4F1TA 4GVAA 3SLSA 2YERA 3DTWA 1JSUA 5CSHA 4ZJVA 1GZKA 5B7VA 4QYFA 3MB7A 5HD7A 2BR1A 3QU0A 1XH9A 4X6RA 4FIFA 4OT6A 2ZV2A 2QO7A 3RI1A 5E92A 2UW6A 1SVHA 3CC6A 3OTVA 4ACDA 4CCUA 4MX9A 3LFNA 4DFXE 4XP2A 2HZNA 3QRKA 4JBPA 3COIA 2HOGA 2CKOA 4DTBA 3PPKA 2OG8A 1NVSA 1DAYA 4IZ7A 5HE3A 2VNWA 3ITZA 3FLZA 3C1XA 2ZJWA 1W0XC 3GENA 3WBLA 5GINE 4WT6A 5AV4A 1REKA 3KVWA 2W1CA 3ZSIA 3OXIA 4PQNA 4J8NA 1M2PA 5JFXA 2XKCA 4O83A 2QD9A 3OHTA 4ZEGA 1XR1A 5BVNA 4FTOA 2F2CB 2VX1A 2X4FA 4KKGA 5CS6A 5AMNA 3R7VA 3SRVA 4B4LA 1UKIA 4AZEA 4EQUA 3KF7A 5CVHA 1BI8A 3L8VA 3FLSA 3U55A 3A61A 5LCJA 4LV5A 1O9UA 3HV7A 3HDMA 3MFSA 5CENA 2UZWE 4Q2AA 3ZO3A 4G6OA 4F7LA 2V62A 5KO1A 1GIHA 4JAIA 4NH1A 3WARA 2C0IA 3PG3A 1F5QA 2PWLA 3Q9WA 4RSSA 5GJFA 4LUDA 3FLNC 5B2KA 3QTUA 4QRCA 2C47A 4V05A 5HLNA 4O7WA 3EQIA 2GCDA 1QPJA 3FKLA 4P4CA 1V1KA 2JDOA 5EM7A 5CXZA 2G9XA 4I20A 3KXMA 4DBNA 4TRLA 4UWYA 4EYJA 4XV1A 2OJJA 3VQHA 4F6WA 1IRKA 3CLYA 2IO6A 3NUNA 4FSTA 5GZAA 2I1MA 2G15A 2QOHA 2WD1A 2R3LA 3R73A 2P33A 3V51A 3FZRA 5CWZA 1NVQA 3QCSA 2FA2A 2HW6A 3KRRA 4IC7A 3PXZA 5B2MA 3R1YA 2GFCA 5TF9A 2QODA 3F5PA 1H1WA 4M97A 4PP7A 4YR8A 5FDXA 4BY9E 3LIJA 4NK9A 4YJUA 2P4IA 4G3EA 2JFLA 4FTRA 3VO3A 3VRYA 3ZCLA 3P7CA 2J7TA 1FVVA 2A2AA 4IVDA 2J4ZA 4ZZNA 5A6NA 1H8FA 4HCUA 3M42A 5J5SA 3QA0A 4DEAA 2PMOX 4IWDA 3CE3A 5JFSA 2UZUE 4FSWA 2YIYA 4ZTQA 2J5FA 3QWKA 4F9AA 3GC9A 4OTQA 3TV4A 4WNMA 4O0VA 4EOQA 4HGTA 2WTIA 4PTEA 5AP6A 2Y4IC 3UMWA 2YDIA 3IW6A 3R28A 4YGAA 1Q4LA 1Q97A 3K5VA 1IAHA 3EL8A 4CTCA 2Y6MA 2CGWA 1HCKA 5JQ5A 4MF1A 3MY0A 1WVWA 3DV3A 3NUPA 4EYMA 2KTYA 2VWWA 2C3IB 2ITNA 1Y8YA 3R7IA 4BCMA 5LXMA 3FMJA 4PV0A 1MRVA 3HV5A 3CD3A 3A8XA 4C38A 2JC6A 4QQCA 3COKA 2ZAZA 4N4SA 1V0OA 4LGGA 4UWCA 4E1ZA 1E9HA 2YIWA 5A14A 2J0LA 5IH5A 4IJ9A 3W2PA 2YAAA 3PIZA 2IZUA 3Q32A 4QT1A 4CYJA 1ZMWA 2IW9A 1Z5MA 3E8EA 3UIUA 3LFFA 3G90X 3Q52A 2UW0A 5FD2A 3UJGA 2ITXA 4I5MA 5DRBA 2W5AA 4L67A 5AAGA 4J8MA 1H0VA 1ZY4A 4PDSA 5I5ZA 3UC4A 2YLFA 3OT3A 4O0WA 5K0KA 4V01A 3TTJA 5FTOA 5LMBA 2VWVA 3R22A 1NXKA 1Y91A 5KZIA 3DJ7A 1UV5A 4IX6A 1OIQA 4CQEA 5HU3A 3W2QA 4E6CA 4DF3A 4UZDA 2C5VA 3LFBA 3CKWA 2B53A 3JY9A 3MTLA 4B0GA 3OW4A 4LUEA 4N6YA 4RWKA 3SW7A 2RSVA 5IKWA 3T8OA 1A9UA 2PZIA 5H8BA 4DEGA 3O8TA 3EWHA 3TCPA 4A7CA 3KRJA 4L3PA 2IW8A 4J71A 3VS2A 3HMOA 5FXQA 5GJDA 1UKHA 2GTMA 3LM0A 4D0XA 4RZVA 2C6DA 3VHEA 3CIKA 3VVHA 1W7HA 2QR8A 3EIDA 1H01A 2RFEA 5AM6A 4B6LA 4B7TA 4QTCA 3OP5A 5F9EA 4NYEA 4FTMA 2EVAA 3QGYA 1OM1A 4HYUA 4QP4A 3DLSA 3OCTA 3ORNA 3ZM4A 3HAMA 3OXZA 1ZLTA 5AR2A 4ZK5A 4H1JA 3I6WA 4BICA 4CMTA 5L3AA 1KV2A 4CQGA 5DT4A 5CEQA 3LAUA 2PVHA 5LARA 3R63A 2YIXA 5HOAA 1W98A 3VS0A 1H1RA 3KREA 2IPXA 3KXNA 4MXYA 2FB8A 4JG8A 4BKJA 3FMNA 3IK3A 3O51A 4ZSEA 3WF6A 2VWUA 3NSZA 5C8KA 4FC0A 2IN6A 1O6LA 1PXIA 5EM8A 4RX8A 4K11A 4KS8A 2YACA 4HVGA 2JAMA 1M7NA 4Y95A 5CAUA 3BHUA 1Q62A 3IGGA 3LCDA 4MHAA 4BKYA 3Q2JA 2ITWA 4DT8A 3O0GA 1XKKA 3II5A 3VBYA 3Q9ZA 4HGLA 4ZS0A 4XH6A 3WF9A 3ZXZA 3KRXA 2OJ9A 4NM5A 4QP1A 3UOHA 2G2FA 2YJRA 3D5WA 3QZFA 4X6QC 5E8TA 5HLPA 1J1BA 2OXYA 4YSMA 4BRXA 1CKJA 2WMBA 3A4OX 1OKWA 3O71A 3PLSA 4D2RA 1AD5A 2REIA 2F57A 4DEDA 3EB0A 5HESA 5IPJA 2WOTA 2YM6A 3PJ8A 3D7TA 4IFGA 2CKQA 1R1WA 4USEA 3V5TA 2A27A 3PY3A 3MBLA 3A60A 5TR6A 3RAHA 4ZXTA 4FZDB 3VN9A 3BWFA 2BCJA 4NFNA 3R30A 4K0YA 1MUOA 2XS0A 4AW2A 4PX6A 1JVPP 5I4NA 4EKKA 3KQ7A 3MW1A 5HTCA 4F6UA 4XRJA 3VUTA 3CCNA 4G6LA 4RIYB 4O7RA 4C2VA 1W84A 2FO0A 2V22A 2BALA 2VWIA 2J51A 4FSUA 4N57A 2ZOQA 3QRUA 2QHMA 3BLRA 3NX8A 4NUSA 5AUVA 1UNGA 2DUVA 2V7AA 3R7EA 2R3MA 3R9NA 5M57A 3BGPA 2EXMA 4HZRA 4M12A 1MQBA 3AMBA 4QTDA 2GPHA 3MPTA 4O0XA 1H27A 4FNXA 3OTUA 2WIHA 4C4IA 3ZLWA 5J5TA 3VUIA 5E8SA 3P08A 4N0SA 4O7TA 1W82A 4ALUA 4G3CA 3GNIB 4BDJA 1GZ8A 3AXWA 2QURA 4F70A 3I6UA 4MD9E 3SXSA 4PMTA 1WBPA 3V8TA 2R64A 3IKAA 5AIRA 4EH3A 2VWZA 1ZMVA 4GK2A 2HY81 2O2UA 4IAZA 3DY7A 3FHRA 1HCLA 4DEHA 2WU6A 4I0RA 3V3VA 5FDPA 4JQ7A 3L8PA 1OPJA 4FL3A 2XKEA 4M7IA 4QPMA 3BYVA 5HCXA 3TNHA 4TL0A 5M53A 3TUBA 2UUEA 3KKVA 4P2KA 2C6EA 3HX4A 4WO5A 5CI7A 2ONLA 2VWXA 3CJFA 3OY3A 4FKVA 2AUHA 5BX0A 1E1XA 3BCEA 3PA4A 2WFYA 4MXZA 3UNKA 4RA5A 4EK3A 2C1AA 2VU3A 2R3GA 2Q83A 4BBFA 2PVRA 4DH7A 2BZJA 4GRBA 5FLFA 3NAXA 5EHOA 2CHLA 3PPJA 2FSTX 1B39A 3KF4A 3BELA 3NUXA 3BKBA 5HVJA 4BYIA 3MSSA 4ZTRA 2GNIA 4JG7A 1OI9A 1KE6A 2YN8A 3LE6A 3DS6A 3K3JA 4MWIA 4RWLA 2OI4X 5DEYA 1NY3A 2PYWA 3ORLA 4IAFA 4L3LA 2QOKA 3AC1A 3MESA 5BMMA 2BRGA 3ZTXA 2WMSA 4APPA 5J1WA 4FKPA 3AD4A 1R0EA 2R3QA 3VS1A 4KS7A 4XX9A 4XBUA 3HEGA 4ANNA 4BC6A 3QTXA 2IWIA 4KIPA 3G6HA 2ZM1A 1VR2A 5EKOA 3NYNA 5DWRA 1Q24A 4F1MA 3GB2A 3O7LD 2XIXA 3LQ8A 5LWNA 3UO5A 4LYNA 5IZFA 4ONAA 1FINA 2JKQA 3KVXA 4HCVA 3GFEA 5HEZA 5LVLA 2J2IB 3VUDA 3S95A 3FL4A 4YTHA 4WKQA 2OU7A 3NPCA 4ZSLA 4KKEA 4MF0A 4C3FA 2VD5A 4YNOA 4CFUA 2I0HA 5E9EA 5AWMA 4MVFA 4O38A 3VAPA 3G15A 3WE4A 3W2SA 3FQSA 4FKTA 4FTIA 3V5QA 4D1ZA 4EBVA 3UPXA 3MI9A 1XBCA 4CRSA 1ZYSA 3TDWA 3DJ6A 1R3CA 3I7BA 4YO4A 3MTFA 5K5XA 3QKLA 2B9JA 1U54B 2XBAA 3ZZEA 4BCQA 5DMZA 4KNBA 5BUEA 5L2IA 3DB6A 3NUAA 3DPKA 1BL6A 1WBWA 2XKDA 3DT1A 3H9RA 3EQDA 2R0IA 5CEIA 1RQQA 2XNPA 4GK3A 3S4QA 2VNYA 4AT5A 5HE0A 2W5BA 4BTMA 2BKKA 5DG5A 5CF8A 1BKXA 4EOPA 3ZM9A 3DJ5A 3U87A 3LJ2A 3U6HA 3OEFX 3DQWA 1UU8A 3B8QA 3SX9A 3VS3A 4EJNA 5AAEA 5HIEA 4NL0A 5I9ZA 3PTGA 3FPMA 4FSYA 4A06A 3RBWA 3PWYA 2ZDUA 4CZUA 5D7VA 2IVVA 3KU2A 4PMPA 3DA6A 2YFXA 5CU6A 3C0GA 5ETFA 3ETAA 4JJRA 1Z57A 2HZIA 3EN9A 4QMPA 4IB3A 4WOVA 3UQGA 4DGOA 5GJGA 5AA9A 2R3PA 4Y72A 2RF9A 4E6DA 3GU6A 3QTIA 3DBDA 2QOFA 4NWMA 2VRXA 3HV3A 3BBTB 4E3CA 5K3YA 4BCPA 4D9TA 3Q04A 2C6KA 3FPQA 3QC9A 3VF8A 4BWPA 3MIAA 2XIZA 1SYKA 3DKCA 1S9JA 4QD6A 5DI1A 2WQOA 4CG9A 3GU4A 4OBQA 2XYNA 3EKKA 4G9CA 3Q4UA 3A4PA 2VO3A 4IVAA 4LGDA 5BVKA 3RPOA 4E5BA 5JGDA 3ZZWA 3P7BA 3QXPA 4DEIA 5LVPA 5EDQA 2XM9A 4W8EA 3E64A 4FTNA 3R83A 1YHVA 2VX3A 2CGUA 1OB3A 2VTSA 3BYSA 3G5DA 2WEIA 2FSMX 3SA0A 4L3JA 4BIDA 4R3CA 5FBNC 4XBRA 3MH1A 3ZDUA 4FOCA 4BZOA 5HGIA 5HBJA 4KIKA 4DC2A 4O1OA 1GOLA 5T6KA 3SRVB 4DGNA 5HORA 4TNDA 2CDZA 4CV9A 3WIGA 4R5SA 4C4JA 4V04A 1JNKA 4WUAA 5EQEA 2GHLA 2NRYA 2UW3A 4ACHA 4CKRA 4PRJA 2YM8A 3FQHA 4CZTA 5L2TA 3D2KA 5CSWA 3RJCA 3AG9A 4IWQA 2H6DA 3PE1A 4AGDA 2BKZA 4I3ZA 2XB7A 3RMFA 1ZYJA 2F4JA 4I41A 1KE8A 4M0ZA 3JVSA 2JAVA 4O2ZA 3UOLA 4DBXA 4U0IA 2B7AA 2JFMA 2Y4IB 3KRLA 3MV5A 3QUEA 3RK9A 5K9IA 5CASA 2VX0A 5DR2A 3WYXA 2W9ZB 5IISA 1YHSA 3LCOA 4JNWA 3ZSHA 2CNQA 4FEUA 3O7LB 2WMXA 3G9LX 3FYJX 5HG7A 5EH0A 3PUPA 4FKJA 4QYGA 3GXLA 4G34A 4WIHA 4BBEA 3NYVA 4YC3A 4YZ9A 3QYWA 3O23A 4JS8A 3CSVA 4O81A 4I21A 3DAKA 4FVRA 4QMUA 3VBWA 3LMGA 4FKLA 2XK9A 5CAPA 2GSFA 4YHJA 2X4ZA 4EZ3A 5EHYA 4YMJA 1YDSE 2W17A 1H1SA 4XHKB 4ZLOA 3F69A 3PSBA 5DR9A 4GKHA 4D55A 5DBXA 2CN8A 3QRTA 5IQAA 1WFCA 3FZ1A 5L6PA 1CSNA 4U44A 5CEPA 4UZHA 3D4QA 3M2WA 5EG3A 3UG2A 2P55A 3UPZA 2BHEA 1U46A 3TXOA 4O7SA 5IDPA 2R3JA 4RFMA 3OMVA 3Q6WA 2AC5A 2ERZE 5HNBA 4GIHA 4YHFA 3A7FA 4RC4A 3NAYA 4IWOA 2X7FA 4DEEA 3UGCA 3RPYA 2JBPA 2BROA 3SV0A 3NW7A 3Q3BA 4YC8A 3F2NA 4ZZOA 5AUUA 2GQRA 4GT3A 4ALWA 4RVMA 1ZZ2A 4FIEA 3RNYA 1OKYA 4IC8A 2CPKE 3UIXA 3VS7A 3TDVA 4IAIA 2UZTA 3KCKA 3R7YA 3R9DA 4ZTSA 2VTOA 3ZEWA 1K3AA 3D5XA 5AV0A 4YTIA 1UWHA 3EN4A 2BFXA 4I6HA 4BGHA 4DH1A 4M67A 5EFQA 3RINA 3GCPA 2OBJA 2O65A 2VTJA 3PVBA 2FSLX 2VWBA 1Q8WA 4MAOA 1KV1A 5KMLA 1ZYCA 5HNGA 3HNGA 4IAYA 4HCTA 1M2QA 3BYOA 4V0GA 3ACJA 2KULA 2JDTA 3KA0A 1Y57A 1WBTA 4YJOA 5C9CA 4EQMA 5LQFA 5FTGA 4G3FA 4H3QA 5AJQA 1YXXA 3C4ZA 5AUWA 2HENA 2YCFA 4LRKA 4CT1A 5CF5A 3ZDIA 4F99A 1L8TA 2EUFB 3QAME 3QRJA 3NUSA 3CS9A 3EQHA 3BU6A 3F3UA 3EQPA 5E91A 1I09A 3RP9A 1UU3A 4LOPA 4BZDA 4QMOA 5IDNA 4BTKA 2PSQA 3VS6A 1PXMA 5LMKC 3Q53A 3UIBA 2P2HA 5DHJA 4QMZA 5B0XA 4ERKA 3CPBA 4MYGA 2RGPA 4D2PA 4O0TA 3HP5A 4QYEA 3TZ7A 2C3KA 4CFVA 3EJ1A 5BYLA 3I60A 4AE6A 2OXDA 4RIXA 1PF8A 3FI2A 4WRSA 4YTCA 4F0IA 2CNVA 4LRMA 4I93A 2IG7A 3R1QA 1Q3DA 4R1YA 2QLQA 3F2AA 1XBAA 2XIKA 1P2AA 4XG8A 4EH5A 4ZMEA 5IQEA 4AT4A 1YWRA 3WF5A 3IOPA 3QD4A 4JDJA 4XEYA 3CQUA 4KRDA 2ZMCA 1FVRA 5FUTA 1GIJA 3CY2A 4KAOA 3V5PA 4F63A 4DTKA 2WGJA 2Q0BA 3Q9XA 4DH3A 1SZMA 3E92A 4TY1A 1H24A 2PVMA 4PTGA 3BV2A 3TM0A 2GS6A 4B99A 3SQQA 5AA8A 3IDBA 5DPVA 4MNEA 4MQ2A 4J99A 1H4LA 2UW7A 3OT8A 1YXVA 4FNYA 3U4UA 4BL1A 4XP0A 4DGGA 3I1AA 4LI5A 5F95A 1H08A 2C0TA 2ETKA 4FIJA 3LXNA 4ZP5A 4D1SA 5K4JA 3P86A 4FTCA 4ZMFA 3QGWA 3V5LA 4C4FA 2C3JA 1JAMA 3D7TB 3RTPA 2VGPA 3ERKA 1Q8TA 4CTBA 1KE9A 3WZDA 1JKSA 4JRVA 3C5UA 4R7HA 3F7ZA 1FOTA 4C59A 4FTTA 4YU2A 2FVDA 2OW3A 5M56A 2WNTA 2XA4A 1PJKA 3R7OA 2WTDA 2J0JA 3D9VA 3FMMA 3UO4A 4BIEA 1P5EA 3UYSA 3UMXA 3ZRKA 4UX9A 3NLBA 5FM2A 3CQEA 5D10A 5EM6A 5C27A 3PP1A 4XG7A 4O7VA 2PVYA 5FXSA 2A1AB 2XM8A 4QTEA 5JEBA 4Y5QA 2VTHA 4WSYA 4A07A 1MQ4A 5EQYA 3LXKA 1YHWA 5HG8A 4E5WA 3COHA 4S30A 4DGMA 5B2LA 3P0MA 2VAGA 4PMMA 3MVLA 1URWA 3VF9A 4M14A 3QC4A 2BAQA 4HNFA 3FV8A 3FYKX 3QTZA 3A7HA 3CTQA 4IAAA 3OCGA 4QNAA 4MXXA 5J8IA 5C4LA 5EDRA 3RWPA 3FC1X 3ZMMA 5ANGA 3OY1A 4N6ZA 4FTAA 2OZAA 5HE1A 3ORZA 3ZLSA 2OF2A 1WMKA 4AFEA 4UBAA 4RX7A 1B38A 4C62A 3DQXA 5EYKA 3QBNA 4G16A 3SKCA 5IH6A 5A54A 3HDNA 4FV1A 4QQJA 3AMAA 4GV1A 3SW4A 3VQUA 1R78A 3LFDA 4E4NA 2EB2A 2PUUA 5CEKA 3MGYA 4FNZA 1CTPE 3A62A 3R04A 3R02A 3OF0A 4MD7E 4FEQA 4TYHB 3QF9A 5M4IA 4WA9A 5AM7A 4XOZA 2ITQA 3G0FA 5G6VA 4RG0A 3T9IA 3UZTA 4WD5A 4BDBA 4EBWA 4YZBA 3TV6A 4WSQA 3KXHA 4GUBA 4F65A 1BX6A 4M15A 4IVBA 3OWJA 5GZ8A 4R7BA 2B1PA 5FP6A 2I0EA 3C7QA 4L00A 5CU2A 1K2PA 5FTQA 3UTOA 4AWIA 4LRJA 1T46A 3SHEA 4C33A 3VUGA 4EI4A 4YSJA 3BGZA 4CEGA 3F3WA 3KN6A 4U41A 4C37A 4C2WA 3ZBFA 3D0EA 4G5JA 1L3RE 3RAKA 3PXQA 5CF4A 1OL6A 5BQ0A 2CKPA 3W55A 2BILB 1OZ1A 3NUUA 3UG1A 4AA5A 2CSNA 4EH7A 4RIWA 5HQ0A 4YURA 4FIIA 3U8WA 4PPAA 4EH2A 4AOIA 1YQJA 4CLIA 4G6NA 1M7QA 4KBKA 4RJ4A 3HLLA 3QFVA 4KSQA 4FZ6A 4DG3E 4ANQA 4LM5A 2ITZA 3HMMA 5AR8A 5AP5A 3IW4A 3MPAA 4BGGA 2JEDA 1YXUA 5CSXA 2QOCA 4EHEA 4RPVA 5GZ9A 1TQPA 3R9HA 5IA0A 2X2LA 5BYZA 2WIPA 3OCSA 1OUKA 4IANA 4PWNA 2R7BA 3F66A 4IZ5A 3NR9A 5DNRA 4UMPA 1WAKA 4S33A 5CVGA 2I0YA 2YZAA 2JKKA 4X3JA 4L52A 2XIRA 3WOWA 3NNVA 4F7SA 1PXKA 4FKIA 3IO7A 2J50A 3PZEA 4IX5A 4O21A 4AA0A 3BQCA 4DGLC 4ZLYA 3VHKA 4YJNA 1PRYA 4DFUA 2E9OA 2PPQA 4KD1A 3W8LA 2FYSA 3DBFA 2UZLA 4QNYA 3CQWA 3CTHA 3SVVA 1TQIA 3U9CA 5IU2A 3QX4A 4U5JA 4X2KA 3HYHA 3Q4TA 4RLLA 3C51A 1UU7A 5CU3A 3AD6A 4S32A 4PY1A 5KZ0A 2VO6A 4EJ7A 5C01A 4R5YA 3R71A 3PFQA 4EOMA 3G33A 2WQBA 2WTVA 3FBVA 4WG3A 3ZU7A 5I9UA 2JIVA 3UP2A 4O0YA 4C35A 1YI3A 4IAKA 2QR7A 4D4RA 2E2BA 5FM3A 5AP1A 2F49A 3FMHA 3TZ9A 5J79A 3LCTA 4YZNA 2WTJA 4FKQA 3GBZA 1QPCA 4FG9A 3MH2A 3PXKA 5D7AA 4JDKA 1IEPA 2XNEA 5GIPE 3PY1A 4UV0A 5CAVA 2ZVAA 4ZTLA 4RFYA 4EK5A 4XCUA 5HO7A 4EOIA 1YW2A 3NIZA 4FV0A 3TKHA 4BYJA 1M52A 2BDWA 2QOLA 3ZO2A 4BCNA 4BDEA 2Z7LA 4FKUA 1ZARA 2W4KA 5G1XA 5L2WA 5AFVA 3FSKA 3OCBA 4GUEA 4EH9A 4ASXA 2V5QA 4G9RA 4B9DA 4FT7A 4A4LA 4FV6A 4P5QA 3F3TA 3WE8A 4YHTA 2XK8A 4JG6A 2BRNA 3D2IA 3TZMA 4ERWA 2JITA 3HRCA 3CGFA 4I0TA 2HK5A 2YHVA 2PU8A 1YDTE 2WMRA 4X3FA 5DN3A 1Q5KA 3MA6A 4BCHA 4H58A 4IW0A 2C6OA 2IJMA 2XK7A 3VJOA 1SM2A 4MK0A 4K77A 4IIRA 2H8HA 4EZ5A 4ZS4A 3RALA 4IM0A 4X21A 4JBOA 4DFLA 2OJFE 4WRGA 3GT8A 4TT7A 5J7BA 3O50A 4KKHA 5JH6A 5TO8A 1U59A 3HA8A 4CXAA 5HG9A 4MKCA 3UNZA 2R2PA 4C4GA 2ZMDA 2B9IA 4MBLA 2WMUA 2XP2A 2JKMA 2QHNA 4EZ7A 3KN5A 3R8UA 3L9MA 4HVIA 2WAJA 2CLXA 3AC2A 4IXPA 3DFCB 2E9UA 3OOGA 3VWAA 1ZWSA 2PULA 5H2UA 3ZUUA 4CRLA 3QYZA 4QMQA 3EQGA 3QCYA 3QLGA 3HECA 3QQGA 3H4JA 3IGOA 1JSVA 1JPAA 3ALOA 4CSVA 4Y46A 1T45A 5KBQA 4MEDA 4GS6A 4C4EA 2XVDA 4RGJA 4FK3A 2GTNA 4Y73A 2VTPA 4FSMA 3F88A 2ZB0A 3VS4A 4BDGA 3UDBA 3IOKA 5T3QA 3PG1A 3D15A 4CZYB 2YZLA 5HTIA 2WEVA 4NEUA 2GHMA 3Q9YA 2ITVA 5HE2A 1U4DA 4E4XA 5A4CA 2ZM3A 2WZJA 4F08A 3VULA 4FOBA 3LMIA 2YWVA 4EOKA 2B0QA 1OUYA 3GFWA 3HV4A 1URCA 4M3QA 3ID6C 1KWPA 1SNUA 2FUMA 2P2IA 4NM3A 4AF3A 1TVOA 1UNLA 1YVJA 4CYIA 2XRWA 1OMWA 4F0FA 3ZLYA 5CNOA 1YOMA 3BWJA 3COMA 3V8SA 2C6MA 1OBGA 3AC4A 3GCQA 3RHKA 2C3LA 3E8CA 4HYIA 3PSCA 3BE9A 4I94A 4HOKA 3R8ZA 5JZJA 4EWQA 2W9FB 2XNGA 4JRNA 4DH8A 2YISA 2Y8OA 5E4HA 4CFNA 3PJCA 5ACKA 5C1QB 3KMMA 5E8UA 4LL0A 4FYNA 4GT5A 4A9UA 5HTBA 1KE5A 5AADA 5E8ZA 5IQFA 1ND4A 2X6EA 3F5UA 3IDCA 3LOKA 3OWKA 3KXXA 5CNNA 4L43A 3MA3A 3NNXA 4X0MA 2Y4PA 5HBHA 4QMVA 3ZHPC 3QUDA 4DFNA 3RGFA 3TZ8A 4C4HA 5AP4A 2XMYA 1MRUA 3IONA 2XIYA 4YLKA 4CFWA 1VYZA 1G5SA 4X2NA 1J7LA 4YBJA 2JIUA 4J1RA 3V01A 4JX7A 4DHFA 5BVFA 3P79A 1PYEA 3SOAA 1XO2B 3C50A 1OL7A 4C3PA 5M4CA 2RL5A 3TEIA 1NVRA 5CX9A 3EKNA 5DEWA 4RJ8A 4UYAA 4GH2A 4FYOA 3N51A 2C5OA 4R3PA 4HVHA 4F09A 2QI8A 1VJYA 2HZ0A 3BHYA 4FKRA 4FTJA 2BTRA 2VZ6A 4RIXB 3ZSGA 5IUHA 2BVAA 3FQEA 4U9AA 3TKUA 5E8YA 4CV8A 5H8EA 4ASDA 1H1QA 1KUTA 2W1ZA 3DLZA 3I0QA 4U7ZA 4WHZA 5LVOA 3KEXA 2HAKA 5JGAA 3RM7A 1NW1A 5AIKA 2G2IA 4QYHA 3SD0A 3MFTA 3P5KA 4FV9A 3TG1A 3IECA 5HIBA 1FPUA 3VUMA 4RJ6A 4I1ZA 3LKMA 3HMNA 3JXWA 4FX3A 2QONA 2W5HA 3A99A 3FAAA 5FWKK 3QALE 1WBOA 4F7JA 4RX9A 5BVDA 3RZBA 2AYPA 2X8EA 4YP8A 1J91A 2X2MA 3THBA 4MNEB 4GJ2A 4D5KA 2FGIA 4UEUA 1PMVA 4FF8A 2QKWB 4FICA 4E4LA 4HVDA 5KMKA 3LVPA 4R78A 4GIIA 1I44A 2BTSA 4F9BA 2ONLC 4OBPA 4F4PA 4CLJA 5KX8A 3VRZA 3UOJA 3FHIA 5GHVA 3C4XA 2GMXA 3DTCA 3NCZA 3ZC6A 3SAYA 3UYTA 3CGOA 5E8XA 5L2QA 2XK4A 2ETRA 1QPEA 4XOYA 5D1JA 3C4WA 3WYYA 3GGFA 3G51A 3KRWA 3OWPA 3MN3A 3DZQA 3QL8A 1LEWA 4IZAA 3POOA 2BDFA 4AX8A 2GFSA 2VTQA 2XCHA 3K54A 5CXHA 4NTTA 3UVPA 3UE4A 4FKWA 3FXWA 4RLKA 4FIGA 2UW8A 5CEMA 2GHGA 3E3BX 3DDPA 2PE1A 3PA3A 5AR5A 4O6EA 4QQ5A 3ZO1A 5KMMA 4RC3A 1H0WA 2JIIA 4YO6A 4DLIA 2O0UA 4C3RA 5JQ8A 4LL5A 4R1VA 3U4WA 2YEXA 3SGCA 4TPTA 3NW5A 2BRBA 3KFAA 4AZFA 3IG7A 3B8RA 5IQBA 3SG9A 4HZSA 3T3VA 3E87A 4RVTA 3I79A 1ZRZA 1OITA 4RJ5A 3C4EA 4BB4A 3ZLXA 4DINA 2R3NA 3HRFA 3T3UA 3WZUA 4QMSA 5TT7A 4IJPA 3UVRA 1A06A 3RCJA 3JVRA 5LWMA 3U54A 2R3KA 1M2RA 1YKRA 4FNWA 2Y0AA 4YJPA 1LP4A 3AC8A 2JGZA 2W1EA 3QRIA 1CKPA 3I5NA 3P23A 3WZEA 3CJGA 1LUFA 2OZAB 4ENXA 2X1NA 3FLYA 1PXJA 2A19B 5DIAA 2WELA 2JD5A 5FEDA 5DVRA 2Q0NA 3KCFA 1DI8A 5AP0A 4L42A 2W1FA 2G2HA 4M66A 1YI4A 4JIAA 4RRVA 2QU6A 2GQGA 3POZA 3D5UA 4KRCA 2WOUA 2Z7RA 3Q4ZA 4OTIA 3IW5A 4FTUA 1PHKA 3QQLA 4R77A 4EKLA 1JKKA 1OL2A 3F82A 2XK3A 3MYGA 1G8SA 3H9OA 4L68A 3H10A 3A7IA 2OXXA 4NW6A 4HVSA 5KBRA 3QQKA 3EFJA 3U6JA 4YBKA 1H28A 4ITHA 2BMCA 3PYYA 3Q4CA 5GNKA 4S34A 4XNEA 3ZFXA 2QG7A 4IEBA 4MCVA 3PE2A 4UMTA 2VTTA 3C0IA 3QD3A 4ZZMA 3U51A 3FLQA 4GG7A 2BIKB 2BAKA 5DOSA 4X7QA 5DT3A 5L8LA 3BLQA 5ICPA 3G6GA 4IWPA 4USFA 5CANA 4RJ7A 4MTAA 2XRUA 4FK6A 4KINA 4GYIA 2CLQA 2SRCA 4EORA 5DT0A 5HD4A 5KKRB 2A4LA 5AX3A 2XUUA 1R39A 5HICA 2E9VA 4TKSA 2C6LA 5F20A 1STCE 3VJNA 5A4QA 5FEEA 1JSTA 2WQMA 3W2CA 4CNHA 5HLWA 4FL1A 4RIWB 3QTWA 5HNIX 4WUNA 4PNKA 2RG5A 4QO9A 4GL9A 2YCQA 4R6VA 4BCKA 4CFMA 5J9LA 4GMYA 4CG8A 2OJGA 3KY2A 2YIQA 4LMUA 4WG4A 1SMHA 5I9XA 3FKOA 2E9PA 2QLUA 4YJTA 4EWHA 1FGKA 4AN3A 3BEGA 5FG8A 4CVAA 4K8AA 3FEGA 4ZLZA
chains in the Genus database with same CATH superfamily
4X2FA 4Y8DA 3VUHA 4CT2A 3TNIA 3LFEA 1OL5A 3A7GA 4XG2A 3W16A 4P7EA 4W8DA 4F78A 4O4EA 3TIYA 3ZFMA 4Z7GA 4FIHA 2XAOA 3LW0A 4FJVA 3LZBA 2P0CA 3D83A 3GEQA 5D12A 5DRDA 4DAWA 4AOJA 5GIOE 4M69A 4FT3A 4FA2A 3EMGA 2QOBA 3TJDA 5K5NA 3S2PA 4O7ZA 4DHIB 1XH5A 4FT5A 3H3CA 3RNIA 3GU7A 1XH4A 3QKKA 4AW5A 1PMNA 5AV1A 4H39A 2RFNA 5HVYA 3MVJA 2PE2A 1IASA 3E5AA 4U8ZA 2R3RA 3QCXA 1YOJA 5ANDA 1Q3WA 5M07A 3N4VA 3NMUF 3OVVA 4BBMA 1OECA 5JRQA 1O6YA 4OT5A 1XQZA 3DZOA 2QKRA 2WMWA 4GFOA 3TIZA 3DNDA 3RAIA 3FI3A 4DFZE 1GZOA 4FGRA 4X2GA 4A4XA 3AGLA 2CCIA 4C61A 4OTHA 4JAJA 5I3RA 3UODA 4XJ0A 1IA8A 1F0QA 2VGOA 5EI6A 5KMNA 3BGQA 4I5CA 3DXNA 4Z55A 3TUCA 4OTFA 2PE0A 4U40A 5ETAA 4EOSA 3M11A 4IM3A 5J7HA 4EC9A 4EL9A 2BAJA 4FSRA 1PMUA 3W0MA 3DAJA 4H3BA 1HOWA 3FLWA 1UWJA 2QOOA 5CYIA 2UZOA 2ZV8A 4BN1A 4EHZA 4CGAA 2A0CX 3S00A 4L45A 2IW6A 5IA2A 3LCKA 3D94A 3PRIA 5BPYA 4JX3A 3E88A 2ZM4A 4MXAA 2Z60A 5IA1A 5KHWA 1G3NA 4AXAA 3MFRA 4EONA 4O84A 1PMEA 3UC3A 3ATSA 2W7XA 2X9EA 5CAOA 2PUIA 1VYWA 1KOAA 2YIRA 3W32A 1WVYA 3PFYA 5BUIA 3W0RA 5FXRA 4IB0A 5EW3A 4KABA 3GC8A 4ZY6A 4O4CA 3TNQB 3ODYX 3BBWA 3ORTA 4BF2A 4J52A 4MBJA 4JQ8A 5A6OA 4II5A 4QP3A 2V55A 1TKIA 4PL3A 1XJDA 3R01A 4XG6A 3FXZA 4EQCA 3S1HA 4ZTNA 4ANLA 4BDDA 3ORMA 4OGRA 3A8WA 3KULA 4FV7A 3UO6A 4APCA 3FKNA 3ROCA 2C0OA 1F3MC 1A48A 3BU5A 3E8DA 2EWAA 5FRIA 5C8NA 5M51A 1UA2A 4JOAA 4LOOA 4U97A 3F5XA 4F7NA 2OF4A 3NDMA 2BZHB 1XBBA 2V0DA 4GW8A 3ULZA 2WTCA 4CMOA 1PY5A 5CTPA 3FI8A 3AMYA 3SXRA 4TWPA 4KA3A 4FT0A 4IB1A 3TWJA 1Y6BA 2UZVA 4H05A 3DDQA 2BRMA 4NIFA 3QHRA 4O0UA 4X2JA 5A3XA 4DH5A 3MH0A 3GCUA 3RWQA 3I7CA 4E8AA 5E90A 2J9MA 3H0ZA 5JRSA 2QC6A 4NCTA 4GFGA 4F0GA 3QHWA 4C36A 4BDCA 4U81A 3DKGA 3N9XA 1PXNA 4BJJA 2UZBA 3V5WA 1OBDA 4FUXA 2I40A 3EN7A 1YOLA 4FV2A 3ZYAA 5AX9A 4ITJA 4UMQA 3UDTA 3LM5A 1Q8ZA 5A4LA 4G5PA 4NM7A 3HAVA 4XG3A 1P4FA 3O8PA 2RFDA 4EUTA 5EM5A 3R8MA 2XNBA 4B8LA 4C34A 3QQHA 4FV5A 5M55A 2BZIB 2HCKA 3EQFA 4C57A 5CSVA 3NEWA 5KCVA 5E8VA 4ZY4A 2B54A 5ETCA 2C69A 5DR6A 4D2SA 4G1WA 3NS9A 4A9TA 3AGMA 3P4KA 4UB7A 3BHVA 2QOQA 2Z8CA 2VO0A 3ENMA 5DGZA 4BHNA 5M08A 1KOBA 1WCCA 2Y9QA 1BI7A 1S9IA 3ZO4A 2W96B 3EQRA 2UW9A 3C4CA 4DA5A 1PXPA 1YDRE 4CMUA 3FMDA 3ZS5A 4AOTA 1H26A 3MJ2A 5JT2A 3PIYA 3IQ7A 3GCVA 3RM6A 4OTRA 5D41A 3QD2B 4FTQA 3RCDA 1FBNA 2VTMA 3ULIA 4J53A 4TWCA 5CT0A 2XF0A 3IW8A 4D9UA 4D4VA 4L9IA 2PK9A 4PDYA 5IQDA 2RFSA 1X8BA 5D9HA 5LJJA 4I5HA 4LV8A 1Z9XA 3VONA 4PUZA 4EH4A 3QZIA 2HELA 5JMSA 3L8XA 3EOCA 3GVUA 2O63A 2ZDTA 3QQJA 3ROYA 3BIZA 2X39A 4A9SA 5BVOA 2YJSA 3VC4A 3EFKA 3HV6A 4TXCA 4ORKA 2WMAA 3E3PA 4JDIA 3OW3A 3OBGA 1GAGA 2JBOA 2LAVA 3TI1A 2IVSA 3OD6X 4FE2A 4AFJA 3AC5A 4C02A 3T9TA 4AS0A 1OPLA 2J0KA 2OFVA 4IHPA 3CKXA 2R4BA 3MB6A 2HWOA 2OIBA 4LFIA 4PDOA 1REJA 2H34A 3FZPA 1ZMUA 4NM0A 4WBOA 4ZSGA 4BTFA 3C5IA 4EK8A 3NNWA 4R3RA 2Z2WA 4ANOA 2VV9A 3EYHA 5IQCA 2XCKA 1QMZA 1Q8YA 1FMKA 2YABA 3IW7A 3WF7A 3ELJA 4YJRA 4PDPA 4FBXA 4RWIA 4Q9ZA 3N4TA 4E20A 2CKEA 3E7VA 5L8JA 3LFCA 3R1SA 1TQMA 4FVPA 4YPDA 5ANOA 5EI2A 2NRUA 2W1GA 3L9LA 3L8SA 2XBJA 5AR4A 3UQFA 5M09A 4XV3A 3WI6A 4JBQA 4S31A 4BVUA 2R0UA 1OIYA 4AZTA 1JKTA 4JR7A 5EDPA 3B2TA 2VTLA 3HUCA 4Z16A 2C68A 4FV3A 4J7BA 2ZV7A 5ANEA 2OLCA 4EOLA 4FT9A 5FGKA 3RZFA 3R2YA 3OUKA 5CAQA 4W9WA 2CGXA 3P1AA 4XV2A 3DK7A 4XYFA 3ZOSA 3EN6A 4BCIA 4IACA 3JY0A 5HO8A 3VW8A 4LG4A 3DK6A 4O22A 5DFPA 4FV8A 4YZMA 5C03A 4U45A 2B52A 3R2BA 3A7JA 4E6QA 4BHZA 1RJBA 3H0YA 4I24A 5DA3A 3DOGA 3HMPA 4O6LA 2YAKA 2HW7A 4AZSA 3F9NA 2R3IA 1CM8A 3JPVA 4GT4A 4IB5A 3TUDA 4O7YA 3W0SA 4RVLA 2J90A 1FVTA 3EL7A 2XKFA 3ZXTA 4E7WA 1JOWB 3TV7A 4L6QA 2PMIA 2QNJA 2V7OA 4WBBB 4KUJA 1EH4A 5M44A 4FSZA 1XH7A 1H07A 4L7SA 4JBVA 5A4EA 4HPUE 3S3IA 4K33A 5H3QA 2EXCX 3HUBA 5AUZA 5LCKA 3TNWA 5KKRC 2GDOA 2VTIA 3PP0A 4IQ6A 1GIIA 5I9VA 2IZRA 4NKSA 4AGUA 4FVQA 1ATPE 1LR4A 3FC2A 2C30A 2R9SA 3GQIA 4G3GA 2C4GA 4W9XA 5DE2A 4FTLA 2BPMA 4GFMA 4QTAA 5I9YA 2ITPA 4DG2E 1ZXEA 4J98A 1XWSA 1B6CB 2W06A 1PW2A 3RVGA 3W18A 3LCSA 3K2LA 3DBCA 4DCEA 4NU1A 3ATTA 2R3HA 2XEZA 4DHZA 4BWXA 1YI6A 1JBPE 3PZHA 4OW8A 1JLUE 1ZAOA 3I81A 4NFMA 4ACCA 1V0PA 5CU0A 4I6BA 1ZYDA 4OR5A 5IMEA 3IDPA 2DWBA 2ZYBA 4HJOA 5FQDC 5LVMA 5EHLA 2W4OA 4C0TA 1WZYA 4G31A 4ZTHA 2C1BA 5FP5A 4JDHA 4PF4A 4U42A 3REPA 2WTKB 3O17A 4L44A 4UMRA 1OGUA 2X0PA 3EYGA 2UZNA 3SC1A 3BZ3A 4TTHB 4XG4A 4EC8A 3LQ3A 5I0BA 1M17A 3OROA 4BDIA 5LOHA 2CN5A 3EQCA 2ACXA 1GZNA 2BHHA 4I6QA 3RPVA 1H00A 4CKIA 4IFCA 3F61A 2IZSA 3ZH8A 3EHAA 4BI0A 2WQNA 4UN0C 5AEPA 1U5RA 5BVWA 3H30A 1IAJA 1YWVA 4DTAA 5J87A 2W1DA 3DU8A 1PYXA 3TT0A 3FZSA 3LFSA 3MVMA 4KIKB 5CQUA 4O4FA 4BCGA 4O0RA 3QA8A 2EB3A 1OVEA 3MPMA 3WZJA 3FUPA 3ET7A 4JXFA 1FMOE 3R6XA 4FG7A 3V8WA 4K18A 2OFUA 4XV9A 4MBIA 4EK6A 3DFAA 4C8BA 3WIKA 5JGBA 2F7XE 1OIUA 2CCHA 3TNPC 4GSBA 4XLVA 5BMSA 4WNOA 5CU4A 5F4NA 4A4OA 5C4KA 3BHTA 2VUWA 3EZVA 3LFQA 3RK5A 5IH4A 3MFUA 4C58A 2B4SB 2XK6A 5IEXA 4XLIA 3R8LA 1GJOA 1Q61A 3DBQA 4FMQA 4R8QA 3G2FA 2B55A 4IDVA 4RA4A 2P3GX 4YC6A 5E1SA 3QKMA 3ENHA 2QCSA 2GNFA 3D14A 4QOXA 4A9RA 3VIDA 4DT9A 3BU3A 5AAFA 4RX5A 1IG1A 3NZ0A 5BVEA 4KWPA 5M4FA 3FMLA 4NJDA 1Y8GA 5BUJA 2G01A 3Q2MA 4GK4A 4EHVA 4EH8A 3TTIA 5IA5A 2YM3A 3TKIA 5HIDA 4QP9A 4AXDA 4Q5EA 2W05A 3HRBA 3DAEA 4M69B 5DH3A 3W1FA 1WBNA 2WXVA 4D28A 3CEKA 1SVGA 4AAAA 3IPHA 4D2WA 4X3FC 2PMLX 1APME 1BMKA 4E4MA 5AR3A 3E62A 2XEYA 3QCQA 3R0TA 3DXPA 3BE2A 4KB8A 2VTAA 4IADA 4UWBA 3PJ3A 5KE0A 4ITIA 4PNIA 4BDAA 2OIDA 2O5KA 4TZRA 4EOJA 2C5XA 3F2RA 3PVWA 4H3PA 2OWBA 3L1SA 2A98A 3GC7A 4HNIA 3CBLA 3AC3A 3CPCA 4HW7A 5JFWA 2X81A 4DCAA 2W1IA 3QD0A 1ERKA 3FZTA 4FEVA 4ANSA 2DS1A 3R21A 2PVKA 4FZ7A 2J0MB 3V5JA 4D2VA 3HKOA 1DS5A 4AXFA 4RT7A 4OAVB 5IUGA 4QQTA 2OK1A 4UALA 3CXWA 4AACA 4QMLA 4AGCA 4OUCA 5F94A 4DG0E 4EH6A 4EK4A 4J97A 4O27B 4F64A 4AW1A 5J9YA 5IQGA 3LFAA 4XG9A 2HIWA 3FL5A 3B2WA 5HCYA 4O91A 2YA9A 3LJ0A 1AQ1A 4EEVA 1SVEA 2VTNA 3PVUA 4YJQA 4L7FA 3W33A 2UV2A 4JI9A 4U6RA 3VNTA 4QMNA 2J5EA 3L9NA 3OEZA 2YDJA 4BCOA 3BLHA 3CR0A 4Q9SA 4AUAA 3ANQA 3AOXA 5EYCA 5C8MA 5HU9A 3GOPA 4QTBA 3KL8A 5CZIA 1ZY5A 3D5VA 4S2ZA 5H9BA 4FEWA 5KUPA 2R3FA 4G17A 4V0GB 4PPBA 2FH9A 2WHBA 2WB8A 3CY3A 4GG5A 4M0YA 4QMXA 4I22A 3W10A 4CD0A 4RZWA 3D7ZA 3N4UA 2PTKA 5CQWA 2GNJA 3RPSA 3E7OA 3Q60A 2X8DA 3EH9A 4I6FA 4YJVA 3UNJA 3AQVA 2I6LA 4FGBA 3JYAA 3H9FA 3NCGA 2NO3A 3KULB 2PHKA 1W8CA 3E93A 4QMMA 3R9OA 5DYJA 2I7QA 3OC1A 5J95A 3ZFYA 3RKBA 4D1XA 2X0GA 4IMYA 2GNGA 3ODZX 5ANIA 3P9JA 3K5UA 5K4IA 4LMNA 3C0HA 4AW0A 3DB8A 2NPQA 3P7AA 5CZHA 2OH0E 3PDTA 4ZSAA 1RW8A 1U5QA 2F7EE 2X9FA 3MIYA 4RBLA 1YWNA 5AP3A 3WF8A 2B9FA 4FI1A 3BYUA 4MUQA 4D4YA 4Z3VA 1BYGA 3C9WA 2O3PA 2XJ2A 3PY0A 3ORXA 1GY3A 4NIFB 4Y83A 5I3OA 3R8PA 2W1HA 2DYLA 1BLXA 3DKFA 4RFZA 1LEZA 2QQ7A 3OUNB 1J1CA 4R7IA 4TYGA 3FJQE 3QZHA 1W2DA 4U79A 2YLEA 3PJ2A 2CMWA 5KMJA 4TN6A 4NZWB 5HVKA 4WNKA 5AV2A 3HZTA 4E5AX 1R0PA 4E73A 2X0OA 4ASZA 5L4QA 4JR3A 4O0SA 5EKNA 4BJJB 2W4JA 2PZPA 3OOMA 5IUIA 4AQCA 2E9NA 4G3DA 2W0JA 3FSFA 1H25A 3QXOA 3HGKA 3K3IA 2NP8A 3UIMA 4GKIA 2J6MA 5CSPA 2EU9A 2ITTA 2ERKA 3KMWA 4ZSJA 3SOCA 2GS2A 4TYHA 4U3YA 3LLTA 1YRPA 5ANKA 2X7GA 2JKOA 3NYXA 4CKJA 4PP9A 3ZUTA 1WBVA 3KXZA 2WMTA 4BCFA 1BL7A 5AP2A 5BYYA 4E93A 4BI1A 3KGAA 3NIEA 4W4WA 4AZVA 2ZV9A 2WO6A 4D4SA 3NWWA 5CLPA 4GU6A 4MNFA 3P78A 3BV3A 3PWDA 4P90A 1WVXA 4NJ3A 1J7IA 4FKGA 3VBTA 2PZRA 4QYYA 3LQ5A 4AG8A 3RPRA 4AN2A 4IBMA 3BL7A 3RK7A 3L9PA 4I5PA 2GNLA 2X8IA 4ZTMA 1O6KA 4KSPA 3C4FA 4DEBA 2PZYA 2VTRA 2R3OA 1Q41A 5JN2A 2CJMA 3NYOA 4L53A 3ORIA 5L6OA 3V04A 2YM5A 2OICA 4TWNA 4OTDA 5AUTA 4FEXA 2HY0A 4K6ZA 3GC0A 4JIKA 3FMEA 3LXLA 1E1VA 3UDSA 4QMTA 4ID7A 3PA5A 5CT7A 2OH4A 1DM2A 3LJ1A 4QP8A 4ACMA 4KIQA 5IQHA 1YXSA 4XRLA 1ST0A 4DN5A 1CMKE 3GU5A 5KMIA 2WMVA 1CDKA 5IMXA 3PIXA 1Q99A 4H36A 5JFVA 4TYIA 5IA3A 3BRBA 2B9HA 4M84A 4GEOA 4RQKA 1KSWA 2YCSA 5J1VA 5CVFA 4K9YA 4PPCA 5CEOA 3QQUA 2ZB1A 4BI2A 3Q5IA 5AR7A 4KBAA 4HYSA 5M4UA 3HVCA 1JWHA 2F7ZE 3OXTA 3OG7A 3OZ6A 4FG8A 4B8MA 3NVMB 3KK9A 3QWJA 3V6RA 2XJ1A 4ENYA 5AP7A 4BFMA 2PL0A 1LPUA 3TN8A 4EUUA 5D11A 5I9WA 3DK3A 1JKLA 1XH6A 2ETMA 1Q8UA 1OPKA 3BPRA 3C13A 4RJ3A 4UYNA 1W83A 3PVGA 3UZRA 4JVGA 4IE9A 5L8KA 3OBJA 3CTJA 2HWPA 2O64A 2XH5A 3A2CA 4FR4A 1G8KA 2XARA 4E26A 5HX6A 4DLJA 1PKGA 4L46A 5IEVA 4K1BA 4ASEA 5EYMA 4J95A 2R7IA 3OFMA 1PKDA 4HGSA 1RDQE 2VN9A 4D58A 4TW9A 2XNNA 4U43A 5ETIA 5EQPA 4DDGA 4DYMA 2OSCA 1PXOA 2UW5A 2PVJA 4W4VA 3FWQA 4W4YA 5EK7A 5HKMA 1J3HA 3R7GA 4RWJA 3O2MA 2WU7A 3QUPA 4RC2A 4F1OA 3MVHA 2ESMA 2WTKC 1M14A 4IX3A 2RKUA 4KIOA 4YPSA 3FZOA 3F3ZA 4QP7A 5TKDA 4A9YA 4GCJA 3V6SA 2XJ0A 4FZFB 4U3ZA 3EFWA 3HP2A 4NT4A 3DNEA 4IVCA 2HZ4A 4IM2A 2Z7QA 4ZJJA 3BX5A 4YJSA 4U80A 1VZOA 3ZBXA 5IA4A 4M68A 4OLIA 5K0XA 4F9CA 2XYUA 2F2UA 2OKRA 1OKZA 4AT3A 1PXLA 4NW5A 4F6SA 3VS5A 3BI6A 2ITUA 2YM4A 3LLAA 2W99B 1K9AA 2R5TA 1AGWA 3F6XA 1DAWA 3UQCA 4CCBA 5KNJA 5L2SA 2FSOX 5ANJA 3RAWA 4F9WA 4ALVA 2QU5A 4ANBA 2WPAA 3BEAA 3QZGA 1MP8A 4YLLA 4AP7A 5EW9A 3UZPA 3SG8A 4PL5A 4QEBA 3GOKA 2G1TA 3WILA 5JSMA 4JL9A 4QPSA 4BZNA 2I0VA 5A4TA 2BFYA 1OKVA 3E63A 3GU8A 3NGAA 2BIYA 4IZYA 3GUBA 3JR1A 4OAUC 5KMOA 4OTGA 2C6TA 2Z02A 3AT2A 4GVJA 2BZKB 2JDRA 4N70A 3EFLA 3PXRA 5FBOA 4AE9A 4TWOA 4Y85A 4GYGA 4JLCA 4M13A 3WZKA 2GS7A 2OZOA 4YZDA 4FSNA 3UBDA 5BNJA 4AGWA 4HGEA 4FL2A 3S0OA 2XNMA 2Z7SA 2QG5A 4O1PA 3DGKA 3DXQA 2WQEA 3LPBA 3PRFA 4FSQA 4W4XA 1FGIA 3HA6A 5LMAA 4MXOA 4YUQA 2ITYA 3ALNA 4FZAB 3ACKA 1YXTA 4PMSA 4TYJA 3UVQA 5HI2A 4O7NA 3PLAE 3FY0A 2UZDA 3ORKA 5E7RA 4AA4A 4NTSA 3NUYA 4BKZA 1XHAA 3FDNA 3R7UA 5E1EA 3BYMA 2GU8A 3QTSA 5IF1A 5J9ZA 5HX8A 5EYDA 3DCVA 2WKMA 3F7WA 3E8NA 3O96A 3SDJA 1SNXA 1P4OA 2UW4A 2IZTA 4P5ZA 3R1NA 2AQXA 1P14A 1VEBA 2F9GA 3O5AA 4USDA 3PPZA 4UMUA 4O7LA 3F3VA 3U6IA 1DI9A 1XH8A 4UY9A 5HG5A 4AN9A 5AUYA 1ZOHA 3IS5A 2YITA 2CGVA 5DLSA 1V0BA 2AC3A 3MWUA 5HCZA 3TACA 3MH3A 3QLFA 4X3FB 3PSDA 4XS2A 2DQ7X 3BHHA 3EN5A 3NW6A 4XP3A 5LMKA 3ANRA 4D0WA 2YWPA 4RQVA 3SXFA 3KK8A 3NRMA 4Z9LA 2XNOA 3KB7A 4LOQA 2PMNX 3QTRA 3MS9A 5IEYA 3BQRA 3TJCA 4RIYA 4K2RA 3FI4A 3PJ1A 1RE8A 4ZAUA 1Y6AA 3VBQA 2PVFA 2QO2A 3ZEPA 3MY1A 2Y6OA 4ZOGA 4FUYA 2UVZA 3KC3A 1OIRA 5JZNA 4DE4A 1CKIA 4ZIMA 3KXGA 4IDTA 5F1ZA 2YDKA 3ZUVA 4I0SA 5CF6A 2GQSA 2IVUA 4FV4A 3CD8A 4BWKA 4E6AA 4DFBA 4JQEA 2VWYA 4H1MA 4RMZA 2OGVA 4QP6A 5CALA 1JQHA 5H8GA 5E8WA 1QCFA 5M06A 5HHWA 5CI6A 4CFFA 2OIQA 4FODA 3LXPA 5JKGA 4EOOA 5C26A 2X2KA 4I23A 3UP7A 3OS3A 4D5HA 2QVSE 2UVYA 4FKSA 4UXLA 3MJ1A 4Q5HA 4RIOA 2PUPA 4Z7HA 5LVNA 4YZCA 3W2OA 2NNWB 4XUFA 2PVNA 5ACBC 2XANA 2J0IA 4HYHA 3TL8A 3NVKI 2YM7A 3Q5ZA 3O8UA 3GP0A 4OBOA 4QMWA 2GNHA 2RG6A 3Q96A 5IQIA 4L8MA 4KBCA 5T68A 3ZRLA 3AT4A 1G8JA 5FEQA 4MH7A 4NKAA 1GNGA 3EQBA 3ZRMA 2EXEA 1UNHA 2RIOA 3FMKA 3I0OA 3DBEA 2JDVA 1FQ1B 1ZZLA 2PZ5A 4YTFA 1KE7A 2PY3A 3HMIA 4TNBA 2VO7A 3PXFA 3I5ZA 2WTWA 3R8VA 4BDHA 2UVXA 2CNUA 2XZSA 2C5NA 4GU9A 4ANMA 3AD5A 3NNUA 4EHGA 4NSTA 4I92A 5A46A 4ZY5A 3VW6A 4BDFA 4C7TA 3GI3A 4NCTC 4AZWA 4DITA 5A9UA 2YCRA 2Y7JA 2H96A 3GQLA 4BTJA 4MQ1A 2C5YA 1QL6A 3QTQA 1ZOGA 2C6IA 2X6DA 5EOLA 5AV3A 2BUJA 5HO6A 5EOBA 3U9NA 4QPAA 5ITAA 1MRYA 5IG1A 3QX2A 3AT3A 1NT2A 3ZC5A 4ACGA 2HXQA 3CP9A 3MY5A 3FY2A 4G2FA 3ZONA 2JLDA 1ZYLA 4HPTE 4BIBA 4IX4A 1NA7A 5HZNA 5EI8A 1BUHA 2WMQA 2PVLA 4LGHA 2OJIA 2BDJA 2HXLA 4QP2A 3ORPA 1QPDA 4FTKA 5EW8A 1IA9A 3VBVA 2QO9A 1UU9A 2LGCA 1W2FA 4O2PA 4O82A 4PTCA 3R9RA 4YNEA 4WNPA 3GCSA 4AU8A 4RVKA 3JUHA 2X7OA 1G8AA 4BCJA 1J7UA 1OL1A 3VBXA 1ZOEA 4XMOA 3LMHA 3FXXA 5TE0A 2BRHA 5CY3A 3Q6UA 3EZRA 2OO8X 4CFXA 4WG5A 3VUKA 4PL4A 4QMYA 4UXQA 3G9NA 4BGQA 1U54A 4O96A 4L01A 4Y5HA 3JS2A 4TYEA 5TOZA 3W2RA 3W8QA 5JK3A 3FE3A 3QQFA 4FKOA 3F5GA 3UOKA 2HYYA 3DKOA 4GJ3A 3MDYA 3R00A 1H1PA 4MXCA 4DFYA 2PUNA 4OTWA 4ZJIA 2IVTA 2QOIA 1IR3A 3PXYA 2UZEA 5AUXA 4ARKA 3LHJA 4OTPA 3RHXA 4F9YA 4BDKA 2H9VA 3OWLA 4LQMA 4I4EA 4I4FA 3G0EA 5L6WL 4J96A 3HL7A 5HBEA 3M1SA 4M8TA 4MD8E 4IH8A 4O86A 1WBSA 2O8YA 5KHXA 3I4BA 2JDSA 4BR3A 4MWHA 2ITOA 4JT3A 1UVRA 3KMUA 4D2TA 4F1TA 4GVAA 3SLSA 2YERA 3DTWA 1JSUA 5CSHA 4ZJVA 1GZKA 5B7VA 4QYFA 3MB7A 5HD7A 2BR1A 3QU0A 1XH9A 4X6RA 4FIFA 4OT6A 2ZV2A 3AKJA 2QO7A 3RI1A 2AEGA 5E92A 2UW6A 1SVHA 3CC6A 3OTVA 4ACDA 4CCUA 4MX9A 3LFNA 4DFXE 4XP2A 2HZNA 3QRKA 4JBPA 3COIA 2HOGA 2CKOA 4DTBA 3PPKA 2OG8A 1NVSA 1DAYA 4IZ7A 5HE3A 2VNWA 3ITZA 3FLZA 3C1XA 2ZJWA 1W0XC 3GENA 3WBLA 5GINE 4WT6A 5AV4A 1REKA 4I6LA 3KVWA 2W1CA 3ZSIA 3OXIA 4PQNA 4J8NA 1M2PA 5JFXA 2XKCA 4O83A 2QD9A 3OHTA 4ZEGA 1XR1A 5BVNA 4FTOA 2F2CB 2VX1A 2X4FA 4KKGA 5CS6A 5AMNA 3R7VA 3SRVA 4B4LA 1UKIA 4AZEA 4EQUA 3KF7A 5CVHA 1BI8A 3L8VA 3FLSA 3U55A 3A61A 5LCJA 4LV5A 1O9UA 3HV7A 3HDMA 3MFSA 5CENA 2UZWE 4Q2AA 3ZO3A 4G6OA 4F7LA 2V62A 5KO1A 1GIHA 4JAIA 4NH1A 3WARA 2C0IA 3PG3A 1F5QA 2PWLA 3Q9WA 4RSSA 5GJFA 4LUDA 3FLNC 5B2KA 3QTUA 4QRCA 2C47A 4V05A 5HLNA 4O7WA 3EQIA 2GCDA 1QPJA 3FKLA 4P4CA 1V1KA 2JDOA 5EM7A 5CXZA 2G9XA 4I20A 3KXMA 4DBNA 4TRLA 4UWYA 4EYJA 4XV1A 2OJJA 3VQHA 4F6WA 1IRKA 3CLYA 2IO6A 3NUNA 4FSTA 5GZAA 2I1MA 2G15A 2QOHA 2WD1A 2R3LA 3R73A 2P33A 1TZDA 3V51A 3FZRA 5CWZA 1NVQA 3QCSA 2FA2A 2HW6A 3KRRA 4IC7A 3PXZA 5B2MA 3R1YA 2GFCA 5TF9A 2QODA 3F5PA 1H1WA 4M97A 4PP7A 4YR8A 5FDXA 4BY9E 3LIJA 4NK9A 4YJUA 2P4IA 4G3EA 2JFLA 4FTRA 3VO3A 3VRYA 3ZCLA 3P7CA 2J7TA 1FVVA 2A2AA 4IVDA 2J4ZA 4ZZNA 5A6NA 1H8FA 4HCUA 3M42A 5J5SA 3QA0A 4DEAA 2PMOX 4IWDA 3CE3A 5JFSA 2UZUE 4FSWA 2YIYA 4ZTQA 2J5FA 3QWKA 4F9AA 3GC9A 4OTQA 3TV4A 4WNMA 4O0VA 4EOQA 4HGTA 2WTIA 4PTEA 5AP6A 2Y4IC 3UMWA 2YDIA 3IW6A 3R28A 4YGAA 1Q4LA 1Q97A 3K5VA 1IAHA 3EL8A 4CTCA 2Y6MA 2CGWA 1HCKA 5JQ5A 4MF1A 3MY0A 1WVWA 3DV3A 3NUPA 4EYMA 2KTYA 2VWWA 2C3IB 2ITNA 1Y8YA 3R7IA 4BCMA 5LXMA 3FMJA 4PV0A 1MRVA 3HV5A 3CD3A 3A8XA 4C38A 2JC6A 4QQCA 3COKA 2ZAZA 4N4SA 1V0OA 4LGGA 4UWCA 4E1ZA 1E9HA 2YIWA 5A14A 2J0LA 5IH5A 4IJ9A 3W2PA 2YAAA 3PIZA 2IZUA 3Q32A 4QT1A 4CYJA 1ZMWA 2IW9A 1Z5MA <