3QUMB

Crystal structure of human prostate specific antigen (psa) in fab sandwich with a high affinity and a pca selective antibody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
219
structure length
219
Chain Sequence
QVQLQQSGAELAKPGASVKMSCKTSGYSFSSYWMHWVKQRPGQGLEWIGYINPSTGYTENNQKFKDKVTLTADKSSNTAYMQLNSLTSEDSAVYYCARSGRLYFDVWGAGTTVTVSSAKTTAPPVYPLAPVCGDTTGSSVTLGCLVKGYFPESVTLLWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Prostate-specific antigen
publication title Crystal structure of human prostate-specific antigen in a sandwich antibody complex.
pubmed doi rcsb
total genus 24
structure length 219
sequence length 219
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qumB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qumB02
4QRPD 3LRSB 5BJTB 3KYAA 5I19L 3SGKA 5J1AB 1QLEL 3MGTB 5DD0L 3U4AA 5GGUB 3EO0A 5B4MD 4I0PB 1I3GL 4HW6A 2A0LC 4AEEA 3TT1H 4YFEA 1I7TB 2VDKL 5IFJA 2DLTA 5FGCB 4X7SH 1NSNL 2BC4A 2BSSB 2W59A 1S7UA 1XCQA 3B5TA 2VDML 3CC5B 3LD8C 4CN4A 1Z5LA 3SJVE 3L5WA 5I0DA 4TNWF 4XTRC 5FUCC 4NO5B 2MKWA 4PTTA 1MJUH 3VXQB 4KTEH 4O2FB 2YEZA 1B2WL 2KQMA 1OWRM 1C5BH 3BH9B 4PJFE 4AMKL 2CLVA 3L3IA 4KHTH 1OF2A 1M6OA 5DJ8B 3L3GB 2CKNA 2EIZB 3QIWA 1G6RL 1GOHA 1RZKC 2PW1A 1IEAA 4Z18A 4PD4K 4PLOB 3O6FA 3MLUH 1DN2A 5BS0E 2DL9A 4MA3A 4NQCD 5SX4I 1MCHA 5IFHH 2A0LD 2BK8A 3WFCL 3EO0B 5ETUA 3RTQA 2D03H 2WWMC 1G6RA 5IFJB 1WWBX 3L1OL 4F9PA 4S1RH 2BC4B 1UWXK 2DQHH 2FO4A 5CEZD 1S7UB 3VI4F 1XCQB 4XTRD 1IBGH 2KH2B 1ZLVH 1ZT1A 1Z5LB 4MNQD 3VXPA 3L5WB 4Z7NF 2IH1A 3MV7D 3O0RL 4U1MA 3BT2H 3HI6H 3JTTA 1NC2D 4GQ9L 4M00A 4PTTB 4WUUA 2WIMA 2YEZB 3WFEH 3TCXA 1PEZA 3D0VB 2CLVB 3L3IB 1G6VK 4X9FA 1M6OB 3HR6A 3QIWB 3WHE1 1R5IA 2PW1B 4UMGA 1IEAB 3CXHK 3O6FB 1J1XH 3A6BL 4MA3B 4LNVA 5HGGS 1A6UL 4WW1A 4M48H 5ETUB 3C6SA 4PJ7E 3RTQB 1OTSC 2HRPH 4OFDA 4X0KA 1G6RB 4KRPC 3NCJH 4LMQE 5JNYA 4Z7OF 2FO4B 3ARQA 4PB0L 1K6QL 1ZT1B 3VXPB 4XC3L 5SWQA 4KVCH 4U1MB 1CLYL 4WUUB 1GSMA 3BIKA 3WSQL 3OR7A 1YY9C 3EYUH 5T3ZE 1KC5H 2JCCE 4CW1A 2XG4A 4OKDA 4M6AA 3THML 1R5IB 4XPTH 1NUFA 1E27A 5T5NG 4OZGF 1MY5A 5DJDA 1OWWA 2YD7A 4FQLL 4L5FH 4UNUA 1OTSD 4XVTL 1LO0L 4WW1B 4PFEA 4KRPD 4U0RC 3C6SB 1H3WM 4AT6A 4TYUA 2AKRA 4YWGL 4X0KB 1TXKA 4KY1L 1PX4A 4MS8C 4BM7A 5JNYB 5I1HL 4IIQC 2NY6C 2UY7A 4TVPE 5HHXL 1RIUL 1X5ZA 5BV7C 5EU3A 4JQXC 5SWQB 4O5LL 2WWKT 2OCFD 1YY9D 4P9MH 3CVHH 5J13C 3PL6C 1RJYA 5GS1C 4P23C 3GMMA 1VFAA 4QGTA 4CW1B 5H35A 2AQ2A 4TQEH 2O5ZL 3O2WH 1OL0A 4XMLL 3LV3A 1YEFH 1I3RA 4NQEE 2DLHA 1E27B 1NC4D 2VITA 4G7YL 3JVGC 2GCYA 4UB0H 1U8HA 1QFWM 3BE1L 1MCPH 5C3LD 15C8L 3SKOA 2DMBA 4HGWA 4LARH 4G6KH 2PYED 4DGYL 1EA9C 1U92A 5T33L 2FH8A 2NPLX 4AT6B 5ADOL 1NLBH 4EDWH 4MS8D 1M4KA 3HI1A 3MRQA 2AKRB 2J8UA 5IBTH 3A6CH 3E6HA 2XWJA 1GHFH 4M93C 5GGVL 3RU8H 2GY5A 4BZ1L 3VI4E 3OKNA 4RISH 4W70A 2XQYG 1D9KD 2HG5B 4Z7UA 5EU3B 4Z7NE 1CLOL 4JZOA 4A2LA 3KYKH 4NQDB 3PL6D 5JDSA 1FAKT 4P23D 4WTZA 4JHWH 1IAIH 3NFSH 4MD4A 3FB8A 1N64H 4YDIH 1RJYB 4K07A 3PWPE 3GMMB 1VFAB 4OCWH 3TC9A 5H35B 4LHUG 1JMXA 1BZQK 1I3RB 2PXYA 3U9UA 3HTLX 5D1XA 2VITB 2MSPA 2GCYB 2FEDC 1U8HB 3H42L 1UM6L 3SKOB 5I1LB 4HGWB 2Q8AH 1KEML 2Y36L 1WWWX 1K4CA 1ZMYA 1U92B 4XWOC 5FDYA 1MCRA 3HI1B 2XXCB 3MRQB 5F97E 2HLFD 1OHQA 1RZIA 4GAYA 1IAIM 3E6HB 2XWJB 3LIZH 5FGRA 3MGAA 3C8HA 4LKXA 5EZOH 3FL7A 1H0DA 4Z7OE 5I2IA 3OKNB 3D87B 3GNMH 5FA4A 1JNLL 1L9MA 4Z7UB 2D7PA 2IG2H 2WQRA 4JZOB 4B7IA 1KACB 4XP1L 5JDSB 3NZHL 1EHXA 3RPIA 3FQUA 5C0NC 2RJMA 4MD4B 4PJ5E 3FB8B 3LZFL 2DJUA 2Y25A 2FEDD 4LAQL 3G5YA 5J06A 1U93A 2PXYB 5IK3A 3D18A 3U9UB 2P48B 5CUSH 5D1XB 3VU2A 1LILA 1PSKH 2KQNA 3K1KC 4XWOD 3VFPA 3VW3L 5HHOD 3PWNA 2PETA 2UZIH 1K4CB 4GSDH 1JJUA 1F58L 5DJ2A 5FA3A 1F11A 1RULL 3TN0A 5IFAH 2FH6A 4JO2L 1RZIB 4GAYB 1CE1H 3QDJE 4LKXB 2Z4QA 5DMKA 1H0DB 5E4IA 3ARGC 2R0LL 3HN3A 5I2IB 5FA4B 3EHBD 1XGQA 5C0ND 1FC2D 1G9ML 5A2LH 5EU5A 3RPIB 2E7LA 3FQUB 1BWWA 1VFOA 1DQDL 4F57H 4IOIA 2AJVL 2X6MA 3QNZA 1XT5A 1A6WL 2NY2C 3OGCA 3EDDA 4P2QE 3G5YB 4OF7A 1HHJA 1U93B 3QFJA 3D18B 5IK3B 3GZKA 2ZCHL 3DYOA 3BO8A 3VFPB 3OMZA 4G9FD 1FL6A 3PWNB 4JGJA 5DJ2B 4JQVA 5FA3B 3GRWA 1F11B 2YN3A 1JWSA 1RFDL 2C9AA 2OL3H 2Q6WA 3TN0B 4CUCA 3LOWA 5IQ7H 3ARGD 4LSRL 5EUOA 3ULUC 1HXYA 4HEPG 3BFOA 2Z4QB 2FEEL 5DMKB 3L9RA 4IM8A 2XA8H 3ZTNH 5H8DA 5BO1H 5E2WL 3KXFE 1V7ML 2ZCLH 1XGQB 4PJ8B 3TVMC 1NFIA 2Q76A 4Z7QF 4KV5F 2BVYA 3V4UL 4R6UA 5EU5B 3X17A 4DGVL 5SWSA 2HN7A 4IOIB 1NBZA 3QNZB 4KFZC 4YE4H 4Y5YA 1HHJB 2WW8A 1WT5C 3QFJB 2ZPKH 4MXQC 2VDPH 2ESVD 5F71A 3BO8B 4WY7H 1LE9A 4E41E 1FL6B 5F1OB 1MFCH 3WFDL 2YD9A 3LPGA 4DN4L 1NAMA 4LEOA 5KN5A 1JWSB 3ULUD 1G9MC 3WIHL 3N85H 5JHDE 3JUZA 4JREB 3VD3A 5EUOB 1HZHL 3EZJB 1HXYB 4M1CC 3L9RB 1HCVA 3RL1A 2X10A 1JFQH 1NCDL 1FNSL 2IWGA 5F6HJ 1T0NA 2GJJA 4B0MM 1NFIB 2Q76B 2UYLA 2CMRL 4L8DA 2LU3A 5KSUA 1CGVA 3WIHA 2UY6A 5SWSB 5AAWA 2HN7B 5ISZE 1NBZB 1X6NA 3CPLA 2X4NA 2KKQA 4MXQD 4OV6F 5F9OL 1Y6NR 4Y5YB 4EUPH 5GPRA 2EO1A 2EH8H 4OCXH 1OSPH 1AC6A 3GSNL 5D5MA 1KTLA 2W9EL 1B90A 4GRWE 1I7UA 1LE9B 3MV9A 2O93L 5TE4L 1NAMB 2IBZY 3ZZ1A 2NY5C 4YGVA 4LEOB 5KN5B 4JM4H 5CINL 1ZGLP 4M1CD 3TIDB 5I1KH 1BFSA 3BGMA 4H5SA 4HUXA 5INCA 3FRPG 2QL1A 4NCC2 3F58H 4KROC 3WN5C 1JZ5A 3UAJC 3C8DA 1AR2A 1T7ZA 1YMHA 3U4BH 1Z0MA 4OD3L 1HEZA 2UWEA 4HAGA 4KPHL 3RL1B 4M4RA 4MLIA 3O4LD 4F37F 2UYLB 3HC3H 4L8DB 4NGHL 3WMSA 1AFVH 3EYSL 4JFFE 1O7SA 5KSUB 5EORH 2R8SL 3T0EA 2AXGA 3CPLB 2X4NB 4UU9A 3OJDB 2OZ4L 3FB7A 3V7AG 3W0WE 4ORZC 4F2MA 3S98A 5JW3L 5E1AA 4OCYL 1R24A 4Z6AT 5D5MB 1X4XA 1KTLB 1I7UB 2FBJL 3QPXL 1TTFA 4K7PH 3MV9B 4G80A 3RA7L 3FJTA 4P3WA 2A9MH 5I9QB 4KROD 3UAJD 3QAZB 4ZO7A 3BGMB 4H5SB 4HUXB 5INCB 3ROLA 2XKSA 4BK5A 5C09A 3MBXH 1MCJA 2IBBA 5A2KH 2CRMA 1A6VH 1HEZB 2UWEB 3P2TA 1MRCH 5FYLL 4UTBH 5HI5C 5ITFA 3MUZ1 5J57B 1T21B 4A2MA 5ID0B 1OAXH 3AMKA 4P5TA 3RDTA 1DTUA 4KV5E 3ET9F 4Z7QE 1N4XL 1OT2A 4ZS6C 1OM3H 4LPCA 4LSSH 1UM5H 3HS0A 3RI5F 5DMIL 1L6ZA 3T0EB 2AXGB 4UU9B 3FB7B 2E6JA 2NY4B 4OCSL 4N0UA 4F2MB 2WUBH 5E1AB 5FAAA 5C0JA 4M6NH 4Z8FL 4TPRH 1R24B 3G9VA 1JTPA 3IU4L 1GGUA 3MRFA 3NFNA 5GRVL 4G80B 4HWEH 5J6HA 2HYMA 3W5NA 1ZVHA 1XH3A 2ZNXA 4QRUA 3KS0J 2X1WL 2I9TA 3ROLB 4D2NA 5HI5D 3FQNA 1VFUA 5C09B 1YQVL 1S8DA 5C92A 5AZEL 5BVPH 5ITFB 2KDGA 4LLQA 4ZUUA 3V0WH 3DVIA 4ZS6D 4GUPA 3I6LD 5JXAH 4P5TB 4D9LH 5KW9H 4JO3H 2APTA 3ARPA 3S37X 5DZOA 5DJ6A 4L1DA 3T08A 3VXME 1N5YH 4YDKH 4XCFH 1Q0XH 1ODAA 4P3CL 5I66A 3HS0B 5DEGA 2ADGA 3RBGA 3CJJA 4JRYE 1GPOH 4N0UB 4RMVA 2QHLA 2R9HD 1ZLSL 5C0JB 1WZMA 3BQUA 1F4HA 5EU6D 2XN9A 3PIQA 3SGDH 2E7BA 4LRIC 3MRFB 4L4TA 3VFVA 4YHPA 5J6HB 4XNMA 3VXUA 3PWJA 1XH3B 5E8DH 4QRUB 5DR5H 1MAKA 4LQFH 1PG7H 3O9WA 3V0VA 2I9TB 1UEMA 3FQNB 3PHSA 5C8JA 4Y4KA 1HH6A 3LEXA 1S8DB 4UIKH 4P2OC 5I8EA 3QJHB 4LLQB 4ZUUB 1ORQA 4Y1AE 4GUPB 4P4KD 3WDIA 4MJ4A 5SWZE 5HGBA 3QSKB 1XGYL 5DJ6B 4Q6IC 5I66B 1C7SA 5DEGB 2XACC 4KK9C 5HGDA 2NY1B 5GIRA 4H8WC 4GKOA 3ZE0F 3ULVF 2ADGB 4MQXC 2ZG2A 2A1WL 1IKNA 4P9HC 2F8OA 5JA8B 3BQUB 1X5XA 5CJOL 4PGDA 2XN9B 3HC4H 3V8CA 4UT7H 1VA9A 3PIQB 4L4TB 1IEBA 3VFVB 3STLA 5CJBA 3DSFH 4YHPB 1IKFL 5J12B 4XZUA 4XNMB 1DBMH 3VXUB 3PWJB 4NHCL 5IVOA 2Q7YA 4NUGH 3SDDB 4N1EA 3V0VB 2J5LB 5SX5H 4P2OD 3S37L 4NC1C 1F90L 5C8JB 3MA7A 3E8UL 4Y4KB 1HH6B 2AEPH 3LEXB 3ZT6A 1S3KL 4B41A 5I8EB 4HF5L 1GGTA 1ORQB 3QHTC 4JO4H 3HI5L 4CRPA 4U1SA 2ZUYA 5F7MC 4KK9D 5HGBB 4MQXD 4XC1L 3PABA 4HWBH 5HGDB 2NXZB 5GIRB 4PJAA 4I3SH 1D5XA 4DJMA 1TIUA 5E8PA 2YPLA 4ORGA 1J8HE 4ESKA 4LSTL 2N56A 4R2GC 5TGBA 5C0AA 3KJ6L 5INDA 3P0VL 4BKLA 2PUQT 4JFPA 1IEBB 3STLB 4XZUB 4RAHA 1MFBH 2Q7YB 4M7LH 3ARDC 3L5XL 4D3CL 1M71A 1Q9OA 4OM0H 4X6DE 3MA7B 2F53A 3BRGC 3OKYA 3C60A 3EUUA 1T66C 3I6GA 5I1GL 1TPXC 5D93B 1KELL 2GITA 3D25A 4U1SB 5DK2A 3O2DH 1LDPL 2XTJB 4MJIB 4BUGA 3LQMA 2X4RA 3QCUL 4U1KB 3PABB 4PJAB 3LQAL 1D5XB 1A6TB 5I19H 1EO8H 2AAVA 5E8PB 2YPLB 2ARJA 4ORGB 4GBXA 5EWIL 3ZL4L 3HZMA 1P6AB 5EZJA 3PQYD 3UBXI 5TGBB 3GJFA 5C0AB 1JPTL 3U2SA 4C55A 3KYOA 3CLEH 1YMMD 3OJVC 1WGOA 3QP3A 1CF8L 3UZVB 4LHUD 1MF2L 4XBEH 4BKLB 4UV7H 5CGMA 3QO1B 3ARDD 5MP6L 4G5ZH 4CDGC 1VB9A 3VDAA 3SDAA 2VDMH 3DMMA 3LS5L 1M71B 2VJXA 2YD8A 1Q9OB 1T66D 5DD5L 1QO3A 2F53B 4KDTA 4NKOA 5EOQL 5LGHH 2I25N 3C60B 3S4SA 3I6GB 4Z95L 4PLNC 1YEGH 1E6OL 1B2WH 2BCKA 2GITB 3D25B 4R4FH 5DK2B 5C08A 4FABL 5DK3A 1QSZA 1JHLL 2X4RB 3U0WL 1G6RH 3HB3C 1HNFA 1XF5A 4NO2A 5KS9E 4K2UL 1MUJA 3O3BA 5FCUL 5IR1A 3IU3A 3ZE0E 1GRWA 3ULVE 3P73A 1GGCL 2ARJB 3QIBC 4GBXB 2QADB 3HZMB 5LWYH 5EZJB 4IOFC 2B2XL 3U2SB 3GJFB 3HG1D 3WFCH 5IEKA 3KYOB 2AI0H 4LK4A 1MOEA 3LQZA 2FHCA 1BEYH 1GZQA 5A2IH 3TYGL 4M1DL 2DLGA 4CJ0A 3L1OH 3ZKNC 1YEIH 4M5ZL 5I1DA 3K4AA 3DMMB 3LKOA 4ALAL 3DYPA 3UTSE 2P5EA 2V7HA 4LMQI 1QO3B 3QPQC 3EO9L 4NKOB 5HVHC 5MEOA 5I1CH 2ZUSA 4GQ9H 3S4SB 2EECA 4ZUSA 3KHOA 2BCKB 1I1CA 5C08B 3HB3D 4R0LA 5CKGA 1H5BA 5E9DE 3FO0L 2JJTA 3QUYD 4WHDA 2CK2A 4ZFFA 1VGEL 4FRWA 3QIBD 1XF5B 4NO2B 5JW4N 1LD9A 3CU7A 1MUJB 5DFTA 3FN0H 5ECJE 3RIAK 1FIGH 2QHRL 3O3BB 2WLYA 4IOFD 1G7JA 5IR1B 3IU3B 3P73B 4G6JL 2ZOLA 4LEXL 1DVFC 4YEEA 5E4EC 1CD8A 3GDBA 5JW4M 3NPZB 5IEKB 1IGYA 3F65A 1BP3B 1GAFH 1KT2A 3CSBA 2VN4A 3BYYA 3LQZB 4XGZA 1FH5L 1GZQB 2P7TA 1T7VA 3MODL 3SJVD 3S3JA 2XZCL 1OCWL 2OBGA 4N9GA 5I1DB 3QPQD 5MENE 5AUMA 3G6JA 4Y7MA 3K81A 3LKOB 5C6TH 1W0WA 4NN5C 4XC3H 2P5EB 2V7HB 1KJVA 4I2XA 1KBGL 4JGMA 5MEOB 5IBUG 4WVRA 1CLYH 4PB9H 5EUKA 3UTPD 2EDYA 4OT1L 4ZUSB 3ARTA 2NNAA 3TT3L 4TVPL 4R0LB 1ZTXL 1H5BB 4YO0A 3IFLH 5BS0D 2D0HA 1MI5A 4HCRA 3P4MA 2C26A 4ZFFB 2Q1EA 3A0OA 1NGPH 1LD9B 1DVFD 3VD9A 2R4RH 1G7JB 2VQ1A 4MDIA 2ZOLB 2OQJA 1BM3H 4I0CC 2HP4A 2ZUWA 3RVVC 1G0DA 4JN1H 1SYSA 1IGYB 1F2QA 1LO0H 1QSFA 2J8OA 1KT2B 2BNQE 3QDHA 1P7QD 4XGZB 1VDGA 2V17L 1FZMA 2P7TB 2R29L 2XQBH 3T77B 4QRPA 4HT1H 5I1HH 4X6FA 3RIFK 4N9GB 3V4VH 1T5WA 3EW3B 4MA7H 5AUMB 3G6JB 5HHXH 1W0WB 4NNPL 5IM7A 4O5LH 4I2XB 3FHQA 3F7RA 2OTUA 1BD2A 4L9LC 5EUKB 2YUZA 3QUXA 2NNAB 2KUTA 4I9WE 4TRPH 1KJ2L 3JWDH 4FFYL 4YO0B 2AK4E 1MI5B 3P4MB 4XMLH 3CK0H 3QWRD 4DAGH 1RZJC 5DRNA 3CFDA 2VQ1B 5CJQL 4HJJL 4MDIB 2GKIA 3Q5TA 1QBAA 5ESQA 15C8H 4ZS7L 3K0WA 4DGYH 4UAOC 8FABA 1SYSB 1AJ7H 2I60L 1QSFB 5I1EL 4PJGA 4XPHH 2WUCH 1FZMB 2D9CA 4FTVE 1M7DA 4QRPB 5TQ2L 1A7NL 3CMOL 4I0KA 5GGVH 4X6FB 2FJFA 2HMIC 1GIGL 2BXZA 3FMGH 4NQCA 5IM7B 3OTTA 4AYFA 4Y89A 1CLOH 5T3ZD 3PDDA 4I4WA 2OTUB 4LLDB 1BD2B 1S7XA 3AB0B 3EBAA 4HBCL 4U2ZA 3GM8A 3MLSH 3QUXB 4MCZA 3QUML 5GRVK 1R3IL 1T7XA 3QQ3A 5C2BH 4YAQB 3ABZA 3BPLC 2VDOL 3ARRA 2QSQA 5DRNB 3CFDB 4MNQA 1DDHA 2B1AH 3MV7A 1WICA 3I02A 5ESQB 2R0WL 3PV7A 4G8IA 2FECL 1KEMH 2Y36H 8FABB 4N0YH 3F7VA 4WENB 4GH7B 4PJGB 1KJ2B 1MIEL 2I26N 2L4OA 3ZYIA 3N50A 1CK0L 3KPLA 1I1FA 3Q48A 1X4ZA 5JDJA 5DDHA 2HMID 4TSCL 1NCNA 4MWFA 3MRIA 2VLRE 2ZNWA 4GKSA 1M7DB 2ICEA 4GMSL 2AP2A 3R8QA 2FJFB 1RVFH 3RKDC 3H6JA 5F7UA 4QEGA 1MCIA 5EH1A 1QNZL 2DQTL 2XA3A 2Z31D 4I4WB 1S7XB 3KPPA 4MCZB 4NQED 1OP3K 1B6UA 1T83C 5GGQH 4PY8I 2XQYK 3QQ3B 4HHAA 3R4DA 1IEHA 1PJ9A 2E8YA 1Q38A 4M4PA 5F7YC 4MNQB 1DDHB 5GRYA 2P46B 1V7NL 3MV7B 1JZ3A 2QEJA 3I02B 1HWGB 4G8IB 2EIBA 5CD5C 4YHYC 3HMXL 3F7VB 5FO9A 1JF6A 1RULH 3KPLB 1I1FB 4K94L 5DDHB 2DLFL 3RKDD 4LVNC 4MWFB 3MRIB 3OKLA 4GKSB 2ICEB 4JLRA 1UCBL 2W60A 4R26L 3CDFA 4QTIL 3LHPL 3I3DA 1MAJA 4KAQH 4XP6H 2EYTA 3PWPD 5AYUH 5I30L 3RL2A 3O4OC 1NFKA 2DBJA 3KPPB 3HLAA 3T2PA 1LWRA 1PX3A 3GRWH 1WAAF 5TE7H 1YECL 4HHAB 1PW3A 4U31A 3B5GA 2R2EA 1CE6A 1LP9F 5GS0L 2ZCHH 4XPAH 4Y2DC 1YNKH 3E1F1 3AU1A 3HC0A 3UJJL 2G5RA 4Z0BL 1MHEA 2VC2L 4JEGB 4KZEL 2OXHA 1LO5A 4PRDA 5FO9B 3KPSE 2DD8H 3U1SH 4LASL 1LNUA 1U3JA 1CFTA 4D9QE 3QXDA 2PTUA 3OKLB 1BGXL 4JLRB 2W60B 2DM3A 4NO0D 1V7MH 4PJ5D 1SY6A 1BAFH 2P4AB 2EYTB 2QR0A 3BP7A 2O5XH 3V4UH 4MQTB 1N7ML 5K93A 5D6CA 3RL2B 4DGVH 3HLAB 5JMRA 5JLZA 1RUKL 4IIQA 4ZUTA 1NAMH 3IYLW 3MLRH 1J0KA 4OFIA 3MACL 1A2YA 4JQXA 1F8TL 1UT9A 2R2EB 5EO0A 3CLFL 1CE6B 4Y2DD 5DURD 2WBKA 1AH1A 4XNUL 3PL6A 1UACH 3AU1B 3HC0B 5GS1A 4WFEE 4G3YH 1MHEB 5IHUH 2E9WA 3GJFK 5F7HA 2E9BA 1WZLA 3QDJD 1LO5B 4PRDB 5E6YA 1HKFA 1NCCL 5I1JL 1LO3L 3WIHH 1LNUB 3JVGA 4KJYA 5LBSH 1CFTB 2HJLA 3S3PA 3QXDB 1GGIL 1HZHH 4RCAA 4TSBH 4FQXA 1YN6A 4CVUA 3O3UN 3MCKA 1FE8L 5L7XL 4X4MA 1U8PA 5DLML 4TOYL 4EOWL 2QR0B 3BP7B 5D6CB 1KB9J 4P2QD 2FJHA 2W0KA 4OLUH 5E70A 5JLZB 1TVDA 4IIQB 4R97C 4ZUTB 2NY6B 2BNRA 4LSPL 3TIEA 5DC4B 1A2YB 2H3NA 5BV7B 4Y4FC 1JZ2A 1JGVH 5B3JF 2AJXL 5EO0B 4DEPB 1OGAA 2G9HA 5FCSH 5J11C 1WCQA 3PJSA 3G04A 1KN4H 2W9EH 4PJ9D 3PL6B 5FGSA 5GS1B 4S0SD 4DVBA 5I73C 3MLYH 2ZG3A 2XRAH 2VISA 1IILE 2NY3D 4KJYB 3CD4A 3TA3A 3KXFD 2HJLB 5F44A 1X4YA 1IFHH 5CAYB 1S9YA 4FMKA 2HFFA 1A7OL 1YN6B 4FQXB 3MCLH 5ID1A 3MCKB 4KPHH 2VSCA 5D96C 3UO1L 4Z9KB 1U8PB 1N0XH 3B8SA 3BKYL 1KCUL 5E5RB 4GG6A 3EYSH 5HDLA 3O8XC 1JNJA 2FX9L 3X14A 2R8SH 4YHIA 3BI9X 3VFWA 4FZ8H 1V3JA 5HBBA 2BNRB 5FYJL 3TIEB 1WAAE 2H3NB 4ZFGH 1IQWL 4OQTA 4OZFG 4E41D 2PYFA 4B53A 5JW3H 1OGAB 2G9HB 2FIKA 1LP9E 3PJSB 5D7JC 2V2XA 3G04B 4DN3L 4OGYL 5E6ZA 1NAKL 5EZIL 3QPXH 1ZVYA 4MSWA 5JHDD 1BQUA 4RFOL 4DVBB 4ZODA 4I8DA 2IFFH 3EOBA 4FZEH 2VISB 3HRPA 3QRGL 5I0ZA 5JQHC 1TDQA 4DFIA 5MERA 2GFBA 4CVZA 3VD7A 3TA3B 4HXBL 1S9YB 1QACA 1E28A 2HFFB 4IS6A 5DVMA 5ID1B 2VDLL 4WJ5A 3WJJA 1IC5H 2OK0L 5I8CA 5A3IC 3O8XD 5E24E 3D0LA 3MRJA 1J11A 1F3DH 2H45A 5E7BA 4HPYH 3X14B 1S9WA 3BPNB 4YHIB 2IANA 3WFBH 2VZUA 3VFWB 3K2MC 2JIXA 2EDJA 3U46A 3QDGE 1AY1H 4OCSH 3T2NL 5D7JD 2PYFB 5T1KA 3S7GA 3WLWC 2FIKB 5GS2D 4OJFH 4Z8FH 2W0LA 2FHBA 4DGIL 2V2XB 1OP5K 2C5DC 3K8LA 1NGQL 2MTPA 2X09A 1UC6A 1Y18A 1KTRL 4G6AD 4PJDA 3NMEA 4MSWB 4LKCA 4KMTL 1RPQA 3C5SA 4OZIA 3WIIL 3CFKA 3EOBB 3NACL 4RGOH 5TF0A 3MOQA 1GCFA 4V2BA 5MERB 2GFBB 4CVZB 4H1LG 4N1HB 4LRNL 3KPRA 3VXTA 4TNWK 5A3ID 1KLFA 1E28B 4IS6B 4JFFD 5D1QC 1Z0NA 1QQDA 4WJ5B 5IV2A 1FPTL 5I8CB 4XCCH 3V79C 4S10A 3D0LB 3MRJB 2VZVA 1KENH 5JORA 1H8OA 2EO9A 2ERJB 5KOVC 4JHAL 1S9WB 4HK3J 2IANB 2AV1A 4PJIF 2N1KA 2JIXB 3U46B 1EO7A 5HYEA 2FCBA 3TVMA 1A3RL 3MLZH 5T1KB 5B3JE 5F7FA 3U7YL 1DBKH 4ZUVA 5EC2A 2Y23A 4PJDB 1Y18B 2JJWA 2NY2B 4LKCB 5ITBH 1JWMB 4JFZH 1MCWM 3C5SB 4OZIB 4HUMB 3CFKB 1WT5A 4WNQA 2AJSH 4P46C 1T2QL 3MZTA 4U6TA 2ADIA 3KPRB 4DKFH 3MRMA 3RHWF 1QQDB 5EN2A 1T20A 3MXVL 5IV2B 4JKPL 4BQCA 2BFVH 1UH4A 5HXMA 3K74B 5JORB 3MLXH 2DIBA 4MA8L 3SN6N 2XWTA 3JV6A 2AV1B 3EGSA 2QQLL 5EOCH 1A21A 3Q5YA 5FDWA 4JHZA 1AQDA 3TVMB 2UVEA 4OGXH 2CDEA 1WBXA 4XPBL 5DHVA 4GXUN 1MCDA 1LEKA 3O4LA 1Z3GH 1Y6MR 4NBXB 4W6YB 2ZCKH 2NW3A 3V6OE 5DK0A 4ZUVB 5EC2B 5M7QA 2YBRA 1RU9L 2X4UA 4P46D 4GXUM 1IKFH 2VWEE 4NHCH 4OSUH 4WNQB 3MTRA 1WUNT 5K9QI 5FKAA 5BQ7B 4BZYA 3MRMB 1S3KH 2F54A 1EFXD 5EN2B 4R7NA 4RRPA 3VXMD 5GZNC 1T20B 1BF8A 5HVGB 2EDFA 4JZNA 3IRZA 4Y19E 4K8RH 1MH5A 3T0WA 1YYLH 3WN5A 3MFGB 2ADJA 2XWTB 3JV6B 4Q2ZA 5JQ6H 3EGSB 2IFGA 5FDWB 3FT4A 3LEYL 1AQDB 3BIAX 4S1QL 3LRGA 2DIJA 2CDEB 1WBXB 3B9VA 5JR1L 1H3TA 1LEKB 1VADA 3KJ6H 3O4LB 4U3CA 1JGEA 2IQ9H 2J7LA 2NW3B 5DK0B 3QI9C 2YBRB 1PLGH 2X4UB 2ZP0T 4PJHA 3RKPA 3L7FA 5ADPH 4PREB 2OX5A 1XGRA 4NP4L 4M7KL 1L0YA 4Q58C 4DCQA 5FKAB 3EJZC 3SDXA 1QOKA 4Y1AD 5GZND 1UVQA 2QV2A 3KPMA 2F54B 5SWZD 3NBNA 5F7WC 2BHYA 1FZKA 4R7NB 3MX0A 3SKMA 1RUQL 4OFPA 3GJFH 4HMDA 1ZS8A 4JZNB 3X3GL 3UZEA 4TN9A 1MH5B 1E6JH 2DB8A 4KROB 4H0GA 1YEJH 2R1XA 3TV3L 3BKMH 4YC2C 1KEGL 1J5OL 2ADJB 4Q2ZB 3G5VA 4PJIE 4BA8A 3FT4B 4K9EL 1HQ4A 3CGTA 1K9TA 2FX8H 4K7PY 3VGAB 3QI9D 1KCSH 4XAWL 1CR9H 1YY8A 5FUOL 1JGLL 1LGVA 1AHWA 1VADB 1JGEB 4UOW0 3C08L 1JTOA 5GRXG 1CF8H 5F6IC 3P0YH 3RGVA 4PJHB 3ULVL 5IVXE 3L7FB 4JQIH 3EJZD 1SJEA 1XGRB 3OKEB 2XG5A 4DCQB 3SDXB 3LS5H 4KXZI 3P77A 5DD5H 1CXFA 5IT2L 4I48A 5C70A 1UVQB 2P43B 5C0CA 3KPMB 5EOQH 3P9LA 2OJZL 5IJVA 3RVUC 5EU6A 3SKMB 1FZKB 3WS6C 5IESH 1ZS8B 2E5EA 3BSZH 3IDYC 2J1KA 4HJGA 3SDYL 1EHLH 4LCIL 5KJRH 1J8HD 3U0WH 2R1XB 2F58L 1EO5A 2P42B 3B3IA 5GGSA 2DYPD 1VHPA 3G5VB 1SBBA 5K9JL 3QEGL 4IMKC 4UI2A 1GGCH 1HQ4B 2WMPA 2YSSA 1YY8B 2VDRH 1AHWB 4K3GA 5ACZA 4JFOA 2DQEH 1T04A 5FHAL 3RGVB 5DT1H 5CP7A 3LEVL 3TYGH 4OB5L 4YUEH 3AREC 1SJEB 4M8QA 3MLVL 4MQSB 4G8GD 4ALAH 3TNMA 3P77B 4I48B 3KJ4C 5C0CB 1TITA 4LRIA 1IAOA 3P9LB 5KVMC 1FYTE 3MBEC 5EU6B 4X6CF 3S3SA 1DUZA 3L95A 3K8KA 1JPGA 1IJ9A 2GK0A 1FQ9C 2YKLH 4KKCC 2WM0A 4HJGB 2FX7L 3V0AC 4PGJA 3B3IB 5GGSB 4RFNC 4XMPH 5GRWA 4P2OA 2HWZL 2QHRH 1H8SA 3K8MA 3DLQR 1CL7L 3S35X 4G6JH 3TNNA 5DD1L 1RUAL 4TTDC 1I8MA 2YSSB 2R2CA 2QTEA 5T1LD 5ACZB 3T1WA 4JFOB 3ZDZF 4JFDA 1A7BA 1WITA 1T04B 3ARED 3RUGF 2Z8SA 5CP7B 5KVFH 1MWAL 2WBJC 4OV5A 2GSIA 1A6PA 4M8QB 1OCWH 1QSVA 1CYGA 4HCRH 1QRKA 3ROOA 4LF3A 3MBED 3TNMB 2GSGA 1IAOB 1A1MA 3OB0K 3LN9A 1YEEL 1DUZB 3AY4C 3L95B 2YA0A 1SEQL 1BMGA 1JPGB 5CCKL 4UOJA 3N1QC 4Z0XA 2GK0B 3JWOL 1EZVY 5D1ZC 3ULVD 4HS8H 3HNVH 2CK0H 2APVA 5CFHA 3N9GH 3SY0A 3U82B 4P2OB 4TTDD 3H9ZA 3K1DA 2H6PA 2X5PA 4UINH 3TNNB 1ACZA 4PG9A 1RK0A 1YEKL 5I75C 1VEMA 3IJHA 1KPVA 1I8MB 3PDOB 1RIVL 4JFDB 4OFYD 2WBJD 4RWYL 4F58L 4KDVA 3O3EA 2V17H 4UBDD 3TP4A 3UTSD 2QSVA 4OV5B 2GSIB 5AD0A 5A16A 3ROOB 4LF3B 2VL5A 4OF6A 1JPFA 1OW0C 2GSGB 3EFDL 2ARJQ 1A1MB 1P53A 3S36L 5E9DD 4UILL 2QLVB 3D2UD 5D1ZD 5AEAA 1V3MA 2WAHA 5I8OL 5F8QC 4WI3A 3HKFA 5DJAA 4Z0XB 1KJ2H 2LU7A 3GBML 1U41A 1IAKA 4KZDH 1P5UA 1P9MC 4WTWA 3SY0B 5C0BE 3F62A 3W9DA 5DUBA 2H6PB 1G9EA 3QXTA 5F7EL 4PG9B 1RK0B 3H9SA 4PJBE 1CD0A 3IJHB 1KPVB 1LO4L 3ZSSA 4LVHC 2I60H 3LMJL 2H2PC 3TBTA 3QDME 3O3EB 5MEND 3LH2H 3GMQA 3A67H 4WDIA 3DUUA 3CFCH 4WEBH 4R2GB 5AD0B 5A16B 3S5LA 2MQCA 1GIGH 2VL5B 1JPFB 2B20A 5A2JH 4B7LA 1AD0A 2XIDA 4X6CE 1UKSA 3MNWB 1W0VA 5DJAB 1S5IH 1E4JA 2GJ6A 4NM4L 3W5MA 1IAKB 2IEPA 3U48A 4AENA 1GGYA 3W9DB 5DUBB 2BNQD 5C3TA 3H9SB 2VR4A 5GJSL 2H2PD 1KPUA 5T1MA 1DANU 3B6SA 1NANI 5T5FL 1INEL 4OKVA 3TYFA 3ZDZE 3TBTB 5LJYH 1MIEH 2F5BL 3RUGE 4JPWL 3GMQB 4TSCH 2P1YA 4W4NA 4WDIB 2D7MA 3DUUB 2IF7A 3TPUA 4HLZH 2HKHL 5IJKC 3S5LB 2ICCA 4F37K 4FP8L 4I9WD 1YPZA 2DQTH 3ELAT 4EQ2A 1AD0B 2MFNA 1E4XH 5GJTH 2AK4D 4MX7A 4POYA 1TQCC 1X7QA 1W0VB 3SJVA 2B1HH 1KIPA 2GJ6B 4OLVL 4JFEE 4ONGL 2B0SL 3GHEH 4ZO8A 2HH0L 4WW2C 4AENB 5J7CC 1UGNA 4PJFA 3SE3C 3IF1B 1KYOJ 1KPUB 3JSSA 4K3EL 3VG0L 5T1MB 1U42A 3B6SB 4FTVD 4LGSB 4OLWL 4P2RE 5F9WB 4NCC1 3UBXA 4OKVB 3TYFB 4PP2A 4YJZL 1T6VN 2JELL 4K94H 5A2FA 2DQDL 3C2SA 3GI9L 4X4XA 4LLVA 3T0XA 1MRFL 3TPUB 3WNKA 1BQHA 4LDLB 1U58A 4EI6A 3I9GL 1HWHB 4FS0A 1YPZB 3HMWL 2YZ1A 2CRYA 4RIRA 2XICA 5CJXC 3VRJA 9CGTA 4YDVA 1A3LL 5SX4H 1CGWA 1X7QB 2UZXB 1MFAH 3SJVB 4M3KB 1KIPB 2JTDA 1YECH 4KI5F 4YXLH 1OAYH 2VLME 4MCYA 5KVEH 5FGCE 5KVDH 4JRXA 3MRBA 3WKML 1SEBA 3MXWH 4PJFB 4PBXA 4KTDH 4NKIL 3UJJH 3OL2A 1SY6H 4P4RA 4RGNB 3ILQC 3UYPA 3E6FA 3UBXB 2VLRD 4PP2B 3P9MB 3DXAA 4GJTB 4WO4C 2JJSC 1Z6JT 4GW5A 3QWRA 1PEWA 2X89D 4X4XB 4LLVB 4X4ZA 5BV7H 1BQHB 2A6IA 3IB4A 1U58B 3KPQB 4PJ7A 4EI6B 5IB5A 3TT1L 1FYHB 1QLRA 1FFOA 4OIIH 1XCTA 4WGWB 4FQ2H 4RIRB 2NQCA 3VRJB 1CCZA 4YDVB 2I24N 2X4TA 3QFDA 4NQTA 2CXKA 5ANMA 1MREL 1HYSD 1INQA 1OQOA 6FABH 4MCYB 4KTEL 4JRXB 3BPCA 4ZNCD 2NR6C 3MRBB 1SEBB 3KPNA 4K3JL 3BZEA 3ILQD 4APQC 3FTGA 4KHTL 3BX7C 2JCCA 1OVZA 3MQIA 4Q9QH 4HIJA 4P4RB 3E6FB 4LGPB 4WO4D 3DXAB 3MLUL 5I1JH 1LO3H 4DW2H 2VZ1A 4NZJA 1I9JL 3TWCH 5IFHL 3TBYA 1G0YR 1GGIH 3QWOA 2XWBA 3DX7A 2A6IB 4JY5H 4JVWA 2D03L 4HBQA 4EUPG 5L7XH 4PJ7B 5IB5B 4LCCC 1QLRB 4MMZC 1FFOB 5DLMH 2YXFA 4FFVC 1XCTB 1ERNA 4ZSOA 2OP4H 2DQHL 5E08H 1FLTX 2X4TB 1PFCA 3QFDB 1QSEA 5ANMB 1INQB 2VLKE 2NR6D 3HUJA 4XB8A 3OAYH 1U2CA 3BPCB 4APQD 1EX0A 3KPNB 3WFEL 3BZEB 3M17A 4Z7UF 1U8NB 1B0GA 3FTGB 3KPSD 2JCCB 1NLDH 1FNLA 4HIJB 4WUUE 2GJZA 4I5BA 4LIQL 4RX4D 4D9QD 5CGTA 5GRJH 3NABH 1IE5A 4HQQH 3VE0A 1J1XL 5GGVY 3VGHA 3LPWA 3ISWA 1U8MB 3OR6A 1NUDA 3TBYB 1BIIA 5B8CC 3QWOB 2CGRH 2XWBB 4M48L 4HDIA 4OQTH 4UAOB 2R0KH 4KKAC 2Y72A 1TVHA 1F45A 3NCJL 1AI1H 4LCWB 4ZSOB 5DD3H 1E4WH 4ZTPH 1YC8A 3QYCA 1QSEB 4PRPD 4KVCL 2VUYA 1EGJA 3HUJB 1IQWH 1QR1A 1YJDC 4A6YA 4GRLD 3CX5J 4WFED 3EYUL 1UXWB 1QBMH 5DRZA 2Z9TA 3M17B 1B0GB 1KC5L 4ODHH 7CGTA 3RWHA 1BVZA 1JPSH 1T83A 3MOAL 1A14H 4RFOH 2GJZB 4I5BB 3BPLB 2IPTL 3VE0B 2VXSH 3RVXC 2DRUA 2GTZA 3UDWC 5GISL 1CDGA 4L5FL 5EU4A 3P9WB 4PYGA 2BOBA 4HDIB 4ONFH 3UROR 2VDLH 1NQBA 2HVKA 3OPZH 1TVHB 3BHBA 3B8YA 3D85D 5CGYC 1QFWL 4JFQA 4HH9A 1LK2A 5AZ2H 4Y4HA 3C87A 2Y9RT 1FL3A 4D0CA 4PRNA 5FOJA 4PPTA 4PJXA 1QD0A 3M8OH 1AR1C 4P9ML 1QR1B 1MCNA 3K80A 3CVHL 1RUPH 3VD5A 5IW1A 2XZQH 4DGIH 2AJZA 3FQRA 4JG0L 4TQEL 3RVXD 1A4KA 5L88H 3RWHB 1NCTA 1YEFL 4NQDE 2PTTA 3SGJC 4UB0L 2X1PA 2VIRA 1CDHA 1T1YA 5ELIA 5KANI 2GTZB 4RDQF 4G6KL 4JZJC 5D7LA 4DUWA 4Y2DA 5EU4B 1RZFH 4U1GC 2Q8BL 4N8VG 2BOBB 4YHYB 2G5BA 3NH7L 3D3VB 1U3ZA 5CGYD 1NLBL 4EDWL 1FPTH 2HVKB 3BHBB 5IBTL 1I9RL 4YK4B 5E95B 3A6CL 4JFQB 4HH9B 1GHFL 2CDFA 5E5MA 3SBWC 1LK2B 3RU8L 4BSJA 4LVNB 4W4OA 1KCLA 3NCYP 4Y4HB 3D39E 4RISL 1AR1D 1FL3B 4D0CB 1Q1JL 2P24A 4OZHA 4PRNB 5EUOF 3KYKL 1WEJH 4PJXB 2E7HA 2V2TA 3QZWG 4N0FA 3WDJA 3TO2A 1IAIL 4YXHH 2A73A 5BRZA 1FSKC 3MRGA 1N64L 5IW1B 4YDIL 3EZ8A 4OCWL 4Z7UE 1S7VA 2AJZB 3FQRB 1I8LA 2Y06L 1A4KB 3O3AA 2FSEA 4TTGA 4P2QA 2PTTB 4C4KT 2OR9H 4O2EA 4NZRH 1T2QH 1T1YB 4LLUA 5D7LB 4Y2DB 3D48R 2GT9A 1ZHNA 2G5BB 3WUZA 3BDYH 3EDEA 4K23L 1LE5A 4M02A 1SM3H 5FK9A 5MHSE 5DQJA 3Q2CA 4M6MH 2CDFB 3C6LD 5E5MB 3QDGD 4F8TA 5EZOL 4LPXA 3GNML 3AMLA 2IG2L 2A9NH 4X5LA 2P24B 4JHBA 4OZHB 2J3SA 2V2TB 5A40E 4N0FB 3D9AH 4KK6C 3TO2B 4JM2A 3DSNA 3ZDXE 2A73B 4CADA 5BRZB 3MRGB 4U1HA 2ZUQC 2WIIA 3V6BR 1S7VB 43C9A 1FO0L 2NY5H 1RV6X 3O3AB 1RU9H 2VN7A 3WFZA 5IOPA 4P2QB 4F9LC 4Y4FA 2AV7A 2Q86A 5BMFL 3H9YA 1PSKL 4O2EB 3AS2A 4O51A 4YHOH 2O61A 4LLUB 3E2HC 2UZIL 4GSDL 2GT9B 4K3DL 2E6PA 1ZHNB 4NCDA 1IT9H 3EJYD 1P4BH 4U1LA 5IFAL 5D5MF 1LE5B 1O0VA 1FO0A 2OI9C 4IOSD 4P48A 1JN6A 1AKJD 1CDBA 3KLAA 1DANT 5FK9B 5DQJB 3QQ9C 5I71B 4KC3B 1A7RL 4NQVA 4K3HA 5FO8A 5JIHA 3T2OA 2YRPA 4WI2A 2CRZA 4KK6D 1CIUA 1ZK9A 3LEYH 3ZYZA 1HH9B 4YDJA 5EA0H 4MXWH 4JM2B 2UWEF 4CADB 4N0CC 4F57L 3ZYOA 4U1HB 4O4YL 3V6OC 3UTOA 2WIIB 3MNZA 4NOFA 4MAYC 3JV0A 4RMQA 4R97B 43C9B 5IOPB 2UUDH 1J1OL 2VWEC 4Y4FB 2AV7B 2C4FU 2Q86B 3FO1A 5D71H 4NP4H 1DCLA 4NT6A 1D6EA 1W72A 3O81A 4M7KH 5FECA 1P84J 5J11B 4EI5C 2BMKA 2DMCA 4O51B 5D7JA 5JZ7C 2O61B 1FLRL 4H0HB 3QFJE 3QXAA 5I73B 3QQ9D 4U1LB 5E00A 4HV8A 1FO0B 1NKRA 1JN6B 3KLAB 4LPUA 4NPYA 1KG0A 2C7UB 4B5EA 3NA9L 4NQVB 4TNVF 4GXVL 2XA8L 1HINH 3ZTNL 5BO1L 1J5OH 3ESUF 1CG9A 2ZCLL 3RVTC 2W07A 5D96B 5E2JA 4AJ0A 3F7YA 3B9DA 4N0CD 4YDJB 2DTMH 2VMFA 2VZSA 5EUOE 2YZ8A 2R23A 5FUOH 3GK8L 1JGLH 3EO1A 4M43H 3H9HA 2HT4C 3C08H 3NN8A 4LPWA 3MNZB 2D4DA 1Z9OA 4YE4L 1A47A 1UM4H 3TH3T 5HHPA 4EI5D 4MB5A 3FO1B 5JZ7D 2VDPL 5BW7C 4NT6B 1D6EB 1W72B 2QQKH 5FECB 4WY7L 4PG2A 5C0FA 4GRWB 2BMKB 5D7JB 1OLLA 4FA8A 1R5VA 3MJGX 4Y19D 2VSDA 1R3LA 3KG5A 3QXAB 1DBJH 5E00B 4HV8B 3KAAA 4NPYB 4XPFH 1KG0B 4K7PX 3RVTD 1XR8A 1JFQL 5CD3A 5D1QA 1CG9B 5E5UB 4YXKH 4F15C 1K8IA 3F7YB 2HT4D 2JLLA 2R23B 3O6LH 5JUEH 2OSLA 2ATKA 4HWZB 4LHQB 3EO1B 3PHQA 1OAZH 3NN8B 5DXWA 7FABH 2A83A 3H8NA 1S9KC 4WFGE 5FHAH 2VR5A 2D7OA 4RMSA 3DURA 1A7PH 3DETC 1CQKA 5HHPB 3VI3F 4OB5H 2EXWC 3BEWA 2EH8L 4OCXL 4MJ6A 3ARBC 3MLVH 3IGAA 1R3HA 3S34L 3LN4A 5C0FB 1TZHA 3T0BA 3BPOC 1R5VB 2XOTA 1NDMA 3RWCA 1R3LB 1TQBC 3QCVH 4JM4L 2MQ3A 4OCRH 3C5ZC 4JANA 4LVOB 5D5ME 3T04D 4MGXA 3F58L 4P46A 1XGUA 3DI3B 1TCRA 3MUHL 4BZ2H 3VDBA 4H8WH 4D8PA 1BREA 5CD3B 2UV3A 3LKSA 5D1QB 1K8IB 3HC3L 1AFVL 1W8OA 4HZLA 2P8PA 3WD5H 1EFXA 3VXMA 1ND0A 4KJQC 2OSLB 4I18A 2ATKB 5IVNA 3IRPX 2UWEE 2YA2A 1AGDA 1KCVH 1RZ8A 2BP3A 3PHQB 3CSYA 3UYRL 2EXWD 2A83B 3MRHA 4LSVH 2VZOA 5CSZA 1EVUA 5T3XL 3DURB 3BEWB 4MJ6B 1ZLVK 2BJMH 4HUKB 3IGAB 1R3HB 3LN4B 3T0EE 5DZLA 1TZHB 2EZ0C 2C3VA 2BSRA 3HFMH 3C5ZD 5IQ9A 2EXYC 3DECA 4U3HA 1QRND 5IVZA 3BN9C 4FQHA 4J8RA 5DJ0A 3RWCB 4JFHE 2CR3A 4JANB 1MCFA 2BSED 4PBWD 1GXEA 5IGXH 3RWGA 2D7QA 5HYFA 4U3XA 3UYOD 1XGUB 3MBXL 1TCRB 2V9TA 4ZFOL 4Y16C 2K9UA 1Z2KA 3C09B 2A77L 1A6VL 4D8PB 3N0PB 4UTBL 1UEYA 2YOCA 2X4SA 3IAQA 4QO1A 5DUPH 4CN6A 5KBNC 3V52H 1JYWA 1PG7X 5L0QC 1OAXL 1VCAA 4KJQD 2NY0C 4HZLB 3L7EB 5C09E 3P11H 2P8PB 1OM3L 1EFXB 3BP6B 3VXMB 1ND0B 1UM5L 4I18B 1ORSA 1AGDB 1RZ8B 5C0RH 3CSYB 3MRHB 4RWYH 5HYSG 4J3VA 1X6LA 5CSZB 5EBGA 4F58H 4CNIA 2WUBL 1WQVT 2ICWJ 2EZ0D 2BVUA 4M6NL 2GUOA 1NCWH 1FYTD 3CDGA 3BN9D 4PJAF 4WI5A 4MXVE 2C3VB 2BSRB 1EZVX 2F8XC 2CO6B 2B4CL 1MQKH 1RMFL 4HWEL 3EFDH 3QI9A 4EZMA 5IQ9B 2EDBA 4N0UE 5FYLE 5IVZB 4FQHB 4J8RB 5DJ0B 2B7DT 1T1WA 5GHWL 4HG4J 1Q9KA 3S36H 4Y16D 4OGAC 3RWGB 5I8OH 4PUBH 1AIFA 1V5JA 4WTZG 5BVPL 4OIBA 5D7KE 1MVUA 3PWUA 1CICC 2NY0D 1UZ8A 3BISA 3V0WL 2X4SB 4OCMC 4AEHH 5JXAL 3NPSB 1FGNH 4D9LL 4JO3L 5KW9L 4HUNB 4YBLC 1N5YL 4NFBA 1Q0XL 3KLDA 1G9NC 2NTFA 1ORSB 2IGFH 1D6VH 1DN0A 1U36A 4L8SA 5DGQA 1GPOL 4U7MA 1QLFA 4CNIB 4CDHA 4M8VA 3VI3E 2DYPA 2GUOB 3CDGB 1UWEH 2J12B 1JHKH 2VXVH 1RJLA 4XCEA 4R8WH 4XPGL 4XVUC 4QWWC 2X9XA 3W11C 1N8ZA 5E8DL 4LSQH 1CT8A 5DR5L 1Q9KB 4LQFL 1I7ZA 4UT6H 3WO4C 1Q94A 1CICD 1IARB 1AIFB 4X6DA 5HJ3B 4UIKL 1MVFA 3VXUE 1MVUB 3PWUB 4ODSH 1UZ8B 4LFHD 4ERSH 4G8GA 1EBPA 4ZAKC 3WS6A 2VH5H 2BY2A 3V7MA 2ZUXA 2ZKHL 4MD5A 4MMXC 2NTFB 2YN5A 5HGAA 4YC2B 1DN0B 5DA4A 5JO5A 4L8SB 1A0QH 3IKCA 5FYKL 4IMKA 4KHXH 2DYPB 3SQBA 4XVUD 2GK2A 4QWWD 3HC4L 3W11D 4UT7L 3VFGH 5F1IA 1RJLB 5F6IB 2A74A 1F6FB 3SKUD 1DBML 1N8ZB 5T1LA 3RWFA 1JE6A 1HOCA 1CT8B 1IC1A 3ZKMD 4NUGL 3AREA 1I7ZB 1Q94B 3RPKA 4XNZC 5C0BD 4PRHA 4X6DB 2AEPL 4OLVH 3EOYG 5I1IH 1FCCA 4ZAKD 2B0SH 1IQDA 2HH0H 3NCCB 4G8GB 4JO4L 4RDQG 3OKMA 1C16A 3E3QE 5DMYA 1NDGA 2C1PA 3KYMB 2DS4A 1OAKH 4HWBL 3P4LA 3N1PC 4MD5B 5HGAB 5KS9A 5D72H 1IGJA 4FFZL 4FHBD 4I3SL 5JO5B 5H37H 3ARXA 2CIKA 1FNAA 4NSKA 2XTJE 4MJIE 3GI9H 4XVJH 1CN4A 1MRFH 1NMCC 5DQDH 1PY9A 3KS0H 5F1IB 4PJAE 1U3YA 1G7HA 3DGGA 1J12A 4N5EC 1J0YA 1N2RA 2A74B 2YPLE 4QRQA 3O45A 1QFOA 4M6OH 1AE6H 4J3XA 1OOAA 1D5MA 1NGXA 1T7YA 3RWFB 3IAPA 1MFBL 1HOCB 5C0AE 2E6QA 4M7LL 2FZ3A 3AREB 3K7UA 1BLNA 5KSAA 4OM0L 4QXTA 3UTSA 1H15A 4PRHB 4PGZA 2QKIA 1ZWIA 3Q3GB 1BPVA 4WHYH 4WU5A 1IQDB 3KJ4B 4DKDC 3GIZH 3G6JF 2FB4H 1AC0A 4C56E 3OKMB 1C16B 3ALPA 5EDXA 3C8KA 1NDGB 2C1PB 3TPKA 2F53E 5DJXA 5D1ZA 1XF1A 5KS9B 3ARVA 1IGJB 4OF8A 4U6XA 5FHBH 1ZHBA 3SO3C 3CSPA 1EO8L 5IUSA 1T2JA 2J88H 2CIKB 4NSKB 3IDGA 2DI8A 1T89C 35C8H 3CLEL 4PJEA 4N5ED 2DM4A 2EYSA 4XBEL 1YNLH 4UV7L 2P45B 5B21A 3WUWA 1G7HB 3DGGB 4DUXA 1N2RB 4G5ZL 2FYYA 4OFKA 3O45B 4QRQB 5TDPA 1D5MB 1NGXB 3WHXA 2XZAH 4JFED 2FZ3B 3VWKC 2VRAA 1XIWD 1VERA 1BLNB 4UOW1 5KSAB 1Q72H 2ICWI 4HD9A 1JWUA 2C3GA 3QXUA 3NTCH 1MREH 4QXTB 3UTSB 1H15B 5HVFB 1OAUL 5LGHL 1ZWIB 4OLYH 4J23A 4WU5B 1YEGL 1NEZA 4K3JH 4P2RD 4R4FL 3C8KB 5DJXB 3SDCB 1BVLA 5D1ZB 3MLTA 5L8KB 1KB5A 1P9MA 1I1RA 4U6XB 4ZO9A 4G6MH 5C08E 4NO3A 5LWYL 3IDGB 5IEHA 1I9JH 2HTLC 4FQPA 1A1NA 5I75B 2AI0L 1JNNH 3RHWK 4PJEB 2EYSB 4WCYL 3VWJC 3WUWB 1BF2A 1BEYL 5EB9A 3VWKD 2FYYB 5TDPB 5HVWA 1IGCH 2H9GA 8CGTA 3BIBX 3WHXB 1F4WH 1YEIL 2AQ1A 1YYMH 5FUZL 2VLMD 5HHME 4PJGF 2UZYB 1JWUB 4X8JA 1TENA 5JPMA 2AW2A 2DQGH 2KZ1B 4H26A 3FQXA 4YGAB 5I1CL 1NFDA 3ZT7A 1AD9A 4V1DA 3VRLF 3BMVA 2HA1A 2HKFH 1NEZB 4WRLA 4P5MA 1U0QA 2P5EE 1OF2B 5FIEA 1UADC 2AK4A 1BVLB 1FVCA 1Q9WA 3ESVF 3MLTB 5HHNA 2EE6A 4LIQH 3HNSH 4R7DA 3FN0L 1FIGL 4KVNH 1KB5B 2HTLD 4J3SA 2ADFH 4MJ2A 3R1GL 4NO3B 1CXIA 5IEHB 3QIWC 1C5DA 1A1NB 3VWJD 3OXRA 3L3DA 3IFPA 4DKEH 1GAFL 1EGJH 2BRQA 4LVHB 5B22A 4OIAA 4CU6A 2EKJA 4X99A 2H9GB 4HIHA 1HILA 3K46A 4PS4L 5C6TL 2LVEA 4X8JB 5IJKA 4LU5H 4L29A 5JPMB 2IH1B 4H26B 3FQXB 3TZVC 1C7TA 3K3QA 4F9PC 3JTTB 1NFDB 4PB9L 1AD9B 4V1DB 1FZJA 1IZKA 4RBPK 1XEDA 5AWNH 3SPVA 3G6JE 4P5MB 3L5HA 3IFLL 4TVSa 4ZD3L 3VXOA 2AK4B 1FVCB 3MOAH 1Q9WB 5HHNB 1NGPL 2WQ8A 4JE4B 5GQBA 4R7DB 3QIWD 2IPTH 2R4RL 4WW2A 5EU7E 3OKOA 3LN5A 1BM3L 1CGYA 5IHLB 1AGEA 5J56B 5GISH 1C5DB 4JN1L 3F7QA 3OXRB 1Y6KR 3L3DB 3IFPB 3SE3A 5J89A 2EDKA 4XCYA 4G9DA 1F97A 3RTQD 4X99B 2XQBL 1QFWH 2C3HA 4HIHB 2VLKD 2VLRA 1HILB 2QQQA 4HT1L 3V7AE 5HYQA 2RBLA 3V4VL 4MA7L 3TZVD 4DK6A 5LKNA 4EN3A 4L29B 6CGTA 1NH6A 1IC4L 2BRRH 5D2LF 3EJJX 1D9KC 3BIKB 1FZJB 1KGCE 4OF5A 1MQ8A 3OR7B 4WUUD 3SPVB 1QKZH 4TRPL 1YDPA 2IAMC 2VXTH 3ALXA 1Z9SA 3JWDL 1N5AA 2P44B 1C12A 1TNNA 4JG0H 2YWZA 4ODBD 2DQCL 5C07E 3CK0L 1MCEA 1BD2E 4DAGL 2Q87A 4W6XB 4Q6YA 3RY5A 5MI0C 4WW2B 3OKOB 3LN5B 5DJDB 4E9LA 3KPOA 1AGEB 2Z93A 1Y0LA 1AJ7L 2JE8A 1I9IL 2I07A 3GSOA 2Q8BH 3NH7H 4XPHL 4NQXA 4XCYB 4G9DB 2WUCL 1FNGA 1I9RH 2VE6A 4ZOBA 4WO4A 3VFNA 5HYQB 2HLFC 1OD9A 1HSBA 5IMMA 4PV9A 3DVGA 4PJGE 3FMGL 2X4QA 5J8OA 1OGTA 2HTKD 1Q1JH 4EN3B 4XXDA 2CKBA 4U6YA 5E2UH 2IAMD 1AO7A 5KOMC 5EPMA 3MLSL 1B6DA 4M7ZB 4TUKH 2EKSA 1FC1A 1N5AB 2EDOA 1C12B 5J0BA 5C2BL 2Y06H 2EH7H 4CVWA 1ZHKA 3LV3B 3GMOA 1ZVSA 4HIEA 2B1AL 3AFLA 3DX9A 5MEQA 1TLKA 5DJCA 3KPOB 2YD5A 4DKAA 2Z93B 5CBEA 4APQA 3BD4A 4N0YL 1KB9K 3TJHC 4QXGH 3GSOB 4JDTH 5IWLC 4NQXB 1NL0H 4K23H 4Y5XC 1FNGB 4U2YA 4AQ1B 2DKMA 2J8UB 2VE6B 1SVCP 3RVWC 4WO4B 3VFNB 2P47B 4RZCA 3SE8H 1RVFL 1HSBB 1UENA 4K71C 1REIA 5IMMB 4PV9B 3DVGB 4YR6A 2BXYA 3VXSA 1NMAH 2X4QB 1OGTB 1KN2H 3HNTH 4XXDB 2CKBB 4U6YB 4LCCA 5F3HA 1EAJA 3EHBC 1AO7B 4FQQA 5EPMB 5J4MA 2O5YH 1UG9A 3MYJA 4NQDD 2EKSB 2LVCA 1GOGA 4MJ5A 4EBQL 2PO6C 5GGQL 4GFTB 1FO0H 3UMTA 1ZHKB 5LXGH 5BCAA 3GMOB 1ZVSB 4TSAH 3K4ZA 4LCYA 4HIEB 4UT9H 1UCTA 4YPGA 4BK4A 5BMFH 5JMOC 4PRPA 3DX9B 4OZGE 2CLRA 5HI3C 3V9FA 3TJHD 5MEQB 3BGFB 5DJCB 2VABA 4FFWC 4APQB 2AJUH 5D1XC 4PP1C 3BJ91 4K3DH 4WWID 3CVIH 3RVWD 2FGWH 3D39D 4XHJC 2Y1VA 1A7RH 4M1GH 4RZCB 5B8CA 4YR6B 3VXSB 1YC7A 3HZYA 4KAQL 4XP6L 3SE9H 1CDYA 1W72H 4QHUA 5AYUL 4LCCB 5F3HB 5D2LE 4FQQB 4GRWH 1JYVA 2Z0BA 2PO6D 1HDMA 3MYJB 3RGHA 25C8H 5GS2H 4O4YH 3D85A 4MJ5B 3GRWL 2OMBA 5TE7L 1E4KC 4F3FA 1J1OH 5HI3D 1HK6A 3EIFA 4LCYB 4YPGB 5SX5K 4FFWD 4PRPB 1MHHA 2J4WH 1QYGH 5EO1A 3JWNC 4XPAL 2CLRB 4Q9RH 5D1XD 1YNKL 4PP1D 3EFFA 4AH2A 3SGEH 2VABB 1ZLUH 1FLRH 3GKWH 3O3DA 5I18H 5MHSD 2WINA 4XHJD 2DD8L 4J7RA 4XAKE 3T0VA 3T2QA 12E8L 3U1SL 1U6AH 5ALBH 1WTLA 2XY1A 5JPNA 2FEEI 2Q20A 3S4SG 3NA9H 5I74C 3UDWA 4GXVH 4O2CA 1A6ZA 3TN0C 5B8CB 5L2KA 3HZYB 1Q0YL 1BAFL 1MJ7H 4QHUB 2O5XL 2X70A 1HDMB 43CAA 3GK8H 1A7QH 3D85B 1NAML 1OAQL 4JB9L 4PJ8C 3MLRL 4KI1A 2EEAA 3OGCB 4X6EA 1WAAA 1CGXA 2XT1B 4YIQA 4F3FB 4G6FB 2ENSA 5JIPA 4YBHA 1PKQA 1T1XA 1LMKA 3FAXA 4JG1H 1MHHB 1KJMA 5EO1B 2BX5A 2X40A 5EULV 3RZCC 3ECBA 1GOFA 3EFFB 1UACL 3RNKA 4AH2B 1RUMH 3GIVA 4G3YL 3MRNA 5IHUL 5HYJA 1P6FA 2ZUTA 1K5NA 2WINB 1BFVH 1T03H 1M1SA 3SKNA 2Q6WB 5DMGC 1ITBB 1GGBL 3IAGC 3SGJA 5JPNB 5EFIA 5LBSL 4PJDF 3TN0D 3MCG1 2MCG1 2H32A 4TSBL 4JZJA 3T0AA 4OZIF 2RIKA 4O2CB 3IXTA 5IB1A 5L2KB 4JREC 4C59B 3FB5A 2NY7H 1KULA 4PJ8D 2X70B 3GMNA 1FZOA 4OLUL 3SBWA 3UJIH 43CAB 1YEDA 3BKCH 4YHKH 4WV1A 1NMBL 4X4ME 5KVGH 4YLQT 5ABDE 4X6EB 1NBYA 3QDGA 1JGVL 3EYVA 4YIQB 3RZCD 4OF3A 4BQ8A 4FQIL 4S2SA 1PKQB 1T1XB 4RGMC 3AXLA 1KJMB 1X5GA 3QFJD 4XWGH 3S34H 1KN4L 4RBPH 3ECBB 1CXEA 4ZO6A 3MJ7A 2BNRE 1U3HA 3RNKB 1CGUA 5K9KA 1RJCA 3GIVB 2E9IA 3MRNB 5HYJB 3PGFH 5DMGD 1XGPA 1K5NB 2F5AH 3FO9A 3MLYL 1OGAE 2XRAL 3SKNB 4L3AA 1N6UA 5EFIB 5FYJU 3SE4C 1IFHL 2M8XA 2H32B 1KFAH 1H3VA 4JZJB 3MCLL 3NCFB 4HUVA 1MJ8H 3IXTB 1N0XL 5IB1B 1T0NB 3HRZA 3IDJA 3FB5B 4IJ3C 1DSFH 4NN7B 3AS3A 3GMNB 1YEDB 3KR3L 4YDLC 4KUZL 5L6YH 4FZ8L 4WV1B 1AKJA 4AEIH 1IAMA 3WBDA 4H88H 3UYRH 2OXGA 1NBYB 3QDGB 4ZFGL 5LVEA 1BFOA 3EYVB 5T3XH 4LGRB 4QOKE 2AEWA 4S2SB 1JGDA 3AXLB 4KH2A 2W9DH 2R56L 1FSKB 1OP9A 3MJ7B 1U3HB 5K9KB 4HKJA 3DUHA 1XGPB 2YWYA 5AG8A 3E0GA 3FO9B 1S5HA 4YGVB 4XP9H 2IFFL 4FZEL 3QRFM 1MJJA 3FZUC 1P4IL 3MYZA 1YMHB 1CU4H 2A77H 4HJ0C 1IC5L 4HUVB 5KAQF 5FYJE 3HRZB 3IDJB 4YH6A 5F70A 1BJ8A 2CUHA 4OLEA 2P5WA 2PKDA 2ICES 4WFGD 1K4DA 4HPYL 1J0ZA 3LKRA 3WFBL 1P5VA 1AKJB 1ZOXA 1AXTH 1AY1L 1EV2E 4JPKH 5DO2C 2QSCH 3IDMA 1JGDB 4OJFL 2IANE 2AERT 3QEHA 2R9HC 3V6OA 2ZUQB 3VFUA 1KCRL 2NY4C 4CJ1A 2B4CH 4MAYA 2RFXA 4LPVA 4CKVX 1RMFH 4HKJB 3BZFA 4HGKC 3NGBC 4PJCA 1S5HB 3FZUD 3GSUA 5CLWA 3MRLA 5GHWH 2FATH 4RGOL 4WUKH 1X3DA 3WLBA 1N6QH 1MJJB 4KUCD 1X5LA 4HJ0D 4PJDE 4PJHF 4EI5A 5IP4A 1ETZA 4OZIE 4U1JA 1ZLWH 4PV8A 4XCCL 3VXNA 4M7JH 3SDXF 5D7IA 2OI9B 2P5WB 4Y19A 1KENL 3RDTB 3KPRE 1K4DB 4P4KC 5F96L 3LKRB 4Y2OA 4OQ1A 4GW1A 3T0DA 1MIML 4WIQA 5DO2D 3F8UB 3JXAA 4CMMA 5I1AA 3LVEA 3MLZL 4X7EC 2XNAA 2NY4D 2JKXA 4DOHB 1DBKL 1IM9D 3QEHB 1WTGT 2CJUH 4JFHD 4BELD 5ICXA 3VFUB 3FFCA 3NFNB 4MA1B 2RFXB 3CH1A 4MAYB 4XPGH 4HUWA 5ITBL 1JGUH 4JFZL 1EK3A 3FHAA 3UTQA 4PJCB 1O7VA 3GSUB 1IMHC 4MNGA 3WLBB 2AJSL 1OTUD 1NCBL 1UWGH 2KPNA 1G7IA 4KRMB 5BW7A 1S7WA 3HPJA 4DKFL 4YHML 4EI5B 1ETZB 4J4PC 3HZKA 2YPVH 2YXMA 3V4PH 4U1JB 2KBGA 4NUJA 4PV8B 3VXNB 1NGZA 1F00I 1C1EL 4XH2A 1X5FA 5D7IB 1TZGL 2BFVL 2GQHA 1D5ZA 4HLZG 4MLSA 4KTYA 4Y19B 1ITCA 3WXWH 3MLXL 1MCBA 3R0NA 2ZKHH 4GW1B 1ZANL 3UXFA 4HAFA 4U6VL 3VFTA 1MCSA 5EOCL 5ENWA 2AXJA 4CMMB 4EEEA 1ONQA 5I1AB 1GC1L 5FYKH 4OGXL 5AYQA 5F89A 3G5XA 1D5BA 2XNAB 3EYFA 5FYLD 1OT1A 1MCOH 1Z3GL 2ZCKL 1CVRA 4ZYKA 3QWQB 4X7CC 5ICXB 3FFCB 3EYQC 2K3TA 3CH1B 4HUWB 5IVXA 4PY7A 3N06B 3BQUC 3QG7H 4OSUL 4W68A 4MNGB 4KQ3H 4NRZA 5D7KD 3UX9B 3O9WB 3ARBA 1G7IB 1S7WB 2VLJA 4J4PD 3RP1A 3HPJB 4LPYA 4QRTA 3HZKB 4QHKI 1DBAH 3SDDC 4NUJB 1P2CA 5DZNA 1NGZB 2DI7A 4C57C 3C5ZA 4XH2B 1EEZA 1EAPA 1QRNA 3MA9H 1D5ZB 4Y4KC 4K8RL 3PP4H 1YYLL 3CCHA 1V05A 2B5IB 2F54E 1XGTA 1ADQA 2WK2A 2VAAA 4W6WB 5JQ6L 5FKPA 3VFTB 2ZSVA 2YUVA 4FFZH 5ENWB 2IALA 1ONQB 1DQTA 2NY1D 5F89B 4IDJH 1D5BB 3EYFB 3EYQD 1K85A 2NXZC 4MAUL 1IGTA 2IQ9L 2GEEA 1L7TH 5TDOA 4PGDB 3BQUD 3DJ9A 4ZYKB 5DUMH 1PLGL 1H3PH 5ADPL 5IVXB 4PY7B 5BOZG 4L4VA 1DLHA 4NRZB 3ARFC 3PHOA 2E27H 4KKBC 3ARBB 2VLJB 3SDDD 5DWUH 4QRTB 4MVBC 4Y4KD 5LG1A 1S78D 1TQBB 1P2CB 3E3QC 3C5ZB 4RAVA 3SDXE 1EEZB 5D8JH 1EAPB 1QRNB 4E42A 3W82A 1E6JL 3CCHB 3TBSA 4MQ7A 1YEJL 3BKML 1T80A 2NW2A 1ED3A 2VAAB 4LDEB 4Y16A 3QUZC 5FKPB 2ZSVB 1JMZA 2GAZA 3HAEA 2IALB 2NXZD 4QKXB 2FX8L 1KCSL 5GGTA 1CR9L 4HK3N 3MRKA 4JJ5A 4PGEA 1IGTB 4KKLC 1X9QA 5TDOB 5INDB 1ZKAA 2PW2A 2N7BA 4FOMA 3S8WA 3P0YL 4F7PA 4DZ8A 4JFPB 4Y88A 3ARFD 4IEFB 4C58B 4JQIL 4YHNA 4KKBD 5EO9A 1FAIH 4L4VB 1DLHB 4P2YA 3MV8E 3PHOB 2A6KA 2YK1H 3I6LE 4NRYA 3IETA 1P4LA 2VTFA 2LAGB 1BIHA 4MVBD 4LDOB 3U30B 1KB5H 1OAUH 1FRGH 2FO1A 5KSBA 1F3RB 4P0DA 1WFUA 1DP0A 5DJYA 5IESL 3D5OF 1HN1A 1A4JA 3N1FC 1ZGLM 3RWJA 3BSZL 4RAVB 4QF1A 3QUZD 4QXUL 4E42B 2NTSP 1EHLL 3TBSB 3C60C 4MQ7B 2ZUUA 5C0CE 5KJRL 2NW2B 1ED3B 2XTJD 2PN5A 4MJID 4Y16B 4JRWA 2R2BA 3B2UD 2GAZB 3HAEB 3QUYC 1T3FA 5EIQA 4KKLD 5L0QB 2DQIH 4OUUA 2NY0B 4GOSA 2YPLD 2VDRL 3QNYA 4RMTA 3MRKB 4JJ5B 4OTXH 4PGEB 1UJTA 1ZA6A 2DQEL 2PW2B 5ILTH 1RQ5A 4WCYH 4F7PB 4DZ8B 1F3JA 5DT1L 4GBXC 4PRID 4CVXA 3CAFA 5AAMA 4YUEL 5EO9B 4YHNB 4QNPF 1QEWA 3QXVA 4I3RH 4PY8J 3F6LA 4XNYH 3CMGA 5DMJB 5FUZH 2A6KB 3SDAB 3IETB 1P4LB 1CGTA 3WIFA 4AQOA 3NCMA 2A2QT 2VYRE 4C56D 5KSBB 1JV5A 3MUJA 3LQAC 4GQPH 5DVOA 2FHFA 2F53D 5DJYB 4YFDB 5H2BA 2NCMA 3DMMC 1A4JB 4OF0A 3C60D 2EE9A 5TE6H 2NXYB 3RWJB 4BSVA 2CDGA 4F33A 4QF1B 2YKLL 4XMPL 4OD1L 2R2BB 1T3FB 3BWUC 3QIUA 4ZAKA 3R1GH 4PJBA 4OUUB 3TJEH 4YBLB 3QNYB 4GBXD 1ZA6B 1QTYT 5CZKA 4B50A 1F3JB 4ZXBC 4O00A 4CVXB 3ILPA 2K7QA 5KVFL 2DAVA 5BOPA 3SQOH 1QEWB 4HFUH 1JIBA 4O9HH 4HCRL 3MLWL 4PS4H 5F72S 4OGZA 4JFDE 5IB4A 4S0TD 3WIFB 4LBEA 2MMXA 2DBLL 3B9AA 1YNTA 1KYOK 3DMMD 1JV5B 4RMWA 2OTWA 4H20H 2DDQH 2WLZA 2X1QA 5H2BB 3ZKXB 4BSVB 2CDGB 4F33B 4CU7A 1FFPA 4GAJH 4HS8L 3WO4B 1YPZF 2D4FA 2CK0L 3HNVL 4ZD3H 2ZUVA 5E99L 5C08D 4Z76A 3N9GL 3I3BA 2FDBP 1RI8A 4ISVA 4N8VA 3GSVA 3VD4A 4UINL 3BRFA 1WFOA 3QIUB 1F4YH 2A6JA 4ZAKB 2HVJA 3HE6C 4PJBB 4QGYA 1YZZA 4ZXBD 2AJYL 3DV4A 4LNRA 4KGJA 5HHMD 1DBBH 3ILPB 2RHEA 5TQ0H 3OQ3B 5EBLA 1FNFA 4TNVK 4YFLF 4L3CA 5IB4B 4FNLH 4PGBA 1TJHL 4LBEB 5F3BA 2I9LA 4L3EE 3VFSA 1YNTB 1KJVB 2WP3O 3X11A 1GVIA 1IC4H 5E2TH 4EXKA 2BVOA 3DIFA 1EDQA 2P5ED 4QT5A 2DM7A 1A22B 2V5YA 3PXJA 1FFPB 5LQBH 2GW5A 4R4BA 1ROWA 4XNZB 4Z76B 2DQCH 4KZDL 5EU7C 4ISVB 3HE6D 5L9DL 4IRZH 1JI2A 2A6JB 2G60H 2LFGA 2OQJB 1U8JA 5D4QA 2HVJB 1KTDA 3DHMA 4NWTH 1I9IH 2CKBH 4MNHA 4P2RA 2VL4A 3DV4B 4LNRB 1XR9A 1WWAX 2NX5E 3LH2L 3CZFA 3H9SE 1B4JL 3A67L 1UFUA 3TBVA 3CFCL 4WEBL 5EBLB 2LTQC 2EDLA 4OCNC 4DVRH 3KLHD 1T89A 1T5WB 4L3CB 2CQVA 4PGBB 4PIRF 1EJOH 5F3BB 2I9LB 4WI8A 3VFSB 2CR6A 4KK8D 2I5YH 3X11B 4GMTH 4UTAL 4NZDA 5I15H 2BVOB 3DIFB 4QT5B 1BWMA 2Z8WC 4RFEA 2Z31C 2X1OA 5IHZA 3VWKA 1JVKA 4XVSH 1N0LA 5D2NE 1RZKL 1S5IL 3QNXA 2JJVA 4R4BB 3TO4C 3CDCA 3KWWA 1S9XA 1UJ3C 3QUXC 2FECI 2XYCA 4K7FA 3LCYA 3GMLA 1U8JB 1ZAGA 1NC2A 2GJ6E 1QHPA 2CD0A 1KTDB 2Y7QA 1TVBA 3D6GA 2J6EA 1OTTD 4MNHB 1SJVA 2Q7NA 4P2RB 5KAQG 3RX5A 4O2FA 1YQ2A 4XX1E 1XR9B 1R0AL 3ZMRA 4IRJC 4TVPD 1FBIL 4N90E 3CZFB 2JCCF 4DQOH 3I6KA 3SO3B 5SV4A 3NZ8A 3TBVB 4RRPG 1JZ7A 5FO7A 1KGCD 4K55A 3BESR 4NQCB 1AXIB 1E4XI 2X1XR 1JZ6A 2FJGA 4L4JA 3VWJA 3OXSA 1LO2H 2R0ZH 1E4XL 1HHKA 5GJTL 2BHZA 3ZHLA 2ED9A 3QQNA 5C07D 3TO4D 1BD2D 4RFEB 5IHZB 5IKCA 1CDIA 3O2DA 3VWKB 4EBQH 2B1HL 2G75A 3QUXD 3QNXB 3SCMC 3LD8B 5TF1L 1BZ9A 4JY6A 1YPZE 4S1SH 3GHEL 1VGKA 2XPGA 1HKLH 2ZWLT 1S9XB 3KWWB 3NFPA 3QHZH 4YBQD 3UZQA 1MEXH 3WL9A 4K7FB 1PD6A 1EMTH 3GMLB 4EIZC 1NC2B 3HUJF 5B38A 2Y7QB 1TVBB 4IRJD 4WI9A 1IL1A 1F5WA 2PF6A 3WNLA 1CDUA 1L7IH 2CRIA 3RRQA 3D0VA 3I6KB 1J0HA 3NZ8B 1RZGA 5L8LB 3UTPE 5M95B 3CX5K 4KQ4H 4RGNE 2Y5EA 3QCTH 5FO7B 1HIML 1YJDH 2FJGB 2ICWA 3VWJB 3OXSB 4KU1A 1HHKB 3SCMD 3H3BC 2CXGA 2X9WA 3S88L 1ULVA 5IKCB 1MFAL 2G75B 1MLCA 3UTTE 2VLKA 4ODTH 4YXLL 1BZ9B 4JY6B 1OAYL 4P57A 5KVDL 1VGKB 2XPGB 4TULH 4WGVB 3NFPB 5KVEL 3TZVA 1EVTC 3WL9B 3MXWL 5BVJA 2XKUA 1XFPA 4KTDL 4DTGH 5B38B 1SY6L 1IL1B 4JRXE 5TFSH 4XMKH 1J0JA 12E8H 1KF9B 2VO5A 4X9IA 3P3YA 5D70L 4NZUH 5KSVA 1T6WA 1RZGB 1NC4A 5BV7L 4U0QB 3DXAE 1RHHA 2PYEA 1Q0YH 2ICWB 4OIIL 5T1DH 4FQ2L 4KRPB 2WWMD 2EEBA 5ALCH 3DVNA 1SHMA 2GYSA 2HRLA 1OAQH 2E7MA 3BOVA 4JB9H 5I16A 1MLCB 2VLKB 6FABL 3VH8A 4P57B 3KPTA 4NZTH 4PGCA 4BUHA 4K94C 1F4XH 4ZDHA 3TZVB 1D9KA 5F8RC 2H32H 5BVJB 4JY4A 5ANME 4J3TA 2IAMA 4P23A 4Z7WA 4Q9QL 4PJXF 3MOBH 2VDNH 3AROA 4H0IA 5I76A 1U9KA 4PJ9C 3GGWA 1DL7H 5K59F 4DW2L 1GGBH 3TWCL 2BOCA 5KSVB 1NC4B 2APWA 1B0RA 1HE7A 2NY3C 2BY0A 1BOGA 4OLXH 2VOTA 4JY5L 3VJ6A 4U0RB 2DKUA 1EERB 1RHHB 2PYEB 5IBLC 4LOUC 5GS0C 3STBA 2AGJH 3AVEA 2OP4L 1E0OB 1K3IA 5E08L 2H26A 5CSGA 3GM0A 3DVNB 4XP4H 4ODVH 1NMBH 5I16B 4Z7VA 2R39A 2RR3A 3ARZA 3VH8B 4LCWE 4ZSOE 4PGCB 1CBVH 2ENYA 3QHFH 4FQIH 4ZDHB 2P49B 1D9KB 3MLPA 4ZNEA 4JY4B 1QSEE 2MPAL 5J13B 4XAKD 4OZHF 2HG5A 1L0XA 1NLDL 2IAMB 4P23B 4Z7WB 3HUJE 2OYPA 3I50L 4DEPC 4NQDA 5I76B 1UA6L 5GRJL 3NABL 3GGWB 4HQQL 5FV2A 3ZO0A 5J9PA 2X4OA 1CVSC 4G43A 5MI0B 3GI8H 2BOCB 1WZ1H 3L6FA 4ETYA 3IDXH 1B0RB 1JI1A 1BOGB 2CGRL 4LOUD 4OQTL 4AG4H 5IBLD 2YD2A 5GS0D 1PZUB 2R0KL 3FCTA 3VJ6B 5IWLA 5HHOA 2WWKO 4Y5XA 1AI1L 5I1LA 5HYSA 4FQXC 5DD3L 5FGBC 2H26B 1UH2A 1E4WL 2FJHB 4ZTPL 5JIKA 4M93B 3KR3H 1D3CA 3D39A 4KUZH 3BDXA 4Z7VB 4LIQE 2NY6D 3VA2C 1S7SA 1PDKA 3O6MH 1BJ1J 1MCCA 1L9NA 1QBML 3H7LA 4MHHG 3UJTL 2R56H 5CEXA 1JZ4A 3OAZH 4ODHL 5M94B 3U9PL 1HXMA 1UB5A 3MJ9L 2YMXL 1JPSL 2PO6A 1A14L 4EVNA 2XTLA 4JM2F 3ALWA 2VXSL 4G6AC 5J9PB 2X4OB 4G43B 2M2DA 3BH8A 4HIXL 1I4FA 3QEQE 3TM6A 3CFEA 1QFUH 3L6FB 2QBWA 4ELMA 2GHWB 1C5CH 1P4IH 4ONFL 3RBSA 3FCTB 3MJ9A 3OPZL 4FQXD 4G9FA 5HHOB 2RCSL 5F7KC 3TA3C 3FAWA 5ISZD 4Y5XB 2EC9U 3X12A 4GG6B 5HYSB 5AZ2L 5ICZA 4WI6A 3D3VE 1P84K 3D39B 4K71B 3ARGA 5DTFA 5LCVH 3M8OL 2BNRD 1OARL 1S7SB 3BPNC 1RUPL 2DQUH 2XZQL 3WNPA 1DQMH 5CEXB 1OGAD 1CFVH 4R4NC 1HXMB 1UB5B 1KCRH 1TJGH 5L88L 5CILH 2PO6B 4PJXE 4EVNB 3NOIA 3RFZC 1E4KA 1FFNA 3S5LG 1FG2A 1IGIH 5FM4A 5DF0A 4JKWA 3ULUL 3BH8B 5K59E 1I4FB 3W2DL 4BFEA 3CFEB 1RZFL 4ELMB 3BKJH 3KDMA 3TA3D 4WEUD 2ESVA 1RK1A 4G9FB 4GRWF 2F15A 4XXCC 3Q0HA 3X12B 4XCNA 5D7LE 4ZMAT 1CFBA 5CJ5A 5ICZB 5F96H 4XX1G 1Z9LA 3W0WD 3WJJC 4QOKD 1H8NA 3MJ8A 1MIMH 3ARGB 5I8KH 4HULB 5DTFB 1VKXA 1WEJL 2ERJC 3VFMA 3DTXA 3HR5A 4R4ND 4YXHL 4LSUL 4OZHE 4PJ8A 4ZOEA 3VMNA 1FFNB 1CZ8H 1QVOA 1R3JA 1FG2B 5BRZE 2OR9L 4NZRL 1FGVL 1NCBH 5FYJD 3RZCA 3VXTB 4YHMH 2JK5A 3KDMB 3CFJA 1QFPA 2ESVB 3BDYL 1RK1B 3H7BA 1DFBH 3ME0A 1SM3L 1C1EH 1TZGH 4M6ML 4XCNB 2NZ9C 3X3FH 1J10A 1HHGA 3ZTJG 5B39A 5I74B 4YPJA 1ZANH 1MAML 3FONA 3MJ8B 4U6VH 2A9NL 5GRZA 2IAND 1VKXB 3ULSA 1GC1H 2JIXD 1ZEAL 2AABH 3O11A 5E2VH 3VFMB 3D9AL 3DTXB 3UBXG 3HR5B 3NCBB 5T1KD 4HMCA 4O02H 3BRDA 2NY5L 1BQHG 1QVOB 3OWEA 3QQ4A 1XF4A 4HS3A 3IVKA 1R3JB 2NY2D 3U79A 5C6WH 2ORBH 2F19H 3T8XA 1ADQH 4KDWA 5HDBF 1UWXH 2E3VA 4YHOL 1UYWH 3RZCB 2A6DA 4D0BA 2ADIB 3IFOA 2JK5B 1KJ3L 3CFJB 5H37G 1IT9L 5JTWA 1P4BL 1HHHA 3KPRD 1FDLH 1QFHA 3H7BB 2NZ9D 3MC0A 1F4AA 4X7FC 3NIFF 4JRYD 4M9OA 3SE4A 3Q1SL 4GLRH 4Q9BA 1HHGB 1FVDA 5B39B 3VXRE 1HSAA 3FONB 2DICA 3TIDA 5EA0L 1KIUA 3ULSB 4MXWL 1BQLH 3O11B 3AAZA 4JAMA 4P49A 3L3HA 1PVHA 5DHVB 2W65A 2YRZA 3TVMD 3L3OA 4MAUH 4WHYG 4NNYA 3KHQA 4MDJA 2V2WA 4HS3B 1TCMA 3QQ4B 5EIIA 1XF4B 3IVKB 3TH4T 3OAUH 4ODWA 5D71L 3TGXA 4RGMB 3K2UH 3I85A 3T8XB 5HHVL 2OM5A 2A6DB 4D0BB 3OJDA 3IFOB 3HAEH 3RY6C 1TETH 4Q7DA 3CFBA 3T1FA 1HHHB 1MHPL 3B9KC 3JZ7A 1NCAL 5D7SL 5GGTH 3V5KA 2MCPH 1P7KA 5GGRA 2X05A 4XP5H 3DNKA 3JV4A 5DVLA 3WN5B 1DR9A 5FFLA 1FVDB 1HINL 1HSAB 2DTML 5CKAA 4WFHE 3AAZB 4IJ3B 1IVLA 4JAMB 1QHOA 3L3HB 4HG4K 2W65B 3OZ9H 3O2VL 3L3OB 3GSNA 4M43L 2ITDA 1T21A 4YDLB 1PQZA 1RJZA 1J0IA 4NNYB 5CLTA 2ARWA 5ID0A 1UM4L 4MDJB 4NC0B 2V2WB 4JPVH 3VGAC 2IMNA 5EIIB 1V3KA 2YA1A 4HH8A 1PKOA 4FQCL 3QB7C 4ODWB 1VEOA 2QQKL 1C8PA 2YD1A 2HFGH 3B9KD 4KKNA