3QUMB

Crystal structure of human prostate specific antigen (psa) in fab sandwich with a high affinity and a pca selective antibody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQSGAELAKPGASVKMSCKTSGYSFSSYWMHWVKQRPGQGLEWIGYINPSTGYTENNQKFKDKVTLTADKSSNTAYMQLNSLTSEDSAVYYCARSGRLYFDVWGAGTTVTVSSAKTTAPPVYPLAPVCGDTTGSSVTLGCLVKGYFPESVTLLWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostate-specific antigen
publication title Crystal structure of human prostate-specific antigen in a sandwich antibody complex.
pubmed doi rcsb
molecule tags Immune system
total genus 24
structure length 219
sequence length 219
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qumB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qumB02
4J3VA 2NY1B 1X4XA 4S0TD 1F4AA 4NO3A 2F53E 5ANMB 4DZBB 3RZCA 1S7QA 4DKEH 1EUUA 3T65A 4OLEA 1RHFA 4XMLH 4Z18A 4H0IA 1ZTXH 5EU4B 2H41A 4OZHB 4G9FA 2DDQH 5D1QD 2YPKA 1OP5K 4D0BB 1S9WB 3MROB 5L2KB 2ZUVA 3QCVH 1CWVA 4LDLB 4YHKL 4ORZC 3SKNA 3QDJB 1Y18B 1P53A 3O6MH 1WQVT 1MREL 3NOIA 3LKPB 4NZDA 3UJJL 4CRPA 2M1KA 2E9JA 3N1FC 3QUXC 1CG9B 4OCYL 3ZTNH 3MJ9H 3MRCB 4NO0A 3RX7A 5HDQL 1N2RA 2H1PH 2A6DA 4JDTL 3LSOB 1OD7A 4JG1L 5DJXA 1NGPH 3UTSE 1HXYB 3GJFA 2Q87A 3VXTA 4F9LA 4FQCH 1CXKA 4Z5RB 3SCMA 4KJYA 1AD9B 5GRUH 5DJDA 5EIIB 5DQDL 3RUGE 3RNKA 3FJTA 3TA3C 4KK8D 3KXFB 5CIPB 1Q1JL 5HHVL 1FH5L 2AXJA 3O3AA 5GSVA 5HDLA 5SV3A 4R4BB 5T5FH 4LRNH 5EOTB 1YUHB 4KJQC 1GHFL 3QG6B 4KHTH 4L3CB 3MMEA 4UZGA 1NGYA 4AM0A 5CJQH 3W39B 2ZUTA 4MAUH 2HKFL 3RGVB 4G6JL 4U1GC 4WGWB 2P5EB 5DK2B 4ZS7H 1XR9A 3S35H 1R3KA 1FL5A 3VW3H 4JG0L 4Y4HC 4AH2A 5MHSD 1ERNA 3U4BL 1UYWL 1T1WA 4KKNA 1JNLH 4Z8FH 4E42B 4Z7VB 3D69A 1QFWI 4NQCD 4WHCA 3TV3L 4K7PY 3BKCH 3PL6A 2RQ8A 5C0BB 2I27N 4LSQL 4KHXL 4DCQA 3BEVA 4YXLL 2PYFA 4KGJA 2A9ML 4APQD 1A7QH 1I9RL 3PHSA 5D6DA 2CO7B 2IBGA 4KI5C 4U1NB 2AK1L 1DUYB 5D1XA 3G5ZB 5DHXB 5DZOA 4NQDA 3MRMB 4JHZA 3PABA 5C0JA 3NA9H 1KIQB 3NFPA 4ZXBB 4IBLT 3G04B 3P40A 1HI6A 5KSBE 1I1AA 1DBJH 4P2QE 2UZXB 3ZT6A 3HC4H 1EUTA 5KOVC 3QT2A 1ZE3C 1T0PB 4XPAL 1CD0A 3V9FA 2ADIB 2YUXA 4GAFB 1NCDL 3BKMH 1QVOA 2VXQH 4P9HH 4RGNE 5IB5A 5BRZD 3GMRB 4GAYA 1OP3H 4QWWD 1LP9B 2HMID 3BVNA 4HEPG 3DETD 3GK8L 2IPTH 2AJXL 1D9KA 4B5EA 2YOCA 3KYMB 4RFOH 2ZJSL 2ZOLB 2VLJB 3OQ3B 1GGIH 1NDGA 2NXYD 4NOBA 3ARBD 4Y5YC 3BKYL 2VXSH 1F6FB 2P8MB 1EFXA 4X5XA 4Y19D 5TF1L 4JHAH 5DRWA 3X11A 3I6GA 3GGWB 4BSVB 4LSPL 3RGHA 4DKFL 5GZOD 1BQUA 2BJMH 2WWMD 3D3VB 4NYLB 2UZIH 4IDJL 1J0ZA 2IFFL 3K2MC 2BNRE 3CK0H 2Y7QA 1R3HA 3ULVF 1CR9L 1HQRB 2B1AL 4XZUB 2AJ3A 1CICA 3EBAA 1PLGH 3V52H 1Z9MA 5CBEB 4UIMA 1IZKA 4ZPVB 5ESQB 3SJVA 3QDMB 3SCMD 3L3JA 3G08A 4JDZB 2XG5A 2IALB 4D9LL 3LQZA 1A6TA 1AFVL 1D6VH 4LU5H 1HINH 4JPKL 3L3HB 2HKHL 1X9QA 4A6YL 2FIKA 4WCYL 5FGSA 4XCEB 3VFOB 1UZ6F 2RCSL 5JIIA 3REVA 3TVMC 4OF0A 4GMTH 4XCCL 3IAGC 4J8RA 1WFUA 5FUZH 3RWCB 3O3DB 5F7DA 4X8JB 1JWUB 5CBAB 2X9XA 3UDWA 3VFSA 3PNWA 2Q3ZA 3QXDB 3JUZA 1KTKE 2YPLB 2PYEB 1A4JA 1MNUH 4MA3A 4NM4H 2R0ZH 1QLEL 4LLYB 3BPLC 2BOBA 4BELD 3EDJA 4PG2C 1U3HD 1DL7H 1EO7A 1CDIA 1GJIA 1RMFH 3JVGC 5CGTA 4M7LT 1LO4H 1ZLWH 3V6FB 3DLQR 3EYFB 1LVEA 2ATPB 2CIKB 1BBJA 4OSUH 1FNHA 5SWZB 5EU5A 5FYJD 1FHGA 1A1OB 3HUJF 2Y5TA 4F7CA 1MCPH 3BYYA 3ZTJG 1I1AD 4M61B 4PIRF 3FOLA 1ETZB 4F7TA 2R0LH 4G5ZL 3M17A 4HX1B 4G42B 1YNKH 3P4NA 2WUCL 2AK4A 4JJ5A 1UZ8A 2IGFH 1QQDA 3NN8B 1KTLA 5EA0H 1FJ1B 3OKMB 3Q6FA 4XNMA 2DM4A 1F8TH 1A6VL 4Q6IC 4YPGA 5DJAA 5DVMA 3A6CH 4OLYH 1WAAA 1FFPA 3C5ZD 3OKOB 4GBXC 2FCBA 4NJAL 4DAGL 4TUOA 3STBA 1CDHA 4NBZB 5ETUA 4MB4A 5F9DC 2HT4D 4EI6B 5LBSH 5HVGB 4XMLL 1JZ6A 5JOFA 1MRCH 4L4TE 3BD5A 1BHGA 5ISZE 1CU4H 1QFWH 1O7SA 1CGWA 2DDQL 2AAVA 2FHFA 1YN7B 4CU7A 1WZKA 2CK0H 3ILQC 3QCVL 2W0KA 3BUYB 4HCRA 3O6ML 4FZEL 4J6RH 1CGTA 1NC4B 3VFWA 2F53D 2V6HA 3OG6B 4X9GA 1P7QA 3QDAA 3MJ9L 4LMQI 4TOYH 4IOIB 1DBMH 3B9KC 1BFOA 4ELME 4H20H 3NMEA 4PRHB 3OR7A 3BD3A 1NGPL 1S9XB 1ES0A 4RAVA 4M5YH 1HCFX 4FQCL 4I0PA 4PGBB 3WFHA 3LKNA 4JFQA 4PV9B 3V8CA 1CICD 4P3DA 4O51B 2ZG2A 4YBLB 1W72B 3HKFA 3UTTE 1PX3A 2DS4A 2P49B 2X09A 4LRNL 4KHTL 3FT2A 1IEBA 5KSAB 5EU7E 4MVBD 5C0GB 2F58H 5EOCH 5IW6B 1CTOA 3P0GB 1K5NB 3DRQB 3KNBB 4ZS7L 7CGTA 5J6GB 1NMAH 3S37L 1V5JA 3S35L 3NCJH 4WFEE 4MA7H 1BPVA 4HKZA 5CGYC 1S7SA 2EIZA 3Q3GA 4P23C 3VH8G 1IKNA 5HI3D 4Z8FL 2B5IC 3BQUA 3IETA 2I07A 4HH9B 4RAHA 4AT6A 4XHQA 2WZPD 5FO9B 1JN6A 3GFUA 4Q9QH 1FO0A 3EOBB 4I5BB 1A7QL 4HD9A 1NGZB 3MFFB 3ELAT 5IT2H 4L29B 1V05A 3KWWB 4MMXC 3MJ6A 1OM3H 4NC2B 3H7BB 3NA9L 2LAGB 4WU7A 4AEIH 4FQLH 3RDTC 1DBJL 3C60B 4XPTH 1UENA 1N4XH 2J8HA 2X5PA 3DUUB 4AEFA 3BKML 3UP1A 3F6LA 1PYWB 4P9HL 2DOCA 3DVGB 3QA3B 5EBWA 2YWZA 3MBEA 5JZ7D 1J5OH 1A64A 2WP3O 4TQEH 5ALCL 1ORSB 4UNVA 43C9B 4YHIB 3QUKB 3QQNA 5MEPA 1DBKH 4P2QD 2IANA 3UMTA 3OBAA 3SO3C 4LVOB 4KY1L 1L0XA 4K23H 3ZE1E 3HTLX 1FGNL 5I76B 1NGXB 4TNVF 1GGIL 1C12A 4RGND 1KN2L 5B8CC 4U6HB 4LKXB 5L7XH 1QFWM 3T0EE 2AXHA 5EOCJ 1A6UH 4JHAL 1BOGA 4XAKE 4OKDA 1H3XA 2DQEH 2MPAH 2YK1H 2EE9A 3TCXA 4YZFE 2VWEE 4G6FD 5H94A 9CGTA 2W59A 1KIRB 2UZIL 4ETYA 2APVA 3ARZA 3GMOA 3CK0L 4ZUVB 1AC0A 1TQBB 1KXTB 1N8ZB 1IAOA 1MHCB 3FRUB 1FFQA 2X4PB 3AY4C 4M7KH 4DN3H 3MUGA 1PLGL 3V52L 2JELH 3JZ7A 5LCVL 1M4KA 3P4LA 4U05A 4ODVH 3N0PB 3LDBB 4I77H 1D5ZB 4RX4D 4HUVA 1D6VL 4LU5L 3RKDD 2BNRD 4AMKH 5I1EH 1KJVB 3DURA 4WO4D 5K33A 3L9RB 3CUPA 1JK8B 4N9OB 5E8OB 1T0MA 4JGJA 1OW0A 3UXFA 3ROOA 5DK0A 4CVXA 3H9ZA 4YBQD 1LO5B 1NGQL 5HHOA 1FZOB 5IM7B 3MNVA 5CZXD 4JEGB 4OF6A 2CKBH 5DJ0B 3VXUE 1U6AH 2FEDC 5FUZL 1MCSA 5HGDB 4WEBH 2JTDA 1T7XA 2B8OT 2PTTA 4M7JH 3GSNH 2BX5A 4X7DC 4MAYA 3X3GL 1MNUL 2BNUA 5FM4A 4NM4L 5FHBL 1MLCB 3ARFA 4TYUA 4YGVB 4JGMA 1UM4H 1XIWB 4PTUB 5DJCA 1DL7L 1OAKH 1DVFD 4JFEA 4U4BA 4EN3C 1RMFL 3IJSB 1RZGA 4LKCB 3QAZC 4OZIE 1NAMH 2DD8H 4OSUL 3VRJB 5IJVB 5JA9A 3PHOB 2VR5A 3A67L 15C8H 5C0IA 1ZANH 5J0BA 1MCPL 3QIBA 1A1NA 4U3HA 5I1CL 4WNQB 4GJTB 3CFJB 3MLYH 2R0LL 2ZCHH 4PYHA 3SE8L 1J8KA 3LKQA 1ADQH 1D5XA 3I84A 2EDKA 1YNKL 5DSCB 4G8GB 3QJHA 3U7AA 2IGFL 3P2TA 4F9PC 2DIJA 3U46B 3V0AC 1NFKA 2ARJB 3MRKB 4D2NA 4Z7UE 3OV6A 4JZJA 2FLRT 4NBYB 1CN4A 3A6CL 5HVWA 3QI9A 4MXQC 5C0RL 3TBSB 1KACB 2D7MA 4CVZA 2EYTB 2IAND 5I73C 5KANI 4ELKA 4Y1AE 5F70A 1JGVH 2UWEE 1BECA 3GI8H 3DOSA 3VG9B 3UTQB 4U1SB 2RB8A 5J57B 1CFQA 2DMCA 5GGRA 5BV7C 2H8PA 5LBSL 1CDBA 4RRPA 2ERJC 3DHMA 3V5KB 1CU4L 3V4PH 2CJUL 2O61A 2F8VA 4N0UA 4FTVA 1HH9B 2CK0L 1FSKC 1T6WA 1LK2A 2W65A 4O2FB 2APTA 3PXJA 3RL2B 1J0HA 3O2DA 4J6RL 3FO1A 2YBRA 4U31A 3RWEB 3KPOB 4ZUSB 4YDLC 5T3XH 3TZVA 4TOYL 4OFKA 3C5JB 1DBML 5ISZD 5KS9F 2QBWA 4H20L 2IH3B 5JW3L 2PXYC 4U6YA 4M5YL 5HPMA 5F1SA 1I9IH 2D0FA 4KKLC 2SEBA 4F8QA 4H5SB 1KN4H 5JHDB 2VAJA 1IILE 2BVPA 1FP5A 2IADA 5ELIA 3NBNA 5EZLA 3AMLA 3O81A 4HKJB 2CXKA 1CVSC 1SQ2N 4N1HB 1FE8H 1VGEH 3LEYH 3QUXB 4LQ1A 3UROR 2F58L 2PUQT 4PJFF 2NY4B 4YDVA 4E41E 1NMAL 4F58L 2ITDA 1TIUA 3NCJL 4LF3B 4D0DB 1AKJB 1FVEB 2OR9H 2V2XB 3UTTD 1NFDB 4ONFH 5JXEA 2M8XA 2NLJB 2NY5H 5HHQA 3HC0A 4WI6A 4RMUA 3TA3B 2CMRH 5DI8A 4HKXB 2V7NB 2IH1B 2NR6D 3BXNA 3LD8C 4X6FB 3ZE0E 4Q9QL 4TVSa 1WTGT 5F3HA 5IB4B 3OKLB 2PN5A 4XCYA 2RFXB 1NMBL 4ZUTA 4WFED 3IKCB 5EUKB 5IQ7H 2PKDA 3VXRB 3FCTB 5IT2L 5B39A 4GS7B 2DKUA 3MZGB 4AG4H 4QRUB 4Q9CA 4MJ6B 1OM3L 3FO0H 4HK3N 3DROB 4FFYH 1Q9KB 1U2HA 4Y4HB 4AEIL 2F8OA 1LK3L 3MLTA 2P43B 5A2JH 1T5WA 3ZYIA 4GKSB 5F3BB 1BFTA 1XGTB 3LKRA 4XPTL 2JB6B 1N4XL 5CINH 3DUSA 1HXMB 1AHWC 4DTGH 1FLRH 1KG0A 3SO5A 1M6OA 1SJEA 5LAXB 5EG6C 4S2SA 2A6JA 1INEH 3WIHH 1ORQB 4X4XB 1J5OL 1CLOH 4U49A 2AEIT 5EDXA 3TO2B 1D3CA 3QHFL 1DBKL 4ZYKB 2VZ3A 4PJDB 4UBDC 1OF2A 2YSSA 3BIAX 4N5EC 1KB9K 5CAYB 4K23L 3NTCL 4CNIB 4WHYG 4QRRB 1T1ZB 5DUMH 4YHZH 2GSGA 5DQ9A 2CDFA 3B6SB 5D7IF 5T5NF 4TRPL 4ZFOB 1BP3B 4R90H 5KVFH 3GRWH 1FIGH 5L7XL 1OTUC 4X6CE 5CEZE 5J9PA 4IOFC 5HI4D 2W9DH 1FNEB 1Y0LB 4J23A 4IRJD 5GGQL 4IRSA 1YDPA 4CVWA 2ID5A 4UDUA 5GIRA 2DQEL 2YK1L 3L5XL 3ESUF 3UYPA 3ALXA 4H0GA 3HRZB 2APBA 3HNSH 3O9WA 4MNGB 5D5MB 3HG1B 3L3GA 4MJ5B 1SYSA 5IHLB 4L4VA 2V2WB 2D03H 3CXHK 3T0ED 1TVHB 2YXMA 3VRLE 4WW2F 2MSPA 3DJ9A 2YRLA 1KCUH 3O8XA 4M7KL 1ONQA 4OM0H 1CFVH 4DN3L 4XAKD 4Y5YB 3UPAA 3TF7C 2EIDA 1I3VA 3BZDA 2JELL 3RIFF 3V0WL 4CADA 3BWAA 4NFDA 2W38A 3JWDC 1EDQA 4X98B 3TM6A 2FX9H 1KPUA 4U1LB 1RD6A 1F58H 2GJZB 1E27A 3TN0C 1KEGL 2JJSA 5I1EL 5IG7B 1UH3A 1OSZA 4M6NL 4N8PA 3NIDE 5IF0A 2IF7A 2A0LD 8FABB 5J6HB 5ANME 4MJIA 2CKBL 2HN7B 4OZHE 3PP3H 1U6AL 2DQUH 3EHBD 5CSGA 4WEBL 4G7YH 2YD6A 1A6AA 1A22B 3RHWK 3U4EA 4M7JL 5L2KE 1FGVH 3W9EB 3MQIA 3GSNL 4HT1H 2FIRT 4LVNC 5TE7H 1ZEAH 2AV1A 1QFHA 3HZKA 1E4KC 1UM4L 4I9WE 3WKNA 2AJZB 1WBXB 1OAKL 4GKZB 4FQXA 5TGBA 1G0XA 3VXUD 5GS1A 4XCNB 1MEXL 3JWOL 1NAML 2DD8L 2YA0A 1KELH 4LGRB 3TVMB 1EMTL 5IOPA 1ZK9A 15C8L 4J4PA 5T1KA 4Y2DA 3WYRA 5DMKB 1ZANL 4NCC2 4OGXL 4M6OL 4C56B 3KXFE 5MERB 1HSAA 3U9PH 3B3IB 1KBGH 4HUWB 5IB3B 3P4OA 2ZCHL 1T0NB 4PJAF 4GG6A 1ADQL 4JRXA 1HSBB 2EKSA 3HAEG 3MLWH 3QP3A 3L5WA 3PG2A 5E00A 1JGDB 4Q2ZA 1FNGB 5HI5D 3BPLB 1S7XB 4P2OA 3RWIB 4N90E 3N1MC 1R5VB 4K8RH 2UUDH 2VXUH 2YD3A 4D8PB 3S96B 2O5XH 4Z77B 4UQ2B 3U0PB 2APFA 1JGVL 4BQ9A 5H37G 2E7CA 2MMXA 1DE4B 2YEZA 4Z7VE 1FZJB 4OM1H 1FYTB 2COQA 5C0BE 2J6EL 1I1RA 2BMKA 2VDNH 3G6AB 3V4PL 4YHPA 5F93C 1IM9B 1GZPA 4QRPA 4YDJB 3MRQB 1JZ7A 4LLVB 1R3IH 2J5LC 2V5YA 4B41A 4XBGB 3GSUB 4MQ7B 1GGUA 3CVHH 1A5FH 1MFEL 4IRSD 3O4LA 1RK0B 4Y1AD 2VITA 5IUSA 2BSRB 2XWBA 4QT5A 3CFCH 5EPMB 5JDJA 5A3ID 1NEZA 5T3XL 2QL1A 2BNQB 3ZKQD 3VD4A 1BJ8A 1AXTL 4OV5B 5ACZB 5HHPB 1U0QA 5D93C 3AC0A 3SGKC 5IHZA 2N7AA 1S5IH 1PSKL 5F7EH 5MP6L 3DRTA 3ZDXE 2HFEB 3QJFB 1I9IL 3L5JA 1BQHG 4M6AA 2JK5B 3K74B 4R4ND 1UADC 1KN4L 4M93B 5CHNA 1SY6H 1J0YA 1LP9E 4HK0A 1NCWL 1M7IA 2LE9A 4JPIA 5FIEA 4N0RA 4U7SA 3B5HA 2QQLH 5MEQB 2HYMA 2FSEA 5CP3A 3GJFK 4JRYA 5BOPA 5C2BH 1BD2A 1TCMA 4EI5A 1QNZH 1VGEL 2VLJE 3LEYL 4ZFGL 2Z4QB 3B9KB 1KCSH 3CXDH 4HLJA 1IARB 2E7LC 4Y16A 3IF1B 3NCBB 2OR9L 4XP6H 1K9TA 4HS6A 4ONFL 3CFEA 2NY5L 4P2CG 4FN0A 1R24B 4P46D 4OUOA 2CMRL 4L9LA 3IFPA 4LOUC 1PZ5B 1J1XH 3GMQA 2LTQC 3D3VE 3L7FB 3LRGA 3BEWB 3EYVA 4ODHH 4PJ7E 2I9LB 4E41D 5DRNB 5F6HJ 2C3VB 2R2EB 3S7GA 3UBXG 5IQ7L 4JFPA 1Y6NR 2JCCA 3CDFA 6FABL 4FQXD 2QKIA 4AG4L 2IG2L 1ZT4A 4NWTH 1WFNA 3D2UB 5TPWH 5IJKC 4EUPH 5L2JA 3GM8A 3QDME 5HDOA 2A83B 4J4PD 4M7LH 5IQ9A 1G7HA 3STZB 2GJ6B 1NFIA 4P23B 3SDCC 3JV6A 1A7PH 5CINL 3FFCB 2ZUSA 4DTGL 1FLRL 3OZ9H 4OZFA 2CLVA 2QJDA 1AO7A 1X5IA 1XGPB 3IXTA 4JRXD 4XVJH 5INCA 2EEBA 2ZZUT 4L5FH 1EEUA 3B8SA 2NY6C 3WIHL 3M8OH 2DL9A 1JWSB 4TUKH 3FB8B 3LQMA 2VL5B 3TBWA 3MO1B 1VEMA 5DUML 4YHZL 2WUBL 3RDTB 2AABH 2CUHA 4OF8A 3WNOA 1MVUB 2YPLE 4MCYB 2PYEE 1KENH 5F97E 1YZZA 4U1JB 3ZYOA 5KVFL 4R90L 2PO6A 3GRWL 4IMLA 2W9DL 1MCOH 1Q72H 3F5WB 1E4WH 5D1QC 5IFJB 1G7PB 1N3NB 1W8OA 1MHHB 4J7RA 5IVNA 4FXGB 5JPMA 1F4YH 3QEUB 5E2TH 4FFWC 5SWZE 2FJFB 2PW2A 2FD6H 3T3ME 1MAMH 4L8DB 3SO3B 1P6FA 4UT6L 5DVLA 3BUTA 3BKJH 4FG6D 2D03L 2W92A 5CEZD 1T1XA 5IMLB 4DGIH 4PJHB 1GXEA 1KJ2B 2DLGA 5CSZA 3WN5A 3MRPB 4LNRB 2IQ9H 1QSFA 1WLHA 4WV1A 3FRPA 1KCUL 4OM0L 3UPRB 1CFVL 5B8CB 1QUNA 4LEXH 5IIEB 1F11A 1OPGH 4ZAKA 1CFNB 4KK8C 5DS8B 3RIFK 4X7SH 1MJ8H 4FQHB 1U91A 1U8MB 2DWDB 4OBSA 1NAMA 1DTUA 4NKMB 3ARGB 1URLA 1A6PA 1MHPH 3KPLA 3SDAB 2V9TA 3G5YB 3CZJA 5F7YC 4JRYD 3LH2H 2Y6SD 1AE6L 3TPKA 5DO2D 4Q58C 4FP8L 3BPNC 2DQUL 1BLNA 5HYIA 4G7YL 2GFBB 1FGVL 3K7UA 2ZSWB 2CSPA 4Y16D 5DR5H 4HT1L 1NGWA 3X14A 1EZVX 5C09B 2XN9A 2NY1D 4Y8DC 4NZTL 4ZNEA 5MI0C 5D7JB 3PWUB 1MCHA 2XV6B 3T0AA 5HBBA 2EE6A 4X9FA 3L7EA 4APQC 1NQBA 3VWKA 5DD0H 4YGAB 1ITBB 5D2NA 4PRHE 1LDPH 2DM7A 5DJ6A 1TVBB 3HS0B 1R5IB 2X4OB 3B9DA 5L2KD 4K3EH 1KELL 3R1GH 5E5MA 2YHGA 2J6EA 1UQSA 4HZLA 1H0DA 2BVTA 3T1FB 4G6MH 2VLLA 2K1MA 4EDXB 1J7VR 3TBYB 2D31B 3IAPA 4JAMB 5TDPA 3JV5A 3U9PL 1A3QA 1T2QH 1KBGL 4GMSH 4I9WD 3BRFA 1XMWA 1K6QH 3D48R 3DPBA 3NACH 3MLWL 4XPBL 1FV1A 3SKUD 3V6ZA 2R1WA 2GYSA 1H3WM 4LASL 1ZSDA 1JL8A 3RVXD 5D2LF 5KZCB 4Z7OF 4K7PH 5C0CA 1YA5A 4K8RL 2J8UB 3KXFD 2O5XL 3ABZA 3H9SA 4XC1H 3DETC 3RVWD 3IDMB 4UT9H 5D6CA 5BVJB 3I9GH 2EC9T 5EUOB 5IWLA 1BZ7B 2C1PB 4OM1L 2OM5A 4PRAA 1HQ4A 1YYLH 3HR6A 5T1LA 4KPHH 2VDNL 3RGVD 1X7QB 4GG8B 3IJYB 1U93B 3RZCC 1X4ZA 2PO6D 1R3IL 1YEDB 3KDMA 4LSTH 1OP9A 3U36B 3BHBB 3CVHL 2KDGA 4HWUA 3OAYK 5ID0A 3GSWB 3EJYD 5DDHA 1WF5A 2BFVH 5GZOC 3CFCL 3T0WA 2WWMC 5EH1A 4MS8D 5HGAA 5C0BD 3DV6B 5I73B 5DRXA 2FECL 1JGEB 1Q8MA 5JMRA 3QXUA 4OKVB 4PJBF 1S5IL 2FX8H 5F7EL 3E3QE 2YR3A 5F1NA 5BV7B 3U7WH 4WI2A 2MHAB 2AI0H 1N5AB 1PQZB 3KPPA 1SY6L 4ZXBD 1SEBB 3DGGB 3SCMC 1BVLB 2XZAL 3DX7A 1FSKB 4B53A 4HSQA 5CLWA 2H6PA 1HIMH 5DJ8B 5E99H 2CQVA 2CGRL 1MQKL 2QQLL 2EKJA 5C2BL 5FCUH 1Q0YH 1QHPA 1QNZL 4G9DA 4WTXA 1U8JA 5D71H 4YDLB 5M95B 3DV4B 1WBZA 1F4XH 1SBSH 1KCSL 3IS0X 4OLUH 4LEOA 3CXDL 4QEGA 4DZ8A 3TT1H 4XXCA 5JQ6L 4XP6L 1T80A 1V3LA 4OQ1A 2PCPB 4X6DB 1LD9B 4OLVH 3VFMB 4PRBB 4LCYB 4Y4KA 5DLMH 1M71A 1D5MB 2VLJD 1OLZA 1NKRA 5GGSB 4KDWA 4KRLB 4EOWH 3P73A 2E7HA 4ODHL 2DJUA 4CN1A 1MH5A 1UWXK 3I2CL 3HRPA 1H3UA 1U3HC 5I74C 3EO1B 2WK2A 1K4CB 1BF8A 5FA4A 3T2OA 1I8LA 5TPWL 5D1XC 4JVPA 1OB1A 5HYQB 2NTFA 2NW2B 5E7FA 4HFUH 3VD3A 4AZ8A 1A7PL 1I1AC 4WU5A 1HOCA 3BFOA 1HHJA 4PJEF 3Q0HA 5ADOH 4XVJL 2I26N 3LD8B 3I6KB 4JN1H 2NY5C 1T22A 1FCCA 4K94H 5CMAA 4Z9KB 3VFPB 3M8OL 1YNTB 3P0YL 3LRSA 4NQXA 1MY5A 1CXIA 3RA7H 1GGBH 3QDMD 3QEHB 2DRUA 5DEGA 5IMOB 3HI1B 1ACZA 3LB6C 4JY6A 3C6LB 4OUUA 3GB7B 3C8KA 2X05A 2IMMA 2IQAB 4UINL 3C5ZC 1G9MH 3H9SD 4DUVA 3MUY1 1TNMA 3BJLA 2AABL 1WICA 2HFTA 4WUUA 1KENL 4NNYA 1EVTC 3PXHA 4WUUE 1A6WH 1D5BA 1AHWB 1MCOL 1Q72L 5IVXB 3DVNA 2Y06H 4LLWA 5AWNL 3EIFA 2L7UA 1WCBA 2DQTH 5B4MD 4OCWL 4OZGA 4GW5B 2FD6L 1NEUA 2ZOKB 2YPLD 3PJSA 2PYED 5K9QG 1A1MB 1MAML 3SQOH 3ARED 4BSWB 1FFRA 4WFGE 3TPUB 4DFHA 3W81A 3BKJL 5LXGH 2R8SL 4DGIL 5GSRA 4JQVA 1UT9A 2IQ9L 1X5JA 1OSPH 4F15C 5C07B 2HTKD 4G8GE 4LEXL 5JIPA 4HIIA 1OPGL 1U8NB 2XKSA 1CICC 2GK0B 5SWZD 3WBDA 4GAGH 1ZWIB 5K59F 4HWZB 4ISVA 2CRZA 1X4YA 4BQ8A 4X7SL 1MJ8L 4JFXB 4JLRB 2ZKHH 3LS5H 5E56A 5KSUA 1MY7A 4TNWK 5FECB 5IEKA 4R96B 4AJ0A 1MHPL 3HNVH 4RGOH 5ICXA 4Y89A 2BCKB 2WANA 2PR4L 4ODWB 2YD9A 3LH2L 3EFFA 2XKNA 3GMPA 3TT3H 2G75A 4P5KA 3MRJA 2J1KA 2HJFA 2BY2A 2Q8AH 4JO4H 2X4SB 5J11B 3DIFB 1NJ9B 5DRZB 3CZFB 1A9EA 3O2WH 2FGZA 1BZ9B 3BOVA 5DR5L 2X4RB 5HI3C 4X4YB 5HGGS 5GGVY 3TN0B 2GQHA 4JKPH 1S8DA 1OGTA 2B4CL 4HJ0D 5DD0L 4MGXA 4OIBA 4WJ5A 1LDPL 5A43C 1SJVA 5SWQB 1HKLH 1I3UA 4POUB 4K3EL 5DD1L 3EOAB 1BAFL 2FBJH 2HG5B 5DD5H 3FQXB 3P4MA 2R23B 3WDJA 4YHLH 5JHDE 5BW7C 4G6ML 3WS6C 2AV7A 4PGDB 3WFCH 5J12B 5GRVL 1T2QL 2FO4A 1G6RB 4GMSL 4JFZH 5GRZA 3EYSH 3ARDA 1FN4A 4PRHD 3VXMB 4KMQA 3CNKA 4LLMA 5I1IH 5JZ7C 1J11A 2V9RA 4UUJA 1ZHBA 5CEZH 4X5WB 4K7PL 4JREB 4XC1L 3RWJB 3MGTB 1FZKB 1NFDE 2DB8A 4ZMAT 1A7NH 1IT9H 5HSFA 5GPRA 3I9GL 2IMNA 2UYLB 1U8QB 3IYLW 5IFAH 1TVDA 3DMMA 1G7JA 4K3JL 1YYLL 1LHZA 3BH8A 4KPHL 4PJCF 2AEWA 5C3LD 2XWTA 2BVQA 1EGJL 5F1OB 4Q0XH 1RZJC 3VXRE 5E2WL 3CFKB 2FL5A 5DJZB 5I17A 1OGAB 3OGOE 4FQ1H 1UH2A 3FB5B 4KGLA 2X4QA 2Y25A 3LOWA 4XGZA 5C3TA 3RVTD 4KK6D 4L8BA 1JIBA 3D85B 3QNYA 1IGJA 1NCBH 4G6KH 2Q1EA 3UTOA 4G8FB 4KKBD 3ZTJH 5I8EB 3U30C 1FFOB 5CD5D 2FX8L 1TETH 3U7WL 4YFEA 4N0FB 3RRQA 2AI0L 1UJTA 1NDMA 2J5LB 1KGCE 2XT1B 4KI5E 3KLDA 4JVWA 4S1DD 3VJ6A 1XF4B 4PJDE 4EIZC 4OZ4B 4JZNB 5FKPA 3RKDC 3C60D 3WNMA 5E99L 5C0AE 1HNFA 1PX4A 3D9AL 4QRRE 4UTBH 5DA0B 4WO4C 3MLXH 1OL0A 1Q0YL 1L0QA 4AENB 3DTXA 1S9YA 4YNYB 5E8NB 3LAFA 2JJTC 4P57A 1QFOA 1VFUA 1F4XL 3MRGB 4HMCA 1SBSL 5FUOL 4OLUL 5D93B 4IMKC 2D0HA 5IBUB 3TT1L 3VDBA 5IKCB 3X12A 4F33A 2VSCA 4GW4A 4ENED 1I3RA 4LLDA 1IAII 4OLVL 1WWAX 2NX5B 4PP2B 3QIUA 5IVZB 5DLML 2DI8A 1QSEB 3F62A 3BQUC 3BWUC 4MNGE 5D5ME 3HG1E 4EOWL 1U8IB 2VXTH 5CIPH 5ENWB 2KKQA 1NAKH 1DVFC 5K9OB 5EU3B 5DK3A 3T2PA 4KTDL 2DICA 4EVNB 1AR1D 2D7TH 2CDGA 5E8EA 2P8LB 5SX5H 2JCCF 4HFUL 3BH9B 1PG7W 1Q9LB 3R8BB 1LNUB 4PFEA 1Q9OB 2VQ1A 3AAZB 1W0VB 1JHTA 5I1LA 1YY8B 1IEHA 4I2XA 2LTQB 3VDCA 4ETQA 5T1DH 4MDIB 1NH6A 1M05A 5HVFB 4YAQB 4JN1L 2VO5A 4K94L 4NQVA 3HFMH 1C16A 4YHYC 2DQJL 3MBEC 4QHMB 1GGBL 4DQOL 3GSOB 3W82A 3PDGA 5I15H 4LLUA 4RA3A 5E0QA 5IBLD 1HHGB 5CP7A 3S36X 2P5WB 3L3DA 1G9ML 2R1XA 5E1AB 2NPLX 3V5HA 5D96C 4NZRL 3IDIA 4LPUA 3MV7A 3S4SB 2XQBH 3VFVB 4HGWB 3SDCB 1A6WL 4JM2F 2EDBA 1U92B 4P3WA 3DMMD 2EYSA 2EICA 4JFYA 3VXNA 3WV0A 1CK0H 1UVQB 2D7OA 2Y06L 1FRGH 5CJ5A 1FG2B 1SBBA 4B7LA 2NY6B 4JFOA 4NBXB 2N1KA 3WNLA 2DQTL 4V2CB 4HC1A 3F7YA 3C09C 4PLKD 4UILH 5E2UL 3EGSB 3SQOL 3R0NA 4C56E 5IV2B 1EPFA 1JCKA 3PDOA 3EOYG 5LXGL 1RZIA 5D8JH 5F7LB 1XIWD 5KN5A 5L88H 5I1KH 3ZL4L 2VQTA 4HMDA 1QLFA 3T0VA 3I85A 2W1NA 2K3TA 3D39B 3WJLC 1EH9A 4GAGL 3C5SB 3VFTA 3QUMB 4ZTOH 1YPZA 3T08A 2VUOA 4X99A 1I9EA 2DJSA 4WFGD 2ZKHL 3WL9A 5FK9A 4O5LH 4R4FL 1H5BB 5DHVB 1JV5A 3W0WA 2XNAB 1B6UA 3HNVL 1TLKA 4NUJA 4G3YH 1FYTE 2VDLH 3LKOA 12E8H 4K71B 1IL1B 5DJYB 1MAJA 2MCG1 4GRWB 2Q8AL 2DBLH 3D0LB 1A9BB 3NGBB 4JO4L 3LN5B 3U6RA 4DUXA 3BRDA 3O2WL 2HT2D 3LS4H 4N5UA 4QXTB 5GGSY 3WS3B 1E28A 4FXLA 3RX5A 5C9JA 3S97C 4PRNB 4JKPL 1H8OA 2NR6C 3OX8A 2BNQE 1UG9A 1GZQA 1KXQE 3AU1A 5EU6A 4O2CA 4PD4J 2LVEA 4MX7B 1VADA 1ZXQA 1A21A 5D9SA 1RURL 4PJXA 2FBJL 4OV6F 5DD5L 4NKDB 3BPNB 1T20A 5IHBA 1H15A 4NRXA 4R26H 1EGJA 1T7WA 3WFCL 3CH8A 1CD1B 1NPUA 1J9CT 5LVEA 3OJDA 1L9MA 5JDSB 3EYSL 2HFFA 4XBPB 5HGBB 2OTWB 3PGFL 4IIQB 2A74A 5I1IL 3FMGL 2HP4A 3MA7B 2DLFH 1OLLA 4HHAB 4F7PB 5CEZL 1IM3B 2VDQH 1LILA 3LY6A 5JHDD 4JZJC 2DQFA 4NN5C 1BWMA 1T7ZA 5GISH 3QZWB 3V6OE 1A7NL 4DJMA 1IT9L 4JO1H 4WHTB 3BZFA 1EXUA 5I1GH 1ZLUH 3HI6H 1U8HA 1JWMA 1AJ7H 1TZHB 3ARXA 3UO1H 5IFAL 3QUXD 1IAIH 3FZUD 1Z9OA 3MV7D 4WWID 1S9VB 2BVYA 2DF3A 4J2XA 1KEMH 2NY4D 4OFDA 5F72S 5HI4C 4ZDHA 3ZDZE 3BT2H 4Q0XL 4PJIB 5I19H 3FT4A 1EZVY 3KYNA 2ZPKH 1KIPA 4O9HH 1CIDA 1I8KA 2ZSVB 4FQ1L 3RU8H 3BMVA 3RIAF 1QACA 1S3KH 3TA3D 2FHCA 3WNPA 3BZ4A 3MPCA 4G6KL 4MQXD 3QB7C 1HEZB 5EZOH 3SDXF 4KJQD 3FFCE 4CW1B 3TZVC 3T0EC 1VCAA 2VAAB 2X44D 1TETL 4FA8A 3VXRD 4AL8H 4G8IA 4NO3B 3RWDA 1T2JA 3RZCB 4M1DH 1S7QB 1MIEH 5DURB 3T65B 5IBUG 2VWEC 4JPWL 4Y19B 5TE4L 3ARVA 4Y4HD 3O11A 4G9FB 2EYRA 3FQUA 2YPKB 4C59B 4UTBL 5J13C 3MLXL 4PJ5A 4TVPE 4QCIA 1SMAA 3QR2A 3SGJA 3L5HA 3G6JA 4NO0B 5F1KC 3MYJA 4KI5D 5EZJA 2A6DB 2ED9A 1V3JA 3EHBC 5J3HD 2CLRA 4LBEA 5DJXB 4XI5C 5JHLL 3GJFB 4GFTB 3VXTB 5C0AD 1ZS8A 3BP6A 2YZ8A 3SCMB 5FO8A 4KJYB 5JXEC 5DJDB 1DQDH 1AIFA 4QTIL 4CVUA 3RNKB 4ONHB 5FA3A 5FKAB 2DIAA 1W72H 3O3AB 4QTHA 5GSVB 1NAKL 2VN4A 1B9ZA 4KUCF 4PJHE 1INDH 3BGFC 3MMEB 1NGYB 2GUOA 4I3SH 5FYLE 4AM0B 1FVCA 3INUH 3OAZH 4Z7WA 2DN7A 1MCBA 1TFHA 5ITFA 1XR9B 1R3KB 4OIAA 1FL5B 1P84J 3HG1D 3R0MA 5L9DH 3NFNA 3IRPX 1CLZH 3PP4H 1T1WB 3RI5F 1P69B 3IDXL 3S4SG 3D69B 1F02I 1KLFA 1TENA 3PL6B 1PEWA 3HFML 3S88H 1JHLH 1MRDH 1I4FA 4DCQB 3BEVB 3NCFB 5I74B 3VD7A 2PYFB 5EWIH 1J1OL 1ZT7A 4P5MA 5I15L 3P0VH 5D1XB 3RUGF 5LG1A 2XTJC 2XY1A 4NC1C 3ET9F 4NQDB 1B0GA 3OKEA 3PABB 5C0NC 5C0JB 5C09E 3NFPB 3UEZA 2XQBL 3A6BH 2P47B 4WI3A 4ZQKB 1IAIM 3K8MA 5BJTA 5CWSB 1I1AB 3MRBA 3QEQA 1DUZA 5D70H 2EDWA 4DVBA 3DSNA 1CK0L 2OTPA 1FRGL 4FNLH 1NCCH 5EO0A 5CKAA 3IGAA 3VGGA 1QVOB 4IRSC 1YQVH 4JPVH 5IB5B 3KVQA 4KWUA 4RIRA 5DFVD 1JI2A 3UYRH 4GAYB 2AJUH 5F7NC 4S1RH 3EUUA 1KJ3H 5A3IC 4MDJA 3BVNB 3O9WC 3C5ZB 4YXKH 5D8JL 4X4ZA 1D9KB 5I1KL 5L88L 1H8NA 2VC2H 3O6FA 3HZMA 1G9MC 3P30H 1NDGB 1BIIA 3TVMD 2HFGL 1RJZA 2OCFD 1EFXB 4X5XB 1BF2A 5F71A 3ZE2E 1TZGH 2J8UE 4C56D 3AVEA 5DRWB 3X11B 4HIEA 4KKCC 5KSBF 3I6GB 3QUYA 5EUOE 4G3YL 4PGJA 12E8L 1CFTA 2DBLL 3RL1B 3VI4E 4NGHH 2Y7QB 1R3HB 2WBJA 4RISL 3MLVL 4IS6A 4NO5A 5IGXH 1CD8A 1XGRA 2AJ3B 2G5RA 1CICB 2X10A 4P46C 3WXVH 4YPJA 4FXKA 4UIMB 1RIHH 5HDBE 3SJVB 5I71C 3L3JB 3G08B 1FYTD 4NNXA 3LQZB 4DOHB 1A6TB 4EXKA 1IM9D 2XZQH 4KQ4H 2FIKB 2Y9RT 4FQXC 5DWUH 5GS1C 4L3AA 1ZHLB 1QOKA 3REVB 2ZCKH 2H2SC 3G9AB 2FH6A 5B38G 2XA8H 4J4PC 4PLNC 4J8RB 3CGTA 1OD9A 2BNQD 4FABH 3QZWG 5F7DB 1A6ZA 3VFSB 1ROWA 5BS0A 2EXYC 3BMWA 2HJLA 3PNWB 1ED3B 5E5RB 1KC5H 3MXWH 4X0KA 3TJEL 5C9KA 3FQRB 3TO4A 1A4JB 4L8CA 2F8XC 4MA3B 1IVLA 4F7MB 3OB0K 4HG4K 2VDQL 4KROC 4E0RA 1ZGLA 5EBLA 4P2OC 1KYOJ 3QEGH 2DQIH 2LU7A 4KJPC 3L3IA 1KLUA 2C4XA 4X6DE 1VFOA 2P8PA 2X1XR 5F8RC 4JO1L 5I1GL 1K8DA 2Y23A 3HHRB 1BBJB 3HI6L 4PJ8D 1AJ7L 5EU5B 2JKXA 1KLGA 2Y5TB 1IAIL 2NW3A 4IHOA 1U3JA 5SWSE 4F7CB 5EU4A 1KEML 4ZO7A 4D0BA 5TDNA 3BT2L 3FOLB 3HZVA 4YWGH 4F7TB 3W9DA 5I19L 2NZ9D 3C6SA 4LHUA 5JXAH 1J8HA 3M17B 2ZPKL 1MFAH 3P4NB 3QDJA 4O9HL 2AK4B 4JJ5B 3U2SA 1UZ8B 1QQDB 1KTLB 3RU8L 3GIVA 3Q6FB 4C54A 3RJDA 4XNMB 4WTZG 5GJSL 4YPGB 5DJAB 4P2RA 5EZOL 1JZ4A 3RIAK 5TDOA 1FFPB 2F5BH 5E2VH 4AL8L 4TUOB 1ZHKA 5EIIA 5ETUB 4M1DL 3SE3A 3X3FH 1MIEL 3D2UD 1AP2A 3MJ8A 4ZD3H 1T03H 3O6FD 3ULUD 3ZT5A 5JOFB 1HHKB 4HFWB 3O2VH 2QSVA 4LGSB 2WAHA 2VR9A 5E2JA 3N85H 5JW4M 4OT1H 4G6FB 3FFCD 1F2QA 1NBZA 2C3WA 2YC1A 2YD7A 4I48A 5H37H 4YHML 1U8PA 4Y5XA 3VFWB 3U30B 2Y6SC 4N0CD 1GOFA 1P7QB 4CJ0A 3T0XA 5DO2C 1OQOA 1E6JH 5SX4I 5IVXE 1BFOB 4HPOH 3RWHA 3S6CA 5I9QC 5BVPH 4UQ3A 1ES0B 4E42A 4Y16C 4RAVB 1IAKA 4U6VH 4I0PB 3WFHB 1JYXA 3LKNB 4JFQB 5ILTH 3CU1A 4KVNH 3RY6A 4P3DB 4JR9H 3ARRA 4TVPD 4N8VA 1W72L 1J1PL 4OD2A 1INDL 1DUYA 4QRTA 1LO2L 4NT6A 3FT2B 5C07E 4I3SL 1KULA 2P24A 1MCQA 4QXGH 3VH8A 1WUNT 4X83A 3RNQA 1TQCC 1UXWA 3HCVA 3KYOA 1K8IA 4HKZB 5L9DL 5D7SH 1YEHH 1S7SB 1T5XB 2EIZB 4R7NA 3Q3GB 1ODAA 1CLZL 1KT2A 3PP4L 4ERSH 4RZCA 3BQUB 3RTQA 2E6JA 3K8LA 3IETB 1MCNA 5FYLD 5BS0D 3S37X 3MLZH 3S35X 3QO0A 1JHLL 3C9NA 4WDIA 3LV3A 1JN6B 4WGVB 1S7VA 1IMHC 1FO0B 1QZ1A 3MLUH 5EWIL 4C57C 1EEZA 3P0VL 3BE1H 5FM8A 1RZ7L 3O4OC 2ZWLT 1QR1A 3TYFA 3RVWC 4M9PA 2WLZA 4CDGC 4CL7A 3ARGD 1ZA3A 3P11H 4WU7B 3A6BL 3SDAD 3WHE1 2G2RA 2EEAA 3DI2B 4K3HA 3RGVC 1UZ6E 1VKXA 1BX2A 2YN5A 2PO6C 3DSFH 4LSSH 3DBXA 4FNLL 1NCCL 4XNZC 4YC2C 1G7LA 1P4BH 1X5ZA 5I2IA 4YHYB 1HZHH 1CFSA 1YQVL 5EBWB 3MBEB 1MCKA 4HWBH 1A2YA 1NSNH 3UYRL 2AJUL 3EJYC 1RULH 4S1RL 5SWSA 5E4IA 5TQ2H 1KJ3L 4MS8C 5MEPB 3DXAA 5D7JD 4YXKL 1ZGLP 2IANB 5C6TH 1IGIL 4L3EA 4M62H 4CN6A 4EBQL 3O3EA 4NRYA 1P7HL 3VXME 3BGAA 3WN5C 5CBEA 5DVNA 3P30L 4WV1C 3FQNA 2EDRA 1C12B 4PPTA 5CILH 4KK9D 3WNNA 5TJWK 5KSVA 4AQOA 4MSWA 1K3IA 1LEKA 3QYCA 2CR3A 3C09B 2MCPH 5BXFA 1WTLA 1YPZF 5HYFA 2R1YB 4HQQH 5H94B 4Z78A 4FQJL 1HHIA 3GMOB 5ISZB 4YFLF 4NGHL 1NBYA 3NAAH 4X8JA 5KZCD 1IAOB 5IGXL 3WCYA 3MUGB 1J10A 2BP3A 3WXVL 1OGAE 5C8JA 4JY4A 2GW5A 3QQ4A 1KB5L 3V4UL 1RIHL 2KQNA 3Q5TA 1C08B 3KPSA 1BQLH 3ZE1F 3EYOA 4HUVB 4RDQG 2WQ8A 1EK3A 3DURB 1T4KA 2XZQL 5I66A 5CD3A 2GCYA 2DM3A 4KQ4L 3EYFA 2HLAA 1FPTL 3CUPB 1T0MB 5D2NC 5DWUL 4OCNC 5IROA 1CDUA 1O0VA 4M48H 5DK0B 5GRWA 4CVXB 2ZCKL 1PBYA 4LLQA 2XA8L 5HHOB 4MXQD 1N6QH 3MNVB 3TBVA 1DEEA 2UUDK 3UTTB 4YZFF 2BSED 4PJXF 4FABL 2PTTB 4QNPE 3A0OA 1FYHB 1ZV5A 3QUZA 4FMFA 1MPAH 3OF6A 1KC5L 3MXWL 5F9WC 4MAYB 2BNUB 4LSVH 2YKLL 3F7VA 3ARFB 5C6WH 5LQBL 4MD0A 2DQIL 5DJCB 2C7UA 4EQ2A 2NY7H 4JFEB 3JSSA 3THMH 1RZGB 5HY9A 1FC1A 2DAVA 1KFAH 4MLSA 5EC2A 4GQ9L 4TTGA 4M00A 5SX4H 1QSEE 5JNYA 5C0IB 5JW4R 4XNUH 4EI6A 2L7JA 5IWLC 4N0YH 2Y5EA 1A1NB 5FXCH 5IP4A 1Z0NA 2H32A 1EHAA 25C8H 2GT9B 2VABA 3LKQB 1D5XB 5JXAL 1HWHB 1PAMA 3SBWA 1MFAL 2ZP0T 3FO2A 4U0RB 2F54A 2JB5L 1NBVH 3T09A 2NXZC 5K9QI 2R29H 5FFLA 2XACC 5B4MC 2CLZA 2DM2A 4JZJB 2EECA 3MA9L 4GXUN 4X9BA 1I85A 3AREC 5FM5M 5SWSD 2XG4A 3S5LA 2X89D 1ZAGA 4CVZB 1JF1A 2F5BL 3TBTA 1P9MA 5E2VL 4NSKA 4ELKB 4NQEE 2B2XL 3N9GL 5HVHB 1QRNA 1SM3H 3X3FL 5GGRB 4JM4H 5GGUA 5HYSG 1T03L 2H8PB 2FO1A 5TFSH 4OZIF 2O61B 4I0KA 4N0UB 4KRMB 4FTVB 3N85L 1LK2B 3T04D 5KSAA 2P5WE 4JFHE 1GGTA 3OKDA 1AR2A 2Z35A 1YJDH 2DMKA 3PWPE 3FO1B 1FVDB 5IW6A 5CEXA 2YBRB 3DRQA 4LK4A 2H3NA 2R9HD 3MOQA 3SDYH 3TZVB 1KTRL 4LSUH 2AEQH 3HUJA 2GTWA 1LMKA 1OP5H 4HPOL 4Z7UF 5BVPL 3IAQA 4QO1A 4XXCC 3C6LD 1J86A 4U6YB 5HPMB 1CL7I 2JIXA 1U8LA 5FM5O 4HH9A 2F74A 1MLBA 2SEBB 3KPRA 5BMFH 4JR9L 1TTGA 4O58H 4TSAH 5GS2D 3EOBA 4Y4KC 1IQWH 1I9JL 2UWEF 3EFDH 4KZDH 5J13B 2BVPB 1GGYA 4HJ0C 2IADB 2BERA 4M3JA 1XGYH 5EZLB 4QXGL 1V7NH 3D39E 4U7MA 4ZFZA 2EXWD 1I8LC 4YDVB 3OXRA 2ITDB 1R3JA 5T3ZL 2Y36H 2ESVA 4OGYH 2AJSH 1YEHL 3E8UH 2VIRA 4JQXA 1IGML 3MCLL 5HHQB 3HC0B 3CPLA 1NLBL 5C07D 3MLZL 5DI8B 5AAWA 5L6YL 1UCTA 1U8OA 4AEEA 1GC1C 2HT3C 43C9A 1E0OB 4WW1A 5ICYA 3BXNB 3MLUL 1MVFA 5F3HB 1JF6A 1UACH 1UM5H 3BGFB 4GRWE 4WUKL 4XCYB 3HE7A 1TJGL 4ZUTB 5GGVH 3PGCA 5DGQA 5B39B 2OTUA 5I76A 4PBXA 1QD0A 2KH2B 3ZDYE 3GSXA 3P11L 3F65A 3B2UD 5DUPH 1CZ8H 3MLTB 2GTZA 1T5WB 1MWAB 4XP9H 3LKRB 3VWJA 3MUHL 2EC8A 3BD4A 5DD3H 3DSFL 4LSSL 3DUSB 3TIDA 4RSVA 1WIUA 1KG0B 1P4BL 1M6OB 4YDIL 4S0SD 1SJEB 4S2SB 1HZHL 1Z3GH 4UV7H 3QIWA 2A6JB 4HWBL 4GW1A 3IDNA 3BIKA 3RVTC 1JE6A 5TQ2L 4KK6C 3ZSSA 3OKYA 1QO3A 2FHBA 1MRFH 2XTJB 1OF2B 3AM8A 4QLRA 2YSSB 4KKBC 4M62L 3FOMA 3CD4A 4XVTH 4XPGH 1A3LH 5CD5C 4B50A 2GSGB 5DQ9B 3FO9A 2CDFB 1OAXL 1KB5A 3OJ2C 3QNXA 4M8QA 4TVPH 3OWEA 5JW4Q 5CILL 4HUMB 5DEFA 1IGFH 5J9PB 4UMGA 4IRSB 1YDPB 1ITCA 4JKMA 1O7VA 4TUJA 1FBIL 1SVCP 3C60C 5GIRB 3PQYA 4NQEA 1EAJA 1RPQA 1CIUA 4HQQL 3VXMD 4I13B 3O9WB 1LO5A 5IB2A 3V8OA 3L3GB 2VE6A 1SYSB 1HYSD 4L4VB 2EIEA 2EH8H 3NAAL 4RMTA 1KJ2H 4PJGA 4PJIE 1VFAA 4ENEC 2L0DA 3O8XB 1ONQB 3K1KC 4K07A 5F6IB 2N56A 4CADB 3PE9A 3BWAB 2JIXD 1CS6A 1A4KA 1MLCA 3MV01 1BQLL 3KPRD 1KPUB 2E6QA 2W9LA 5ICZA 1RIUH 5EOQH 1E27B 4U1KA 3TESA 4ODTH 3NFSH 1OSZB 3PWVA 1AI1H 5IF0B 4JZOA 1X5GA 4M48L 5ERWA 3WLBB 1L7TL 1OGAD 4MJIB 1AR1C 4ZO8A 5E8PB 4RNRA 3VGFA 2BXYA 2LABA 4G9FE 1CGSH 3D85D 2RR3A 3DX9A 3OAUH 1A6AB 4OAWA 4PS4H 3U4EB 3IVKA 2Q76A 1RVFL 4H8WH 3AS3A 5I71B 1MPAL 3KLHD 3ZZ1A 2X4NA 3VE0A 4FRWA 5DC9B 3NIGF 3ARDC 2AV1B 4LSVL 2HWZH 1I3GH 3DYPA 3TGXA 1CQYA 3VRLF 4E41B 5E24E 3PHQA 3HZKB 5ESAA 1RK1A 2E6PA 2EO1A 2BOCB 4HUXB 4N1EA 4YE4H 4PTTB 4TSCH 5ABDE 2NY7L 4FQXB 5TGBB 1EHLH 2A38A 4LRIC 5GS1B 5IESH 3HAEA 3LRHA 1FAKT 4GOSA 5GJTL 3KR3H 5IOPB 4KVCH 5T1KB 2VLKA 2V5RA 4Y2DB 2R4RH 4O02H 1G9EA 4N0YL 1CL7H 3NIDF 3HMXH 3QXVA 1HSAB 3DMMC 1PEZA 4M1CC 3V7MA 2ARJQ 3P4OB 3VWJD 4GG6B 4JRXB 2EKSB 1Q94A 2WM0A 1NBVL 4OZHF 4Q2ZB 5E5UB 1JF5A 2D7NA 2R29L 4KROB 4P2OB 4RRPG 4PLKC 4PB9H 1CGXA 2GSIA 1I1YA 2P7TA 1FC2D 2X40A 2X42A 5AZ2H 4HXBH 1KXVC 1PY4A 2OQJA 1CF8L 4LVEA 4X4MA 4BKLA 2YEZB 1H3GA 2BSSA 2J3SA 3GO1H 5AUMA 2XOTA 1U41A 2BMKB 1H3TA 2UVEA 1IBGH 4Y5VA 4XP5H 5TFSL 4YHPB 1GZPB 4QRPB 2MNUA 5ACMA 4F37K 3O4LB 1K4DA 1YJDL 1P1ZA 4NQDE 2H2PC 3ZYZA 1NCTA 1HN1A 1BQHA 2A73A 4NQED 2VITB 3IRZA 2XWBB 4QT5B 5JLZA 5DTFA 4X6CB 3SDYL 1NEZB 3RBGA 5DHYA 2E27H 4LSUL 1AY1L 4OCXH 5IHZB 2FGWH 1IGYA 1OAYH 2HT2C 3DRTB 1A3RL 5H8DA 5TE6H 4P4KD 5BV7H 2P5WD 4JFHD 4OB5H 5BMFL 5J1AB 3PWPD 3QHZH 4U7KA 2R4SH 5CHNB 1U2CA 4TSAL 3STLA 3WE6A 3B5TA 5HYJE 3WUZA 1QFPA 1IQWL 3EFDL 4KZDL 4HK0B 4Z7VF 1M7IB 4CAGA 3E2HC 4JPIB 4C83A 5EUKA 4KDTA 3FCTA 3BIBX 2QV2A 2GAZA 4K9EH 2FSEB 4JRYB 1RZKH 1BD2B 4G7VH 4MNQE 1V7NL 1KOAA 4BZYA 2EDEA 4XNXH 5I9QB 4QGTA 2Y36L 4R7DB 4OGYL 2CUMA 2AJSL 4Y16B 1VA9A 3E8UL 3ETBF 3UAJD 4WI5A 4HS6B 3ZKSD 3UBXA 4DKAA 4YO0A 3CFEB 4IOSD 3QDGE 4L9LB 1JNJA 3IFPB 5IB1A 1S7TA 2X2YA 3GMQB 3D39D 4HGKC 1U8KA 3EYVB 3ZDXF 1UACL 1UM5L 4OQTA 1S7RA 2PF6A 4GKNA 4JFFA 5C2UB 3TJHD 4DFIA 4JFPB 2JCCB 1T1ZA 4NN7B 1TQCB 1D7FA 2QKIB 1LP9F 2JLLA 4FFWD 2W9EL 3MODH 1ZT4B 5KS9A 4PB0L 5GS0D 5L2JB 5KTEH 4LCCA 3SJVE 1XF2A 5DUPL 1CZ8L 3KYAA 3FZUC 1G7HB 4N8CH 4XP9L 1JJUA 5IQ9B 1NFIB 4DOHE 3JV6B 2NY4C 4BZ2L 1MFDH 3MLPA 3DYMA 3BPCA 4I3GA 4OZFB 2C5DC 3H3BC 2CLVB 4Z95H 3TLRA 1AO7B 1Z3GL 3IXTB 4UV7L 1KF9B 5INCB 5TQ0L 1AGBA 1TJHL 1KCVH 43CAB 3MCKA 1DQTA 3VGAB 2AKRA 3O4OB 1GAFH 4MQXC 2OMBA 5F21B 4PJFA 4PY8J 1IKFL 4XVTL 2DKSA 4XPGL 5GGRY 5ITBH 3TH2T 2J88H 4GS7C 3ULSA 5GS2H 4BUHA 4WWKD 5IR1A 2PO6B 2XFXA 1IGFL 4XNZB 4IMLB 4YC2B 5ESVA 1F6AA 3QCTL 1YEJH 3QBTB 3I6LE 1G84A 2LU4A 5JPMB 4NPYA 5E6ZA 4NWUH 2V5SA 2PW2B 3OHXA 3GSVA 1HH6A 2Q8BH 5FHAH 5E9DA 1LO0H 3WJJC 1T2XA 1N6UA 1T1XB 2EH8L 1KJ2L 5CSZB 3WN5B 5J3HC 1QSFB 3W9EA 4WV1B 4S10A 4P3CH 1GOHA 2AK4E 5C08A 4ZTPH 1F11B 3F7RA 4ZG1A 4Z7QE 1WISA 4ZAKB 1EIBA 2WMPA 2I60L 1RIUL 5EOQL 5BO1L 4BQ6A 1U91B 1WAAE 2YUVA 5HXMA 4C4KT 2IBBA 3NFSL 1AI1L 2C26A 3CCHA 2YUWA 3WUWB 5J4MA 3KPLB 5FYKL 2OZ4H 2DQGH 4HBCH 1UH4A 4KKAD 4LPXA 4I8DA 5ALBH 5HYJA 2Q7NA 3GJEA 4QKXB 4UB0H 5D7IA 1HE7A 3FQWA 5LWYH 1DQML 3OAUL 4PS4L 4XB8A 2PTUA 4NP4H 1UWGL 3T3MF 3JWDH 1NGWB 1FNGA 3X14B 4MNQA 1DFBH 1S7XA 2XN9B 4NOFA 4PG2A 4TULH 1QBAA 2ZUQB 2HWZL 1I3GL 5F1IA 3KLAA 2VOTA 2M26A 3RZCD 3LPFA 1QG3A 4F2MB 1UKSA 5DURD 4YE4L 3L7EB 4TSCL 1JRHI 2G5BB 2XZZA 3VWKB 1EHLL 5D2NB 4G9FD 5DJ6B 5IESL 3MRRA 4UAOB 3QDGA 1WWWX 3I3DA 5E5MB 3KR3L 4WW2A 4KV5F 4KVCL 1UQSB 2Y07H 3U0WH 2R4RL 4HZLB 2VLLB 1CL7L 4PJ7B 1B88A 3HMXL 4LLVA 1UGNA 5TDPB 1RUKL 3MRLA 3VGDA 4EDWH 4MQ7A 1G6RH 3QFDA 5F9WB 1OTTC 4NO0D 1R3LA 3MR9A 1FV1B 3L95A 3QXWA 5KVDH 1Y6MR 4FOMA 3ZO0A 4Q6IA 1LO3H 4KTEH 3V6ZB 3AS0A 5DFVC 2R1WB 3EDKA 1NMCC 1ZSDB 2WIMA 3QULA 4W6WB 4YX2H 4XMPH 1G9NH 4GBXA 3QNZA 5AZ2L 5C0CB 3R06A 5HHPA 4HXBL 3H9SB 3ES6B 3MGOA 4HS3A 4QGYA 3VCLA 4ZOBA 2CRMA 1X5HA 3VRIA 3MTRA 4R8WH 5D6CB 5C71A 1BM3H 2JK5A 1OAQH 2YS4A 2PW1A 3GO1L 1NEZG 4PRAB 1HQ4B 1NC2A 4O00A 1IBGL 4XP5L 2OBGA 3MV8A 1I8IA 4D0CA 1Z0MA 4URTB 3KDMB 4NZUL 2WLYA 5E70A 4X80L 1FORH 3EJZC 3EDFA 5L8JB 2NXZB 5AD0A 4PREA 5FOJA 5B3NA 2VLRA 4N1CA 3AREB 5DDHB 2OR7A 4LIQE 3ZKND 3PL6D 4CMMB 2X1WL 5HGAB 2DQCH 3EO9H 1IFHH 5E94A 2E27L 1P5UA 5DRXB 2EDXA 3SGJC 2FGWL 1OAYL 5EZIH 3JXAA 5D1XD 5BV7L 4PJAA 4OB5L 4CUCA 4X6EA 4NQDD 1XF1A 2R4SL 3KPPB 4KXZI 5A2FA 4QXUH 3DX7B 2I9LA 4FQQA 3T8XA 2IANE 1J18A 2H6PB 2CIIA 1ZLVH 4OGAD 4K9EL 2WQRA 4JKWA 4MXWH 1RZKL 3H9HA 4G7VL 4G9DB 4BFIA 1U8JB 2FYYA 1T3FA 5BZWA 1YJDC 2VQUA 3UTPE 4XNXL 4LEOB 2GJ6A 4FQIL 5HYJD 4DZ8B 3TFKC 3LB6D 4NIKB 3MLRH 3DNKA 2CRYA 5FDYA 1D9KD 5DUBA 1D6EB 4Y4KB 5F89B 1M71B 4DKEL 2BSTA 3RJQB 4MNQD 5SV4A 3SKMA 3P73B 1ZTXL 4F3FA 1MIMH 4PY7A 4M93C 1RQ5A 1MH5B 3QH3A 2R0KH 3I3BA 1EFXD 4OZFG 3VD5A 1XR8A 2L4OA 3K3QA 3DX8B 5FA4B 4PJ8C 5CGMA 5KTEL 3QDGD 1OB1B 2NTFB 4K3DH 3ZSTA 4R9HA 3VGHA 4OFYA 3ZTNL 2H1PL 4HAFA 4WU5B 1HOCB 4OI7A 3GMNA 4CU8A 2I9TA 3G5XA 2NZ9C 1HHJB 4M7ZC 2X1PA 6CGTA 3V7AE 1FZMA 2WBWB 3AFLA 3OR6A 5GRUL 3V6OC 1T22B 5CMAB 4I4WA 3LRSB 1RJCA 3IDYC 4NQXB 5HHOE 3SJVD 3CX2A 1GAFL 1JVKA 5DEGB 2JF1A 1YEIH 3FN0H 5T5FL 1KJ2A 2BDNH 4JY6B 4OUUB 4XPHH 3QFJA 3C8KB 1QKZH 4ZFFA 5ITBL 5CJQL 5EBGA 4MAUL 4YR6A 2W0FA 4WUUB 2FDBP 4GRLA 4NNYB 4QYOB 3MREA 1D5BB 1V8HA 4GUPB 3O6FC 3ULUC 3VW3L 2HJKA 4FQHA 1NC2D 3BISA 2DWDA 3WFZA 4H1LB 1S7WA 2YRZA 2VUYA 3DVNB 1YEJL 1TDQA 4LLWB 3FRPG 4JFEE 5KG9A 4U1MA 1RJYA 1FNFA 3O6LH 1JNLL 3U9UA 5GXBB 1WCBB 2OS7A 3BKCL 1JZ3A 4NWUL 1JRHH 4OZGB 3G6DH 3M07A 3CSYA 3ARPA 3WKMH 2Q8BL 5FHAL 3PJSB 1LO0L 2WW8A 1IJ9A 3AY4A 4N0CC 3VXPB 3HI5H 5GSRB 4ZO6A 3WUWG 4W6YB 3CSGA 4P3CL 4Z7OE 3I6LD 3CVIH 1EEQA 4QHLA 4HIIB 1BVZA 4MZ3A 4FMKA 2GY5A 4PJGF 3HC4L 2ICWA 5I18H 4KAQH 4ISVB 3QUMH 3JUYA 3UZVB 4JKLA 3BAEH 5KSUB 5DHVH 5IEKB 2VXQL 2C4FU 3ZLQC 2F5AH 5ICXB 4HBCL 2DQGL 2Q7YB 3ECBA 4PRDA 2AK4D 5ALBL 3EFFB 3GMPB 4UB0L 3TBYA 2G75B 3HMXA 2D31A 3MRJB 4P5KB 4QHNA 2YRPA 3L3OB 4GRWH 4LAJH 1PKQA 2IPTL 4N0UE 4PRIA 2MWCA 2EDJA 4FTVE 1A9EB 1DP0A 2BZDA 3RPIA 4NP4L 1NLDH 1NUFA 1YEEH 3JWDL 4RFOL 3CC5A 1DFBL 4J1UA 4R97C 4TULL 3CFDA 5FYKU 2OXHA 4EN3A 4HAGA 2VXSL 3TO4C 1S8DB 1OGTB 1B4JH 5MENA 5CSBA 4WJ5B 4JFDA 4A6YA 2YUZA 4PRPA 1B4RA 4HV8A 1Z2KA 5JUEH 1MJJA 1KB9J 2C1PA 4JHBA 2FZ3A 4EKXA 2BJML 2Y07L 3ARGC 3P4MB 3HC3H 3U0WL 3SDAC 3IDGA 1C5BH 3X13A 3M45A 2AV7B 5E95B 2FO4B 3CDCA 1P7QD 3Q6GH 1A7OH 3BHBA 2E9BA 4KXZH 4CBPA 3ARDB 1FN4B 5L8KB 5D72H 4PJ9A 1LO3L 4ODUA 4H8WC 4KTEL 4LLMB 5AYQA 4I0PD 4UUJB 4YX2L 2K7QA 1ZHBB 4XMPL 5I75C 4ZUUA 1FQ9C 3VMNA 1HINL 5D7JC 3GI9H 4KMTH 4XWGH 2R39A 4R8WL 5EIVA 1N0XH 4WFHE 3CXHJ 1BM3L 5JO5B 5HTSA 4XTRC 1OAQL 2Q6WA 4K7PX 3DMMB 1G7JB 3BH8B 4XRCB 4GRLD 3MV9A 1RHHA 1KUMA 2VDRH 2J12B 4GMTL 4HIHA 4KK9C 3L6FA 2RBLA 2BVQB 4MA1C 4KU1A 3SPVA 1FORL 4QRQA 3Q1SH 2HTLD 5FGCB 1KCRH 5F7HA 2FL5B 3RP1A 5I17B 3BQUD 4MB3A 2X4QB 4XGZB 4XH2A 1INQA 2R0ZL 4L8BB 2YD5A 2IWGA 3QNYB 1IFHL 1IGJB 4PV8A 2VR4A 2PXYA 1NUNB 2BVOA 1LO4L 3VFMA 4OLWH 2IBZX 4HGMA 2ICEA 1QBMH 3WO4C 5HYEA 2OL3B 1TITA 3KPMA 1HILA 3W11D 1I7RA 4AK1A 5JW5A 1NDMB 2WIIB 4NO2B 1NFDF 3RY6C 4TSBH 3VJ6B 4UV4H 2XTJE 1IC1A 4NC1E 3HPLA 2XY2A 5FKPB 1DQLH 2DWEA 2IC2A 5D2LA 4MXWL 2HRLA 4GAJH 4NN6C 3WFBH 3DTXB 5EA0L 1XCTA 1S9YB 5FV2A 1JUFA 4P4RA 1S5HB 4P57B 3MBED 1F8TL 3MJ9A 3MRFA 4LCWA 3LMJH 1YY9D 3BYTA 3PIQA 1J05A 1VENA 4MHHI 4GXUM 4OLYL 3X12B 3MLRL 3BP5A 1JPTH 4RAUA 4GW4B 4M4PA 1I3RB 2GI7A 3BGMA 4LLDB 4ESKA 4P9MH 4PRID 3GJFH 3QIUB 1FFNA 1UB5A 4F57H 1AGDA 4RMRA 2KZ1B 3E2HB 4HJGB 4ZPTA 4CJ1A 1YMMA 1OWRM 1MRCL 3UTPD 1QFWL 1MIML 1RUQH 5IMOA 4L4VE 5HPOA 2A1WH 2R0KL 1WZ1H 1W2KT 4HKBA 4YK4B 3BDYH 2GK2A 5MEND 4XVSH 5FO7A 4KI5F 1KCLA 4PRPD 1JPGA 4K9EC 4PJBA 4PJDF 1A0QH 4E9LA 2BC4B 1RZKC 4UOJA 2QADB 2CDGB 3I75A 2V7HA 3O3UN 5AEAA 2ENYA 2VQ1B 1JHTB 1J88A 5I1LB 1VERA 4I2XB 4QHKJ 4ETQB 1M05B 5C7XH 4QOKA 5A40E 1PJ9A 1CE6A 1OAZH 2DYPA 4OIIH 1MI5A 4NQVB 2UZYB 2XPGA 4MJIE 4M9OA 4I18A 4H1LG 1R0AH 5C0EA 3FN0L 3OG4B 5EORH 2BDNL 4LLUB 1UB6B 1DQQB 5D1ZA 2O5ZH 3KGRA 3TYGH 5CP7B 2E9WA 3L3DB 2R1XB 4KJWD 3V5HB 1ND0A 4ZSOA 4I3RH 3TH4T 1F90H 5FYJH 2GIYA 3DYOA 3IDIB 5AZEH 3F58H 3MV7B 4LLAA 1X5FA 1XZ0A 5EOCL 4RFEA 3ROLA 2OK0H 2IAMA 2EYSB 2VZ1A 4MA7L 4JFYB 5HHOD 2ADGA 3VXNB 1JZ2A 4AIOA 4TPRH 1EEYA 3EO0A 5F6HI 4JFOB 4NKOA 4IJ3C 1JRHL 3G6DL 3F7YB 3WKML 5L0QC 4MAYD 2V17H 1B0RA 2R9HC 4OFIA 5HGHA 3PDOB 5BQ7B 3ARFD 3DIFA 3HI5L 1RZIB 2VKXA 4GG6E 5KN5B 1AXSA 4JRXE 1QLFB 4JFED 2D2OA 3C6LC 3WXWH 2H9GA 4L8SA 4PJEA 3RX8A 3CJJA 3CX5K 4FQLL 4X6BA 3VFTB 4Q97A 1GYAA 5I18L 4KAQL 4ZUWA 1YPZB 3OKNA 4X99B 1G6VK 2Z31A 3QIBD 3BAEL 1XF5A 3FAXA 5FK9B 3MUJA 4HH8A 4LCIH 1JV5B 3HZYA 2CDEA 4M5ZH 5DFTA 2Z91A 3W0WB 5JOPE 5GZNC 4NUJB 3BO8A 4OCRH 3GEWB 3LKOB 5BZDA 4TQEL 2EXWC 3V0VA 2W0LA 3KHOA 1RZ8B 1DANU 4QRPE 3QI9D 5C0AB 3K0WA 1TTFA 1NLDL 2FATH 3ALWA 3HR5A 3MGAA 3O4LE 1DN2A 3T77A 1E28B 4M1GH 5EO1B 4YDKH 4OFVA 5I8CB 2I25N 5C9JB 4Q9RH 2NZIA 1JHKH 2YWYA 3OX8B 4TNVK 1A6UL 1B4JL 1GZQB 5IW3A 5EU6B 4O2CB 1XGQA 2IPUK 1VADB 1XGUA 2MPAL 3QQ9D 4FTVD 4LL9A 5D9SB 4DKDC 3LN4A 4U1IA 5GHWH 3B5GA 4B7IA 3HC3L 4S1QH 3GKZA 1T20B 1F42A 2GKIA 1H15B 3B2UC 4YQXH 3ULVC 1C5BL 5EFIA 2Q86A 1PKOA 4JDVA 4OLXH 1ZT1A 3TZVD 3NVQA 1A7OL 3OJDB 4Z0XA 4P0DA 1A7RH 5D7LA 2HFFB 2R2HA 5IBTH 2W07A 5J11C 4JRYE 1BD2E 1M7DA 4RA0C 2NNAA 2A74B 4ODVL 4LPCA 1YEKH 1Y6KR 4I77L 3RY5A 4OI8A 1MI5D 1EJOH 1CT8A 4CKVX 2DQFB 4AMKL 1WITA 3GI9L 3QQ3A 4XWGL 1I85C 5J7CC 1CFBA 4XC3H 3JBG7 2FR4A 1N0XL 3BZFB 1EXUB 1U8HB 1JWMB 1SYVA 4J3WA 3F8UB 1OVZA 2VDRL 1XF4A 1KJMA 4ZDHB 4YFDB 2IAMD 4U33A 4XI5D 3VXSA 3FT4B 2D7QA 3KYNB 2IPKA 2JCCE 1KCRL 3Q1SL 4YHKH 5J12C 1KIPB 5L8LB 3LKSA 3PV6A 1NMCB 1I8KB 3NCYS 5JXED 1MREH 4WFHD 5E8NA 3T4AA 2AXGA 3UJJH 5CJOH 3BN9C 4DGVH 4OCYH 3BZ4B 5HDQH 1HYSC 3L3KA 1EV2E 3CMOH 4V1DA 1G9NC 3PWLA 1F4WH 1PW3A 4JREC 4PP2A 2NX5A 4OLWL 5IVZA 5H35A 2DKMA 1AO7E 3OAYH 4R6UA 1OAUH 4G8IB 3RWDB 4RQQA 3FHQA 5DQDH 3WIFA 1Q1JH 1FH5H 2E7MA 2ZG3A 3O11B 1RZJH 4UV4L 1EHXA 2EYRB 3BPOC 3FQUB 3MLYL 5K9OA 1WWBX 2F15A 2ZNXA 1IEAA 4XWOD 4AIZA 3EZ8A 4HCRH 3WFBL 1TCRA 3ZDZF 4AYFA 1NCAH 4PJ5B 4G6JH 4QCIB 2E7LA 4GSDH 2H26A 1LNUA 3G6JB 4LDOB 4PBVC 3EDEA 3MYJB 3EAKA 5EZJB 1JPTL 3U4BH 3AAZA 3TIEA 4Z6AT 3GSQA 4PJCA 2XTJD 4LBEB 5DQJA 1DLHA 4P9ML 3GI8L 5C0ND 1ZS8B 3TV3H 5FO8B 3KLHC 3SKJH 2WWKO 4F57L 1AIFB 4JCMA 4KHXH 5FDWA 2D9QB 1DCLA 3OB8A 5FA3B 5TH2A 1P2CA 2A9MH 3VD9A 4J3OC 2A1WL 4QTHB 1I9RH 3GBMH 1U9KA 1WZ1L 2AK1H 1ULVA 5IJKA 1QSFE 4XVSL 1UXSA 2VB5A 3HE7C 2GUOB 1FVCB 4WTWA 3AMKA 1A0QL 2E9IA 3QDHA 4Z7WB 4HS8H 5ITFB 3O9WD 2XQYG 3TNNA 2Z9TA 1UWXH 2OSLA 2Z93A 1UVQA 3O3BA 3FT3A 3JTSA 3NFNB 4L4VD 1KPRA 3IU3A 1N26A 3VWJC 3QPQD 2V2TA 1OAZL 3O8XD 4NCC1 3IDJB 4QF1A 2CXGA 1Q9WA 1I4FB 4YHNA 3FHAA 3HPJA 3QWQB 1FO0H 1ZT7B 3NPSC 4P5MB 2CK2A 5EORL 4KKCD 3ARSA 2O5ZL 4PJ8B 2NY3D 4XX1G 1SVZA 4I3RL 1F90L 5FYJL 1FE8L 1B0GB 3OKEB 3F58L 2XN9E 2YD4A 4NHCH 4PJHF 5BJTB 4ZNEE 5D1QA 3I02A 3K4AA 4LIQH 2OK0L 4MD5A 5KJRH 3MRBB 3QEQB 1DUZB 4DVBB 1MUJA 4MJID 2LFGA 4M7ZB 5TF1H 1DBAH 5CJBA 3MBXH 4PLJC 5D2NE 5EO0B 3IGAB 5F9JA 3CLEH 4JY5H 3VXSD 2DLHA 4PG9A 4DKFH 3IDYB 4RIRB 4IDJH 2VZTA 2IFFH 2V17L 4ZOAA 4XNYH 5B3JE 3P9MB 1KNOA 4MDJB 4FFVD 3WLWC 1CR9H 4JN2A 1FDLH 3P9WB 4V1DD 3WXWL 3FO0L 2AXFA 4W6XB 4P4KC 3O6FB 3HZMB 4H0HB 4DK3A 2H2SD 4FFYL 4YH6A 2BY3A 1XCQA 5CS7A 4PGEA 1RJZB 5T1KD 4Y2DD 5C0CE 3H9SE 4UOW1 2EXYD 2HVKA 4HIEB 3FTGA 1LE5A 2X7LA 4R2GC 4PUBH 3VFNA 4X7FC 3VFRA 1E4XI 1MAKA 3QUYB 3FQTA 3VMPA 1INEL 1CLOL 3ME0A 1CFTB 4KROD 5CUSH 4B0MM 4P2OD 4XCCH 5E4EB 5HD8D 5I16A 4KJPD 1PGRB 2WBJB 3IB4A 4JM2A 4NQCA 4IS6B 1KPVA 4NO5B 1XGRB 3C08H 3MOBH 3UAJC 2FATL 2HLFD 4M1GL 5J06A 1H9VA 5JOPD 4APQA 5F96H 3FONA 1FIGL 5F7UA 1QLEH 4Q9RL 1I7UA 1JHKL 5B38A 4NNXB 2BRQA 5LGHH 4OFPA 3A6OA 4QRPD 1FNLA 1QEWB 5IK3A 3TJHC 5I0DA 3GM0A 2XKUA 1H5BC 3O4LD 2J8UF 5GHWL 4HXAH 3HNSL 5GS0C 3U79A 2CKBA 4Z76A 3CH1A 4RMVA 4K71C 1SHMA 4M6MH 4OLXL 4ONOA 5EUOF 5IW1A 1F2XK 3UC0H 4HDIA 1JMZA 4JJHA 4C4KO 1A7RL 4N68A 1JYVA 3GSNA 3NGBC 1A6ZB 2WUCH 3PGDA 4R97B 5BRZA 2N4IA 5BS0B 2HJLB 4K7FA 1QPXA 2ZSVA 3IJHA 3VI4F 1CGUA 4X0KB 1MELA 3PUCA 3TO4B 4UI2A 1YEKL 4L8CB 2FX9L 1S7UA 1A6VH 3WIIH 1QA9A 4E0RB 1ZGLB 1F58L 2Z0BA 1EJOL 5EBLB 1U3ZA 2GITB 4XCFH 3L3IB 1KLUB 5F88B 5HDBF 5AG8A 4XC3L 2QEJA 2P8PB 5CEYA 1NUDA 4NJAH 4DAGH 3ARBA 1K8DB 3MRHA 5MEOA 3HLAA 2BXZA 1BD2D 2R2BA 4MNHA 4EI5D 1KLGB 4Y19A 4WTZA 2NW3B 3AXLA 4IDLA 4IHOB 4WWKC 5TDNB 1PG7X 1ADQA 3HZVB 5B21A 4Y5VC 1MOEA 3W9DB 3MRDA 3C6SB 1G0DA 1GL4B 4LHUB 1J8HB 3LCYA 4HZAA 1EERB 3H3KA 3U2SB 5TE7L 3RWGA 1P7KA 1ZEAL 4FZEH 5I75B 3GIVB 1MCWM 5CJOL 5IEHA 3S98A 4DGVL 3IDUA 4IIQC 4P2RB 2YZ1A 3L5IA 3HB3D 3KPQA 3CMOL 3PWJA 1T83A 5TDOB 5J1SC 1B3JA 4NRZA 3VFGH 1F4WL 2WV3A 3Q48A 2QSTA 4U1HA 1P4LA 1OAUL 4POZD 1ZHKB 4DEPC 5LGJA 2J7LA 3DO7A 3LIZH 1AP2B 3MJ8B 4ONHA 4MA1B 4X6DF 5FKAA 2YD1A 1RZJL 2EDNA 2AS5M 1HHHA 3B4NA 1JNHA 3D25A 3MNWA 1V3KA 3RVVD 4HCRL 3T3PF 3U0TA 5A16A 1NBZB 4KDTC 2YC1B 3O2DH 3OXSA 4OCMC 1AO7D 1NCAL 1QHOA 1WVZA 4I48B 1N59A 1U8PB 4KKAC 1NBQA 4GSDL 4Y5XB 3S37H 3JTTA 2O26U 2VXUL 3VFUA 3RWHB 1BGXH 3P77A 3WO4B 4A2MA 4UQ3B 4NKIH 4JM2D 5K9JH 1N5YH 1IAKB 1U95A 4MCZA 4EEEA 4X7CC 3SKJL 2X70B 4MJ4A 2DTSA 4OZGE 1JGLH 5IVOA 1KSRA 3FN3A 4FHBD 1U3HA 3KJ4B 3FFDA 1ZVSA 1VACA 4N8VB 5DD6A 5IMMA 4IRZH 3GBML 4OD2B 4NN6B 4MQTB 1RI8A 4QRTB 1VSCA 4GRMA 5H2BA 1A5FL 4NT6B 2P24B 3VH8B 3SDXA 1QSVA 3RNQB 1WEJH 4ZQKA 1UXWB 4YEFA 5CWSA 5J1TC 4HS8L 3CDGA 3HCVB 3KYOB 1X6NA 1K8IB 1N6VA 4LCCC 1WJ3A 3ILPB 4N9GB 1QLRB 4R7NB 2IBZY 3B83A 3G5VA 1KT2B 4RZCB 3SDDA 1X5LA 1QSFD 3RTQB 2Z8WC 3QO0B 2XI9A 5IVXF 2WNGA 4F9LC 3C9NB 4WDIB 3LV3B 5ALCH 1S7VB 1FO0L 1E4XH 1IQDA 3C5ZA 4Y2OA 4ZOCA 5I1AA 1EEZB 4ZAKD 1QFUH 2DI7A 1MJUH 4KY1H 1QR1B 1FGNH 3TYFB 2XZCH 4KUZH 4OD1H 1ZA3B 1KN2H 4NHCL 4LIQL 2G2RB 5KJRL 1BIHA 1FNSH 3KJ6H 3GSRA 1MWAH 2K7PA 1VKXB 1BX2B 1DBAL 3MBXL 4RMWA 5IMKB 3DBXB 4P59H 1JPFA 1G7LB 2IEPA 5FAAA 3CLEL 3Q5YA 4JY5L 5I2IB 4U2YA 1CFSB 2F53A 3WIHA 4WEUD 3T0DA 1J1XL 1A2YB 5FYJU 1N64H 2XN9D 3LQAC 4XNYL 5SWSB 1WC7A 3ZKNC 4JCLA 3PL6C 3RL1A 1B0WA 5EC1A 5JTWA 3DXAB 3UCRA 1MF2H 3VXQA 4OI9A 1I8MA 1FDLL 2OX5A 4L3EB 3S9DB 3VWKD 3O3EB 4NRYB 5D6DC 1W8NA 5DMGD 4NWTL 3FB6A 4I1NB 5LCVH 3FQNB 1LDSA 3GRWA 4C55A 3WFEH 2MOVA 4M7LL 4MWFB 4YIQB 5KSVB 1MHEA 1XH3A 2VNCA 4MSWB 3OZ9L 3UTSA 4IJ3B 1F00I 1LEKB 5EIQA 4OGAC 4G80A 4PUBL 3CFBA 3O41B 5FGBA 5L0QB 5BXFB 4L5FL 1ZHLA 4NZJA 4G43A 3RUGA 3OGCA 5HHNA 1UM6H 4Z78B 1NGQH 5CUSL 1HHIB 4TUKL 5T3XD 1G1CA 2K9UA 1NBYB 3SY0A 4GLRI 5C0CD 2MJWA 3C08L 3MOBL 5FGCE 1ED3A 1II4E 5DFWH 3D18B 1D9KC 1UC6A 3D0VA 3FQRA 4HBQA 3X3GH 4JY4B 5C8JB 3QQ4B 5FHBH 5F96L 4F7MA 3REWA 3JV4A 3KPSB 2VDPH 4YJZL 1VDGA 2A9NH 3LZFH 4ODXA 5T1LD 3EYOB 5LGHL 1E4WL 3ZKXC 3RFZC 1I1FA 1T4KB 5I66B 1GSMA 5CD3B 2GCYB 3T2NH 5BW7A 2HLAB 1F4YL 2FRGP 2NXZD 5E2TL 3WS6A 3A67H 4HXAL 3OJVC 4LLQB 3R8QA 1AGFA 1F6LL 3TBVB 4WW2C 5I1CH 1DEEB 1IE5A 4M6ML 3SE8H 3UC0L 1ZA6A 2J8OA 4RBPH 5JA8B 1H8SA 3QUZB 1F45A 5KSBA 3SDDD 4P2QA 2YA2A 3P9LA 3F7VB 3WIIL 3AGVA 5FOBA 5C0RH 3UJTH 3BW9A 5K9KA 4MD0B 4XCFL 1MCEA 2C7UB 4LHUG 3OPZH 1KTDA 5I30H 2HRPH 5HY9B 4NNPH 5EC2B 5HHMD 2V5TA 1PVHA 3VI3F 1VPOH 5JNYB 2P1YA 1HHKA 1T7YA 3V79C 2ADFH 4NKQB 2CJUH 4HFWA 3EJJX 1K2DA 3CAFA 4DW2H 2H32B 2VABB 2C9AA 4U3XA 3FO2B 1YC8A 2F54B 5KOMC 3UDWC 1CXHA 5INDA 2CLZB 2ATKA 3TCLA 4KUCD 4Y4KD 1IZJA 3DHJA 4QNPF 5HYSA 1ZHNA 5K93A 1CD9B 3D6GA 5KAQG 3K4DA 4ZS6D 3S5LB 4HW6A 3AB0C 3VFGL 1JF1B 1BVKA 5JW3H 3TBTB 3NCCB 3UZQA 3SQBA 4LFHD 4NSKB 4I2XE 5KW9H 5T1MA 3R1GL 4PGCA 1CGYA 3GUTA 1J87A 3SHSA 1QRNB 3LIZL 4RX4A 5GGUB 1X6LA 2BNRA 3VXOA 1IC4H 1DN0A 4WO4A 3SKOB 5CZVH 3CVHA 1VGKA 1K6QL 3NACL 2JJTA 3T0BA 2Z92B 1AGCA 1F4HA 3OKDB 1F3RB 2Z35B 3NABH 3UTSD 2NY2D 4JANB 3MRIA 3O2DL 2ZUUA 4IMKA 5F7KC 4O2EA 3WEXA 3MV7E 2HT3D 1CE1H 5CEXB 2H3NB 4N8VG 4F58H 2Z8SA 4ORGA 1Z9LA 1YMHA 5F7FA 1T5XA 2GTWB 3HUJB 1L6ZA 1T04A 3WHXA 4NQTA 1BGXL 2V9QA 4WRLA 4UT9L 4NKIL 5K9JL 1N5YL 1BJMA 2JIXB 1U8LB 4MXVE 4XX1E 2F74B 1MLBB 1JGLL 3KPRB 1SY6A 1J0IA 3HN3A 3BPOB 3RZWA 4WUUD 1DVFA 2IJ0C 2E8YA 3D1MC 4IRZL 1NMBH 3BP4A 3SN6N 4LSTL 2KPNA 4D9QE 2APXA 4HIJA 5CP3H 1FIEA 1H3PH 2P44B 4G8EA