3QULB

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 altered peptide ligand (y4s)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected T-cell recognition of an altered peptide ligand is driven by reversed thermodynamics.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 14
structure length 99
sequence length 99
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qulB00
1WTGT 1E4KA 4XNXL 3DX8B 3VGFA 1W0YT 2W0FA 3BI9X 2VXSL 1A1OB 1HH6B 3LRSB 4Z6AT 4M5ZL 4EBQL 4CADA 2BDNH 1OAKL 4JFDE 1B90A 1GL4B 2X4QB 3F7VB 3MACH 1ACZA 1FPTL 4PJEE 5JMOC 3D25B 2PTVA 4DUXA 3H3PL 1OTSD 5GJSL 1BAFL 4L8SC 1DTUA 5C0EA 5EBMB 1M7IB 3CLEL 3MRJB 2V5YA 4I77L 2EXYD 3H9HA 1DQLL 4LIQE 3CUPA 5F7LB 2VIRA 4C4KT 1MPAH 2WIIB 4OQTA 3UJJL 4K8RD 1M6OB 2HFFB 1G9EA 3T2NH 3C6LB 2WM0A 4MA8L 2EDTA 3SDCB 4WO4A 2Z31A 1T22A 4NN5B 1CLYL 4H88L 2EIDA 1ONQB 4OZHE 3QNXB 1KYOK 3O4LB 3BDBA 4FQLH 4ELMA 1DN0A 1MWAA 1J87A 4DN3H 1KEGL 2XZCH 2NY4D 4PJ5D 1A6VL 4DKFH 1SYVA 1FGNL 1QO3A 2IAMC 2J5LC 4IS6A 3NAAH 1FSKB 4F57L 4B5EA 2HTKD 2IH3A 3EYOB 1JGUH 2VISB 2SEBB 5FIEA 4Z7WA 1WGOA 3F58H 5C08D 1WK0A 4U2ZA 4EDWH 1LGVA 2WK2A 3IRPX 1JPFB 5E70A 5F97E 4KXZH 3KPRD 4E9LA 1UB6A 3S97C 5C0DA 3OHXB 5E08L 4S0SD 1W72B 1URLA 5F96L 3UMTA 1FNFA 2R29L 3B4NA 5JLZB 2NY2D 4X80L 4XCNA 3P9MA 5I76A 1FL6A 1OF2A 3O11B 3D0LB 3LQMA 3QH3B 1KCUL 4F37K 1K4CA 2RIKA 4OLXL 4QRRB 1M7XA 3MLWH 4NNPL 4JRYE 4JAMB 4JFZL 4WY7H 5BXFB 5ISZB 2X7LB 3ARBB 4JZOB 1YEIH 4UTBH 3DVIA 1YN6A 2EDQA 2Z91B 3IJSB 2Q3ZA 4Z9KB 1NBZA 3S34H 4F8TA 1MRDL 3RGVD 3H9YA 3TJEL 1YJDH 3MCG1 3SGJA 1LK2A 4ZO7A 5DD3H 1RZGA 5DRXA 5FEBA 4HBCL 4MD5A 4Q0XH 3UTSA 3VWJA 2Z8RA 5H35A 1U36A 4XP6L 5KAQG 5DJZA 3DGCR 4JM2C 5E9DD 5D7KD 5T1KD 3VGEA 4LMQE 3U9UA 3C08L 4LP5A 2DDQH 5LGHH 1A6VH 3VI3F 1QSFE 3RVTD 3ULSB 4JQIL 4IRZH 4X0KB 3CPLB 1XGQB 1TQBB 1E28A 2BVQB 5TGBB 4LKXA 5HHQB 4OGXL 1I8LC 3T4YB 2FHBA 2XV6B 1KPUB 3QQ3B 1UKTA 5HYQB 1QR4A 4GG8A 4NO5B 1CL7H 5KSBF 4WUUA 3U36A 2XQBL 4ZD3L 1A02N 4C56E 3P9MB 2OR9L 5I76B 5HHPA 1MI5A 3SCMD 5EO0A 5BVPH 5E00B 3HR5B 1IQWH 2CJUL 4JFQA 4ZO8A 1CS6A 5EZOL 1N8ZB 3SKUD 1XAUA 3MV8B 5BMFH 1G6RH 3QQ9C 4PJCA 2NY3C 1W2KT 4H25B 4OB5H 2X40A 2Y1VA 2FGZA 5J9PB 1A3RL 1MCNA 4PJFF 3DOSA 3MRBA 3WYRA 5IB1A 2OS7A 1HNGA 1T1ZA 5HI4D 3UXFA 3INUH 4NKIL 3QHZH 4JZJA 4JZNB 5A1AA 4Y16C 1WCQA 4MCYA 4N0YH 4P5KA 5CGYC 1YEGH 4OLUL 1D7FA 2OK0L 1HQRA 3DSNA 4LQ1A 3OXSA 3QUMA 3BZEB 1MCPL 4OGZA 4X7TB 2R2HA 5T1LB 5E2TL 2HVKB 1FORH 2QADD 4X7FC 1RVFL 4C58B 2GI7A 3MGTB 1NMBH 2JIXB 1D5XA 4HWEL 3B2UD 4WDIB 2R69H 4LRNL 4ZFOA 3QWOA 3QXDA 4J2XA 5BVJA 3M07A 1CDYA 3QZWG 5FV1L 4YXKL 4G6KH 4JPWL 2MPAL 1DBAH 1A8JH 4R8WH 2F58L 1FO0L 3O3BA 5I74C 1P2CA 4OCYH 4HH9A 2IPTH 4QHKJ 3GZKA 4F33B 4QYOB 3MLVH 5TQ0L 4KUCD 3QWRD 3VGDA 4DAGL 5C0EB 1OWRM 5EA0L 5E8PA 1HQ4A 4GKZA 4TVPH 3TBSB 1Z9MA 1NFIA 4XC3L 3C60C 3OKMB 3BH9A 4DTGL 1QOKA 5JPNB 2IMNA 3UTTE 4C56D 3L3KB 5I1IH 3C5ZB 4Q74A 3X14B 1Z0MA 4PGDA 5FKPA 3VFWA 3C2SA 5F7DB 2GJ6B 3UTTA 1H8OA 4UT7L 4M7LL 4Z95L 1WIOA 3VI4E 5FA3B 3LD8C 4LLYA 3LN9A 4NN6C 3HE6B 5F6IB 4MDJB 4YXLH 2BY0A 2IPUK 5FF6B 4CJ1A 2VXQH 3ULVF 2ZPKH 3C6LD 1R3JB 1FDLL 3ROLA 5I71B 2BRQA 4HSQA 3BGFC 4EVNB 4ZFOB 1N0LA 4V1DE 2DOCA 4Z76A 4RWYL 3IFNL 3ZT5A 1QYGH 2HVKA 4Y5YA 3M1BA 2R69L 4HJ0D 4J4PA 4PP2B 3U0PA 5DVKA 3BZEA 1NGYB 1MFBL 1IARB 2WQRA 2Q86B 1P7KB 3SPVB 4QRPE 3CFCH 1HHJA 1ZLUH 2HKFL 5GGSA 1HWGB 1U8PB 2BC4A 3SGDI 5DMKB 5DVLA 4OLWL 3PJSB 3RRQA 3SDXB 1MUJA 2K7QA 1EK3A 4FABH 4CKVX 4F15C 3BKML 4PGBB 3WIIH 3HUJA 5I15H 4U1NB 3TFKC 1G9NL 3VW3L 3ZYZA 4CVWA 3IDMA 3M1BB 4F2MB 1WBZB 4EUPG 3MYJA 5HVFB 1BIHA 5D1XD 5DC0A 4QHMB 1KPRA 2VN4A 1L0YA 4XCEA 1C5CH 1I1YA 3L6FA 2D7QA 5GGTL 5TDPA 2BMKB 5KG9A 4NM4H 4NWUH 4QRQA 1ZHLA 4Y4HB 3TN0D 1K4DB 5F9WC 5F1KC 2OTUA 5I18H 1KXVC 4YXLL 1YQVH 2BZDA 4HWZA 3DROB 1MCIA 1N2RB 3D3VE 3MOBL 4P2CG 2ZUSA 4NQXA 5LQBH 1SM3L 4OIAA 5E7BA 4HJGA 2VH5H 2QHLA 3PWJA 3BO8B 4JE4B 2B2XL 4J8RB 1DQQA 4Y19B 4S1SL 1XF3A 2F74A 5INDB 3OJMB 1P7KA 3SPVA 4RISH 3VWJB 1QSZA 3BP7B 4WENB 3TBWA 2PO6C 1CLZL 1YEEL 4BH7B 2R4RH 1INDH 1ZT4A 2HLAA 3G6JE 3V0WH 3WFZA 5IK3A 3BE1H 3GKWH 4P2OC 1H0DB 2VLJE 1BD2B 1EO5A 5CD3B 1X3DA 5DT1L 4LGRB 3JXAA 1BBDL 1MQ8A 4G6FB 5H37G 4MQSB 2FYYA 3KPSA 1FLRL 3EHBC 4UIMA 1FSKC 4WFFE 4BQ9A 2IALA 3CDCA 1JRHL 2H32B 2K3TA 2H2SD 4U1NA 3RZCA 4UV7H 1E4WH 4PRPD 1IT9L 3MRFB 4G9FB 5IQ7L 4NDMA 4C57C 2FBJL 1SVCP 3O41A 1JI2A 4MDIB 3RVVD 4ALAH 1NL0H 3AAZA 3CSPA 1MVUB 3CXDH 3KG5A 3MFFB 1Z9SA 2YZ8A 5C0BA 1GGBH 1NGPH 1RUQL 1RZKL 2VDOL 3OGCA 4MJ4A 5TQ2H 3E3QC 2ZZUT 3QPQC 3UDWC 2OR7A 3RJQB 1YEFL 3P2TA 4KKBC 1I9RL 4PUBL 2CO7B 5FECB 3AVEA 5ESQB 1VFMA 4ZQKA 3MRFA 3RIFK 1I8KB 4MNQD 5DJ8A 4CVZB 4JKPH 1MCWW 4POYA 3DTXA 5IG7B 3L3DB 4K55A 4FQ2H 1MIEL 4WW2A 4BSWB 2WWKO 3V9FA 5JW3L 1PVHA 5I1HH 4PFEA 5DJXA 4MQ7A 1XF2B 5GS0D 3O9WB 1XIWA 1D5XB 2YPVH 3TO4B 5D5MB 5F7KC 4DK6A 5C0IB 5TF0A 3WLWD 3EW3B 1K2DB 4F7PA 3B8YA 3B6SA 1D6VH 3AB0C 1MRFH 1FVDA 1U58B 1KEMH 4X4ME 2ZG2A 1MHPH 2EYSA 4EI5B 4GO6B 4R4ND 4Z0BL 4LEXH 4UV7L 1UWEH 5IIEA 1OGAD 3TBTB 1MHCA 2G5BA 1RFDL 4OT1L 1YECH 1B0WA 4BUHA 4CU6A 2WBWB 5EPMB 3TVMD 3M45A 4EDXA 1KJMB 3QAZC 1G6RB 5IHBA 1FJ1A 1LD9A 1FZKB 2EZ0D 5AZEL 4JFHD 5ICYA 4Z7UE 1F4XH 1AR1D 4EN3B 4ONGH 3QPXH 2X1PA 1UADC 4QWWC 4NFBA 5HHPB 3V2AR 1I9RH 3Q6GL 5JOFA 4DFIA 4WO4D 5IVZB 1YJDL 5HGAA 3RHWF 1JWMB 3IFLH 12E8L 4IIQB 5I30H 1JZ5A 1BVLA 2Z8WC 3NZHL 1E6JL 2KPNA 5BRZA 4M61B 2O5YH 1UQSA 3SE8H 2X4NA 5K93A 3RFZC 1N64L 1OW0C 2J8UF 3MLYL 1NH6A 5DEGB 5HHXL 2P7TA 3V6ZB 3PJSA 1T7VA 3EYUH 1OGAE 3KHQA 4L8SB 3GNMH 3MRBB 4LQFH 1X5AA 4D94A 5EC1B 4GG6B 5JQHC 3N1FC 1AD9A 3GGWA 3QIUA 3BFOA 1KSRA 3RWFB 4WWKC 3UC0H 1NDMB 3G04B 1XGYH 5DHYA 5T1KB 1IGCH 4C56B 4X5WA 1GGCL 1BMGA 4I18A 3LH2H 5E00A 2JB5H 5BV7H 4GW5B 1HYSD 4MJ6A 4EVNA 3NZ8B 2YRPA 2HRPL 1F3DH 2VJXA 3BW9A 3RBGA 3VD9A 1A1MA 1SJEB 4BFGA 2H26A 1JHLH 3FRPA 4JDVB 5ICXB 1IKNC 1T0MB 1K4CB 2WANA 2FNBA 1CXIA 1GGYA 2OTWA 4HS3B 2NXZB 5HHQA 4ZDHB 3LZFL 4GW1A 3NCJH 3K0WA 4OFVA 4UAOC 4Y4FA 5D6DC 1T1WB 3B2VL 4APQA 3VI4F 4P4KB 3EGSB 4U1HA 3IKCB 3SJVA 4G8GB 1JWSB 4BYHA 5GSRB 2FCBA 5EU4B 4HGKC 4QXTA 4QOKA 4MX7A 2CMRL 3DSFL 4Z0XA 2YN3A 4NQDD 5GS0L 2J4WH 3QT2A 1NMBL 3L5XL 3PQYE 3AB0B 5EZIH 3JTTB 4LRNH 1RUPL 2GTZB 1NCNA 1CXLA 1AP2B 1OTTD 4AL8H 4RDQG 2AV7B 1SMOA 1CXKA 5ANMA 1Q0XL 3OB0K 3JV5A 1TZHA 3RUGB 3HC0A 5CZXC 3FT4A 2M8XA 4NNYA 3FFDB 1MRCL 2RAMA 3DYPA 2C4XA 5SX4H 2Q1EA 4FXGB 4GRWF 2DM4A 4RFNB 1FIGL 1YA5A 2C3VA 1O7SA 5KVEL 1IGFH 2PCPA 3CZFB 4PB0L 4M03A 2R1XB 3RY5A 1F4WL 4X9IA 1RPQA 3LB6C 1AXSB 1T0NA 1IC4L 3JBG7 2P5WB 5AG8A 1BEYH 5M7QA 4QWWD 1QLEL 5EBWA 1F4YL 5H37H 4Q9QH 1CIDA 3ZDYE 2FL5B 2GCYA 2GFBB 2VMFA 1HEZB 3U1SH 1R0AL 5HYJA 2A0LC 4P9ML 4LCCB 2ZCHL 3LKQA 3ARDA 4G80B 3IDJA 1F8TL 3B9DA 5I6XC 4PJ8C 4Y4FB 3ZLQC 2R0ZL 5C2BH 3MMEA 5FA4B 1JNHA 1FH5H 2FSEA 1UJ3A 2VE6B 1U95A 2VDNH 3MV7A 3AU1B 3BP6B 1KN4H 1CICA 4X6CB 3IDIA 3L3HB 5TPWL 3P30H 2QL1A 4Z7UF 1L7IH 4OM1L 3HNVL 4WV1C 2QSTA 2H3NA 4PV9B 1YY9D 4NZDA 5JUEL 4ONFL 4AM0A 1O7VA 1NFDE 2Y5TB 1P84K 5JHLH 4IRJC 4X6BB 2X4OA 3X3FH 3IDJB 4JFEE 4Y8DC 4MCZB 1KCLA 1WJ3A 5INCA 2QHRL 4L5FH 2CKBB 3W11D 5FECA 3HPLA 3WHXA 2NXYD 4QLRA 5TF1L 1T20B 1KIPB 3HTLX 4RMWA 5B4MD 1T5WA 2ICWJ 5D7LE 4AIXA 1SHMA 2ICEB 3O4OC 2WZPD 2DQEL 3QUKA 4MQXD 4NYLB 1F4AA 5JXAL 4G5ZL 1DQJA 4U7MA 3T1FB 1LE5B 4JGJA 4PYHA 5CGTA 5JW4N 5GGRA 1AI1L 1F3JA 5EZOH 1U8PA 2BC4B 1T89C 4M6OH 3VWJC 2QSVA 1GXEA 4PJXA 1C7TA 4YFEA 1AGDA 4XP9L 3QPQD 3QUMH 4Z7NE 2PXYD 4J6RL 4KTDH 1CZ8L 4ORGB 3B5HA 1WZMA 2EDOA 4XMKL 1I3GH 4JANB 5BS0B 3IVKA 5KW9H 3L5IA 4N0YL 4M5YL 1IGJB 4PJDF 5F44A 1UJ3C 2F53D 2ICWI 4E5XB 2P49B 4TSAH 5FCSH 3O0RH 1WFNA 2BVTA 3ARBC 1GPOL 1S7QB 1FH5L 1RV6X 1ZVSA 2ZNWA 3CFJA 3EOAB 4Y1AA 5I1DB 2VERN 5I71C 1DUYA 2R4SL 3QEGH 5T33H 3ZKXC 3SDDD 1NJ9B 4I18C 1W0VA 3UBXG 3QO0B 2Z8SA 4KHTL 4BH7A 1OAYH 4PJXB 5L88H 4W81A 4QCIB 5J06A 3BRDA 5FM4A 1B0RA 4XB7A 4PJBA 4F3FB 4GAYA 2EDKA 2AKRB 3CFBB 4HT1L 3IDNB 3AXLA 1CE1L 2E7LA 3SDDA 4QNPF 2V2WB 3VXMA 3EYFB 2FH8A 4GXUM 1U3ZA 4LSQL 4CUCA 4PRIB 1IAMA 5IQ7H 5INCB 2EZ0C 3HS0B 2F53E 1JP5A 3QUYC 1HHGA 5IJKC 3OB0H 3TA3D 4WU7A 4AMKH 1NUFA 2IEPA 2XWBA 4GH7B 3MJ9A 3GUTA 4AM0B 1MFEH 3W5NA 3C6LA 1H9VA 1BZ9A 3BGAA 1KB5L 3TN0C 2YD1A 2BVPA 2BCKA 5JW4M 3F6LA 2X1XR 5L2KA 1HKFA 4LDOB 5HDBF 3DUSB 1MI5E 2DQTH 1UYWL 4HIHA 3LS4L 4X5WB 4LNRB 3ARTA 3AS1A 5I2IB 5ADPL 3QUYD 2ORBH 3CK0L 1A6UL 4XWGH 3BWAB 3OTTA 1YDPA 3MRMB 1MJJA 3MCLL 3FCTB 2XWJA 4C83A 1CVRA 1P7HL 3IFNH 3QEHB 3RVWD 4M1DL 3CX5J 1ZV5A 1Q9LA 2FWOA 3I9GL 4AT6A 2XICA 2UUDH 5F7EH 2Y36H 2C1OB 2APVA 5A16B 4MXQC 1FP5A 4YE4L 3KYMB 4OCWH 5FDYA 5CKAA 4K3HA 2Q86A 4BQCA 2ATPA 4YBQC 3HZMA 1I1FB 3QFDA 5DLML 5F89B 2FATH 1TMCB 4I3GA 4NQVB 4PLKC 4R96B 1L7TL 1T2QH 4YHPA 2BJMH 1AGCB 3MLXH 3TZVA 3O45B 3IGAB 4HHAB 3TO2B 3DRTB 4JFFB 1MHPL 4N0FB 1LVEA 3EJYC 2MJWA 5MEND 3HB3C 4HZAA 1P6AB 3VW3H 5I8CA 5C0FB 5GJSH 1FE8L 3D3VD 4YZFE 3VFMB 2VXUH 2FX7L 2BNUB 3CLEH 5DQDH 5B39G 1VEMA 2A83B 1Q9LB 5F93C 5JIIA 1LMKA 2X4RB 4IRSC 1GVIA 5AD0A 3K2UL 3VG9B 1GZPB 1CGXA 1HHIB 1FL5A 2ATKB 4LLDA 5AZEH 5D2NB 1EJOL 2NY6D 1A7RH 4BA8A 2NX5A 1CLYH 1T6WA 5E1HB 3EHBD 1NGXA 5GISH 5LBSH 1N5AA 3IJHB 4DCQB 1EV2E 2BCKB 1CFVH 4ETQA 1UM6H 5E2UH 1TQBC 3DO7A 2AJVH 4MNHA 4BQ6A 3DX9B 1T6VN 3DMMA 4PV8B 3W11C 1DZBA 2PO6D 1J9CT 3C6SB 3P0VH 3VXPA 2A1WL 4GRLC 1XZ0B 4ZAKC 1QR1A 2E8YA 2HWZH 4WGWB 1PKQA 4MJ5B 5DA4A 5I1EL 4HFUL 3HAEA 3MRGB 3PP3K 3RI5F 4K7PL 3FB5B 4Z95H 4JM2B 3RA7H 3BUTA 3EOBB 1X6NA 3BN9D 4JRXE 1N3NB 1IAIM 4G7VH 4S1DC 5C0BD 1ZEAL 3WFBL 1SMAA 1HI6B 1KCRH 4NHCL 2VDPH 5IKCA 2DYPD 4PJ8D 4R9HA 4MNQE 3CXHK 3QIUB 2ZG1A 3VFUA 5MENE 5GRVL 2DKUA 3OGOE 5IV2B 3MUHL 2Q20A 1ZAGA 1OM3L 3WD5H 4U6TA 1MCFA 1OGAB 4MCZA 4KU1A 4PR5A 3SBWA 3GKZA 4PG2A 1IC5H 5CAYB 5DEZA 4M7LT 1EJ6A 3DRTA 4RGNE 3V6OC 2OQJB 1ZHNB 4L4TA 4QXGH 1RIVH 2VDLL 3GMMA 5GS2D 3OAYH 1CFVL 1OPGL 2OI9C 4FMFA 4AIZB 4O2FB 4L8CB 1G1CA 5F8RC 1CDGA 1G9NH 5LGJB 1KF9B 1CFTA 4JQXA 4QOKE 1NAKH 5FYJH 4M4PA 4RIRA 3FQXA 1I3UA 4PJ7F 5CZXD 5HI5D 4HJ0C 2AV7A 4CN1A 4PPTA 3MOAL 1R5WB 5B3JE 2I26N 1BVKA 5HD8C 4PJEF 1NFDF 4DEPC 4Z5RA 2H2PD 5DRNA 4XVJL 4K7PH 1MJUH 3C6LC 2D9CA 2MCG1 1S9WB 1GOFA 4M43H 1U8JA 3BPNC 1WBXB 4ISVA 4OV6F 3RL2B 4XBPA 4YEEA 4FP8L 1N5YH 2AXGA 1NEZA 4KROC 2Z9TA 1RHHA 3SE9L 3ZYJA 4GQPH 4CW1B 3MOBH 1MSPA 3GI9H 4NUJB 4Q2ZA 5KTEL 4YC2C 1BZ9B 4ZO9A 5C0CA 1MAJA 3GBNH 1V3JA 4Y5VA 2EXWC 2P42B 4IMKC 4MA1C 2NY2B 3TO4A 2OLDA 4XPTH 1PKOA 3EYSL 5DD0L 5IMMB 3R1GL 4NWTH 1FVCB 5E5MB 1ZTXH 4TUJB 4XVTH 3RUGA 3ILPB 4R4FH 3WFDH 5C6WH 2NTFA 4MAYB 2BNQD 1N7MH 3OAUL 1S7SA 3VXUB 3SDDB 1NCAH 3C09B 4KVCH 2RHEA 1QKZH 2AK4E 1E4KC 3D39D 4V1DB 3QDJA 2B1HH 4JRYD 5EFIB 1CL7I 4JO3L 4P4RA 3PGDA 4ONHA 3C9NA 1S5IL 1L4IA 3FMGL 2HJKA 2W0LA 4JKWA 2QSCH 2VISA 3FN0L 2VUOA 1A7OL 2UZIH 3LS5L 1AKJA 2X4UA 1WZKA 5DWUL 5GHWH 5LCVH 2I07B 4L8SA 3TWCH 3CMOL 1ZLWK 5I1CH 3VE0B 1KPVB 1WEJL 5D4QA 5DJ0B 2XIDA 2YPLA 1JPTL 1UM4H 1F2XK 1LO3L 1LO2L 1M7DA 5DC4B 4Y7MA 3HLAA 4TNWF 2JCCE 1QFOA 4M7JH 1S78D 5FYKU 2YK1L 2YA2A 3SE9H 3FT3B 4XNQA 3TN0B 4P46A 3TGXA 1JZ6A 5DK0B 3RX8A 3S36L 3QDMB 5D7SL 2A74B 1OAZL 5FOBB 3GBNL 4FZEL 3CLFH 4PGDB 5I19L 2ADGA 3BD4A 3BZ4B 1I1AC 4NUGH 4Z7VA 1NCUA 4LRIA 4LU5L 4GLRH 1VFUA 2FX8L 1NGXB 1X4XA 2J8UB 5T3XL 4GKZB 1UFUA 2Q7NA 3BAEH 1EHNA 2FO4A 2A38A 3NPZB 1KGCD 3IDXH 1ERNA 1HXMB 5CBEB 1QVOA 4QYOA 2BVOA 2EDYA 3QDMA 2R8SH 5KSAB 1AQDB 5CUSL 5CIPA 2VKXA 3UBXI 5KS9E 5DK3A 2OJZH 3BKJL 4OZHB 2BNUA 3LKRB 1T5XB 4MNGB 1N6UA 3L3HA 2AK4A 4JANA 3LEVH 1OTTC 4XNMB 1RU9L 4ZUVA 2R2BA 4YXHH 4YX2L 5C0IA 2Y06L 4X6DA 4LSDA 4AH2B 3HKFA 4KDTA 5E08H 1C5DB 2YXFA 2CLRB 4ERSH 3DETD 4JR9H 3FB7A 4YDIL 2BXYA 3K3QA 2X4UB 2UWEF 1EAPB 3QO1B 4Y89A 4RX4D 5EU3B 1WBYB 2FIRT 5ETUB 4DTGH 1KIUA 4D8PA 2ICEA 4KTEL 3VGHA 1WT5A 2EDJA 4HIXL 3MA7A 3T0BA 1XF5B 2APTA 3BP5A 4Q9RH 2B39A 1IZJA 1J8HD 1HKLH 5EOCH 3VFOA 1E6OH 1DBBL 3L3OA 3RL1B 3WSQL 1MAML 2CLRA 4MXVE 4BSJA 5HHOD 5FM5O 3ZMRA 2WP3T 2AQ2A 4K3JH 4CMHB 4JY5H 4LSSL 3QUXD 4KROD 2LAAA 2OZ4A 1UZ6F 2NY1B 7FABH 1WC7A 4Z76B 5I1GL 5L2KB 4MXWH 4U1JA 3GRWH 2OJEB 1Q1JL 3G6JB 4Z78A 5EOQH 4A6YA 5AG9A 2CUIA 4G43B 2F54E 4G8IA 5HGBA 4NCC2 2OBGA 1ND0A 4MJIB 1YEHH 4YQXH 5EZLA 2A9MH 4JCMA 4PRIE 1DLFH 4NZRL 1H15A 2AXJA 1N0XH 1IGML 3TYGL 5GGRY 1P69B 1CTNA 2N1KA 4NO3B 3HNVH 4H5SA 4HXAL 1OSPL 1H5BB 4IDJL 2VN7A 1T4KB 1INDL 3E3QE 4OF0A 5FK9B 4AIOA 3BHBA 3HPJB 3RDTA 4NRZB 4OZFH 5GZOD 5DJDA 1I8IB 4A6YL 2EDRA 2NY6B 4MVBC 4Y19A 4J1UA 4GG6E 2A6IB 4K94L 4NQCB 2AK1H 3BKYH 2OZ4L 5D72L 3CIQA 3UBXA 4OBRA 1QRNA 1BQLH 1P1ZA 1XH3A 5C70A 3NCYP 2FR4B 1TITA 1HN1A 3FQNA 3LPFA 3VFMA 3L7EB 4LAJH 4HCRH 5CZVH 3GSQA 1QFPA 2CGRH 5JHDB 2V7HA 1RMFH 3VGGA 3GMOA 2AXHA 3VDBA 1R5VB 5E1AA 2YXMA 2EH8H 5CWSA 2FZ3B 3P0GB 4LSRL 4DOHB 3GHEH 4EXPX 3TH3T 2IG2L 4XH2B 4WFGE 5LQBL 4LSSH 4LLWA 1FORL 4JREC 3FQUB 5BS0A 2NR6C 4KWUA 3U48A 3PHOB 4FG6D 4C56A 2R2HB 4LSTH 2D7TL 5ACMA 3L3JB 5IKCB 3LKOB 2G75B 4P9HH 4RMVA 1FIEA 4C83B 5A43C 3T77A 5LWYH 1FIGH 4HMEA 4H5SB 3MBED 3SDYL 2ZOKB 1TCMA 5L2JA 1T1WA 1X5JA 3P0VL 1WITA 3BZFA 2FH6A 1EZVX 1PLGH 2YSSB 2HWZL 4NPYA 4FFVD 4P48A 3FQTA 1DBJL 1HIMH 1IRAY 2W9EH 4HFUH 4RGOL 1LP9F 4NQEB 3RWIB 1IM9B 1JE6A 3HI1A 2CUMA 3MJ9H 1VFAA 5ADOH 5GS2H 3O2DA 1IT9H 4ENEC 2KZWA 1KJVB 3NIGF 3TIEB 5F9WB 2QKIB 2OJEA 5E2JA 2DQCL 3ROLB 4PJGB 2ESVD 3ARXA 3ARBD 2VDRL 2CRIA 1DFBL 3BH8A 1WVZA 2DI9A 2UUDK 3PIQB 3T8XA 3QNZB 3LN5B 4I0PD 1Q9OA 3RHWK 4PJIA 3EYFA 2QQNL 2ZPKL 4KAQH 1XGPA 4Z5RB 3E6HA 3F7VA 4UNTA 3VXQB 1HH9B 4ELME 3D18A 1QSFA 1A7NL 1WV7T 3SKMA 4MA1B 4PRNB 2YWZA 4GAGH 2V9QA 4PP2A 3U0PB 1MFAH 3C60D 4J7RA 2W9LA 1A6AB 2DQJL 1IGIH 5SV4A 3WXVH 1MI5D 5E03A 3TJHD 2ICES 3U9PL 3ZHLA 2VUYA 2ID5A 5ICZB 3MLSH 2ZKHH 3NACH 4Q6YA 4HH9B 4XTRC 1BJ8A 4HWBH 1FNGB 5T3ZD 1ZOXA 1IM9A 5CEZH 3P11L 2A9NH 4IMLA 1T5XA 5KSVB 5CSGA 4OZGB 4F7EB 3RJDA 4GQ9L 4LLMB 3I2CL 2DQDL 5DJ6A 4E42A 1TLKA 1LEKB 4JZJC 4ODVL 4ZTPL 4GW4B 3FTGB 4X6DE 4LASL 2HH0L 2X10A 4AT6B 2EIEA 4NP4L 1UWEL 3QFJB 1FCGA 5KVFL 3PWVB 4KK6C 3OG4B 5IWLA 2XWJB 3T0DA 3T77B 2L7UA 2NR6D 3EO9H 3L3KA 1JUFA 4LP4A 3O3DB 5KTEH 4YNYA 4FXKB 5CP3A 1CQKA 3ARFD 3TPKA 3BKCH 3FOMA 2O61B 3KWWB 4JFXA 4HKJA 2UV3A 4M62H 1E4XI 2MFNA 4NN7C 1J8HB 1BM3H 2Q8AL 7CGTA 1PG7L 4WUKL 3KYKL 1FFPA 3BXNA 4U0QB 2A0LD 2IH1B 1JVKA 2UVFA 2X4SB 2I60H 4EEEA 4JFDB 4YHML 3GIZL 4OZGA 3S96B 3VMNA 4F7EA 5EU7E 1YC8A 4WVRA 3HZYA 1E4JA 3U46B 3W9EA 3IAQA 1UB5A 3VI3E 3DO7B 1MCKA 4I5BB 3H7BA 4P57B 4L3CB 2I24N 2YPLD 2OTWB 1MIML 1E4XH 4HC1L 3N9GH 2H26B 2GAZA 3GSNH 5TH2B 4HKJB 3T3MF 4DK3A 1A0QL 1QHPA 4YGAB 4UOW1 4BQBA 1B0GB 2H41A 4YGVB 2BOBB 5A3ID 4XZUA 3V5DA 3K4ZA 4JZNA 2QR0A 3ISWA 1KELL 5FK9A 5IW1B 2EDWA 5DRZA 3QFJA 3VXTA 3NCFB 4X99A 1RK0B 1CXFA 1LEKA 4DVRH 1UM5L 2NNAB 3MV11 5D1QA 1DE4A 1PX3A 5ACZB 5BO1H 1ND0B 3UZVB 2QQKL 3QEQD 2IQ9L 3STZA 3PXHA 4APQD 4XBGB 3KPRE 4PJGE 3MCLH 1BQSA 2HFGH 3JV4A 3RVXD 1KFAH 1BM3L 5D1ZC 2F8OA 4E41B 1V7MH 3TIDB 5J12C 2CLZA 4LU5H 1IBGH 5I0ZA 4QRTA 4HJJH 2HT3C 4BK5A 3S34L 2FECI 4Y8AA 2HYMA 3DETC 1NFDA 1H3PL 1NLBH 3S35H 4LRIC 3GIZH 1XR9B 2G60L 5DMIH 2AJ3B 3HUJB 2BVUA 4PGEB 2R2EA 3UTZA 2Q7YA 3VWKD 4WW2C 3OBAA 4JY4B 4O4YL 5I8EA 2NXYC 4J8RA 4EI6B 5ISZD 1RZKC 3EDFA 5BQ7B 2Z92B 5EZIL 4WTZA 3E1F1 4EQ3A 3V4PL 5FCUH 4OJFH 5KS9B 1FLRH 4LCYB 1S7VA 4HUUA 4G8GD 3P9WB 4RGND 2EE6A 2HVJA 1X4ZA 4EUPB 3GMQA 4XPBH 4GKOA 4H20H 2CK2A 1QFUL 3OV6A 3EDJA 4HXBL 4Z77A 1CLCA 4ODTH 4Y1AD 4LLWB 2XA8H 3B9KC 1DUZB 4N8VG 1DEEB 1EEZA 2AGJH 5JZ7D 1YEKH 4O02L 5D1ZB 2BVEA 5A2KH 3LD8B 5CBAA 2QLVB 4KUCF 1DLHB 2CJUH 4X9BA 2XA3A 4HLZH 4P3DA 4XAKD 5BO1L 4PRIA 3BZFB 3CPLA 5J1SC 1TZGL 3HE7D 3IETB 3SDCA 4OFPA 3OX8A 4WO4C 4F9PC 3MRHB 1DUZA 3T0WA 5D2LE 5L8LB 4I18B 3GMLB 4HEPG 2B8OT 3NFNB 1QUNA 4TVPD 4L9LA 5MEOA 1IKFL 5EC2B 3QQNA 2PYED 3PDDA 4PRHA 1FC2D 5HVWA 3QULA 2YOCA 3B5TA 3QCVL 4B0MM 1KYOJ 4ZAKB 3P77B 1D9KA 4O4YH 3LN4B 5EULV 5JO5A 4EI6A 4Y4KD 3VH8A 3G5YA 3V4PH 1A7PH 4JAMA 3UTZB 2YPKB 4PGEA 1EFXB 4DJMA 1DBAL 3GMOB 5BZDB 4JN1L 4U2YA 2AERT 2BOCB 3JSSA 5E5MA 4LLYB 2GK2A 3MNZB 5GGQL 4YDLC 3K1DA 1EFXD 2VLRE 4JG1H 4NBZB 5DJ0A 5E6IB 3TYFA 3OKEB 1BQHG 2CXGA 4YIQA 5EIVA 4WO4B 4JM2D 1FGVH 2NY3B 3IGAA 4JG0L 4U0RB 4J1UB 5C0DB 5HSFA 1A6AA 3GIVA 3WN5B 4PRNA 4FQQA 1F3JB 2EXWD 1UKSA 2XKNB 4U6VH 5ENWB 4BZ1L 4LSQH 5LGKA 1HQ4B 3RP1A 3U7WH 4KJWC 3SBWC 2NY5C 4M8VA 1A7QL 3DV6A 3REVB 4HMDA 3TBVA 1A47A 2W9DH 1SYSB 3ARFA 5IROC 3QDGB 1FZMB 3KGRA 4XT1C 3T08A 3X13A 1V3KA 3O81A 2BOBA 3P9LB 4KROB 3VU2A 1CD1B 3FT2B 3F65A 4LSRH 5C6PB 1FVDB 2DRUA 4N90E 4D9QD 3RNKA 4TUOA 3NAAL 4F57H 1VKXB 4WNQB 1IM3B 2GJZB 3L3GB 5E8DH 3QG6A 4ZXBB 3IKKA 2HT4C 2VLRD 1P5VA 1DBMH 4O58L 1CICD 3PP4H 3BEWB 4Y4KC 1CBVH 1U0QA 5JIPA 3BPLC 4RBPK 3F5WA 2VSDA 3AU1A 1SM3H 3HE6D 1UCBL 3L1OL 5GS1A 5TDPB 5IGXH 3ECBB 5TGBA 5D1XA 5CIPB 3GB7A 5AYUH 3O4OB 1X4YA 1S7UB 2W38A 4WW2F 3ULSA 3JWDC 3QIWC 4BFIA 2NPLX 2IH1A 1NDMA 2ZOKA 2FO4B 5L7XL 2A77L 2GFBA 3OKOB 1SQ2N 3PWPB 1G7QA 3MBEA 4EOWH 1N4XH 2FL5A 2FX9H 5AZ2H 1MF2H 3MUGB 5GIRA 5DTFB 3T4AA 1BFVH 1MCOL 3LHPH 2DM3A 3L3JA 5J6GB 2JCCA 4JPVH 5F88A 2X4NB 2GUOA 1ZT7B 2AJUL 1TZIB 3GJFB 1A14H 4OI7A 3REWA 5K9QI 4TRPH 5FYLL 4K94C 2XRAL 1A6WH 3A67H 3BSZL 4RA0C 5JOFB 3D3VB 3QWQB 5DUMH 1ORQA 4KJYB 1QBMH 4JREB 1ZLUK 2HTLC 3MRPB 4C59B 4WWKA 4Y4KA 1VGKB 5LCVL 3B3IA 5CBEA 1P5UA 4XCFL 2C9AA 3VG0H 3VXMD 3FJTA 3DNKA 4GKNA 1ZHBA 4U1MB 4DGVL 2EE9A 5F7DA 4HK3J 2XQBH 2UWEB 3PV6A 1NSNL 3IJSA 4HUVB 3T1FA 2WWMC 3G9AB 4LHJB 4ZAKD 5BZWA 2HT3D 3TBSA 4LHUG 3RWDA 3BHBB 3RDTB 5BRZD 1L7TH 1T2QL 4P4KA 3WBDA 4WFEE 5E8PB 1KIPA 4MHHG 2DD8H 2HLFC 3WDIA 1DN0B 1L6XA 3KLSA 2W65B 3IXTB 4APQC 2V2TA 1J05A 1N6QL 5CJ5A 5LXGH 3D0LA 4NO0A 3FB8A 3UYPA 4KV5E 4I0PC 3GSVB 3S3SA 4HUKB 5I17A 1S7WB 4OUUA 1EEUA 2B20A 4NQUA 4YHNB 3F5WB 4YHLH 3SOBH 4XNZB 3SGJC 5C0CD 1UWXK 4OZGF 2ICCA 1GGIL 1EEYB 4NKDA 4M62L 1MREL 3EJYD 5ACLA 4HMCA 2YD4A 3VXUD 1U8IB 4IRSD 3ROOA 1O0VA 3UTTD 4XP4L 4OD1H 4PJHA 3K8MA 3MO1A 4K3DH 3OXRA 3HFML 1CDIA 3Q6FB 1S9XA 5IFAH 3SDXA 1JFQL 5GIRB 3O2DL 2HFEB 4I48B 5EOTA 1OT2A 3MV8E 5JNYB 5BRZE 1AFVL 4HGWB 2YD9A 3BWUC 4OLEA 3WUWA 3BWAA 3ESUF 1NUDA 1CFTB 1JPST 2I5YL 1WIUA 4GRWB 3WKNA 3RVWC 2QHRH 4X83A 2YD8A 4ZNEA 2IADB 3V52L 4BFEA 4P9HL 4JQVC 3ULUD 3KXFD 1RZJL 2BHUA 5DQJB 4I4WB 3FO2A 1C5DA 2CDGA 2NTSP 4GXVL 4P4KC 3RBSA 3PL6D 1JGLL 2X1QA 3EYUL 4JFEA 1MI5B 5T1DL 3WV0A 4XVSL 5E99L 1NBQA 4ISVB 1DBJH 1I3RA 3RL2A 4WUUB 5FYKE 4MMXC 5DMYA 4YWGH 2HTLD 1TQCC 1UA6L 5FUZH 3MCKB 1FPTH 3K8LA 2DICA 1J88A 1BAFH 1HINL 3ARDB 4G80A 1PG7W 5KW9L 1LNUA 4ORZC 1DQQB 4EI5A 3KPTA 3LVEA 1ACYH 4XNYL 4JFOA 4M5YH 2D4FA 4XZUB 3DECA 4ZPTB 3ES6A 1LP9A 3RWJB 2VDRH 3MO1B 1G7PA 2W0FB 1WFTA 3BT2L 2J8UA 3CFDA 1WTLA 5EORH 1X5IA 2V5SA 4NZRH 4BH8B 1ZTXL 3O6LL 5D1XC 1CGSL 4HD9A 3TA3C 4OF6A 4D0CB 4I2XA 2JJSA 1H3XA 1I4FA 4LPXA 1YPZE 1QLFA 1U8KA 3BDXA 4PIRF 1HSBA 1BJ1H 2I9LB 3MV9A 2ZCKL 4H8WC 1JF1A 4O9HL 3WDHA 1EVTC 1JF6A 4ZUSA 2FEDD 3GJFH 3O6FA 2MKWA 5GGVH 4S0TD 1CDHA 3B9AA 4XNUL 3OJVC 2YS4A 3BZDA 3OGCB 1DQMH 3BYYA 3UROR 1VA9A 3OXRB 4WEUD 5CP3H 4Z7UB 3BPCB 3G04A 3VXSA 4QXTB 1TETH 1VPOH 4NYLA 2MNUA 4GW4A 8CGTA 2A83A 1K6QH 3AMKA 1J1OH 5I1DA 4YDLB 5EFIA 3VXUA 4ENED 3V6ZA 1KCVL 4QHUA 4YDVA 3GB7B 5CWSB 3N50A 4MHHI 4HGMA 4Y5YC 1I8MA 4QNPE 1QFWM 3DX9A 1QLEH 3U79A 1R6VA 4MLSA 2JJUA 5L9DH 4PJ7B 2GTWA 5D71H 4OFYA 4FQXA 5KVGL 4L3EE 5J11C 2WUCH 5GRJL 3ZDZE 2GUOB 4MQXC 3NZ8A 1ED3A 2YA0A 5CJOL 4IRJB 1XGQA 5K9QG 3PV6B 1CD9B 3WMSA 3K80A 1NCWL 1C1EL 2V9TA 5ID1B 1U8NB 2XN9A 1I9JH 4N0CC 3ARFB 4F7MA 1QBLL 2AJXH 3V5KA 5C07B 5JDSA 3VFGL 5CEXB 4OZIF 5K9OB 4DQOL 1QRNE 1U8HB 2R0LH 1S5HA 2X9YA 1QD0A 1K5NB 4G8GE 4PYGA 1RJLA 3VJ6B 3HAEG 1MEXH 1TVHB 2ADGB 1AXTH 3OKYA 5DHVH 2G9HA 4ZFZB 1T7YA 1KELH 2IPTL 2MMXA 2BNQA 3CVHA 1JI1A 1WWWX 4FQPA 5FGCE 5C9JA 2VZ3A 1Q0YH 4UINL 3IDMB 4JO1L 3DX6B 2LFGA 3RIFF 2XWBB 2NY0C 2XZZA 4QY8A 3FQTB 3MNZA 2D2OA 2DQEH 4EN3A 3HG1A 3QB7C 4I5BA 1IQDA 2NXYB 5EOCL 3ZTJH 3QUZC 5CLTA 5E2UL 3PE9A 3GBLA 4XPHL 3LKQB 4XPGH 3WLBB 3OKDB 1XEDA 4RRPG 5C09A 4K3GA 4PR5B 5D2LA 3OHXA 2V5MA 3KPNB 3LB6D 3ZT7A 4YHIB 5KVGH 2EC8A 4FQJH 3NFPA 1K9TA 3I85A 4Y1AE 1B9ZA 3GHBH 2FJFB 1CFSA 4L8BA 2GYSA 3CSYA 1N8ZA 2VDNL 2NY5L 1RAMA 1MCJA 3MFFA 3FAXA 4M5ZH 1EXUB 4HUXB 2Q8BL 3OKDA 1KLFA 3MRQB 3BMWA 3D5OF 1CFQB 5ISZE 3RI5K 4TTDD 3O4LA 1BJMA 1G7JB 3HE6A 4QGYA 3P40A 1R24A 1IAKB 4LLMA 1ZSDA 1A4KA 2C4FU 4XPAL 1FV1B 2A77H 4IOSD 1BD2E 5ICXA 5IF0B 4OCLC 1KT2A 5HI3C 5CBAB 2FYYB 4J3VA 4G9FD 1OARH 5ICZA 5D1ZA 1BD2A 2P5WD 4K9EL 4AG4L 5CLWA 5H2BA 3CVHH 2GTZA 1KLGA 1DSFL 1TVHA 5MP6H 3NH7H 4NM8H 4CVXA 3RVXC 1NPUA 4TULL 4GFTB 1G7HA 3LZFH 4XMLL 1FFNA 5D2NA 1QSEE 4HKBB 4HV8B 3V4UH 1LP9B 2PYFB 2O5XH 3RWJA 5GSRA 2P8LB 4Z7VB 5ALCL 5C0BB 5F7MC 2HJFB 1K8IA 4PBXA 4M00A 4Z7OE 2XZCL 1G7MA 5I1KH 3QDHA 1QKZL 3P4OA 1RIHL 1CXHA 1AGEB 3U7YL 2EEBA 1J8HE 3MV7E 4KJYA 4PY7B 2KBGA 5DJCB 2NY2C 4G42A 3HNSL 4OCSH 3C5JB 3LIZL 4MGXA 4RAUB 5HI5C 2AK4D 1ULVA 2D7TH 2V7NA 3WE6A 1A9EB 3DO3A 5GJTL 1DDHA 1JJUA 4U0RC 4G9DB 3B8SA 4PLJD 3ARWA 3KS0H 1SVZA 2H1PH 3PQYD 3V0AC 1FG2B 1A22B 5CJBA 2Q76B 4HUNB 2ADFH 4JZJB 4KK5C 1FJ1B 1LD9B 5HYEA 1FRGH 4QEGA 1UM4L 4P5KB 1D5BA 2EECA 2NLJA 1MWAL 1D6EB 2F54D 1OQXA 1X6LA 4PG2C 4YR6A 4YHIA 4F9PA 5F8QC 3VXTB 2ICWA 3BPCA 4GMSL 4D9QE 1LILA 5TE6L 5EBWB 5J89A 2G5RA 2NY0D 4U1IB 1DSFH 2Z31C 4BKLA 4XRCB 3QNZA 1NCAL 2OMNA 1IGTB 5C0GA 3SDXF 4ODXB 3ET9F 3LV3B 4I3RH 4XNMA 4QRRD 3NIGE 3A6OA 1QG3A 3ZE0E 3PDGA 4XP6H 2IG2H 3CDFA 4J3SA 3ULUL 2YWYA 3U4AA 4W6XB 1Q38A 2LABA 2KQNA 1JFQH 3D69A 2P4AB 1C5BH 4KPHH 2C3XA 2XTJE 4LLQA 4AK1A 3EUUA 4OCXH 3STBA 4NO0D 4LCCA 4L3EA 1G7LA 5I0DA 4LIQL 1H5BC 3WEXA 4EQ2A 4P4KD 3NGBC 3G08B 4YX2H 1BECA 2AQ1A 4LGPB 3UTTB 5KN5B 3AY4C 4JPWH 5LAXB 3ZL4H 2X09A 3DURB 1RJYB 3BESR 1NAMH 1UENA 4YHZH 3BD3A 4OF5A 3BGFB 2Y5EA 3MODH 4FRWA 3MC0A 1CGWA 3X3FL 4FZ8L 4NRZA 3PUCA 2B5IC 1A6TA 3DVNA 4U1HB 1ED3B 1GGIH 2A9NL 2HKHL 1NMCC 5HHME 3VXRA 5IFHH 1T7WA 3TA3B 3N85L 3QA3A 4Q9RL 4L1HA 1MRFL 1F42A 3WKML 1UXWB 4XCNB 5IB5A 2VSCA 1S7QA 5IVNA 1LDPL 1T7ZA 4L9LC 1SJEA 2B4CH 4URTB 5ELIA 3CGTA 3HMWH 3RUGE 4Z78B 1P4LA 2VTFA 3LOWA 4G8FB 3MPCA 3QCTH 3WNMA 4I0PB 2DQHH 5D7LD 2E7BA 1JYVA 1MNUH 5C71A 1D5IL 5TE4L 5IK3B 5HPMA 4JY5L 1LQSR 5E2TH 1CR9H 1SEBA 2GW5A 2Q87A 4ORGA 5CSZA 4XP5H 2F9BT 4HUWA 4PLKD 1VGEH 4RMSA 4WEBL 4P2OD 5IVXF 1G84A 3T4AB 2IBBA 2QQLL 2FEDC 1QEWB 5D2LB 2D03L 3QDJD 3MRHA 3O41B 4MDIA 5TFSL 2GIYA 5DD1H 3BIKA 3QWRA 5ESVB 3VG0L 2VAJA 3WFEL 3MJGX 4IOIB 3WNKA 3MBEC 4BQ8A 2I9LA 3MJ7A 3PGCA 3QCUL 1H15B 5KZCB 5C7XH 1I1CA 4OF7A 1QPPA 3CFCL 3MGOA 1J0JA 3IAPA 4HIXH 5KOMC 4LKCB 4LVOB 4XNUH 4AQ1B 4QXUL 2E7LC 3I6GB 4ODSL 3SKOA 4I3SL 2HH0H 3H6JA 4KK8D 1G1YA 1WFUA 1JNNH 5F9OH 2CIIB 4QKXB 4HW6A 4HIJA 3VRJA 2G2RA 3P4NA 2VNCA 3ARFC 1PG7X 1PKQE 2LAGB 4QHNA 3E6FB 4MA7H 4F2MA 1J05B 4KTDL 2HN7B 2IFGA 3SE3A 1OVZA 1UM5H 3SGEI 4J3UA 3I50L 4FQ1H 1KTDB 5C0AA 5KVDL 4RGMB 4JFOB 4CMHC 4ETYA 5KSAA 3RL1A 3MNVA 1IFHL 3DXAA 1F45A 3ES6B 4ODHH 4KUZL 5IB1B 3TCLB 1MQKH 4CADB 1E27B 5C08B 3QFJD 2EEDA 5I16B 4HDIB 4U1GB 3EIFA 1KIQA 1IBGL 2IMMA 3QEGL 2ADJB 4OKDA 5GS1C 4QHNB 3QIBB 3ZHDA 2AEQL 3G5XB 3T0VA 4HS6A 4PJGA 5I8CB 2GTWB 2PCPB 1AC6A 3B2VH 3QIWB 4K23L 4JRXA 5D7JA 1NBYB 2CK0H 2HKFH 3GEWB 1G9ML 4OZFB 4XCEB 1ORSA 3GSUB 2R1YA 2RCSL 1DL7L 1VFAB 4AH2A 1PFCA 2Y36L 2V7NB 3QIWD 1FZKA 4KQ3L 5EIIA 5KBNC 4PRDB 4UV4H 4YAQB 5DQJA 2XTLA 5DURD 3DSFH 1RZFL 1JPSL 4XHQA 1BZQK 3ZTJG 1ZA6B 4OLXH 4LSUL 5CD5D 1QSFB 3K74B 2J3SA 1JNJA 4YDJA 1ZWIB 1F58H 5KSBA 4U6HA 5B8CB 4GBXB 3CXHJ 3A67L 3BSZH 1XGYL 5HDQH 4PJHB 4RMRA 3B43A 3P4MB 3RAJH 5ILTL 4NM4L 4NWUL 1NFIB 5HBBA 5FGBC 1XMWA 3HNTH 2EC9U 2YKLH 5HHMB 5D96B 4Q9BA 1EEQA 1OT1A 4QOKD 3FFCD 5DD3L 3E6FA 3OZ9L 2DBLL 4LMQI 2D31B 2GITB 5IBTH 5LVEA 4RDQF 1YN6B 2DMKA 2Z91A 4U1SB 1IGFL 4PB0H 1LHZA 1U6AH 3TBYB 1WWBX 1MHHA 3ARBA 1P4BL 5B38A 3M17B 4U3XA 4P2YA 1IL1A 4UDTA 2EEAA 3S5LA 3VRLE 4ZFOL 1IM9D 5E2VH 1LEGB 1RI8A 3D9AH 4YHKH 3S96A 3KPSD 5F1SA 1FVCA 3PXJA 4IRJD 5BS0E 1I7UB 4WU5A 3QFJE 4P99A 1A1MB 2W07A 5LG1A 3S5LG 3LKPA 2NY4B 1ZLVK 2EKJA 4AEIL 3O3AB 3ZE1E 3B5GA 5CILL 4NOBA 3CFKA 1T7XA 1OAXH 4HUVA 2R0ZH 4FG6C 1BOGA 5GS3A 4OCRL 3L3OB 4R0LA 2DYPB 2HJKB 3QUYA 5IJKA 3VCLA 1OGTA 4GBXA 5DYOA 2PYEB 3I2CH 5HGDA 4LASH 4KZEL 4LCWD 4XH2A 2UWEE 1ADQL 4L3EB 4NN5C 5F72S 1LK3L 1J1XH 1ZVSB 35C8H 4RFOL 3QJHA 5T3XE 4R26H 3V6BR 4A6YB 3HR5A 2OK0H 3MLVL 1CE6A 1U8MB 1VPOL 1R5IB 1WSST 1WFOA 2KUTA 5TQ2L 3TA3A 2F19L 4QHMA 3EFDH 2B1AH 4ZUVB 2VR9A 5JDJA 5BMFL 2DTMH 1J0ZA 1LP9E 3KPPA 5FDWA 1QA9A 1OP3K 3V4UL 1MFAL 2FBOJ 5BZDA 1U6AL 2ZG3A 3D2UA 5CHNA 3ARVA 2IF7A 3MRCA 4LKXB 4G6AD 2MPAH 3MSPA 4EDXB 1QNZH 3P4OB 1MLCA 1YMME 2VXTL 2CDEA 5FYLD 1V05A 5CEZD 4KMTL 4KFZC 1CZ8H 2ZCHH 2VZOA 3L7FA 3U9UB 1I85A 1BBDH 4FS0A 1TPXB 4KKLD 1CYGA 5EN2B 4OLVL 2MHAA 3LSOB 1JMXA 3PWPE 4BFIB 4CU8A 1JRHH 5FHBH 5DHVA 4K7FB 3MR9A 4W4NA 4APQB 4M48H 5ANME 3FZUD 2I27N 4EDWL 4KTYA 4TSBL 2R2BB 4N8VA 1I7UA 4HQQH 1FFOA 2BNRB 2OX5A 1GIGH 4FTVA 1EPFA 3WJJC 3JTSB 2OQJA 4OTXL 4M1GL 4XP1L 1OSPH 4HXAH 4CNIB 3IFOA 5E8NA 3BDYL 5DJ2A 5CMAB 1IM3A 3L3GA 4DAGH 3J7HA 4HX1B 2AV1A 1T3FB 3MMEB 5FA4A 1AQDA 5FYJU 4PBWD 3SY0A 4JFFE 5DFWH 2DLHA 4PJHE 5ESVA 3W0WE 4KGLA 3TBVB 5HHOA 2ICWB 1OHQA 2V17H 1FVEB 4HIIA 4LPCA 3OKNB 5FGSA 5J6HA 3F7YA 4HKBA 4HV8A 2F54B 4LSVH 5HTSA 4HLJA 2H6PA 1EUTA 5HJ3A 4MNGE 2VLKE 5CP7A 4HKXA 4XPHH 4P4RB 2SEBA 4LAQL 4MXVF 2ATKA 2HAZA 4JDTH 4LLDB 5HYIA 4UUJB 2E8ZA 1UG9A 2Z92A 4R90L 4WWKD 2H2PC 1CLOL 4WRLA 3BPOB 1PDKA 1MWAB 4P9HC 4WHDA 4ELKA 1TJHH 1S7RB 5A3IC 3D39E 3C08H 3HG1B 3MUY1 1YMMD 3GSQB 1XZ0A 5FYLE 3KS0J 4XMPH 3RZCB 1KJ3L 1OAKH 4POUB 2YD7A 1AGDB 4Y19E 3VE0A 5IW3A 3Q3GA 3S37L 4HUXA 1C16B 2J6EL 3DRQB 4WFHD 4Y5XB 2XT1B 2VABB 1U3JA 3WL9B 5JQ6L 5ABDE 2ADJA 3LQAL 2ZOLB 3NIFE 1G7QB 3MBEB 1NGZB 3NFNA 4QOKB 3P73A 3QUZD 4ESKA 5IIEB 5DD0H 1KLGB 4P2QA 3WEXB 4NNPH 1LEIB 4IJ3C 4NN6B 2V17L 4NQTA 4ODUB 5F1NB 1YPZF 4HPYL 1OTSC 4G9FE 1TJGH 4JPIA 1D5IH 1JV5A 2P5EB 4CU7A 1FFOB 4R2GB 4S1DD 4JO3H 1TCRA 5JZ7C 4KK6D 2IBZX 2E9IA 5FHAH 2XKSA 4P57A 2GJZA 4WTXA 3SJVE 5HYSB 3KNBB 4NQCE 2EE2A 2NW2B 1KULA 3FQRA 3RY4A 1OAUL 6FABH 3D1MC 1A7PL 1OP3H 3NMEA 1QSEA 4LFHD 4LLVA 1OLLA 4N0CD 4OGYH 1FZMA 1HHGB 4YDKL 4X9HA 1KN4L 2HVJB 4GAGL 5HYJD 5I1AB 2XTJD 5F3BA 3DV6B 3P30L 5DUBB 1GYAA 2BXZA 1U9KA 4V1DD 4UT9H 4YLQT 1INQB 5DS8B 1F5WA 4TNVK 4X6CF 1NL0L 5I8KL 5BVPL 1OAQL 1B6DA 3R0NA 4FFYL 2DF3A 3FO1A 1P4IL 5DEFB 3NABL 4KKBD 1IQWL 3CLFL 2D7OA 1BBJA 3IF1B 4NBYB 1NUGA 4DWHA 4NDMB 5MI0C 3T3PE 5HPOA 5FM8A 5TE7L 3LKRA 4E41A 4ELKB 3BIBX 4LGSB 4NUJA 4Q2ZB 1A3RH 5CJQL 2FHCA 5DZOA 3QXWA 3GSXB 1I8MB 3C6SA 3VXPB 4I13B 5JA9A 1SBSL 1ZEAH 3KPOB 3WFBH 5I1JH 5JW3H 1EHLL 1RJLB 2WINA 3EYVA 4OD3L 2PKDA 1YEGL 5I1LB 3VGAB 3KPQA 5C0JB 1RFDH 4PRHE 4D0CA 3IVKB 3ULVH 5D7IF 3MXWL 1RULH 3CNKA 3QXTA 4FNLL 4HS8H 5EOCJ 2JJTC 4JN1H 1OLZA 3BQUB 2A6DB 4FFWC 1A5FL 3SKMB 3V7MA 1Q0XH 4PP1C 2AEQH 1ZA3A 3VD3A 5INDA 4NQEE 3VXUE 4U1KA 1NAMA 4H8WH 1AO7B 1A4JA 4G6KL 5HHMD 3EFFB 2F58H 2A74A 2J6EA 3FOLA 2FGWH 3SDCD 2EH7L 4C55A 3HAEB 3MRGA 1II4E 3CC5A 5C09D 4NM8L 4I0CC 1JTPA 4IIQC 1T80A 3AC0A 4NQSA 1F00I 4Z7QF 4LHUA 5SWQA 4NKQB 4LSUH 2YD2A 3EYVB 1G6VK 4PJFB 1DLHA 4RAHA 3WS6A 4M1CD 3E0GA 4I8DA 1REIA 3TVMC 1TFHA 2P46B 3TO4D 1T04B 3T2NL 4MNHB 4KMLB 3WIFA 1FNSL 3BUYB 3G5VB 1JNLH 1BQLL 3OG6B 3IJYB 1MCCA 1WBZA 1YNKL 2JE8A 2O5ZL 5IMOB 1M71B 1BBJB 5I73B 2P47B 4GMTL 5T3ZE 5FYKD 1G7PB 3VH8G 1TTUA 4OT1H 3Q5OA 1N59B 4P59L 4ZOBA 5IFJB 2Q8AH 1P7QB 5HGHB 5IJVA 2OXGA 4FXKA 4EIGB 4X4YA 1T83A 2JJTA 3D85D 1INQA 3PG2A 3C8KB 3DGGB 3MXVL 4HPOH 4IJ3B 5DJ6B 1KCUH 3MXWH 4GRLD 3O2WL 2CR6A 3M8OH 5EU3A 3S6CA 4ACPA 5K59E 2K7PA 3O6FD 1S9KC 2ZUQC 3FQUA 2P8MB 1EERB 1FZOB 2XFXA 3VG9C 1T0NB 4U3CA 2W59A 4XC1H 5IUSA 1K85A 1I9EA 1TXKA 1EGJA 3MUZ1 4OFYD 3SDDC 1A9EA 4F80A 3JVGA 1EIBA 1XCTB 4NC1C 4GG8B 5JXED 3LRHA 3MLYH 1ZT4B 2HLAB 2ATPB 3IU4H 2FJHA 5HYQA 2H45A 3FN0H 2E3VA 1IEBA 4XB8A 5SWZE 1RUAH 1ZGLM 4M93B 1R3KA 3WFCL 1G7MB 4UT7H 1MEXL 3QEHA 1RMFL 1GZQB 4QTHB 2YPLE 3QUXC 5TDOB 2VR5A 5BV7B 4OZFG 3KDMB 4N0UE 1F11B 3U4BL 2H2SC 2NW3A 3MLZL 3TV3L 1C08B 4K8RH 3UTSD 1Q9KB 5GGUA 4IOFC 3H42H 2B1AL 3SKNA 1EEYA 3RGVA 3VMPA 1YQVL 5C0CE 3GJEA 2D4DA 3U82B 3RPIA 3SJVB 2ESVE 3E8UH 3CCHA 4P23A 2AJSL 4NQVA 4U6XA 1QBBA 1NKRA 3S5LB 5GRJH 1PZ5A 2YMXH 4PLNC 5L88L 3V95A 3QXAA 4MXQD 3AY4A 5DSCA 1KNOB 2PO6A 1I8KA 5F7EL 2FX8H 1F6AA 3HRZA 4TSCL 4QHLA 3TJEH 5EO9A 4JFHE 4KKNA 1YY9C 3KPSE 3JVGC 1YQ2A 1I85C 3O6ML 4CGTA 1UB6B 1ZLSH 1MFDH 5C0RL 4BKLB 3GK8L 4UV4L 3MV01 1JPFA 5E9DB 4XNXH 1DANT 3MUGA 5DHYB 5T1KA 3ARED 5KSBB 2B0SL 1BZ7A 3HUJE 3FB5A 4JVWA 5EU4A 1KBGL 4Y5YB 5IB2A 1IAIL 1D6EA 4J12A 5EO9B 1G9MC 3VA6A 4POZD 3MRPA 1Y6MR 5EU6B 4JO2L 5DD5L 5I17B 4X98B 4UTAL 5SWZD 5K9JH 2WW8A 4R7DB 1RUQH 1RZKH 4HX1A 3QQ9D 1D5MB 3LDBB 4ZNEE 1KJ2L 3GBMH 5I9QB 2E9WA 2BX5A 4M9OA 3P3YA 3NOIA 3UBXB 5FYKL 2VAAA 2E6JA 2XXMB 3FQWB 4MVBD 2LU7A 1KPUA 3O6LH 3QQ3A 3RWDB 5GGUB 3SDAA 4KVNH 4YE4H 4HF5H 4ONFH 4RCAA 3FO0H 4Q58C 4U6YB 4NKIH 4ZOAA 1NKOA 3ULVD 1RIHH 1HILA 4GRLA 3NIDE 5ITFB 4GUPB 2H9GA 1YEJH 5JR1L 1J0IA 1JZ2A 4JM4H 4DUWA 4OSUH 4M7KL 2PW1B 3KYOA 4MS8C 5T3ZL 4DKFL 1M05A 4BUGA 5BS0D 1ZGLP 2XG5A 5C86A 3TNNA 1YPZB 3K8KA 3BZ4A 1GCFA 2I9TB 2DMBA 2BMKA 3GIVB 5KG9B 1ZXQA 2HT4D 5F7YC 1BVLB 3T0AA 2R39A 1A2YB 3EZ8A 5IVZA 4KI5E 5DF0A 4AYFA 3CSGA 5IESL 1B2WL 1JYNA 1J1OL 1JPGB 3QG6B 3ZE2F 4XRCA 3KYMA 1OP5K 1MF2L 3STZB 2AS5M 3OKLB 5J1AB 1GAFL 3QJHB 1CD1A 1KJMA 4NZJA 1LE5A 3RGHA 5B4MC 4JY6B 4JPKH 3FCTA 4OIIH 1KN2L 4UDUA 3QEQE 3I6KA 2RFXB 3WSQH 3Q6GH 1UZ6E 2P5EE 4GRMB 4FQXC 3VFOB 4F58H 1MCDA 2ARJB 2P24B 5CP7B 1WBYA 1U91A 3LMJL 4DN4L 1LDSA 2DYPA 4WI9A 4HIHB 3WNNA 3RTQD 3V5DB 4O9HH 2C7UA 4OAWB 2YD5A 2VLRB 1EAPA 3QAZB 4L3ED 2MQCA 3QHFL 1C12B 1CFNB 5J3HD 3GSOA 4Q6IB 3VXSE 3MLUH 1RIUH 3ZYIA 3AAZB 4N0UA 2Z8VC 4EN3D 1S7SB 4FFZL 5ID0B 1QSED 2WUBL 1NEUA 3HC4H 4ZS7L 4X6CA 3IETA 5B8CC 1Q72H 4ODWA 3S98A 4H1LG 2BSRA 4LDEB 2HTKC 1BVZA 2Y6SD 4LVNC 4UQ3A 2E5EA 3ULVE 4PJ5E 5IB3A 4EI5C 4HXBH 1TDQA 4N9GB 4Z0BH 2NY4C 1WLHA 4PV8A 5IVXB 3UC0L 3MJ6A 4Q9CA 5FHBL 4JQIH 2XA8L 4JDVA 3MV7D 4XCCL 1GGCH 4Y4HD 2A6IA 4NCDA 3I9GH 4X80H 4X6EA 4GW5A 1CK0H 1CIUA 3Q48A 4ZFZA 1N5AB 1F6LL 1DEEA 1EEZB 1I1AD 1WZ1H 4BSVB 4UINH 3HPJA 4BZ2L 4OTXH 3OQ3B 4DGYL 1Q9KA 5ERWB 3V0WL 2CIKB 2W91A 4JFXB 2OZ4H 4P2QD 5FOJA 1W0VB 4PJ8B 4Y4FC 5GSVB 3UO1L 3T09A 4E0RB 4JFZH 2BSED 4WY7L 1JGDB 5ADOL 3C5ZD 3CK0H 4XWGL 3DARA 2G60H 5DMIL 1MVUA 3CJJA 4XNQB 4GKSA 3HMWL 3O6KH 1KV3A 4OIIL 3SEPA 4X5LA 4YDJB 3SOBL 5E6IA 5IHUH 1BWMA 3PQYA 43C9A 1ZLWH 1WISA 3GSXA 3VFVB 4FQJL 1IAKA 1IVLA 1P9MA 1NAKL 3FHQA 1KB5H 3D3VA 3VDCA 1CFQA 1YY8A 1Q9WB 4LQFL 4FHBD 5I18L 5GS0H 1QTYT 3QQ4B 5FB8B 1GGBL 4PJBE 4MZ3A 4DEPB 4OZFA 3V6OE 3QG7L 1B4JL 1HZHH 4ZOEA 3CSYB 2DJUA 2VDML 4RGNC 4XBGA 3P77A 1A6UH 1JZ7A 2DLIA 1EO7A 4OF3A 4HKXB 2YN5A 4C54A 5E9DE 5F96H 1NSNH 1X5FA 2EH7H 3AREA 4NQDB 4G6JL 2ADIA 3VFUB 4ZD3H 1FBIH 1FVEA 4HIIB 2D7NA 3CZJA 4HCRA 1IC1A 4X99B 5D1QC 3HPLB 3WHXB 5CCKL 2NLJB 4UOJA 2PYEA 5B39A 4I48A 5EOTB 5JNYA 4MLIA 3NACL 3U0WH 4KK9C 4U1GC 1RD6A 2EYSB 3WNPA 2YEZB 5D1ZD 2ZUYA 2Y4SA 2DLGA 4Q97A 1PX4A 4Z7WF 1NANH 5D8JH 1HKLL 4Y5VB 3KXFB 3G9VA 3BUYA 3G5VA 4WUUD 3KPLA 3RVVC 3BAEL 1IC7L 3LEYL 5E6IC 1QQDB 4PTUB 2DQGL 4OUUB 1NGWB 4ZXBA 3VFVA 3ARDC 5IHZA 3WIHH 1S9WA 5F1NA 3CFEB 4H0IA 5FYJD 5HD8D 2O26U 3ZE2E 3KPRA 3KLHD 1T83C 4PJIE 1S7XB 5EBMA 1OM3H 3WD5L 4LCYA 1U8NA 3BGMA 4WV1A 1ADQA 5D6CB 3D25A 3O3EA 2WLYA 1VSCA 4KRMB 1B4JH 2V5TA 4AENB 3I84A 4DFHA 3OKMA 4ZPTA 3UTQB 5E24E 3IDGA 3K4AA 4MA3B 4NQCD 2GT9B 4FQ2L 2NQCA 3H3PH 3O3UN 4Q6IC 5ISZA 5BXFA 4F7PB 2VKWA 4WUUE 4MYWB 3L5WB 4R97B 3EOTL 3CD4A 5AWNH 2X05A 5DI8B 4PJEA 4OZIE 4PRAA 4TVSa 4Y4KB 5CCKH 3MFGB 4K8RC 4UOW0 3TH2T 4XMLH 2FJHB 3JV6A 4HT1H 5C09E 2VZVA 2OMBA 3LHPL 5D5MF 1HCVA 5ALCH 4ZS6D 4HHAA 4M6OL 3RAJL 1Y0LA 3S88L 4P5MB 4R90H 4N1EA 1QP1A 3VFPA 4ODHL 4M7LH 4R4NC 2X9WA 2AJYL 1U91B 4JHAL 7FABL 5DEFA 4GRWH 4PB9L 2X4TA 4GAJH 4GRMA 1FDLH 2R0KH 5DJDB 1U58A 3IS1X 1UCBH 3L1OH 4HIEB 4HK0A 3TFKD 3FKUS 4G8GA 3I3EA 4YC2B 1N3NA 5HHOB 4K23H 3OKOA 1P7QD 3O3EB 1VACA 5IMKA 5IBLD 2JELL 4PJ5A 5GS0C 2J6EH 2MQ3A 2VZTA 2A6KA 2VDKL 1RUKH 4G8EB 1F6AB 5DUPH 1MVFA 1Y18B 5ADPH 2E7HA 4X7DC 3NIDF 4JO4L 4OZIA 3DX6A 4DOHE 4ZPVB 5GGTA 3NCEB 2E27L 1DQTA 2L4OA 3O6MH 1AR2A 1CF8L 3WXWL 1DP0A 1M6OA 2IFFH 1UH3A 4OLWH 4K7FA 3ABZA 4G7YH 4BH8A 3EOTH 1U2CA 2P8PB 4FABL 4QO1A 3VFNA 4NQEA 2IANB 4LHUB 4D3CL 1QFUH 5J13C 4NCC1 4PGBA 1EO8L 4K2UH 2A6KB 3VRLF 1FNHA 2DLFL 4AMKL 1C5CL 4QTIH 3ULUH 1S8DA 1MAKA 1F2QA 4S1RH 3BIKB 2ENYA 4HG4K 3S88H 4GBXD 5DEGA 2ZCLL 1BQUA 2GCYB 4GS7C 4RA3A 3DROA 3HB3D 3PIQA 3T8XB 1WAAE 3DVGA 2XKNA 2ADIB 2OTUB 4DVBB 2N4IA 2OTPA 4HUWB 2GJ6D 3BH8B 5EWIH 4JHWL 3PABA 1UYWH 3UTSE 3KPSB 3WUZA 43CAB 4OZGE 5EO0B 5CD3A 4L4TD 5KSBE 5F89A 3AM8A 4FFVC 1EGJH 1TJIH 1AGCA 4E5XA 1DDHB 3QIWA 3W0WA 2PETA 4O2EB 1OY3B 2OP4H 5ALBH 3MYJB 2XWTB 3LQZA 4G3YL 3ZDXF 3X3GH 3MV8D 2DBJA 4KV5F 4JM4L 1BQHA 2DN7A 3D6GA 2OM5A 4OLYH 2LQRA 1G0DA 4PTTA 1FYTA 4FQIL 4QF1B 1EDQA 1XF3B 2F74B 4OLVH 2WQ8A 1QBLH 1PYWB 2Z4QA 3C60A 2GJ6A 5GZNC 5KVEH 3B2UC 1ZT1A 1ES0B 4R0LB 4X4MA 3JWOH 4XWOD 5CEZL 3NTCH 4RAVB 3WS3A 4D0BA 5B21A 2OI9B 1JTOA 1RZGB 3PWPA 1NCBH 5DRXB 3UYOD 1XGUB 1MNUL 5CGYD 5JA8B 3D48R 4TUKH 4HIJB 1FNEA 15C8L 4R97C 4ZTOL 2FX7H 4ERSL 3OX8B 4ELMF 1MH5A 2AABL 4X7SH 4P46B 4PRPE 1FHGA 2DIBA 2NY3D 4YPGA 3OPZH 4ZDHA 1KCSL 4ZPVA 5EU5B 3G5ZB 4RZCB 3TBYA 3RU8L 1A3LL 4X6FA 3UX9B 3H2WA 3S3JA 5IQ9B 1B3JA 1CT8A 1K3IA 4NUGL 5DZNA 3HG1E 1FFPB 3BXNB 5GZOC 1NEZG 3CFDB 5D7JD 3IDNA 4L4VA 3UAJC 2VB5A 3H9SA 5F9AC 1IILE 2DWEB 3EJZC 4JDTL 3OJ2C 2NX5D 2DI8A 2GJ6E 2FJGA 4U1KB 3OR7B 3GSOB 1J0YA 3BH9B 2AKRA 2JKXA 5I75C 1AE6L 4OAWA 3K7UA 3JZ7A 4QTHA 5K59F 4TSCH 3NZHH 1VB9A 3LQAC 3VXNB 4FA8A 1QFWL 1GGUA 1JHKL 5TF1H 1JHTB 3VFTA 5ITBH 3QO0A 3GRWL 3GSNL 5I1LA 3I6KB 1P6FA 4LBEA 4ZYKB 5C3LD 2IGFL 2IPKB 2MCPL 5KVFH 4LEOA 1B4RA 2VOTA 1GC1L 3TT1H 3NTCL 4DKDC 1XR9A 4JFQB 5FF6A 3OSKA 3TZVB 1A1OA 1HH6A 4JN2B 4TQEL 4HBQA 1XCQA 25C8L 3QA3B 2UZYB 2X89A 2W0PA 5FXCH 4QT5A 3I6LE 3DV4A 3U36B 2OSLB 3SKJL 1FZJB 5BV7L 3C5JA 4RAUA 3SDXE 5C0BE 5FO9B 4NJAL 2VQUA 1D9KD 1ZKAA 3IDGB 4OM0H 2J8OA 5K9KA 1MPAL 4X8JA 4N68A 1E28B 3MLRL 4HJGB 1Z6JT 3RIAF 2Z93B 4UI2A 5I2IA 4XP9H 4CRPA 1HYSC 3FB6A 2A73B 1FAIH 3VCLB 4GXUN 2XN9B 2DQFA 2P5ED 3N9GL 4N1CA 2EC9T 3L9RB 4KQ4L 5D1XB 4FTVE 2J1KA 4MJIA 1ZMYA 4R0LC 3CFKB 4R7NA 5CILH 4S2SA 2O5YL 3TZVC 2VLKD 4HH8A 1OTUD 1AE6H 1H3TA 3FRPG 3O3AA 3FN9A 4ZTPH 1S7WA 4X7EC 3TIEA 3LEXA 5MI0B 3QWOB 2F53A 1QQDA 1NGQL 1W0WA 1WIPA 5ESAA 1JMZA 4P3CL 2X7LA 4JLRA 1TCRB 2ZJSH 2JF1A 4X6FB 5D2LF 5LGHL 1R3IH 4Y88A 5SWQB 3G6DL 4IBLT 4Y16D 4Z18A 3BKCL 4N8VB 1I1AB 1GC1H 1J1XL 1YMMB 5KANI 3MYZA 3X12B 1MCHA 1JYXA 1KG0A 5JLZA 1KOAA 1QRND 4P2QB 1PY4A 2CRYA 4IMKA 1XF4A 2R0WH 3BP5B 4YHOL 4X9GA 4QHKI 1CI5A 4JB9L 2F19H 4PJ9C 1ODAA 1KFAL 4L8BB 5D71L 3MLWL 4P23C 4EUPA 1OL0A 4KZDL 3IFPA 4Z7WB 4ODBD 4KMQA 3VWKA 1S78C 4I3RL 1KJ2B 5C0JA 2CQVA 4HFWA 3D2UD 2B4CL 4PJIF 4LOUC 3X17A 4LL9A 2DQHL 3V8CA 2DIJA 3LKNB 2FZ3A 2EH8L 5K9KB 2VQ1B 4PREA 5DQDL 5J1AA 2J2ZA 3U2SB 4O2CA 1CD8A 5A2LH 4UIMB 1FZJA 2OR8A 4K3DL 4XCFH 3L7EA 4RGOH 3QZWB 4O2EA 2BVQA 5D70H 4W70A 5CFHA 3LS4H 5ESAB 4OQTL 2DDQL 4TYUA 1ZT7A 4WJ5A 4TVPE 3HA0A 4QRRE 4M6NL 1DVFC 4ZUWB 4XGZB 4L4JA 3I02B 5JHDE 3MJ8A 4W6YB 1F90L 1R3IL 3UJIH 3WJJA 4D9LL 1I9IL 4OM1H 2HMID 4NO3A 1MHCB 2Z93A 4J4PC 1NLDL 4GT7A 5CEYB 4N9OB 4DGIH 4NHUA 3SGDH 1CU4H 3NFSL 3H9SD 4ODSH 4PD4J 3IAGC 4LPUA 4R6UA 1W72L 3U4EA 5D93C 3PL6B 1I1AA 5CINH 4YHOH 2JB6B 4P3DB 2BNRE 5IVXA 3LRSA 2CRZA 1BD2D 4PJAA 2GAZB 2EE3A 2LV4A 5FO7A 3RVUC 5LBSL 3W0WD 2MQ0A 3GMPB 4JFPA 4EUPH 2OCFD 4Q0XL 4M7KH 3GSRB 4JFEB 4X7TA 3I6GA 4HS8L 4FNLH 3O9WD 2HFFA 1MCQA 3TP4A 1A5FH 3HMXL 4QRSA 4R7DA 5AUMB 5HYJB 1MH5B 2VDKH 1DBKH 3PGDB 3P73B 1KJ3H 3VFTB 1QRKA 4UBDC 1VACB 5IMKB 4TSAL 5GXBB 1NGZA 2FGWL 3H9SE 3CH1B 5SWSD 3B9KA 1V7NH 4PJCB 2AVGA 5IESH 2CK0L 4X7CC 2F15A 5C09B 4NRXA 3MV9E 3W39A 4RIRB 4U4BA 2P48B 2P7TB 5DR5H 4XGZA 5F9JB 4HC1A 2KQMA 4JR9L 4TUJA 5IBUB 5IMOA 3QSKB 4K7PX 1AR1C 3IU4L 2A1WH 3ARGD 1AGFB 4PGCB 4G9FA 3SQOH 3TESA 4I9WD 1U8MA 1F4YH 1OB1A 3RWGB 5IROA 3VFSA 2MWCA 2IALB 5CGMA 4Q9QL 1NANI 1NC2B 3GRWA 4G5ZH 1IKFH 4PY7A 3N1PC 3EKCA 3A6BL 2G9HB 1P9MC 3WIHA 4GMTH 3V0VA 4X0KA 5JW4Q 5TJWK 5GPRA 1K8DA 4ZSOA 3UCRA 3O8XD 4MWFA 5J4MA 2PW1A 4O51B 1JK8A 3BQUD 2CKBH 4FQLL 4KI5F 5CUSH 3BN9C 4HPOL 3LIZH 5IBTL 1K3ZA 4J3XA 5I16A 4S1QH 2E6PA 3E6HB 1DEDA 3IKCA 1F11A 5EOQL 5F9DC 1H5BA 4NBXB 3SJVD 4JRYA 2CDFB 3EOBA 1C7SA 4LVOC 1KTDA 4YZFF 4HWUA 1WZ1L 1BGXH 3HLAB 5T5NG 4N9GA 3CFJB 5I30L 3B83A 4JJ5B 2Y23A 4MQ7B 4UQ3B 3L3DA 1JPSH 4JLRB 4J3WA 2XOTA 3BP4B 3LRGA 4G6ML 3VXME 4U1SA 4UIKH 1A7QH 1J10A 2ZUVA 5ID0A 3THML 1CFBA 1A6ZB 3UJJH 3UTOA 3T0ED 4WIQA 4R7NB 3ARGA 4P5TA 4LCIL 3BD5A 3JWDL 1MY7A 3F58L 3IU3B 2DQFB 4WI2A 3NCJL 2EYRB 3U4BH 3KYNA 1NLBL 3S35L 3JWNC 2XQYG 1UWGH 1YYML 1Z0NA 1ITCA 5EZJA 2DBLH 1QZ1A 5DUML 4LLUA 2HJLA 3K46A 1ES0A 3J8F7 1QBML 3LH2L 5DO2D 1VFBB 3ZDXE 2AJZB 3PP4L 4KY1H 1HHJB 3LKOA 2VDMH 4ZMAT 2WWKT 3NPSC 2H32H 3GM8A 3MRLB 2CKBA 1Z9LA 2JJVA 3RNQA 4LNRA 5IOPA 3BX7C 2NYYD 4G6JH 4NT6A 5SX5H 1T2JA 2QADB 4BELD 2AQ3A 4P0DA 4YBQD 1AFVH 4P5TB 4L29B 5H94B 3MRKA 3VRIA 3OAZK 5JIKA 5C9JB 4PV9A 1FAKT 1NQBA 1WCBB 4LPYA 2QSQA 4M1DH 5E5UB 4L4VE 5GISL 1N4XL 4WI3A 4JJ5A 3BEWA 4MNQA 5J13B 1GOHA 5C6TH 1MFDL 4N5ED 3ARZA 5C7XL 1KCKA 4JKPL 4OFKA 5DJCA 4TNVF 5GRZA 1MFCH 3TVMA 5J56B 2VYRE 2R4RL 1YNLL 3VXQA 1CGTA 1MCBA 1PW3A 2B0SH 3TCLA 3IRZA 4GKSB 3MJ9L 4HWNA 3BOVA 4NQXB 1K8IB 3IDUA 1OW0A 2YHGA 5CZVL 2PN5A 1N2RA 4BM7A 2NY7L 3MZTA 1R3KB 2IAMA 4IDLA 1YMHA 4A2LA 2YRLA 1NFKA 4K3EH 4LF3A 3V8OA 1VEOA 1HHKB 2CIIA 3IXAB 3CH8A 4AIZA 3SKJH 5DGQA 5HI4C 3KR3H 5J8OA 1ZLVH 4P9MH 1IFHH 3N1MC 3EDEA 1DUYB 1GAFH 2DLTA 2N7AA 1RURH 1G0XA 3GMNA 2IQAB 5I8OH 2WINB 1H3GA 1TZGH 3CFEA 3F62A 3S3PA 4D0DB 1X7QB 5D7LB 3HZMB 2H8PA 2ITCA 3U7WL 1ZSDB 5D7IE 5BOZG 1BIIA 2X4SA 1VESA 3O11A 1MLBB 3FT4B 3T3PF 1C8PA 5IB4B 4M6ML 1BF2A 1EUUA 3PP3H 2V9RA 1RUML 3G5YB 4PJCE 1RZ7L 5JORA 1J18A 1FQ9C 3KWWA 4Q6IA 5B38G 1X5HA 3U30C 1AP2A 5FM5M 3VGBA 1AKJB 3X3GL 1NGYA 2FJFA 4NKMA 4YHYC 1E4XL 3B9KB 5GGVY 3PWVA 1ITBB 2BJML 1MCPH 4Z0XB 4O5LL 5I1EH 2ZJSL 5SWSB 2OL3H 3GO1L 4L9LB 5MEOB 4KJQD 2X1OA 1EBAA 5JTWA 1WUNT 5GGVL 4GOSA 5J6HB 4OD2A 4UDUB 2DQIH 4EBQH 1HSAB 4JY6A 3RZCD 1QFWI 1DFBH 3S37H 4XCCH 3W2DL 2IBZY 4UBDD 1RZJC 1U2HA 5KS9F 3W0WB 1OSZB 4OCYL 3KLHC 3QNYB 3RGVC 4YDIH 4CNIA 1J1PH 5E8DL 1S9YB 5L7XH 1XH3B 3JV0A 4KRLB 2GSIB 3KYKH 32C2B 4MNGA 2MOVA 5DJYA 3FFCE 4X4XA 2EYTB 1BFVL 3MR9B 3UTQA 4WHTB 1QLRB 2I5YH 1AGEA 2UYLA 4X6CE 3RQ3A 3BKYL 4PD4K 5D72H 5IMLA 2K9UA 4TN9A 3T2OA 1QVOB 5AYUL 3P9LA 3RX7A 5I1IL 4L8DA 1MAMH 3WO4C 3T0EC 2WIMA 2ZUTA 3HI5L 4S11A 2HG5B 4HAFA 1T20A 2VDLH 5FHAL 3VD5A 3D85B 1KLUA 2W92A 1W8OA 4ZSOB 5EZLB 5LJYH 1ZHLB 4Y4HA 4DN3L 5C0FA 1FGNH 1H3UA 4H0HB 4OQTH 3HG1D 2KDGA 2WBJB 4M61A 4L8CA 4LNVA 1KXTB 3GDBA 3SE3C 4K71C 1OP9A 1LO4H 3Q0HA 4R2GD 3O4LD 2VITB 3V6FB 3OKEA 5CZKA 2YKLL 1JWMA 2X89D 4O2CB 3R06B 1FRGL 1CK0L 2CGRL 3QNYA 1MWAH 4OIBA 1XCQB 4KC3B 2AAVA 4G8EA 3U2SA 4U1IA 4Z7WE 1HK6A 4M43L 9CGTA 1DQLH 2C26A 5GGRB 1YC7A 4FP8H 1N5YL 3PGFH 1T03L 3HCVB 4LBEB 1MJJB 1JIBA 3SHSA 5DMGD 4OV5A 4RFNC 4WTZG 4EZMA 4ZFGH 2HFGL 2PTUA 3SE4C 4F9LA 4HJJL 5J9PA 1NC4B 4NRYA 1D5BB 1UACL 2EDNA 2ZSWA 4DGVH 4X6BA 5EC2A 2YUWA 3MLRH 1GOGA 3LPGA 8FABB 2R2CA 1JWUA 1MRDH 5I1JL 2X41A 2NW2A 5E8EB 4I1NB 1R3HA 2XKUA 4KVCL 1C5BL 3DI2B 5I9QC 1BFOB 1YYLH 4QHLB 5K33A 1AD0B 4JFYB 2JLLA 3MLTB 3EDKA 4GJTB 4KQ4H 4J3OC 3JWOC 2CXKA 2VITA 3CSBA 1KACB 3DLQR 4LSPH 1HXYA 4ZUTB 5SX4I 5TFSH 3KLAA 3MROA 5EO1B 2I25N 2WBJA 8FABA 3GJEB 2Y6SC 4ZQKB 5I1CL 4Z7OF 1RSFA 2R29H 2N7BA 2RGSA 4OGXH 1OAQH 3MGAA 3PWPD 5F1IB 3VJ6A 1CDBA 1J8HA 1XGUA 4U31A 3U0TA 5FAAA 3SQOL 5I74B 4GKNB 4XP4H 4AEHL 4FQCL 4JG0H 1HIML 3O3DA 1T2XA 3ZKND 5IFAL 2E9JA 1AHWB 2XG4A 4L5FL 2X5PA 4WHYH 4XVSH 4NGHH 3PV7A 4JZOA 3SCMA 3PHQB 1A4KB 3OAUH 1ZA6A 3V4VH 2DQUL 3PNWB 2FLBT 3DX8A 3PWNB 2W9DL 3LMJH 4DN4H 4JFFD 1RJCA 1G7IA 1T66C 1TZHB 1QFHA 1OB1B 3RWGA 1EFXA 3IYLW 5I73C 4KHXH 2YC1B 3QEUB 5SWZA 5L0QB 4GXVH 4R96A 1HQRB 2E7CA 2HMIC 2VLRA 1OP5H 5C2BL 4MAYD 4ZS7H 1F8TH 1RZIA 4QHUB 4LPVA 1QPXA 5EU6A 3D0VA 3T65A 5T1MA 3UYRH 1T1ZB 5GHWL 4CAGA 3M8OL 3VXSD 2IAMD 4LVHC 1WEJH 4H1LA 3MA7B 3CH1A 4IM8A 4OD2B 2ITDA 1CN4A 1A1NB 1T1YA 1B6UA 3BDYH 4UU9A 3AREB 3GSWB 4NQDA 1JHTA 4PRHD 2BDNL 4CN6A 2QBWA 3QO1A 5IW1A 5IEHB 1S9XB 2NY0B 4PJ9A 4B41A 5A2IH 3BPOC 3CVHL 1MFBH 3FQRB 4NQED 5JORB 3BT2H 4WFHE 4XPGL 4LCIH 5J7CC 5D2NC 3WE6B 3K81A 1T22B 4UNVA 2BVYA 2GSIA 3IJYA 3ALWA 1WWCA 3HRZB 3BW9B 4XC3H 4KGJA 1A21A 1U95B 1RK1B 3ARQA 4MJ6B 4WFED 1IC5L 5FO7B 3ZT6A 4L1DA 2VIRB 5D9SB 5KVDH 1BOYA 1R0AH 5IEHA 3A6CL