3QUMH

Crystal structure of human prostate specific antigen (psa) in fab sandwich with a high affinity and a pca selective antibody
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
217
structure length
217
Chain Sequence
QVQLQQSGPELVKPGASVKISCKVSGYAISSSWMNWVKQRPGQGLEWIGRIYPGDGDTKYNGKFKDKATLTVDKSSSTAYMQLSSLTSVDSAVYFCARDGYRYYFDYWGQGTSVTVSSAKTTAPPVYPLAPVCGDTTGSSVTLGCLVKGYFPESVTLLWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Prostate-specific antigen
publication title Crystal structure of human prostate-specific antigen in a sandwich antibody complex.
pubmed doi rcsb
total genus 33
structure length 217
sequence length 217
chains with identical sequence K
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qumH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qumH02
4YHNB 2A6KB 4LSPL 5D6CB 1MFNA 3U7AA 3SKNB 1A1NA 4ZOAA 3L7FB 5D5MB 3JWNC 1DSFL 3BAEL 2ZG3A 2BFVL 2EE6A 3PV6B 3P0GB 3QI9D 4KRMB 4R4BB 3SGEI 5F7KC 3WJJC 3BIBX 4TNWK 3JVGC 4FQJH 2R0ZH 4E42B 3DUSB 1U8PB 5FAAA 1J5OL 2CQVA 4OZGA 1OW0A 4ZQKA 5JTWA 3MGOA 5F9WB 1PYWA 5ESQB 1OGAB 1IC1A 4CMHC 4FP8L 3BP4B 1UM6L 3W5MA 4U2YA 3SE3A 1JZ5A 1J0IA 1ZLWH 5HPMB 4LNVA 3EO9H 4PJAE 2IAMD 1F3JB 2XKNB 2E9BA 4X7EC 4DVBB 4RRPG 1FG2B 1MI5A 5TF1L 4OFIA 4P5MA 4LU5L 1ORQA 2IADB 3H9SB 3PL6B 5EUOE 3WHXA 5ELIA 1XR8B 2DQTH 2JCCE 4NO2A 1OTTD 5KAQF 4G6ML 3CU7A 2Q76B 4ONOA 1J87A 4OLZH 2BNUA 1Y18A 4WFHD 3GMQA 4ZFFB 3JUZA 4GRLA 3STZB 3QAZB 3LV3B 4JY6A 2WP3T 1YNLL 4P2QB 5D93C 3ZHDA 1OQXA 1FL3A 5IGXH 1GIGH 1NCCH 3O6ML 2NY0C 3BKYH 4WEBL 3P3YA 2P48B 3W2DH 4KTEH 1MCRA 4MCZA 2I60H 5IVZA 2FX9H 2VJXA 3AMLA 3QULB 5HI4D 1KENH 1MCHA 4WO4D 1ZLUK 2E27H 5EC2B 4I5BB 5CEZE 1F4WL 1HIML 5BJTB 1F90H 3IF1B 1FZJA 5I1GH 1MH5B 2YZ8A 4GSDL 2Y36H 3P9MB 4X4XB 3MMEB 1QFWM 3EOBB 3QHFL 3L3OB 5DMGD 3O2DA 1O7VA 5I1LA 1U91A 4U31A 1PX4A 2ZG2A 3LSOA 2ADJB 3OR6B 2DJSA 5HI3D 4GKNB 5J12C 2H9GA 2G5BA 1X4YA 3K8KA 4N1CA 4OZFA 2IQ9H 1B0WA 4ZO6A 4PYGA 3MRDB 1HNFA 3F5WB 4M48L 5ERWB 4FQ1H 4YO0B 2AQ2A 4L8CA 1D6EA 2YUZA 3SO5A 1D3CA 4MWFB 5IVXE 3T0EA 3GSOB 1A6UL 4LCIH 3UTSE 3FB5B 2NYYD 3MLSL 4JM2D 3OAUL 3JV4A 3MV7E 1ZANL 2AJ3B 4XVJL 3OF6A 3PP3K 4YR6B 2VISB 5I30H 4RBPK 5C09E 1RUKH 2NXZC 4WEMB 4Y8AA 4HUKB 1RI8A 3QPQD 4YDIL 1MLCB 3EYFA 5GRXG 3SKMB 3O8XD 1C16A 1U2HA 3HAEA 2R2BB 3QYCA 3WO3B 1BD2E 3HE6C 4CU7A 5C0AD 2EYRA 4LSVL 2NZ9D 4QXGL 3WL9A 1JJUA 5D7IA 5IB3B 4KQ3L 4OD2B 4J3OC 3S3PA 3BWUC 2BY2A 1RZFL 2GSIA 3B9KA 5ILTH 4K3DH 4DW2L 5IV2B 1KFAL 3E6FA 3LQZA 3UAJD 3CFDA 5EO9A 2VDOH 1B0GA 4XH2A 3ZKNC 1N64H 2I9LB 5IMKB 1GOGA 4OZIF 4LCWD 3QIUB 1CFQA 1BBDL 1MREH 2C9AA 4GAYA 1R3HB 3W9EA 4D0BA 1DLHB 3EKCA 3W82A 2FGWH 4PG9A 1AKJA 3A6CH 5KSBF 4PJDF 2G60H 3QCVL 1LO2H 4LLYA 5F9OH 2FJHA 4OCMC 1LO0L 3S37H 3LH2L 3PGDA 3DNKA 4Y2DC 5CKAA 4YAQB 3WFDL 2CH8A 4M6OL 2IC2A 4P46D 1PZUB 2B5IC 1IEAB 1W72H 1PKQB 2EDDA 2OXGA 2NR6C 1AC0A 1ODAA 2BNQA 4K94H 3I85A 2NLJB 1N2RA 3NZHL 1LE5A 5TGBA 1MOEA 4I0PA 1E28A 4U33A 3UTTD 1UB6A 5D7KD 2QQKL 1Z5LA 2Q8AH 5C0GA 1KACB 4Z7UB 1MFEH 1AE6H 1CD1A 3NBNA 4ONHA 2DRUA 2VLKB 5CSGA 1BX2B 4C83A 4KVCH 1RK1B 1NGQH 4HIIA 1R3KB 5EU4A 1JYNA 1DE4A 5HDBE 1HKLH 1IM3A 4G5ZH 2DD8H 1CDGA 3DGGB 1Z9OA 4GXVL 5AG8A 4GG6A 3OZ9H 3QEHA 4Q74A 4DKFH 5J56B 2RQ8A 3QCUH 3AM8C 2CO6B 1XH3B 4PB9H 4LVHB 3KPMB 3PF2A 3ZE2F 3AMKA 3UPRA 3JWDH 2HT4C 3WFBL 3C8KA 5TQ0L 4ODUA 5T33L 4NO0D 1YY8B 4XAWH 3WFEH 4U49A 5CIPH 5GGSY 4FQCH 3KPPB 4NQDA 5JXAL 5C0BD 1ZHKA 3D25A 1F4XL 1NPUA 3PWLB 4Y4HA 1I3UA 1RJZA 2R1WA 3BP5B 1M7XA 4F37F 3GSUA 2H1PH 3U0PA 3GHEL 4TSAH 2HMID 4PP1D 4KKAD 1KGCD 4LLWA 4QTIL 4UT6L 3RVTD 2GAZA 3DVGB 4RFOH 1JFQH 3QUMA 4X80L 3PHQA 2F53E 4YE4H 3TFKD 4WV1C 1CBVL 3V7AG 4NHCH 4NT6B 4M43H 3TVMA 5T3ZH 3MRQA 3EO0B 3MLXH 4EUPA 3Q6FA 4MNQD 2ZP0T 4LARH 1YUHB 3BFOA 1EUTA 3DTXA 4B5EA 3RL2A 3KLAA 1JVKA 4Z7NE 4PLJD 1HEZA 2FYYB 5I8OH 2DWDA 3HC3L 4R3SB 1RMFL 3VGHA 2PTTA 2GT9B 3HTLX 3CK0H 5DRWB 3VFMA 1FYHB 3HZMA 4UILL 1M7DB 1K6QL 1KLUA 3NAAL 2APWA 4HIXH 5FECA 4WHDA 5D1XA 5KG9A 1JZ6A 3W39B 1HOCA 3IDMA 3V0VB 2GY5A 3UJJH 3TPUB 2X1QA 3O6LL 4AEHL 1NEUA 3G6JE 3GMPB 4WTZG 5HVWA 2VTFA 4QGTA 4XRCA 1LEIB 1A14H 4G8IA 1OLLA 1NGPH 2VDKH 3I75A 3MNVA 1S7SA 2ZUTA 1YEJH 4BSVB 4XPTH 1HHKB 5DGRA 4AENB 4NUGH 3UROR 4EDXB 3I6GA 1CL7I 3MUGA 4FQXA 3C60A 5FM5M 3F7VB 2AJVH 5EU6D 1KJVA 2Q6WB 2BCKA 2DI7A 3RGVA 1X7QA 1HH6B 1E4KA 2FX7H 2DLFL 1AO7A 4JFDA 4R8WH 2OR7A 3BPOB 3HG1E 4G7VL 2NX5E 1CXKA 4XCFH 5J13B 3SDCC 1FVCB 5JZ7D 4MXWH 4ALAL 4U1SA 3O4LA 1I3VA 5FHBL 5DD6B 3SPVA 3D3VA 5BZDA 2VE6A 4M1DH 3BPNC 3S37X 2DLIA 3L1OL 3DURA 5E1AA 1XGYL 1SYSA 1CXHA 5F89A 5ID1B 3GIVB 2A6DA 3BI9X 1FIGH 1HSBA 4AMKH 1OGTB 2VZ1A 5MEQA 4J3SA 4IJ3C 4KK6C 4Z77A 1SVZA 4P4RA 4HS6A 4RFNB 1F4AA 1S9WA 2K7PA 4P9HL 1JK8B 3RWDA 1T1WB 2CR3A 3KJ6L 3DV6B 5C7XH 3BUYB 4FFVC 2PYED 4POZC 4RZCB 3GJEA 1OB1A 3TYFA 3SDYH 4LL9A 2ZUVA 1DQLL 5E9DB 5T3XH 3MUJA 4MAYA 3L3DB 5EBMA 1JGLH 3O41B 4IHOA 2B8OT 1FFPA 5C0IA 1UJ3C 5JHDB 2BVUA 2XN9D 2G5RA 4XT1C 1ZEAH 1QLRB 2D9QB 4EI5C 1QLFB 4CADA 4LAJH 3HLAB 4LNRB 3NCYP 1D7FA 3DECA 2YD2A 2Y5EA 3C6SA 5CHNB 1U6AH 4F57H 3VFTA 4XBEL 5KVGL 1LDSA 1KTLA 1NL0L 4GKZA 5KS9F 1M05B 1FNLA 4G43B 1XF4A 4FFWD 1XCQB 4A6YB 1YY9C 4JN1H 1ES0A 3WNNA 1ORSB 3CDYA 1GC1H 4HIHA 4LOUC 4PS4H 4X9IA 2DIBA 3WIIH 4BZ2L 5JLZA 1HINH 4MNHB 1HCVA 4XX1G 5CP3H 1DANT 4H5SB 1YC8A 5EOTB 3KVQA 1BQUA 1IEHA 5ANME 3GMOA 5DK2B 1I1AA 4MZ2A 4OCNC 2CIIA 5E4EC 2F54A 1LNUA 2D03H 3LS5L 1RZ8A 1T2JA 5EO0B 4UV4L 5MP6H 1WBYA 3TGXA 4YHML 2LTQC 3S34L 3DO7A 3BKCH 1G7MB 1YN6A 2P24B 3QUZD 2MCPL 4GMSL 5ALCH 4YHZH 3V5DB 5FGBC 5CILL 4ZFGL 1BJMA 2X4NA 5JMOC 5I75C 5SWQA 3RWIA 1X5JA 1A7OL 1JN6B 2OR8A 5A2LH 5D1ZD 4CBPA 5EZIH 5DO2D 3ULUE 2H6PB 4WFGD 3MCG1 4OBSA 1NMCB 2Z31A 4NHUB 1JZ2A 1EFXB 1C8PA 4LPUA 4KDVA 5HSFA 2ZUWA 2ATPA 4KKCD 4JQXA 1A2YA 2CO7B 1W0WA 2ZSVA 3ULUC 3MLRL 1E6OH 4GG8A 5AZEH 1EERB 1MCKA 1ZTXL 1HXYA 5C0FA 2AW2A 4IRSC 2FRGP 3SY0A 3E2HC 3PWPA 3GIZH 4HJGA 3QDJD 4JE4B 4N0UB 4FOMA 3BZ4A 3SDXB 4KRPC 2HJLA 1FV1B 4JJHA 5CD3A 2QQLH 2HAZA 2P45B 2GJZB 4ORGA 1YPZE 5HYJE 3RZCD 2X4QB 4QRRD 3UC0H 2OMNA 2OZ4H 3HI5H 3WDJA 5IQ7L 1A6WH 3T2QA 5EIIB 4OM0L 2IAMB 1TFHA 4YK4B 4HWZA 4RAVA 2F5BL 1Z6JT 1KCSL 3T8XB 4PD4K 3MJ8A 4OD3H 2CRIA 3C6LD 2VUOA 2VLJE 4JJ5A 1CDBA 1D6VH 1EX0A 2FBJL 5DJAA 2HT3D 2G9HA 3FCTA 4GAJL 3T0AA 3ARGA 3BPCB 1IZJA 2WZPD 2F15A 3QG6A 2OR9L 2YBRB 3RWFB 5JQ6H 4J2XA 1EEQA 1C5CH 3U0WL 2QKIB 3DX8A 5E1HB 2HKFH 3F6LA 4LSQH 4K9EL 4HG4K 4PJHA 4X83A 1WFTA 1CG9B 4JKWA 3QO1A 4Y4KA 1C5DB 4WUUE 5BZWB 5LXGL 3IVKB 1QRNB 2OK0H 2W9LA 3BZDA 2YUXA 4YPGB 4Y5VA 5HYIA 1FAIH 3HE7C 4F8QA 4GFTB 2E7LA 2H45A 1JNLL 5F9JB 2V5YA 4H20L 3O3UN 1NGYB 4GLRI 2X4SA 4U6XA 1JGEA 1CGYA 3QIWB 2DQJL 2FHCA 1NGXA 4JY5H 5EZOH 1RHHA 2NXYC 4PRIA 4QXTB 5F9DC 2H32A 4XGZB 1CLYH 2H8PA 5FO9A 3QSKB 3I50H 3BZEB 1BIHA 3K2UH 4P57A 3TNNB 1CFSB 1CDIA 3ESVF 4XPAL 5CBEA 3IDYB 1OP5H 1IGCL 3U7WH 1IEBB 3C5ZB 3P0VH 3PE9A 1LEKA 2ERJC 4PJ7F 5CEXA 5L8LB 1HXMB 4I8DA 5D2NE 2PETA 5KSVA 3V5HA 1HWHB 1MIMH 3MNWA 5C0CB 5JR1H 4JM2B 4YHIB 1H15A 3VXRE 3VFUB 5A2JH 1PQZB 4NKIL 4OCXL 5I76A 2VR5A 3MXVH 2OM5A 1KTDA 3WHE0 5D2NC 1HHHA 5C0AB 2PCPB 1QSFD 5KVMC 5DWUH 5I1KL 1MVFA 5I19L 1INDL 1DZBA 2BRQA 3OR7A 4PJGF 3K1KC 5F6IB 2CLRB 4P2OA 1I1FA 3FKUS 3STBA 5DQ9A 1YMMD 5IMMA 1KB5H 4LSSL 3FT4B 3KAAA 2GCYA 3N9GH 2QQNL 3SJVA 5ID0A 4U1IA 3VXPB 4PTTB 3ILQC 1I8IA 2DQUH 1YYLH 3D9AH 1RZKH 5FF6B 4UT9L 1FH5L 2F58L 2XWTB 4ZOCA 3W81A 5A1AA 5DA4A 1FNGB 3V6OA 1JGUL 3WE6A 1BVLB 1B90A 1MQ8A 5IG7A 3HFMH 5B39G 4FABH 1RVFH 4GBXD 2YWZA 5AZ2H 3W11D 2XZQH 4P46B 5EIVA 5L8JB 5FUOL 1Q9OB 2R4SL 1FN4A 1KEML 4MLSA 2VLRE 2OL3B 1EUUA 3CLFL 4X4YB 2HLAB 3BIKB 5I17B 4UINL 1FCCA 1U8LB 4U6HB 3UTTB 3BEWB 3NCBB 3GSWB 5BS0E 2J4WL 2CK0L 3O3BB 4QEGA 2CDGB 5L2JB 5GXBB 1JI2A 3O3AA 3QQ4A 1EHLH 4HIJA 1VKXB 5LGJB 5DQDH 1DQDL 5DSCA 5TJWK 4Z7VA 1RAMA 5ITFB 1XMWA 2P5WD 2FIRT 3VE0A 4K2UH 1MLBA 2ITDB 2NY6B 1WT5A 4NZJA 1GZPB 4I0CC 4TPRH 1QFPA 1IKNA 1RZ7L 3MA7A 1ZWIB 2JJVA 1AIFA 1EEZB 1HI6B 2M1KA 3CFBB 4K7FA 4HV8B 3RNKA 4HBCH 1WAAA 4XNYL 3WO4C 1A8JH 1J8KA 4LSDA 2BK8A 4HKBB 3ARDB 1XCTA 3LPWA 1JF1A 3SO3B 3STLA 2O26U 5FFLA 4PJCB 1KCLA 4K3JH 5TQ2L 1ED3A 1S7WB 5DLML 5IBTH 1NEZG 1I9JH 4X6FA 4NO0B 1YJDH 5EU5A 4FQPA 5FOJA 3QNZB 3JV5A 3KYMB 5E8OB 3GRWL 1G9ML 5C0BB 5J1TC 1EPFA 1KNOA 3DO3A 4QOKA 3IDIA 4JFHE 2VSDA 3KPRE 4TUJA 1D9KA 3OQ3B 1IGTA 4QRQB 3BW9A 4LFHG 4PJ9D 3V52L 2IPUG 1ZOXA 5DD0L 4BFIB 5KSUB 1JPFA 1ETZB 2DQDH 3C87A 5FYKE 1T66C 2NW2A 1I9IL 1PX3A 3NABL 3VXSE 3R06A 1JHKH 5F1KC 3T2OA 2CKBH 1WEJL 3GEWB 2EXYC 2WSKA 2PW1B 3DXAE 2DQFB 5E99L 1TJGH 4PV8A 4JGJA 5F7LB 5EULV 3ZLQC 5F7EL 3FB8B 2R39A 2F9BT 4MA7H 3B3IB 4PJFA 5SWZD 3ES6A 4IRJC 3EBAA 3ARBC 3PP4L 4M7KL 4JFZL 4S2SA 3D1MC 4Z6AT 4ZS7L 3VI4F 4ZMAT 2VKWA 4UT7L 3TCLA 1VACB 2C3GA 4G9FA 1YQVH 1DQQA 4V1DA 3MOAH 2HH0H 1I8MA 1KJ2L 4K23L 5F96L 1LK3L 1T2QL 1N59B 3WKNA 2B4CC 4HJJH 1LDPH 4Y5XA 2OP4L 3EFDH 4JPVL 4JQVA 4KHXL 4QO1A 1QLEL 1ZVSB 3EDEA 32C2B 4PJIB 1FAKT 2AEQL 1P9MA 4L9LB 4K7PH 4MJIA 3HNSL 4JHBA 1N3NB 4QNPE 1K5NA 1QBMH 3QDMD 5HVFB 2DL2A 4NO5A 4XNQB 1K2DA 1XR9B 1BIIA 3VRJB 5HDQH 2YC1A 3PWVB 8FABA 3LKSB 1XF2A 1JF6A 1H3PL 3FFCB 3OB8A 1EO8L 5ESAB 1N0LA 3V8OA 1H5BC 1NH6A 1RD6A 3DROA 5D6DC 4CN6A 3EHBC 1O7SA 2FHFA 1NMBH 4NRYA 2C4XA 2W92A 3B9EA 1YEFH 3QWOB 5FK9B 1FLTX 3B9AA 3VA6A 1ZGLP 2NY7L 2VR4A 3O9WC 2QTEA 4QHUA 1UGNA 4MCYA 1RZJC 4PRPE 3TWCL 3DGCR 3LEXB 2PXYC 4L8BA 3TBYB 1UACL 4F3FB 2PYEB 2YPVH 5FUCE 1UVQA 3T1WA 4O9HL 5FDWB 3IJHB 2QSCH 3F58H 3RY4A 3MRKB 4JDVA 4NM4H 1R3JB 3ET9F 4NBZB 5E6IB 1YMHB 3TBWA 2DQHH 2XN9B 3JWOL 1A4JA 5A43C 5BO1H 5I15L 4MXQD 3V4VL 5FUCC 4KH2A 1G7PB 4KJPC 4JO1H 2MOVA 3BE1L 5ACZB 3PWNA 2D0FA 3TA3C 1ZVHA 3P4OA 5GGVH 4F7EB 1T22B 1GXEA 2NNAA 3F12A 4XP1L 4N8VA 5J1SC 4BYHA 4PJXA 5IMOB 1YEDA 4M1CD 1QRKA 2VITB 2EDQA 4LKCB 4P2RA 1QPPA 1IC5H 2IH1A 5GPRA 2BVEA 1QOKA 5J1AA 1UZ8A 3AREA 4G80B 4OUUA 4TNVF 1NC2A 1QVOA 1RJLB 3QCTH 4DKAA 5E4IA 2DMKA 4YEEA 5GGRA 1RHFA 3D0VA 1OSZA 5I8CA 2AP2A 2FNBA 3BO8A 5F72S 3T0VA 3WS3A 2Z8VC 4X9FA 3VFNA 1Q72H 1H8OA 3PWJB 5IW1B 4S1RH 3QUZB 2KZWA 2BRRH 1WWWX 1F4YL 1QP1A 4LSUL 4OCYH 1KJ3H 3MREA 4UIMB 4AEEA 2NY3D 5GZND 4NCC2 3QP3A 3WUWB 4M7LH 4PLKD 1U8HA 3IFNL 1HKFA 3GK8L 1XF5B 3FOMB 5DHVH 1U58A 3D85D 4XC3H 2GITA 1OT1A 4GMTL 4W6WB 4JCLA 1ROWA 4PJEA 4ZAKA 5F1NB 1EXUB 2KPNA 2RCSL 5BCAA 4NQSA 4Z0BL 1TIUA 2B1HH 3RX7A 4MXVF 5D5ME 2L7JA 1KELL 3FAXA 5FKPA 2CSPA 4JZNB 4PGEA 2DQGH 3KXFB 1AQDA 1T7XA 3QDJB 3F6IA 4U1NB 5IF0A 1AGEA 3NVQA 1FJ1A 4WGVB 4MDJA 4I77L 2OI9B 3RZCB 4K7PX 4NRZA 3ZSSA 1OGAE 5I1JL 4QRRB 1T0MA 1G6RL 5D70L 1DBKL 5EBGA 1DQJB 3RVWC 5IJVA 2N7AA 3IJSB 3TT3H 5ISZD 5CGYD 1DVFA 5MERB 4OAWB 4H26A 3C9NB 4X98B 1C7SA 4LQFH 1XF1A 2FO4B 5CBAB 3WXWH 3H9SE 3ZDXF 5F9WC 1T0NA 5ENWA 4NUJB 3MJ7A 3OB0H 3LN5B 3WN5C 1NFKA 5FO7A 1JUFA 2X4OB 1S5HA 2ZSWA 1RZJL 4LDOB 1OLZA 4L29A 3FO0H 3NIFE 4NCC1 4NSKB 3BP6A 4RWYH 3SKJH 4P2QE 3GBMH 4X5WA 3VMPA 1A6TB 1BQHA 4F2MA 5DJYA 1HYSC 2FJGA 2D2OA 1WBZB 1WC7B 2YEZB 4NWUL 3PL6C 4QRTA 4G7YL 4TQEH 3RL1B 4X0KA 4N1EA 1A6AB 3NIGE 5DRNB 3LB6D 4BH8A 4D0CB 3I6LD 2BSRB 3MRJB 5DZNA 3MGAA 1B3JA 1WFOA 3QAZC 4ETQB 3EIFA 1MJJA 2IMNA 1RZIA 2VOTA 5E8NA 1LMKA 4PJBA 3VG9B 1BQSA 3E6HA 3SDDD 3GO1H 1W0VB 4CVZA 5B3NA 4U1LB 3U9UB 3TBSA 5C70A 4Q6IB 3ZYJA 2EDJA 1F6AA 2VWEE 3QEQA 5TE6H 1IGYB 1AD9B 5CZKA 5MENA 4MD0B 2L7UA 2W0FB 2IG2L 1SBBA 2N7BA 3RU8L 5HYSB 1VFBA 3FONB 2NY5C 5J11C 4LASL 4QHLA 4XB7A 4FTVB 2GJ6A 1HHGA 3LRGA 3MXWL 2FZ3B 2UUDK 4QTHA 4AY0A 2C3VB 4FNLH 1FGVL 3QUXB 4UU9B 3OKOB 3V5KA 4NYLB 3B43A 1KB9K 2VWEC 5ADPL 1OARH 2BHYA 2APTA 2R2EB 1BJ1J 5E95B 3MBXH 4ONGH 4DZBB 3BKJH 4YFLI 1AQKH 3MJ9H 1NGWB 4XMLH 4OLYH 4XPGL 3VFOA 4ZTOL 3QWRA 4Z8FH 1U8OB 4IIQA 4YHLL 5FB8B 1H3XA 3QFJB 3LIZH 3IYLW 4G6JH 2IPKB 1QSFB 3S4SB 1G0DA 2Z35B 2O61B 4HK0A 5HHMD 3MRNB 1XGQA 3VFRB 2IBZY 3WNMA 4AQ1B 1IRAY 1KJMB 4U6YA 2JJUA 4WW2A 3T09A 1M71A 4BJLA 2CLVA 3HZKB 1CYGA 1KIQB 4FQJL 2R0ZL 3SE9H 1LHZA 5EO1B 5HYQB 2DYPA 1D5MB 2OJZH 5DD5H 3W0WB 4Y16A 4O51A 4P4KB 1IGIH 1KOAA 4UB0H 1A4KA 4HXBH 2PYFB 1FNHA 3EO9L 1QEWB 1DFBH 3RIFK 2GSGB 4L4VA 4MJ4A 3MLPA 5JORA 4KVNH 2XWBA 4JFFD 3QIUC 2NMSA 2DQTL 3FN9A 4HWUA 1PKQE 2OTPA 2WBKA 4YHKH 4GKSB 5IESH 1MQKH 3ZE1F 5D2LA 4OLZL 1VGKA 5DJCA 3D2UA 3NTCH 2Z8SA 2VABA 3VXNA 3INUH 4O2EB 1EHXA 1ZT7A 4MB3A 5IGXL 4P99A 1GIGL 1NCCL 3BKYL 4XI5D 3FTGB 4ZOBA 3W2DL 4KTEL 2GTWA 2I60L 2FX9L 3CC5A 4Z7UE 4YZFF 3MRBA 1KENL 3LKNB 5IUSA 2BVQB 3N0PB 2E27L 2VLKE 1BOGB 2P5WB 1F90L 2C3XA 1NFDA 1H3WM 5I1GL 2QV2A 2LVEA 5BVPH 1TXKA 2J8UB 1QFWI 1BBJB 2Y36L 3BT2H 5GJSH 5BQ7A 4QRUB 3SN6N 3HR5B 3X12B 4KJWC 3EOTH 3BOVA 4LPVA 3SE4A 4JM4H 4RGNB 5E70A 3VDBA 3MROA 3ARFC 3VH8G 2IGFH 3IDJB 2IQ9L 1QR4A 3DVNB 2H2SC 1DJSA 1IGJA 4TOYH 3DJ9A 5JW5A 1S7XA 4FQ1L 3RKPA 3F7QA 3ZO0A 3QH3B 1AHWA 3FRUB 4LVHC 4LCIL 4AEIH 2DS4A 3VXQA 5C0ND 3SGEH 5F3BA 5BRZA 4ACPA 3TCXA 3CX2A 1MHEA 5CEZD 3PABB 3NN8B 5I30L 2HFEB 1RUKL 4RGOH 3ECBA 3GBNH 4U7SA 1XEDA 1BVZA 2UYLA 2VL5A 4C59B 3BUTA 3C8DA 2BOCB 4XMPH 4N0CD 1X5ZA 3H7BB 4EUPH 4JFPB 2ZOLA 4NFDA 1AGCB 1INEH 1CGSH 1X9QA 4U3CA 2R56H 1IZKA 2UWEF 3TPKA 2YWYA 3ZKXB 5ILTL 4K3DL 4QHKJ 3PXJA 4RDQG 4M7LT 3U4EB 4XCNA 2VDOL 3MBEA 2Z92A 4IOSD 1N64L 3L5WA 2HVKB 3RVVC 3EJZD 4LHUD 1MREL 3GJFK 5DFVC 1U41A 4ZUVB 1VHPA 2I07A 3GRWA 3NFNB 3HE6D 3FQTB 4OTXH 1JYWA 1SVCP 2FGWL 3UTSD 3A6CL 1AR2A 4YNYA 4X6DF 2G60L 1A3LH 4YBQC 4P3DB 1N5AA 4RWHA 1LO2L 2VDMH 2HT2C 5F9OL 3S37L 4Y19D 3MV7D 2BNRB 3FB7A 1OD9A 1VSCA 3UBXI 4BZYA 3SDAB 4BQ8A 2X10A 5BVJA 3E0GA 3PDGA 3FHQA 5KN5B 1W72L 1BD2D 3LCYA 4PP2A 3GFUA 4RA3A 1KEGH 2J3SA 2PKDA 1VFAB 5IFJB 4K94L 4R6UA 2XQBH 3OG4B 5IIEB 5KANG 4LRIA 4PJ8C 2WIMA 5F7WC 2D31A 2Q8AL 3L3IA 5D7LA 2ICCA 1ADQH 1M4KA 1SJVA 3G6AA 1OY3B 2DI9A 3CFIC 1MFEL 4QCIA 3C2AH 1M6OA 5IJKC 1AE6L 1LD9B 4KDWA 4H1LA 3QZWG 4RMSA 3DBXA 4GRMB 4KVCL 5BV7H 1A9BB 3T0XA 2E9JA 1NGQL 5KZCB 5IBUG 3V8CA 1FO0B 4JN2A 3NPSB 1HKLL 3C5JA 4G5ZL 2DD8L 4APQC 3BPOC 5HD8D 4DCQB 1FFNA 5J13C 3CSPA 3LQMA 5GGSB 1ACZA 2DLEA 3OZ9L 1KJ2A 4NKOA 4DKFL 5CD5D 5J4MA 3QCUL 5GS0H 1MCJA 1EO5A 1NCDH 4EEEA 2EDTA 4PB9L 4N5EC 3JWDL 2IALA 5IKCA 5HDLA 1J05B 4OZIA 3IAQA 2P47B 3ARQA 3GMRA 4NZDA 4R96A 4XAWL 3WFEL 4CU8A 4FQCL 1P6AB 5E9DE 3QQ9D 4OFKA 1JPSH 5KSBA 4PJDA 5L2KD 4OCWH 3WLBB 3EYUH 5JHDE 3FRPG 3JTSB 1Q9LB 1MFDL 1B0RA 5F7NC 2H1PL 2VZVA 4TSAL 4WY7H 9CGTA 4WJ5A 3TO2B 3ULSA 5IR1B 3K4ZA 3L3GB 3DUHA 4RFOL 1CGVA 1JFQL 3GKZA 1FPTH 3CDGB 4YE4L 2EE2A 3V9FA 2FWOB 3BJLA 1N4XH 1WK0A 1MRDH 1X6LA 3P40A 4NHCL 1XGUB 4M43L 5T3ZL 3AU1B 3MV8B 4A2LA 3MLXL 1RPQA 4WIQA 4XNZB 3I6KA 5SWSD 3GI8H 4LARL 3OKLB 4RDQF 5DYOA 3RX5A 3U0TB 1NC4A 4PB0H 2OQJA 5I8OL 2D7MA 5HXMA 4LLQB 3BVNA 1X3DA 2BSSB 3CK0L 4UQ3B 4Z5RB 1MUJA 1NBZA 1I7ZB 2QJDA 1V7ML 1SYVB 4KMTH 3TBTB 4HIXL 4QRPA 4YIQB 3T1FA 2MKLC 5IVOA 1ITCA 3M1BA 1YDPB 2W07A 4UQ2A 4JZJB 1P4IH 2NCMA 3UJJL 1DDHB 1MWAH 1HQ4A 3HPJB 1A14L 4R90H 5F7MC 2NY3B 3O6FD 1NGPL 2VDKL 4QHMA 3IDUA 3TIDA 3GZKA 3MV9D 1YEJL 1KCRH 4XPTL 1JWSA 4GW5A 3FT3B 4IDJH 4NUGL 2UZXB 3CXHJ 2AJVL 4AH2A 1P6FA 1QFUH 1P53A 2FX7L 3R8BB 2K9UA 3HPLB 5EBLA 2ADFH 3L5HA 4R8WL 3D39A 4XCFL 3V6ZB 4N68A 3D18B 2F8OA 5T1LD 1T5WB 4HFWB 4MXWL 1QO3B 3UDWA 3KWWB 4ZNEA 5CAYB 4O5LH 4YGAB 4G6FD 3PGCA 1DN0B 1ZKAA 4F9LA 4M1DL 1E4WH 2UZIH 4F8TA 4W4OA 1ZLSH 4F33A 3V0WH 2UY7A 4HIEB 1NMCC 4CDHA 5DQJB 5DZOA 5I0ZA 2BVOA 4HUMB 1FIGL 4P23A 4N0UE 5FKAA 3SDXE 4AMKL 5FA3B 3VMNA 4LHQB 4AIZB 2FSEA 5H94A 1H9VA 1N7MH 4XCCH 1JHTA 2CDFB 1T1ZB 4W68A 3SDCD 1RULH 2HJKB 4D9RE 1JZ8A 4M9OA 2WBWB 4RQQA 5C7XL 2D7TL 1FYTA 5ISZB 4Y1AB 1JGDA 1TJIH 3OKNB 3SDYL 1IM9D 3OXSA 3MRFA 4LSTH 5T3XL 5CEYB 1FVDA 4KHTH 1JGLL 4XCEA 2NX5D 3QNYB 4HPYH 1MI5D 3N1GC 43CAB 5HHQB 3IJYB 4NKMA 3MLZH 1F42A 3KLDA 5I66A 3P73A 1BJ8A 3PHOA 1ZEAL 5LJYH 2IAMC 3QG7H 3CFJA 4CVXA 3GSNB 4JFQB 5E5UB 1ZXQA 4TVSa 1JMZA 1U6AL 4F57L 2R0LH 3KG5A 3ZTNH 2XQYG 1B9ZA 1OTTC 3UTOA 1Q94B 5FOBB 1HH9B 1U8JA 1QACA 5DJXB 1R3LB 4JN1L 3LS4H 1UXWB 1QRNE 3MPCA 4OGAD 2VIRB 1GC1L 2FHBA 3QEGH 4J4PD 4OT1H 4FXGA 1AFVH 5IWLA 1R5WA 2W60A 3NZ8B 4PS4L 4UDTA 4PGCB 4QYOA 3WIIL 1T83C 1HINL 4F7MB 5KJRH 4LF3A 5ACMA 1G6RA 1ZA6A 2ZUUA 3FT2A 1CL7H 5HI4C 1ZS8A 3UTPE 4ELMF 4Z7WF 4Y4FB 2I9TA 2Q20A 3AUVA 1QFOA 1K8DB 3SGKA 2D03L 5D6DA 3DPBA 5IM7A 5MP6L 4X8JA 1TPXB 2VAAB 2ZKHH 1PY9A 3BKCL 3RWHA 4LOUD 5ALCL 3QA3A 4LBEA 4YHZL 4L5FH 3QIWC 2X41A 1IAMA 1H0DA 1MCNA 3EGSB 5HI3C 3U4AA 4EUPG 5TDOB 4U1HB 1WFNA 1AXTH 2H26B 5C0CE 4CW1A 1OD7A 4FQQB 5EZIL 1LO5B 3T0ED 4EOWH 3IDYC 5JUEH 1N0XH 3RZWA 3C5ZC 2NY4D 3VRLE 4HS3A 5LGHH 3OF6D 1UJTA 1SEBB 2C1OA 4R26H 5C0AE 2NYYC 4HH9A 2P5EB 3MLUH 3K74B 4JM2C 5ALBH 4AEFA 1GHFH 1E6OL 2R1XA 2WAHA 3B83A 5AZEL 4OQTH 1AP2A 2YKLH 5KS9A 3DIFA 4Q97A 3QPQC 3GIZL 2O5YH 1BZ7B 2OSLA 3TIEB 4LRNH 2ZUSA 2QQLL 1HILB 1HE7A 2NZ9C 4QT5B 4UNVA 1AC6A 4QRSA 4S1DD 4ONFH 2W91A 5F6IC 3OJDA 3UC0L 2OZ4L 3H3KA 3HI5L 5K33A 3MRHA 3QDGA 1A6WL 5J89A 2R2HA 2GUOB 4PGBA 5D7JB 2YSSA 4KK5D 2X1XR 3F8UB 4UNTA 5EPMA 4RMUA 3UMTA 1AKJD 5AAWA 2SEBA 4EN3D 4IRSD 5E6YA 2EIEA 1UXSB 1UWXH 1MCBA 4OD3L 1I1YA 2VDLL 4JEGB 3VXOB 3MOBH 1CGTA 4KRPD 1D6VL 4F7PA 5INDB 4DOHB 3EZ8A 4WTZA 3NCJH 2WWMD 3NOIA 4PV9A 2RR3A 5E8PA 2ZUYA 1EHAA 5HGBB 2E6JA 2YN5A 3UTTE 5JQ6L 3NIDE 3GMLA 4WU7A 1C5CL 3S5LB 4E5XB 4P46C 2HKFL 4LSQL 1L4IA 5I1IH 2FX8H 3RWCA 4JHAH 5JDSB 2OK0L 4WGWB 1FAIL 1JWUB 1LQSR 1WIUA 5GIRA 1JPST 1Q0XH 3CH1A 4HUXA 1A7NH 5M94B 2BSED 1JNNH 4F58H 5DDHA 1PDKA 2EKSA 3QO0B 4JRYA 3BWAA 4TVPE 5J6GA 1QR1A 1D5BB 4JY5L 5I73B 4PRBB 5EZOL 5F7DA 3T65B 2QSTA 1BQLH 1CLYL 4G3YH 1GSMA 2NTFB 4N90E 3P77A 4JFYB 4U6TA 4OZHF 4N9GA 4PJCE 3I50L 2NY6C 1I85C 2G75B 3K2UL 4RMRA 1DBBH 1U2CA 4PY7A 5HHOB 3HE7D 3U7WL 4JANB 4JCMA 5KSAA 2R8SH 5C0BE 2O5XH 3IFOA 1UQSA 1T1XA 4UUJA 5DEGB 1MF2H 2UVEA 3P0VL 4U1MA 4PGDA 3GJFB 1RURH 4C4KO 3S35H 3SO3C 1MIML 5JR1L 3HZYB 5C6WH 2YS4A 4R0LA 5HVHB 3X13B 4E0RB 4P0DA 4CN4A 4P5KB 3UTQA 1KUMA 4MD5B 4EKXA 5I1CH 4NNYA 4MMXC 3SOBH 4DUVA 3MXVL 3WN5A 1CDCA 1CFVH 3MZGB 4M8QB 4DEPB 3O3DB 4NN6B 3ZKMD 5FO8B 1FIEA 5DWUL 5DMYA 4HDIA 5J3HD 4XZUA 4PP1C 4RAUA 1BEYH 5I71B 3T4YB 2YD3A 3S36H 3RVTC 1T1YB 1A9EA 3QWQB 3UJTH 2QADB 3TVMD 3WDIA 1U95B 5F93C 1KB5L 5E2JA 5T33H 3TFKC 1KLGB 3N9GL 4KTDH 5GZOD 3TN0D 3NACH 4ZUUA 2DQUL 4BKLB 3ARSA 2V7NB 4LHUB 1YYLL 3D9AL 1RZKL 1VEPA 3EOYG 1QUNA 3VCLA 4JY4B 2DBLH 5CEZH 3QUYA 2DKUA 4YDJA 1AGDA 2P8MA 4Y19B 4M6MH 1UM4H 3HFML 4FABL 2HG5A 5GJTH 1ZGLB 1RVFL 5AZ2L 2WBJA 2XZQL 1JTOA 2X4RA 5D1XD 5C0RH 2IANB 1FL6B 3RI5F 1CDHA 4RX4D 5CWSA 5CCKH 5GGRY 2ATKA 4C4KT 4D2NA 4HK3J 4RIRB 3NA4A 5D7SH 4PJIE 3FFDB 5AG9A 4B41A 3RWGB 4PRNA 2EYTB 2GFBA 2V2XB 2ARJQ 2BY1A 4IS6B 3CFEB 4JRXA 3FQUB 4PJ7A 4FQXD 3C60D 1X5XA 3QXVA 3RGVD 5IQ9B 4ODWB 2Q86B 4O2CA 5BOZG 1EHLL 4HKJB 1AO7D 2I27N 3B9VA 5DQDL 3ALWA 4HKZA 4NWTH 4X6CB 5B3JE 3NH7H 4L9LC 4JPIB 4PBVC 4YDKH 4C56A 1CD9B 3FFCE 3O4LD 4NOBA 5GGTH 5M95B 4K2UL 3VFSA 3THMH 3HUJB 4I18B 2BXZA 3ARVA 5DI8A 4TPRL 3H3PH 1VCAA 2CPCA 2JJWA 2FJFA 4PJGA 1AGBB 5KVDH 1ONQA 4I13B 4HBCL 5J9PB 4BFGA 2ICEA 1JL8A 2Z9TA 1TZIA 1L0YA 2P1YA 1UWEH 5E24E 4K3JL 4RMVA 4JDZB 3QXAA 4K8RC 2PYEE 5IBTL 3G5VA 4D8PA 1I9JL 1YJDL 1W72A 3TBVA 5BS0D 5FCSH 5DC0A 3Q3GB 4RNRB 4XC1H 3MRPB 4KUCF 5L2KB 1WBXB 4W70A 3S96A 5FYJE 1M1SA 3OKEA 2J12B 1E4XH 2XN9E 3S3SA 1J8HA 1PD6A 2DQDL 5J6HA 3G5ZA 5K9OB 1TQBB 4F9PC 3WIHH 5F3HB 3DMMA 5ICXB 4M9PA 1JHKL 5D96B 3VH8B 1ZV5A 1OVZA 2CKBL 2JB5H 3QFDA 4NPYA 2J5LB 4NQEA 3RAJH 5E6IC 1MSPA 5GSRB 3KNBA 1TJGL 5JXEA 2J88H 4OF7A 4MA7L 3X14B 2ZZUT 1ZLVH 5SWSB 1WWCA 3JBG7 1YEHH 1MJ7H 1REIA 3DYMA 2CD0A 3FJTA 5FYLE 2EECA 3L3HA 4YXLH 3S35X 5F21B 4FFWC 1OAUH 2YPLA 1CXEA 1L6XA 4BQ6A 5I2IA 1YQVL 3Q48A 3MOAL 2HH0L 3RUGF 4JFHD 3KPRD 5CIPA 1I1AD 1JZ7A 3PWUA 4PRDA 3MGTB 3ZKSD 4UIKH 2F54D 3OGCA 1MVUA 5FYKD 3ARFA 3BEVA 4HJJL 1LDPL 3ARBD 1YNKH 4XXCA 5IHBA 3EFDL 5DEFB 3QPXH 2CLZA 3MV9B 3RPIB 4WWKD 1AD0A 3JTTB 3S36X 1WITA 4OV6F 3GGWA 3DV4B 5HHVH 4K7PL 2DQEH 1NDGB 3QUZC 1QBML 2MPAH 2V5SA 4WHTA 4IOIA 2P7TB 4O00A 4PGZA 5EH1A 2DJUA 4L3EA 3ZDZE 2F19H 1OAZH 5T1LB 1PKOA 3H2WA 2BC4B 1BFOB 3TO4A 3MRMB 5JA9A 3ARTA 1S9XA 3FQRB 1PZ5A 2A2QT 2EYSA 3MODH 5DHVB 5HDQL 2DM7A 3L95B 4G6FB 4O58H 5D1ZC 5DO2C 3N1QC 1A1NB 1GPOH 3KXFE 1B2WH 4OD1H 2MCG1 2XPGA 2VERN 2VQTA 3QDJE 3DSFH 2AV1A 1NMBL 1Q0YH 4KJQD 2Z93A 3PWPD 1YEFL 5E00A 4KKCC 5EOQH 4CAGA 4FXLA 4Z76A 4G6AD 4J23A 4OZGB 4QRRE 4ZQKB 1EZVY 4PLOB 5F97E 5DJDA 1RUQH 1YECH 3MGOB 5C71A 1PYWB 4MA1C 2YPVL 1IT9H 3BXNA 1TVBA 1UB5A 4I1NB 5DTFA 5TDPA 2QSCL 4NM4L 4JO3H 2AAVA 3OKDA 1FE8H 1VEOA 2MNUA 4NKDA 2QR0A 2OI9C 3RZCC 1MI5B 3DOSA 4ODXA 1G1CA 3EHBD 4P5MB 5B39A 5I6XB 1ORQB 2DQHL 3CCHA 3GUTA 1GGBL 4ESKA 3WHXB 5BO1L 2I24N 4NO2B 1AY1L 3ISWA 2JJSC 2B7DT 1P7QD 4JO1L 4ZSOA 2BNUB 4JPKH 1Y18B 3ARGD 3GMQB 4GRLB 5GGVL 4JY6B 1XIWA 3OJ2C 1FL3B 5IB5A 2P4AB 2ICWJ 3O3EA 4LLVA 4QXUH 4MCZB 4PJ8A 5IVZB 1IC5L 1EVUA 4Y4KD 1TZGH 4JKMA 2EDXA 1FZOA 6CGTA 4PRPD 4HGMA 3TF7C 1FZJB 3QCTL 3UTZA 4L4TA 3TA3D 1UCTA 2F74A 4X6EA 1KIPA 1YN7A 4APQA 1QSEA 3VGGA 2X89A 5I1LB 1U91B 2AJXH 3LSOB 5FHAH 2MHAA 3SGJA 1Q72L 3L7EA 2H9GB 4S1RL 3HN3A 2G5BB 1IFHH 4OZFB 2BRRL 4FTVE 4OCYL 1KJ3L 4YQXH 5DVMA 2MTPA 4WW1A 3MYZA 3IKCA 1NEZA 4M00A 4ZXBA 2X6MA 2ZCHH 2W1NA 2EDFA 4M7LL 1VESA 5B8CA 4L8CB 1D6EB 3F65A 2V5MA 2AQ3A 2E3VA 4ZFOL 3T0EB 3TP4A 4XC3L 5DT1H 1YYMH 3VWJA 4ZNCD 3JV4B 2NY4B 3QUXC 4KK8D 4P5TA 4D9LH 1CFNA 3WDHA 1CQYA 3QFJE 5FGCB 1F2XK 5TH2A 1QSFE 1K4CA 4GW4A 2FIKA 4R7NA 3EYFB 5TDNA 5HHPA 1RUAH 1C16B 2B1HL 3BH8A 3HAEB 5CP3A 3SCMA 1UH2A 3UZVB 2EYRB 3WL9B 2DQGL 2AEIT 3CDCA 1QBLH 3HS0A 5D7IB 3L5XH 1GCFA 3ZKQD 2GSIB 3B9KB 4X7CC 1MRFH 3E6FB 4G8FA 3LQZB 3CFDB 5EO9B 1B0GB 1SJXA 2ZCLH 4XH2B 4KFZC 3IDGA 3SJVD 3W0WE 3QIBA 2LFGA 3VXUA 1CFQB 4GAYB 1Z2KA 3W9EB 3C08H 3TT3L 4D0BB 5GQBA 1S3KH 1OAKH 2DDQH 4PG9B 1AKJB 1RZGA 2DN7A 5I16A 2P42B 4LQFL 4LLYB 2FJHB 1A47A 3WXWL 1TETH 3KHQA 2ID5A 3PGDB 4NM8H 5DF0A 3N50A 3RDTA 1GGUA 4C58B 4CJ0A 4N0FA 4P4KC 3VGAB 1VA9A 3OMZA 1NFIA 4ODVH 3RTQA 4ZO8A 1X5FA 3FO0L 5HYFA 5ITBH 2EDKA 2HN7A 3SKJL 4RWYL 3RFZC 3GBML 2BNQB 2JIXA 3WV0A 1N2RB 2GJJA 1LE5B 5TGBB 2C1PA 1E28B 2CXGA 4I0PB 1F3DJ 3KPSA 1UB6B 4TQEL 1Z5LB 3L3KA 1EDQA 4R4ND 5C0GB 3M45A 2ADIA 2IPTH 1O0VA 3LZFH 2P5WE 1CD1B 1A5FH 4ONHB 4Y88A 3ULUH 4C83B 4XP5H 2DLHA 2J8UE 3U1SH 4O2FA 2JLLA 2JJTC 4QF1A 4HIIB 1CWVA 5EU4B 3GO1L 1DE4B 2OZ4A 1IM3B 1HYSD 4XCYA 2AK4A 4HK3N 4RGNE 4GG6B 3H9SD 3PL6D 3QEHB 2GKIA 1KN4H 2WMPA 4XNUH 2VR9A 2O93L 4PJAF 3RWEA 1DQTA 4DGVH 3UPRB 2A1WH 2ZJSH 3MCLH 3C8KB 2RHEA 4FNLL 4ODUB 1NUGA 3QI9A 5IEHA 4PJFF 5EUOF 4JO4H 1OARL 1Y6KR 2JCCF 4DGYH 1BP3B 4NQDB 2YD4A 1ZHKB 3D25B 2C26A 3LD8B 1DUYA 3MBXL 4ONGL 1ZHBA 4QOKD 3BKJL 1CLZH 4LAQH 4Y4HB 3E1F1 4OFYD 1AQKL 1D9KD 1RJZB 3MJ9L 2R1WB 4XMLL 5KOVC 4OLYL 3GSUB 3O4OB 3U0PB 4Z8FL 4I2XA 4LLWB 5DMKA 1YA5A 4G8GA 3LIZL 2GAZB 4ZUWA 4G6JL 4HEME 3QUMB 1F6LL 3PHQB 2Y06H 5E8EA 4YWGH 3OAYH 2WWKO 3CJJA 3SKOA 3TVMB 4XAKD 3MRQB 3V6FA 2VC2H 3BQUA 4MGXA 4XWOD 1EBPA 4EUPB 1A1OA 3REVA 2OLDA 3Q6FB 3SE9L 4H0IA 3DTXB 3RL2B 3KLAB 4X7FC 2VLMD 3O0RH 1HEZB 4W81A 5T1KA 5IB2A 3OV6A 1CR9H 2QBWA 2OJZL 1FSKC 2DWDB 5D4QA 5DD5L 2IFGA 2PTTB 1IGIL 4LCCA 3VFMB 4M3JA 4JFXA 4V1DD 1CE6A 3HZMB 4UB0L 4HXBL 3P30H 4WO4A 4L8SA 1KLUB 1DFBL 4NC0B 5CJQH 5FECB 2DWEA 2BNRE 5D1XB 5KG9B 3FO1A 4KVNL 3L5JA 1HOCB 3IDMB 4MNGA 4XRCB 5IVXF 1CICA 4IRZH 3ZZ1A 4G8IB 4YHKL 3I75B 5IESL 5BV7C 1MQKL 3MYJA 3MNVB 4RAHA 1S7SB 4D0DA 5IEKA 3NTCL 2V6HA 3INUL 5TF0A 3I6GB 3MUGB 4FQXB 1F45A 3C60B 3SDAC 1KJVB 2BCKB 5B38G 4XVTH 3RGVB 1X7QB 4B53A 1OTSD 4H1LH 4NZTH 3RHWF 3VFWA 1AO7B 4LPCA 4JFDB 1UKQA 4JO2L 1KB5A 4EDWH 4I3GA 4U1SB 3O4LB 1VB9A 2PO6A 2YUVA 1A7RH 3ULVE 5CINH 3DYOA 3WUZA 3SPVB 1IARB 5BVPL 3D3VB 5GRYA 5BZDB 4BSJA 5A2KH 2VE6B 3BT2L 5IT2H 3DURB 5E1AB 5F96H 1SYSB 5F89B 4H0HB 2BY3A 4YJZL 3LKOA 3EOTL 4OF5A 3VGDA 2GW5A 1UG9A 4JM4L 1DUZA 2A6DB 3QXWA 4XPFH 1HSBB 4KUZH 3CGTA 2IGFL 5MEQB 2X44D 3O8XA 4Z77B 4P4RB 4HS6B 4JVPA 3NPSC 1S9WB 1OF2A 1MPAH 4TOYL 3RWDB 5J57B 5I1HH 2W59A 4ORZC 4PTUA 4JG1H 4NNPH 5HVGB 1MCQA 4PIRF 3GJEB 1OB1B 3TYFB 2HWZH 1U8NA 3SBWC 4AEIL 3L3JA 4MAYB 1GOFA 4KJWD 5EBMB 3EYVA 4IHOB 2IQAA 4U05A 1FFPB 5JIKA 5C0IB 4LCWA 2KH2B 4EIZC 4HQQH 1IAIH 2FR4A 4J3UA 3TZVA 4RGOL 3GBNL 3GM8A 3K7UA 4NN5B 4CADB 2W0KA 3C6SB 5FDYA 4AQOA 3VFTB 4XMPL 1RJYA 2XY1A 1KTLB 2AJSH 4G9DA 4GKZB 4MXQC 1INEL 3PGFH 1CGSL 4OFDA 2GI7A 1XF4B 1WZKA 3MV8E 1LP9A 1ES0B 2VLLA 4OV5A 3V2AR 1EAJA 3B8YA 4HIHB 1NGZA 1MAMH 2JF1A 5IFHH 5FGSA 4YX2H 1DCLA 3MRGA 1CE1H 1XGRA 4DWHA 5JLZB 3ARED 5I74B 2AEPH 2BVPA 4LLUA 4HXAH 4M1CC 1NC2D 3VXTA 4XVUD 1G7LA 4MDIA 3KPTA 1Y6NR 3RIAF 2OXHA 3GMOB 4P49A 1I1AB 4OTXL 2CIIB 5LBSH 1RIUH 1LNUB 2F54B 2XT1B 1CIDA 1A3LL 4DUXA 5CGMA 4M6NH 2VDML 1RZ8B 2GEEA 2ICES 1WBYB 3DO7B 1YN6B 2A77H 4M6AA 3QXTA 4NQTA 1KEGL 4BUGA 2CKBA 5DUBA 2X4NB 4PBXA 1U3HA 5SWQB 2XQBL 3IFLH 3RWIB 3GHBH 3OXRA 3UPCA 2LU7A 1S7TA 4ETYA 5IROC 2NY3C 1UT9A 5GZNC 4WI5A 1ADQL 5E7BA 4OLXH 1CLOH 3FZUC 3C2AL 4PLKC 4GRWB 2Z31B 4M5ZH 5DJ0A 1KCUH 5BV7L 2I26N 2ATPB 1OCWH 1IC4H 5H8DA 2DIJA 1A2YB 3FB6A 4ZODA 1W0WB 4X8XA 5BW7C 2ZSVB 2AI0H 4GG8B 1FRGH 4Z7NF 1HXYB 2CMRH 5C0FB 1DQMH 3SY0B 3PWPB 3IDNA 2UWEA 2V2TA 4HJGB 5C2UB 5GS0L 5C2BH 3BZ4B 3D87B 1NCDL 2HJLB 3U36A 2MKWA 1U0QA 5CD3B 1OAQH 3BSZH 2C5DC 4ORGB 4UAOB 2ZUQB 4WWID 4NKQB 5ISZE 4Y1AE 1OOAA 4OSUH 3HC4H 1IJ9A 1KF9B 3G6JF 3MLTA 2B4CH 4MNQA 4HWZB 1JPSL 4RAVB 3RIAK 4MXVE 1DVFD 4X6DA 4OCWL 3EYUL 4NZUH 2OTUA 4R7DA 3DI2B 3MJ8B 1SEQH 1FBIH 4WY7L 2K7QA 3O11A 4HW6A 4DGIH 4JJ5B 3VD4A 1KPVA 2EIDA 4FXKA 5DJAB 3B2UC 2G9HB 3FCTB 3ARGB 5IB1A 3ARRA 3GMNA 3QG6B 4NO3A 3QRFM 3IS1X 4KXZI 3T3ME 5HHXH 3KR3H 1N4XL 3DX8B 1MRDL 1CT8A 1X4ZA 3T3PE 1ZT1A 4C54A 4PJHB 3ROOA 4Y4KB 3QO1B 4ODHH 2HYMA 4FMFA 3GI8L 4Y5VB 3U7YH 2Y5TA 1LO3H 3GSRA 4PB0L 3P11H 5EU6A 2KQMA 1TCMA 4FQHA 1J7VR 2X4SB 4U6XB 1JGEB 5E9DD 3LB6C 1F4HA 4YHOH 2A0LD 2HVJA 1EGJH 4NQCA 4N8CH 1PGRB 4KMTL 1NGXB 4HGWA 1QHOA 3D5OF 1IL1A 1RHHB 3QEQD 4PRIB 5C86A 2H32B 4WCYH 5JNYA 5IVNA 2H8PB 5FO9B 2E6QA 1PJ9A 3OGOE 1P4IL 3MQIA 3CVHH 1MWAL 5FUZH 4P57B 3QT2A 4R90L 5CBEB 2GJ6D 4Y4FC 1KCRL 2FO1A 4IDJL 1LEKB 5CS7A 3LRSA 5CEXB 1VPOH 5F6HI 5KSVB 3V5HB 3MNWB 4ENED 2WUBH 1H15B 2ADFL 4HULB 5L6YH 3QJHA 1MELA 1GZQA 4LGPB 5I76B 2DKSA 4F9PA 1SY6H 4O5LL 3CAFA 2P5EE 4JR9H 1KTDB 1HHHB 4HZAA 3WXVH 3WFHA 1E4WL 1WIPA 2UZIL 3D0LA 4UNUA 1ZLSL 3V0WL 5IHZA 3OR7B 4P2OB 1I1FB 4KV5E 4OGXH 5DQ9B 4XMKH 5C6TH 5IMMB 4HWBH 4KKNA 1N7ML 4XCCL 4Y5YC 2GCYB 3SJVB 5ID0B 4U1IB 1RULL 1I8IB 1S9YA 4N9OB 3ZMRA 1NCAH 3EOAA 3G6DH 3O2VH 1F58H 5F44A 1RFDH 4Y16D 2KL6A 1BZ9A 1TJIL 3EYSH 3WE6B 1FP5A 2WP3O 3H42H 1K85A 4UTBH 1A02N 4LSTL 1MHPH 4ZFOA 5IG7B 4H1LG 4KHTL 3FN3A 3T2NH 1NFDF 4OIIH 4HPYL 1J1PH 4MJ2A 2FH8A 1IKFL 2X4PA 1EFXD 1NMAH 3MLZL 2WLYA 5C9JA 4DOHE 4POUB 2LAGB 3AB0B 4J8RA 5A2FA 1QG3A 1FN4B 5EA0H 5KVEH 3B9DA 4H8WC 2ZNWA 5D7JC 3ULUF 2YPKA 3QG7L 4J3XA 2XXMB 3H0TA 1JNHA 2R0LL 1KC5H 3WMSA 3ZTNL 4WENB 5T1MA 3VG0H 1OAYH 1Z9MA 5T1DH 5HGHA 5K9JH 3LS4L 3O3AB 1DR9A 3QQ4B 3NMEA 1NJ9A 4HIJB 3WLWC 3QEGL 4OT1L 1AFVL 4KRNA 3IAGC 4MX7A 3IU3A 4Q6YA 5DSCB 4D9RD 4Z7VB 3GKWH 5IFAH 5F7HA 2C3HA 1KXQE 4R2GB 5KJRL 3QZWA 4XI5C 5D1ZA 3VE0B 2A6JA 1MLBB 2XTJB 1CL7L 1CS6A 3EAKA 4OJFH 2EEBA 4F7CA 3LN4A 3PG2A 3ZE1E 1J10A 1SM3H 3MA7B 1YPZF 1AIFB 2RJMA 1OTUD 4K7FB 2VZOA 2A9MH 3RNKB 3QB7C 4HSQA 1MFAH 1E27A 1XCTB 1JF1B 2B39A 2ZKHL 3STLB 4PREA 2MSPA 3PNWA 1ED3B 1UENA 1CFTA 2FECI 5HHOE 4L5FL 4I48A 4X6FB 1A22B 3EW3B 5EU5B 4KZEH 5I73C 4CMHB 4IOFD 3H9HA 5C3TA 5I0DA 4MJ5A 1KNOB 4QOKB 3IDIB 1AXTL 4DK6A 4TUJB 2V7HA 2BHUA 1D9KB 3VRIA 2XNAA 1EEYA 1IGTB 1TVHA 3BW9B 1QRND 4BM7A 4EOWL 5JUEL 4YEFA 4O4YH 5MI0B 1JPFB 3FRPA 3VD5A 1N0XL 4JB9H 2V2WA 2NW2B 5LGHL 2AABH 4ZD3H 4QY8A 3R06B 1WSST 4R26L 4M7JH 3BRGC 1INQA 5ETUA 5C0NC 3QIWD 1NBQA 3MLUL 5BMFH 5ALBL 1WTLA 3UTPD 5HVHC 3RBSA 1GHFL 3MV11 3C6LA 1U3JA 4OQTL 4PV8B 3RVUD 2YKLL 3A67H 2QSQA 2NY0B 3K3QA 4PJFB 5CJXA 3LEVH 3ES6B 2O5YL 3CU1A 5LKNA 4HJ0D 4N0CC 4S2SB 4NN6C 5DEZA 4LRNL 4IM8A 2J6EH 3C5ZD 3MBED 4ONFL 1CK0H 5EBWA 5I71C 3TCLB 2R23A 4G9FB 1DQQB 4V1DB 3GB7A 4WI7A 4KKBD 5C0CD 1X5GA 5HBBA 1I8MB 4Y19E 4Z7WA 4ELMA 3DRQA 2NY5H 4FS0A 4HLZH 3EJZC 3MJ9A 2IANE 4CGTA 3BZFA 1B6UA 2QHRH 2BJMH 1OP3K 1I8LC 4Y5XB 3L9RA 3MOBL 5ICZA 4NC1E 3NCJL 1E4JA 4U0RB 4NCDA 3NCFB 5K9QI 2P8LA 1SMAA 5I1AA 2BERA 2ICWA 4U6VH 1JIBA 4MJIB 1K5NB 3IGAA 2XOTA 3MX0A 4MAUH 4NO5B 4YFLF 4FZEH 1K2DB 3FMGH 2HKHH 4NC1C 5I1IL 2FX8L 4MB5A 3OAYK 4X4MA 1BIIB 4JHAL 4X6CE 4N5UA 2DM4A 2E5EA 3GDBA 4DFIA 2YC1B 3PQYA 4LMQI 8FABB 1XF2B 1MFCH 2NXZB 1Q0XL 3HUJE 1A7NL 1JNNL 2R29H 1QNZH 4F58L 4WRLA 4WVRA 1U92A 4NC2B 3DROB 2E7MA 4DZ8A 3BYYA 4LVEA 2FEEL 1A0QH 1JP5A 1BQLL 4NRYB 4G3YL 3WNKA 1H8NA 3OKKA 1BJ1H 4I18C 2NPLX 4QHUB 5HD8C 1DBBL 4MCYB 1B6DA 2DTSA 4L8BB 5CD5C 2R8SL 2O5XL 3LQAC 1UVQB 5DJ8A 1MF2L 4LIQE 5AEAA 1RURL 4JDVB 1YMMA 4KC3B 5L2KE 3S35L 3BN9C 3HMXH 1CIUA 1T3FA 1I8KA 4LLMA 1CN4A 3TBWB 2ADGA 3UBXG 1V05A 3K8MA 1A4JB 4XBGA 3MR9A 2VDRH 3DRTA 3Q6GH 5I1CL 4MD4A 1FNEA 3SOBL 2HTKD 3KPOA 3QQ9C 2NY6D 1XFPA 1U36A 4ZUTA 3PWNB 1CFVL 2G2RA 3P4OB 6FABH 4TVPD 2PW2A 2AJYH 4GBXA 4CVUA 5EG6C 2NNAB 3NCCB 2Q3ZA 3F12B 4KDTC 3IETA 1S9VA 1TQBC 1BEYL 1G7QA 4N8VB 3ARDD 3S36L 4PJXB 4C55A 1A6PA 1URLA 1YEDB 5EDXA 1GGTA 5SWSE 4N90D 3UJTL 5A2IH 4GT7A 3LKQA 4P2RB 4LPTA 4BA8A 3QRGH 3RQ3A 5D96C 1FL5A 2IH1B 2RIKA 2YD5A 3UYPA 5I8EA 5J1AB 1UZ8B 3AREB 4KTDL 4HWEH 4OUUB 2ESVA 2OBGA 3NACL 1NC2B 1NC4D 1QVOB 4WNQA 5GGRB 3VJ6A 3ZT7A 2RFXA 3DI3B 3D0VB 1OSZB 4YDVA 5I8CB 1R0AH 2DBLL 1MFDH 1N6QH 5CEZL 4LKXA 3BO8B 1KTKE 3BD5A 2LU4A 4M6ML 1UM4L 3WS3B 4FQLH 5GJTL 3L6FA 2BSTA 5JQHC 1EAPA 2DLTA 3VFNB 5E94A 5C0RL 4Z7QE 1G6VK 1ULVA 1JWMA 1HHJA 5EOCJ 4OZHA 3MV9E 3MREB 5CCKL 3RVXC 5D7SL 1A7BA 1U8HB 4BUHA 3EO1A 2KQNA 3RY6A 1WGOA 5C9KA 2DKMA 1U58B 3O6FC 2GITB 4MA3A 4GOSA 3WKMH 1J0HA 5B4MD 4MS8C 1E0OB 4K3EH 2VQUA 4PJEB 1VFMA 4ZAKB 3RWJA 3D39D 4NWTL 3NH7L 1SQ2N 4YDKL 1HCFX 3OKYA 4NQSB 3O81A 5GGTL 3VWKA 1V7MH 2HJFA 3NFSH 3THML 4BK5A 4PJ9A 2WM0A 5FKPB 3Q5TA 4PGEB 1P2CA 1J0JA 3CZFA 3H3PL 1AQDB 1I1CA 5KVDL 5IF0B 1PW3A 3VFGH 1AGEB 4QWWD 2NZIA 4P23D 5J7CC 1FJ1B 1FVEA 1K3ZA 1I7RA 4MDJB 1UWEL 4OZGE 4NRZB 1T03H 1T0MB 3KGRA 5IJVB 5SWZA 4Z7OE 1FYTD 4XC1L 4RA0C 1DVFB 3V0AC 1UZ6E 4H26B 1MI5E 2QL1A 1R5IA 4JFEA 3UEZA 3VI3E 1OW0C 3GSXA 3JUYA 1E4XL 4E41A 4F37K 1BFVH 1T0NB 4UV7H 5ENWB 4OLEA 4AG4H 3MJ7B 1ADQA 4M8VA 3UJIH 3WIHL 4QNPF 1TVDA 2CKNA 1P69B 5A16A 3SE3C 3FFCD 5FO7B 1JUFB 1S5HB 2ZSWB 4GKOA 5F7FA 2JB5L 3MLWH 4L29B 3WCYA 4K8RD 4OI9A 3BP6B 3RAJL 4X5WB 4M7ZC 1BQHB 4F2MB 1LK2A 1JRHI 2FJGB 5DJYB 4AZ8A 4DVRH 5I6XC 1VGEH 4M93B 4QRTB 5JIHA 5IK3A 2J88L 4X0KB 1YEHL 2ZPKL 4BH8B 1MJ7L 1LILA 5CP7A 2D7TH 1MJJB 1MHHA 4YXLL 1RZIB 5E8NB 4PJBB 3E6HB 3QDMA 4JLRA 1OAUL 3PJSA 4OUOA 4OGAC 4CVZB 4J4PC 4LPXA 3BPNB 1II4E 3TBSB 5E6ID 1F6AB 5FYJD 1GAFH 1T80A 3QEQB 4UIKL 2EDNA 5MENB 5E03A 5E7FA 2EIZA 1VFBB 1YNKL 1TTUA 4QHLB 2GJ6B 1HHGB 3EJJX 3QPXL 4QTHB 3KPNA 4XP4H 4ZYKA 3V5KB 3ZHLA 3P9LA 5HHVL 4YLQT 3TV3H 2DQEL 3T0EE 4X7TA 2MPAL 2HFFA 1G7IA 2YA1A 2Y4SA 3ARZA 3IXAA 3BMWA 1A21A 2F19L 1OAZL 2AKRA 3VFOB 4Q9QH 3VXMA 3AROA 4PJ5A 3TYGH 1BMGA 5FGCE 4IIQB 5FYLD 3IDXH 1Y0LA 3MODL 2AJUH 1R3IH 3GSVA 1CD8A 4O58L 3D48R 1DBAH 3MLVH 2M8XA 1EEUA 3T0EC 1WCQA 3GI9H 1ND0A 1MCPH 4HK0B 2L0DA 1GPOL 5D1QA 3HRZA 1YEKH 1XGQB 1B2WL 4OD1L 2CRMA 5D7IE 2NY4C 5GRVL 3DSFL 3KPQA 2MQ3A 5K59E 3GBLA 2XG4A 4U6YB 4HLZG 1Q0YL 1KIRA 4WW2B 1M71B 2CLVB 3WIFA 5EOQL 3FO2A 1HSAA 1MJ8H 1S7QA 1CTNA 1MWAA 4A6YH 1KSRA 2DYPB 3MTRA 1RUQL 3LKRA 1T89A 1YECL 2EDOA 1Q1JH 4Y16B 1IT9L 4J3WA 4O51B 1UFUA 3DWTA 2YRZA 3ARPA 3QBTB 3MACH 4JO3L 1A4KB 4PBWD 3RUGA 1FE8L 4GQ9H 4NRXA 1OT2A 4S1DC 1C12A 2R9HD 4L4VB 1T20A 5JORB 2XWBB 3O2WH 2DM3A 5DHXB 1VERA 3LHPH 1BFTA 2LTQB 4DN3H 4KK5C 1F3RB 3GM0A 5D2LB 3MCKA 4JPKL 1VGKB 5DJCB 1CGUA 2BNQE 3D2UB 3KXFD 1FC1A 3HI1A 4EN3C 1S78D 2VABB 3QXUA 3VXNB 3HC0A 1ZT7B 5C08A 4TSCH 4EXKA 2Z4QA 5C07A 2D7PA 3MFFA 2WWMC 4QXUL 3VGAC 5IB4A 2GTWB 3CC5B 5D5MF 3MRBB 3K46A 4JREB 5DRXA 2DQCH 1TZGL 2JK5A 1J0ZA 1AXSA 1DEEA 1MJUH 4RFEA 1NFDB 3DX7A 3EJYD 4I0PC 4EQ3A 5IW6A 1OHQA 3OJVC 4YUEH 4FQ2H 3D85A 4OCSH 4HZLA 4ZO7A 1N5YH 1H3GA 5BQ7B 1MEXH 4JFOA 3S98A 4Z0XA 5GS1A 5C8JA 4GG6E 1UCBH 2VDLH 1P7HL 2AJXL 5DZLA 3MROB 4P3CH 5FHAL 3RA7H 5INCA 1P4BH 1IFHL 1CU4H 2CUMA 1KV3A 1SJHA 1BAFH 4YQXL 2IH3A 1ZAGA 1IAKA 1HQRA 1IGJB 5JW5B 4I4WA 1S7XB 3P4NA 5CJBA 3PV7A 4WDIA 2ZCHL 5KSAD 4NQDE 2AXFA 1ZLUH 3ABZA 3AFLA 2X42A 1AHWB 1P7KA 4MSWA 5DT1L 3VXQB 2GYSA 3NIFF 1YYML 3NFPA 5F3BB 5BRZB 1S7UA 1FFQA 1MHEB 4D9LL 2EC9T 4MZ3A 5KOMC 3ECBB 1Z0MA 5CSZA 2QQQA 1NAMA 3LD8C 1RUAL 2UYLB 2E8YA 2VL5B 1C08A 4Y4HC 4JPWH 3AS2A 1ZLWK 3LAFA 2ZOLB 5GHWH 3O4OC 1QBLL 5C0EA 4OF0A 3L5XL 4MVBD 3O45A 1TCRA 1I9EA 3KDMA 3BDXA 4FTVD 1MRFL 3ZKMC 4MA8H 2CGRH 3MNZA 2CRYA 1YQ2A 4XCNB 3MBEB 2Z92B 3QUXD 5J3HC 1KYOJ 1WLHA 1L0QA 2ZCLL 3L5WB 4HUNB 3SHSA 5E5MA 3CNKA 3TVMC 5LGKA 3C08L 4XPHH 4BELD 2F8XC 2RAMA 2I07B 3PP3H 4ELKA 2EXWD 1S3KL 1OAKL 2DDQL 1VFUA 4M03A 4YNYB 5GZOC 4Y8DC 3TN0C 1A7QH 1TJHH 1N5AB 1TETL 4NM8L 2NXYB 3FB7B 5FM4A 3QFJD 2Q7YA 2WBJD 4FHBD 2CIKA 3SDDA 4AT6A 1CXLA 5F7YC 4YBHA 5BVJB 1AJ7H 4ZDHA 4K71C 2NTSP 2E9IA 4ODVL 1AGFA 4PP2B 1B88A 2K3TA 5ITBL 3FQXA 1G7HA 1P84J 2XTLA 5D1XC 5IHLB 1K4DA 3K1DA 3BGMA 1QA9A 3Q5OA 4OQTA 1AO7E 4CMMA 4I9WE 2D31B 1JYXA 2B0SH 3L3IB 4JFDE 3BRFA 1I3GH 3EYQD 3C5SA 5D7LB 3T04D 3M17A 2IPTL 3G6AB 1NDMA 4QCIB 1M6OB 1DBJH 2VH5H 4HEPG 3LZFL 3O4LE 1T04A 5DK0A 1A5FL 4Q9BA 3W0WD 1WV7T 3QUKA 2JTDA 4H1LB 4OI7A 3ULUL 4P4KD 4FQXC 3DBXB 3C60C 3D3VE 4XP5L 5C0DA 4Q2ZA 3U1SL 4C56D 4OKVA 4L3CA 3RGVC 1A1MA 2ILLA 3AAZA 4JN2B 1E4KC 3BKMH 2VXVH 3C5JB 1TITA 5E2UH 3A6OA 5ICYA 1FFNB 2MFNA 2R15A 5ABDE 1NQBA 5EZJA 4R9HA 3EYOA 3R4DA 1KJ2B 1KN4L 4NKOB 1S5IH 2EE3A 3PXHA 3AXLA 4XNUL 3MJ6A 5MEOA 2W38A 4BSWA 4DGVL 1NBYA 2IALB 4LK4A 4Y5YA 3Q2CA 5IKCB 2A1WL 2ZJSL 3MCLL 1CI5A 4OZIB 2X9XA 3GMRB 4R96B 4K07A 4JO4L 4DGYL 3WFCH 5IHUH 2EH8H 5KSBB 1XGPA 4LAQL 1CLZL 4PJDB 2XYCA 1MCWW 3G5XA 1J18A 5D8JH 2XXCB 2GTZA 2Y23A 1B0RB 1G9NC 5FYKU 1J8HD 4WJ5B 1MNUH 3ULSB 4Z95H 5HHNA 4Q58C 3MUZ1 4PRHA 4G42A 4JVUA 3B6SA 4S1QH 4S1SH 2CJUH 4Z7UF 4K7PY 4MAYC 2Y06L 4NQED 1U8KA 4NN7C 1YNTA 4JFFA 4OF3A 4RGND 1EJ6A 2OL3H 4YWGL 1D5ZA 3WJJA 3JVGA 5JXED 1PEWA 2VC2L 4NN5C 4KROD 3I6KB 5K9KA 5DYOB 5CLTA 1NC4B 2OQJB 4ZUSA 3O0RL 3IXTA 1CR9L 3VDAA 4BFEA 3T77A 5CSBA 3BVNB 3TESA 2R1YA 1MUJB 1NBZB 2VXQH 4U1KA 3ROLA 2F54E 5FIEA 3P30L 4X9HA 5CJQL 2XACC 4QRPB 1FFOA 4LQ1A 3BDYH 3T1FB 2JELH 3BH9A 5I74C 3M1BB 4UQ2B 5E2TH 3E3QE 2XA3A 3BD3A 4TVPH 1HQ4B 3TJHD 5H35A 3FN0H 4IRZL 1I1AC 4PJAA 4X99A 4QHMB 3TIDB 1QQDA 3OSKA 3U2SA 1GGYA 1KPRA 1JWSB 4GW5B 5EUOA 2JCCA 3D6GA 4AH2B 4URTB 3E3QC 4XVTL 5AWNH 4WWKC 4NZTL 5SX4I 1BWMA 4FMKA 5EBLB 4L3ED 1U8QA 3GMMA 3D39B 4GRWE 4EDWL 3TO4D 1I3RA 5D9SA 3PDDA 1A7RL 1TZHA 5CINL 3WEXA 4NP4H 3PGCB 5CFHA 5GGVY 2OX5A 5IT2L 5DUMH 5TE4H 3MRRA 4F33B 2VZUA 1IBGH 2BNRD 3PWPE 1A6ZA 1DL7H 2Z31C 3X3FH 2BVOB 4XPFL 5GRUH 3SDAD 4P23B 4KUZL 1CVSC 5FKAB 1AI1H 1I7UA 1FQ9C 3BN3B 2BDNH 4OLUL 2FSEB 4UOW1 5H94B 1JHTB 4HFUH 3V95A 2VDPH 1MPAL 3LKPA 4GXUN 4H25A 3Q1SH 4GO6B 4W6XB 1YEIH 5I1HL 4KI5E 4JG1L 4KJQC 4NNPL 4RQQB 1FYTB 1JGDB 2HWZL 1X5HA 3OXSB 4G6AC 3MRFB 2VXSH 1FVDB 1BGXH 2NY1B 5L7XH 4XCEB 3ZDYE 1U3YA 5FV1L 4NKMB 1S8DA 5I66B 3P73B 4HQQL 1IAIL 3G9AB 1KIUA 2Y07H 3PHOB 4KI5C 5KZCD 3ULVD 2DTMH 4XTRC 5IVXA 3HE6A 2FL5A 3RGHA 3CFJB 3UTSA 4CVXB 1RIHH 2X1PA 5GGTA 2CDEA 1WQVT 4LCYA 3T2PA 1P4LA 3MV7A 4GXUM 1ZT4A 4U7MA 1MY7A 2AJSL 5JHLH 3PGFL 4DJMA 5C09A 3R1GH 4PJHE 1U8JB 2AK1H 1MCDA 5FA4A 1BD2A 2AJZA 3ARGC 4FXGB 1MAML 2A73A 1R5WB 2W60B 3LDBB 5IFHL 4YX2L 4JZOA 4WI3A 1CE1L 2X70A 4QYOB 4LPYA 4OI8A 1PG7W 2AEPL 4LF3B 1RU9H 2A83A 1G6RB 4HXAL 4I3RH 1ZA6B 2H2PD 5LG1A 3AS1A 3FT2B 1ZS8B 4Y4KC 2N56A 3QHZH 1GGBH 1Z9SA 1J9CT 2Q86A 5LBSL 1RIUL 5E6ZA 4Y2DA 1KPUA 4AM0A 2I9TB 2EO1A 4PRIE 4M6NL 4Y5VC 1AY1H 5DD3H 2X89D 2KZ1B 1FNSH 4G6KH 1GGIH 5T3XD 5IM7B 4ZPVA 4K8RH 4X8JB 4KPHH 5AUMA 3P4MA 4PRAA 2BOBA 3QQ3A 4NIKB 3RWHB 3WIHA 3QA3B 2A77L 4LBEB 4U1JA 4OGYH 4TUKH 3S8WA 4MB4A 1PBYA 5JOFA 1H0DB 1WIOA 4ZXBD 3IFLL 4HHAA 3MA9H 3GHBL 3F7YA 4Z78A 3MV8D 4CW1B 3D69A 2O5ZH 4GUPA 3S6CA 1JGVH 4LFHD 4OLXL 3VWJD 1CLOL 4M5ZL 4HS3B 3WD5H 1KCUL 1PY4A 2C1OB 3BIAX 5FYJH 1XF3A 1H8SA 1OCWL 1IC4L 4HH9B 5FGRA 4OQ1A 4HX1A 2AI0L 1XGTA 2R1XB 4KK8C 2BVTA 2YD1A 1FRGL 1JNJA 3IRZA 1IQDA 3AM8A 1AP2B 2CMRL 5KS9B 1DQML 2Y7QA 2X1WL 3DIFB 4B7IA 5C2BL 3FO9A 2OSLB 2Y25A 3SJVE 2OJEA 1OAQL 3BSZL 4HUUA 3FZUD 4QRSB 5HI5C 2E7HA 4NBXB 5KVFH 3OJDB 3QIBD 5DS8A 4TNWF 3V6OE 3JV6A 3MRHB 2XWJA 3QDGB 5HY9A 4OSUL 3HC4L 4HMEA 5EC1A 5L9DH 2R2HB 4PGBB 25C8H 2YSSB 5FYLH 2B4CL 4R4FH 5EPMB 1RUPH 3CPLA 2IPUK 1LE9A 2SEBB 3CX5K 4NZUL 1WTGT 3SE8H 1KN2H 4NNXA 1I1YB 2HFTA 2VXUH 1SEQL 1FBIL 3NCYS 3RDTD 4DGIL 2EZ0D 4F7PB 3V6OC 3ZE0E 4LLAA 4Q0XH 4ZPTA 2C3WA 5CMAA 3HCVA 4PV9B 2APBA 5E8PB 4WV1A 3RTQD 3G9VA 3GMLB 4WU7B 4YGVA 5HHXL 3CVIH 3KR3L 3UO1H 4NJAH 2D7NA 5B38A 3O6FA 3OAZH 1SMOA 3RWCB 2W65A 4ODHL 2FD6H 2F53A 4Z7VE 1S7RA 3U7YL 4YHPA 4TNVK 1LO3L 3DX9A 5DGQA 2ZOKA 3G5YA 5GIRB 4Y1AD 3P11L 2XTJE 3CH1B 2X1OA 4HUXB 3B2UD 4P48A 2VMFA 4R4NC 1MFBH 4YHOL 5DDHB 1P1ZA 1EGJL 2EKSB 4JRYB 3BWAB 2H3NA 1BF2A 4H0GA 5J6GB 1QR1B 4N8CL 1WAAE 5F7DB 2AK4D 4WCYL 2Z91A 1A3QA 4R2GC 3P77B 2AV7A 4N9GB 3CVHL 5FUZL 2XTJC 1WT5C 2P8PA 4PY7B 3EFFA 1IKNC 5KSAB 3MO1A 4LEXH 3IFOB 1UQSB 1T1XB 1DTUA 3K81A 3QHTC 4G8EA 4UUJB 1I4FA 4U1MB 5CKGA 1EFQA 4QOKE 4PGDB 3EDJA 3BRDA 1VPOL 3LY6A 5CJOH 3G6JA 3DSNA 2EO9A 1FNFA 1OL0A 4R0LB 3SDCA 2WUBL 1LO4H 1DEDA 5L6YL 3UTQB 1IAIM 1WZLA 4NNYB 4TTGA 1SY6L 3WN5B 3KPLA 1IM9A 4G8GD 4JR9L 2FEDC 1D9KC 3WXVL 3DX6A 4Y4FD 3OHXA 3HG1A 3HZVA 2NX5A 4HDIB 5MI0C 4XZUB 4XAKE 4X5XA 2R4RH 4RAUB 3KYKH 4PJFE 4AK1A 1A9EB 1FC2D 4HWNA 4OGXL 4M61A 4XMKL 5C6TL 5F88A 3BQUD 4HMCA 4HWBL 2VLME 5CZVH 4WI2A 5L88H 4ZUUB 5GS3A 1NCAL 3G6DL 3O2VL 3CXHK 4G9FE 1UYWH 4V1DE 5T1KD 2WINA 1F58L 1RFDL 4R97B 4XWOC 5L8KB 2XI9A 4KXZH 3VFPA 3VCLB 3EYSL 1UKTA 3H42L 4J4PA 3QUYB 5DJZA 2DOCA 1AGDB 3BESR 2P8MB 4UTBL 1UJ3A 4YDJB 1MHPL 3QISA 5ADOH 3DHMA 2HG5B 3ARWA 3H7LA 3QDAA 3T2NL 5I18H 1I7TA 2WBJB 4OIIL 1J1PL 2X4RB 4EI5A 4J1UA 4JAMA 1NMAL 5CWSB 4JM2F 2ATKB 2P5ED 4NZRH 5EA0L 5KVEL 5J11B 3AY4C 3MRCA 1CICD 5JW3H 1T4KA 4LLDA 3KS0H 4MJIE 4PRNB 4XXDA 2GFBB 1KC5L 4JRXB 5DVNA 3VRLF 4KKLD 4PJ7B 3VG0L 5DRZA 2IMMA 1GYAA 3OX8A 1OAYL 4Y5XC 5T1DL 4TSBH 5K9JL 1NBVH 1SJEA 4JQVC 4O2CB 4U0RC 3W9DA 2EC9U 4XB8A 3T0BA 3BPLB 4HKZB 3GKWL 1P9MC 4YFEA 1MCIA 5IFAL 4HKXA 4PGJA 4KZDH 1OP5K 4C56B 2PO6D 4YHYB 5D7JD 1OTSC 3VFSB 1JPGA 4OJFL 5DI8B 2EEAA 4HMDA 5IOPA 1EIBA 5GRJH 1FHGA 1SM3L 3G04A 2AS5M 2MWCA 2FJFB 4PJGB 2A9ML 4XWGH 1ONQB 3FAWA 2ICEB 1MFAL 1TZIB 5JMRA 5ANMA 5ESVA 3WLWD 5FGBA 3CSYA 5C1MB 5MEPA 3WYRA 2N4IA 4M3KB 3IU4H 3QXAB 3G5VB 4D8PB 4GH7B 1W72B 4KZEL 5JIIA 4POYA 1CDUA 1LP9F 3TBVB 4M4PA 5I1DA 2OTWA 3MRLA 4L8DA 4JO2H 3S96B 2XA8L 3OKEB 5DR5H 1J8HB 4O4YL 3ZTJH 3NIDF 5J6HB 3G5ZB 4OCRH 4JB9L 3DMMB 2AABL 4ZD3L 4M7JL 1MCLA 3TZVD 3QFDB 4NPYB 2VZSA 4MLIA 4NQEB 5BMFL 1N8ZA 4EN3A 4IRSA 3KNBB 4PJXE 3A67L 2WIIA 4UI2A 4P2RE 4V2CB 3LEVL 4KROB 1RY7B 2X4UA 5C0JA 2YA2A 5EZLA 5HHOD 5DJ6A 3L3HB 2J6EL 4CJ1A 5LWYH 2JE8A 1QBBA 1CK0L 1BOYA 2EDYA 3EDFA 4TRPH 2YPLB 3KLHD 4PY8I 5I2IB 3HMWH 2NQCA 4PJCF 3VD3A 5CIPB 4JHZA 2ED9A 2FATH 3PWUB 4HF5H 2ARJA 4PRDB 4I3SH 1YPZA 5HYJA 3AREC 3QNXA 2NY5L 2X05A 3CMGA 2R69H 3OGCB 1MVUB 3PDOA 5B22A 5E2VH 4XVUC 4P9HC 3WBDA 3ARFB 2QHRL 2BJML 2OMBA 3BEVB 1U8MA 1F3DH 3BHBA 5AD0A 1YC7A 2CLZB 3FQNA 1R5VA 1VADA 1AD0B 3F62A 5GRZA 1LWRA 1J12A 3GGWB 4U6VL 4RMTA 2VLJA 1U3HD 2QADD 2EDHA 2PR4H 4WHTB 2ZCKH 4IOIB 4MAUL 2CRZA 4FZEL 4L3EB 3FMGL 2HKHL 4PUBH 4PJEE 1U93A 3HE7A 3TO4B 1XZ0A 1S9XB 1PZ5B 2EYSB 4ODSH 4X7DC 3R8QA 4M02A 1JHLH 1MFCL 3AS0A 3FOLA 2R29L 4WUUA 1QNZL 3C09B 1C5BH 2XPGB 5JO5A 4ZAKC 2OCFD 1FORH 2AV1B 4LSRH 2IAND 4OLWH 1A0QL 2Z93B 5HGAA 3WNPA 1F11A 2XKSA 5E00B 2WUCH 1I75A 2WV3A 4Z76B 1G7JA 5DJDB 1G84A 1ZHLA 5I8KH 5TPWH 3BXNB 1TVBB 1UB5B 3PIQA 4LVOB 4MQ7A 1QSVA 5DTFB 5TDPB 35C8H 2R0WH 4H88H 3OKDB 5CUSH 3HMXL 2VQ1A 3I02A 4NKDB 2QR0B 4HUVA 4PJIF 4WU5A 4ODXB 1OAXH 3ORJA 3TN0A 5EORH 3WUWG 1N6VA 5B39B 3GUTB 3CCHB 1QZ1A 3UPAA 1EV2E 1A3RH 5TE7H 2VDRL 3Q6GL 5D2NA 1DVFC 2QEJA 4ZSOB 2A74A 3RY5A 3VXRA 5HDOA 5EU3A 6FABL 3OG6B 1H3TA 2AJYL 1XIWB 1X5YA 5IB5B 5B3JF 5HTSA 4UDUA 2P46B 4PR5A 5GISH 4RX4A 3BN9D 3O3EB 3TEUA 5EB9A 4LLVB 4PJ8B 3QRGL 2WNGA 4TUOA 4CKVX 1F5WA 1FZOB 4HWEL 4WTXA 1IC7H 5FV2A 4PJBE 4MJ6A 1U8IA 4M93C 4W4NA 4ODBD 1LEGA 3UTZB 5EFIA 3RNQA 4L4TB 4CRPA 4LHJB 4RFNC 2F74B 4X6EB 1KIPB 5JIPA 2NY2D 1FZKA 1R0AL 1N6QL 3QEQE 1YN7B 4APQB 1QSEB 3ULVH 1JTTA 1CTOA 5JW4N 1FO0H 4NQCD 5MENE 1IILE 4FQLL 2MHAB 1Q9WA 3L7EB 4DKDC 4GQPH 2GJ6E 2A0LC 5I1EH 2BMKA 5BXFA 5JPNA 4X4ZA 3OKMA 4WW1B 4QKXB 5IP4A 3MUHL 5F1IA 4IDLA 3IKCB 1NEZB 5LAXA 4XPBH 1EH9A 2IBGA 3N1FC 4ZXBB 3QXDA 5B8CB 1IAOA 2OS7A 5DA0B 1MCCA 1KBGH 2VLRA 2XIDA 3WKML 3UX9B 3DLQR 3VWJB 3IB4A 2BZDA 4K3EL 4XBPA 4P5TB 5JW4M 2VAJA 1CFNB 3DUUA 5TH2B 5BS0A 1T21A 2HRPH 1NLDH 2C7UA 1K4CB 4GW4B 4U3HA 2FIKB 4FZ8H 4R7NB 5HHPB 5TDNB 3NFSL 3RVXD 4ENEC 5GSVA 3BH8B 4ZS6C 4GW1A 4P2CG 3SCMB 4K9EC 3UYRH 5GGUA 3OBAA 1K8IA 1ZSDA