3QUMH

Crystal structure of human prostate specific antigen (psa) in fab sandwich with a high affinity and a pca selective antibody
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
217
structure length
217
Chain Sequence
QVQLQQSGPELVKPGASVKISCKVSGYAISSSWMNWVKQRPGQGLEWIGRIYPGDGDTKYNGKFKDKATLTVDKSSSTAYMQLSSLTSVDSAVYFCARDGYRYYFDYWGQGTSVTVSSAKTTAPPVYPLAPVCGDTTGSSVTLGCLVKGYFPESVTLLWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostate-specific antigen
publication title Crystal structure of human prostate-specific antigen in a sandwich antibody complex.
pubmed doi rcsb
molecule tags Immune system
total genus 33
structure length 217
sequence length 217
chains with identical sequence K
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qumH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qumH02
4BFIB 4OCXH 4X6FA 3K80A 5DUML 3OR7B 4R0LB 1DQJB 4LVEA 1PDKA 4KDWA 2ADFL 4BUGA 1ORQA 2F19L 4WUKL 3T0DA 3BO8B 3TNNA 4Z7WF 5MEOA 1A7NL 3ULVD 3PWVB 2VXSL 1OB1A 4P5TB 4JFEA 4POYA 3BAEH 1RK0A 3KAAA 3WLBA 2A6JA 1ZTXL 3WDHA 2GTZB 4R8WL 2EYSB 4U3CA 4ZUWA 5HHMD 3PWLA 3WEXA 5KVGH 3AFLA 4OD3H 3T0EB 1HN1A 1JN6B 1XF2A 1SJHA 5CMAB 2X4UA 4JO3L 1ZAGA 4JM4H 4LF3A 1W72L 3KPMA 3LQAC 4OSUH 4WO4D 5EZJB 1U3HB 3I9GL 5DS8A 4DZBB 2XFXA 3H0TA 4ZYKA 1PX3A 1RJZA 5I8CB 4PJCB 3ZTNH 3JZ7A 4EBQL 3T0ED 3T0AA 2NY2D 1IKFL 2P8LB 4OCYH 4Y16B 5SWZD 3G04A 3KPTA 4PPTA 4U1KB 3LRHA 5EA0L 4F57L 2MHAA 4LPXA 1L6XA 3TH2T 5T1MA 1URLA 5EOTA 3QZWG 2ATKB 1BVLB 1EZVX 2F8OA 1KF9B 4V1DA 2VLKA 2CLVA 3WFEH 5D6DA 3TA3B 3IS1X 4ZNCD 3SDAC 5E6IB 5A2JH 3VFWA 3AREB 4HWBL 4R4FL 5FO8B 3QT2A 5ISZE 1QZ1A 3ILQC 1KCRL 4MA1B 1LQSR 2X4OB 4RWYL 5DZLA 1WFTA 4PRDA 2GFBB 4BH8A 4AQOA 4UZGA 5HI4C 1ZHKA 1ZEAL 4DUVA 4Y4FD 1KFAL 3MR9A 4FQLL 2DQIL 1JF1A 5LVEA 2YD2A 1XGYL 5KAQG 1AI1H 2ENSA 4W81A 1YEHH 2ICWI 4QXGL 5IG7B 4K94L 1QPPA 5TF0A 3QIWD 4L8DA 2ICWB 1UWGH 4LCCC 5ALCL 4YHZH 5TDNB 3MXVL 4C56D 4K3JL 5KZCD 5D1QD 2OR9L 2XIDA 4H8WC 3ARRA 3IFPA 3SCMB 3MLRH 3UYPA 4AT6A 3LD8C 4PJBA 2IAMD 5C0CE 1IEAB 5IHZB 1I1AA 3D39D 1NCBL 2DKSA 2H2SD 1KCSL 5D2NA 3WO4C 4KUCD 1RU9H 3QEQE 1A4KB 3FQWA 1TMCB 2MQ0A 1MUJB 1U8KB 1AGEA 1P7KA 1Y0LA 1YYLL 2D7TH 1IRAY 3LEYH 4NCC1 2WQRA 1S5HA 2M26A 3MOQA 1K4DB 5DT1L 5I1DA 3L3IB 5BZDB 3TT3H 4U1NA 5K9JL 1F11A 4HFUL 2PCPB 3O45A 4IMKC 4OKDA 2GTWB 4N0YL 2F5BH 2DM2A 3S98A 1KJ2H 5CGYD 4L29B 3AM8A 5DHYB 1YPZA 3D3VA 2Z4QA 5IT2H 3QWRA 5HD8C 4RAUA 1VHPA 2H26B 2OL3H 4NHCH 1OLLA 2BXZA 4ODHL 2NNAA 3KPPA 3ETBF 1VESA 4OJFL 5F44A 2BVUA 1HSAB 3QUZD 3H42H 2VC2L 2BC4B 1Z0NA 2P8PA 4X5WB 5JPMA 1P7HL 1KCKA 3X3FL 3HR5B 4LSUL 2WBJA 5AZ2H 3B9DA 3IXTA 2ZJSH 4HIXH 1N0XL 3L5JA 5IFAH 2A6IA 4QWWD 2V17L 3QDAA 1KT2A 1F2QA 4ERSH 1Y18A 4LSPL 1Y6MR 2ITCB 3DGCR 3HI6L 3MROB 3SDXA 3WUWG 5HPMB 5DHXB 3BI9X 5H2BB 5FF6B 1G0XA 4GG8A 1XT5A 1WTLA 4P2RA 3A6OA 3D6GA 4A6YL 5DJ6A 5GSRB 3GMQA 3GBMH 4WU5A 3CFDA 2VLRE 4XPGL 5CP7B 5KSBF 1UZ8A 4ZFOL 1AR1C 4LCUB 2ZUQB 1WC7A 2OXHA 3IXAB 1PKQE 3P2TA 1H3PH 3HE7D 2WINB 1KENL 3OKEB 4LRIC 5DD3L 2OR8A 2PW1A 3PP3H 1P7QB 4C57C 3IS0X 5JMOC 2LU7A 4LNRA 5FGCE 2DIJA 4AM0A 3F6LA 3E3QC 5ITFB 1FNSL 3EGSB 2EDBA 3OKLA 5C8JA 1G7MA 4GOSA 2DQGH 4L4VB 3VCLA 3OXRA 2QV2A 5D1ZC 4YBLC 4CVWA 1UC6A 5IBTL 3OAUL 1EXUB 3IDUA 2IH3A 1OP5H 5B38A 4PP1C 1ZVSB 2F5AH 2WNGA 3TCLA 4X5XA 1C5DB 5GGQH 3V6FB 2OCFD 12E8L 4JDZB 5DJXB 5I1IH 4P9HH 1EHXA 1EFXA 3L3HA 4FQCL 3QNZB 2DBLH 4PS4H 5EBLB 1NL0L 4JFFE 1T83A 1CLOL 4Y5XA 2P49B 3CC5B 3UPAA 4NZRL 1BIHA 2IBBA 4K94C 5HGDA 4QXTB 4UB0L 2CR6A 2GI7A 5FB8A 4QOKE 3B2VH 3HZMB 4XAWL 5GRVK 1P9MC 2YR3A 5EPMB 1AY1L 1BBDL 1G7LB 4HG4J 1KJ2B 5I1CL 3N0PB 3E3QE 5KSUB 4Y8AA 3HI1B 2FEEI 4HDIB 2HRLA 5E2VH 1NGQL 1CDUA 2AI0H 4KRPB 3UXFA 5EORL 4YBQC 1NBYB 5J12B 1WJ3A 1M7IA 3LH2L 4J1UB 5JDSB 3FT2B 3JV4B 4RSVA 3VXSE 3Q6FA 3LIZH 1WBXA 1ZT4B 5DRZB 1J1XL 2Z8VC 1ITBB 3FQTA 4JN1L 4WWKD 3CXHJ 4K23L 1TCMA 1QRNA 4RFNB 4HIIB 3QI9A 4M7JL 4NYLA 4L4JA 5HPOA 2VDMH 4ZMAT 5EC1A 4G8GA 4YXHL 3EAKA 1C16B 2ZCLH 1U36A 1V7MH 4U7SA 1K9TA 3DROB 2GIYA 5C86A 4CMHB 4KRLB 2EDXA 2ATPB 4ODWB 1K2DA 1N59A 5DWUL 2NY0B 5C08B 5EZIH 5L9DH 1O7SA 5EO1B 4ODBD 1SEQH 1HHGA 2ICES 2PTTB 1BJ1H 5EOQL 2XKNB 3JUYA 1E4WL 1UEMA 2ZP0T 3RVVD 4O9HH 3MREA 2J1KA 4J4PD 1CDBA 2CDEA 2EDLA 5TH2B 4MHHG 5T1LD 3BQUD 3PABB 1FNEB 1PY4A 4HULB 3O4LA 3MLTB 3DX7B 1DBAH 3LMJL 4G42A 3TO4A 4UTBH 3VGHA 5HHPB 3VD5A 3O3AA 2E3VA 2I25N 3QPXH 2O61B 1D5MA 1N8ZA 4JZJA 3U7AA 1CXHA 3QXTA 4ODXB 5FEBA 2UV3A 5DEZA 1AQKH 3C09B 4G6JH 5IB5B 4OFIA 4GW5B 4PJ8C 2B2XL 3QISA 4XVUD 2GK0A 4DVBB 5J11B 2BSRB 3BIKA 4CGTA 3FQXB 1BIIA 2YUZA 1I3RB 1HNFA 1NLBH 1HILB 1KB5H 3KPSB 3VGGA 3UZQA 1VA9A 3SDCC 5CCKL 1OTTC 2LQRA 2ESVB 1LO5B 4YXKH 4GAGL 3KXFB 1WFOA 3PQYD 1NLDL 4PJEF 2GW5A 1BJMA 4MXWL 1X5GA 1JNHB 1UB6A 1FVCB 1HIML 4IRJA 1JGLH 4PD4K 4PGCA 1T21A 1A1MB 4PREB 3QO0A 1D5ZB 2AJVL 5IUSA 4JAMB 3AGVA 3TWCH 3LEVL 1VFMA 3CCHA 4TNWK 3KXFD 4JJ5A 5DD0L 4RZCA 4HCRH 1TZGL 4NO0A 3DXAE 3FRPG 2AXFA 4TUJB 1RIVH 4M43H 4K7PY 3BDYH 5GGTL 2VLJD 1JPTH 1NCWL 1N3NB 2VOTA 4PRHB 3CPLB 1GGUA 1HH6A 4XZUB 1E28B 3RPIB 2RBLA 5E2JA 3VDBA 3LV3A 4Y19B 4E0RA 3UYRL 3MV8B 4KQ4H 2VR4A 4XMLH 4AENA 4MNQD 5DK0B 1YC7A 2VMFA 2OXGA 1C7TA 2ADGA 4LK4A 5D7LE 1JGDA 3BEVB 3T77B 4XNQA 2LTQC 4GRWH 3PWPA 1I8LC 3QCTL 4GG6E 5BOZG 5A3ID 4WW2C 5JXEA 2AJSH 4DAGL 2R0WL 3TNMA 3MRIA 3HAEG 3OKNB 3BDBA 4E5XA 2EO1A 2D0HA 1F13A 1U3YA 1A21A 3BH9B 4KTEH 4HV8B 1DFBH 1RHHA 5A40E 2YRPA 2OZ4H 3RY4A 4HBCL 1QSED 1EGJA 3TT1L 3D1MC 5BO1H 1CICC 2APVA 2R0KL 5KOMC 2NY5H 4PJXB 4TSCH 3IDYC 2FX8H 2P5EA 4R2GC 3OHXB 2B39A 1RZ8A 2VDPH 3PXHA 1CF8H 4L3EE 4JZOB 2VLLB 4M9OA 2J8UA 4Y1AD 2MOVA 5A2KH 4PJGA 2V2TA 4TULL 4YGVA 1HINL 3HFMH 5CEXA 4G8IB 1MLCA 2DOCA 3H9HB 1IARB 2M8XA 3H8NA 4ODTH 5D7IE 4DKEH 1NGZB 2BNQD 1B90A 2DTMH 4KDTC 2CMRL 4NZUL 1RJCA 1SBSH 5KVEL 4OFYD 4X6BA 1I1FB 3S35X 3HNTH 5GGVL 4H5SB 1F3DH 2R4SH 2EYTA 3T2NL 2GY7B 5BJTB 3QDJB 3HZYB 5IROA 5I0ZA 4OGAC 2YZ8A 5GRJL 1FGNL 5KTEH 2VH5L 2Q6WA 4X8XA 4NRYB 5KSAD 4QGYA 1T5XA 1KB5B 4FA8A 1IAIM 2X42A 3RVUC 1JPSH 3DRTB 1NFDA 4NZTL 3ZSTA 5IB3A 3FMGH 1GGBL 4AEEA 3FT4B 5T5NG 3TBTA 3QDJD 5KW9L 5CFHA 1J7VR 1I8IA 3VG0L 4ZXBA 4R7DB 1K8IA 2NY7H 1FYHB 3QUMA 1CVRA 2ZCKH 4JPIA 2W1NA 3WE6A 3AAZA 5DRXA 5F9JA 3LZFL 1DBJH 1VKXA 1CFVH 1KXVC 3GSWA 4LAQH 4ODVH 5J6HB 2HJKB 5C6WH 1F4XH 5F9WC 2JKXA 1ACYH 4NUGH 5E24E 1RMFL 4IIQA 2EC9T 3KHQA 3PV7A 1EBAA 4G8EB 4U6XA 3W39B 3WD5L 2MJWA 5TDPB 1UH3A 5SV4A 1T5WB 3MACL 5L2JA 4HX1A 4XP1L 3LN5A 2X2YA 3MODL 1VADA 5SWQA 3QDMB 1S7QB 3U46A 1MCKA 1MCRA 5DJ0B 5CS7A 4KI5F 3CU1A 1OAKL 4QRPB 1G9ML 3HRZB 4P48A 1E4XI 2AAVA 1JZ7A 2D03H 4IRSA 4MSWB 1RK1B 5ACZA 3L1OL 5INCB 2A6DB 1RZIA 2JJSA 3H7BB 1J86A 4OZGF 3QDMD 2BJML 4JRXB 2E5EA 1ZKAA 2CIIA 4KU1A 5INDB 3FFCE 3CFCL 4PRPE 3PGCA 4ZOAA 5DMGC 5FO7B 4AQ1B 5HHXH 4MQ7B 3VG9B 3P4OA 4LLUB 1WSST 3FQNB 1IGML 2XZQL 5KSVB 4NQSA 3BP7B 3QXDB 1DUZA 3MXWH 4P46B 2OP4H 3LEXA 4NPYB 2WK2A 4I3SH 2XT1B 3ZL4L 1M7DB 1BEYH 2X4QB 2YPLD 1QHOA 2E9WA 1AXTH 1OTSD 4S2SA 4LQFL 5KN5B 3U30C 1XGRB 5T1KB 4RX4A 4DZ8B 2DQUL 2Q3AA 4JG1H 2VDRL 1MAMH 5F3HB 1ZLUH 4PJDB 4EOWH 3VW3L 2PW2A 4RFOH 4BJLA 1AO7B 2ERJB 5DDHB 2OI9B 3WFBL 3HMXH 1KLFA 2CUIA 4LRNL 5T1KD 4U1SB 1QBLH 3DRQA 2NY1B 4R6UA 3PDOB 2Z35A 5I8EB 2QSQA 1NCAH 2CKBH 2K3TA 3HG1B 4LFHG 1AO7D 1V05A 3RWCB 1AGCB 3IDNA 4NDMA 4FQIH 4P5KA 3U0PB 2BVPA 4G7YL 5F89A 3L3JA 3LSOA 4PRBB 4DW2H 1U58A 2NY1D 1S9VA 2W0FA 4P5MA 4R90L 3MUGA 3G08B 4RISH 1KC5L 3ALXA 1KIQB 4JHZA 4NHUB 3D0VB 1FFPA 3ROOB 2H8PA 3HG1D 3HUJF 2FGZA 4GSDL 3ARWA 1MPAL 2JCCA 3ZSSA 4B53A 2VXUH 3VRJB 5D6DC 2EEBA 4JFEE 4JM2D 4F2MB 1AGBA 4GUPA 5LGHH 2ZSWB 5EBWB 1U8IA 2YPKA 5BVPH 5L2KB 3MNVB 1KNOA 4Y2DC 1A47A 4OZHB 3V0AC 2CDGA 1Q94B 2HT2C 1IZJA 2B4CL 3BPLC 5B38G 2YC1B 1P4IH 4OD2A 4D0DB 5HYFA 1JGVH 2F74A 3H3PH 1QEWB 2VUYA 3K1KC 4XNMA 4PJ5D 1K5NA 2Y5TA 1TCRA 4QNPF 3VI3F 3PWJA 3KS0J 5L2KD 2CLRA 4Y5VA 3CD4A 3WNPA 2FEDD 4BSWA 5FKPA 2JK5B 4TUOA 2FO1A 5EOCJ 2V5TA 2Q86A 1JIBA 43C9B 3Q6GH 4BQ9A 1IAKB 3R8QA 4GKSA 3MRBA 3GIVA 1IGIL 5F1NA 1TNNA 3MLZH 3TBYA 3WSQL 1I1AC 1R5VB 4V1DE 3GMRB 3DNKA 2VLKE 3LKQB 1G7IA 4G7VL 2XQYG 3VD7A 5D2NC 2NCMA 4DGYL 2CRZA 2E9BA 1OY3B 3OKMB 5HYQB 1MRDL 1CIDA 1KIUA 1HI6A 5EU3B 1TQCB 2DQEH 2VDLH 1F90L 4QRSB 2X4RB 2HVKA 4XPTH 4Z95H 4OTXH 1N2RA 4J12A 3CX5K 1U8OA 1DQLH 3G5XA 5DMIH 4WJ5B 1UACL 4N0CD 5IB4B 3QUXD 4JDVA 2HVJA 4YIQA 3TVMA 1UXWB 4JPKH 3AM8C 3ZHLA 4KV5F 4WCYH 4HUVB 4PYGA 3V0VA 4BFGA 2QADD 4XCCH 1H3GA 5FYKH 4ISVB 4Z7QE 2E7CA 5DO2C 5JPNA 4XXDA 1OLZA 3MLVH 4O51A 3VFUB 1YYMH 2EDQA 1K4CA 4KHTL 1JMZA 3ARBA 4JO4H 4PJBE 4CDGC 1D5XB 1HYRC 3FRUA 1M7XA 4LIQH 4KKLC 4KZEL 3A0OA 1GPOH 3HCVB 4ONHB 4X4YB 4ODUA 5HYSB 5D2NE 1CD1B 1MCCA 3V5HB 4PUBL 5JW5A 1XGTB 4D9QE 1YY8A 2VITB 4MS8C 2CLZB 2WBJC 4PJ7F 4XBPB 2KKQA 4H0GA 2XTJB 4MXVF 5IHLB 2X9WA 2AKRB 2B7DT 5AYQA 3UTTB 5I1KL 3BIBX 4YDKH 4Q9RL 1AE6L 5T3ZH 4Z8FH 1PKOA 3IDJA 4J23A 1DLHA 1G7QB 2R23B 3QIUA 1JUFB 1N5AA 2OQJA 3SY0A 1U6AH 3ULVF 5DFTA 3G5VB 4G3YH 1GGTA 5D2LB 3RDTA 2FLBT 1IAOA 3S7GA 3U83A 3D3VE 3EDJA 3N85H 4IMLB 4RMRA 4WI7A 1CXFA 4NN7B 4ONOA 4DKFH 1FZMA 4JFYB 2UWEB 4QYOB 1P4LB 1WWWX 1Z5LB 5KVMC 1KLUB 3ILPA 3ZDXF 3X14A 1KEGH 4CDHA 3IKKA 4RMVA 3CVIL 3SGDI 4M7KH 3HZKA 3W2DH 4YBHA 3CZFB 3VI4F 3FAXA 2X4PA 1N64L 5T3XL 1NPUA 4X7SH 5FECB 1KGCD 3B9AA 4LP5A 3T0BA 1G7HA 1LDPH 5DD5H 4YDVB 4CMMB 5FV2A 5DJCA 1AD9A 3MBEB 4HPOL 4U1GC 2VIRB 3SDXE 5F7DA 2B4CC 3RBSA 5JLZB 1J0KA 1FP5A 5DI8B 3V5DB 2EH7H 3IJSA 4PJCF 3KLHD 4P2RE 1RD6A 3RTQD 3QJFA 3KPRA 3L9RB 2Y36H 3F58H 4F7TA 4AIXA 3RVXC 3FOLB 1T83C 3ARZA 1T7WA 4Y5XC 1MCIA 3OTTA 4AZ8A 3MBED 3NACL 4YE4H 1L4IA 1ZT7A 3F5WA 3QDGA 2L7UA 4PJ9A 3BP4B 4P4KB 1R5IB 1EUTA 1IAIL 4OLUL 4KK9D 3RRQA 5DFVC 4N0FB 5IK3A 2EO9A 5CSZB 1C8PA 3T8XB 4E41A 3IAPA 4XVTH 4LSRL 1D7FA 3NFPB 4JKLA 3TH3T 4ZAKB 1BM3L 3BJ91 4KH2A 3W9EB 4HXBH 2GT9A 4C83A 2XKSA 3GI8L 4GBXB 1U91A 1CGXA 2NY4B 4QHKJ 1EGJL 1YMHA 1MRCL 5C0GB 4KUZL 1B0GA 2NW2A 3VXNB 3D85D 3JWNC 2RCSL 4ZFGH 2BRRH 2F54B 4NNXB 5JHDA 5D1XA 3P4NB 1MFAL 4ZAKD 3RGVC 1EERB 4MA7H 3VXUD 4Z76A 4NBYB 3NABL 1A7RL 5FYKD 1PYWA 2PXYD 1DDHB 3O81A 5JOFA 4DGIH 3QI9C 2W60B 4KUCF 4NKOB 4PB9H 1QD0A 3IAGC 2NX5B 5HI3C 1SVCP 2ZPKH 3S4SG 3O6KL 2B1AL 25C8L 5JZ7D 5FUOH 4LCWB 2F54D 4TQEH 4WFED 5ICYB 1HHHB 4H26B 1E27A 4DEPC 3WIFA 4PLNC 1NKRA 2DQDL 1D9KA 1ZT1B 4OCMC 5TFSL 4J3WA 4KMLB 3SKNB 4QT5A 3V4VH 5LQBH 1S8DA 3TN0B 2CDFB 5CILL 4MCZA 5SWSA 3G6JA 3CVHA 2WLYA 4LLQA 1WISA 1NGXB 4LARL 4O58H 4XPAL 4S1SH 1ZANL 4J3VA 3QNYA 4YK4B 1Q72L 5DJAA 1PG7X 4N8VB 1TETH 4LDLB 4K71B 1S7TB 2ORBH 4JFPA 2FATH 1OARH 5L88H 5F93C 2J8HA 2YS4A 4OIBA 4Z0XB 3AS3A 2HJFA 4AMKH 3TO4C 5TDOA 4ZFFB 4XRCA 4NQDD 5GS2H 3V4UL 3QUML 4OCSL 4YFLI 1GGCH 1T20B 2J12B 4QHUA 1QRNE 2R2HB 1GC1C 3OB0H 5D71H 5F9OH 4JZJC 3E8UL 4JFZL 3TC9A 4ZS7H 4MJIA 5GSVA 3KLSA 2NLJB 1A3RL 2VAJA 4P3WA 1XIWA 1IC1A 4OZ4B 4D3CL 4JY6B 4NRZB 1F42A 1NC2D 3EHBC 1P84K 2BNRA 1M6OA 4IRZL 4TSAL 2FL5B 5ILTH 2A83B 2IJ0C 1JK8A 1VGKB 4YHLH 3O4OB 3MRDA 5I75C 3Q3GA 3LKOA 1IZKA 3EOBA 1TJGL 5MERA 4L1HA 1DQMH 2R1WB 3OF6A 4QHLB 3U79A 3V5KB 1S7UA 3S6CA 3L7EA 3ABZA 4IRJC 2BXYA 5DLML 2X70A 3WS3B 1DVFB 1UZ6E 5TE7L 4BZ2L 3O4LE 3S34H 2KZ1B 3BKYH 5HHOD 1VFAA 3MO1B 2JJTA 4PRID 3V52H 2CR3A 3IYLW 4KXZI 4MD0A 4P2QA 2NXYC 3BP5A 1MHHA 2XWTB 4RNRB 4XX1G 3TZVA 1IQDA 3FJTA 3NFNA 4K3GA 4HJ0C 4DGVH 1Z9SA 2MSPA 1B0WA 4JQXA 3BZEB 3MUZ1 3JBG7 4MNHB 3GMOA 2JJUA 3T4YB 1Q0YH 3TJEH 4PGEA 2J4WH 3A6CL 4KK6D 1R6VA 1QQDA 3T04D 4CKVX 2ZG1A 1QSFE 5CEZH 1F4WL 3V6ZA 5ISZB 5B22A 4IOIA 4OKVB 4GAJH 1NEZA 5JXEC 4JVUA 3RWJB 3UAJC 3IF1B 3FB8A 2AK1L 5HTSA 5D93C 1I9EA 1WV7T 1KYOJ 4YWGL 3ARFA 3GSQB 5F6IC 4P3DA 1SQ2N 1TZHB 3M8OL 3UJTL 1A2YA 1QLFB 2UZYB 1N6QL 4W68A 3JV6B 3SDDA 5T3XE 5DD1L 3ES6A 2EDFA 3BWAB 3QAZC 2DM7A 4Z78B 3P30L 3REWA 4PJFB 1RVFH 5F88A 3HMWL 2H32H 3NCYP 2R2EB 4JFDD 1Q1JH 5DJYA 1FG2A 5ICXA 4KRMB 2VISA 3MV9B 3HPLB 3GO1H 1MQKH 1LO0L 4L9LC 4R8WH 4RGMC 3I3EA 3KWWA 2KH2B 4BYHA 3GMNA 1UVQB 4LBEB 5HYJA 4KROD 3SDAB 3QEQB 1W72H 2VLME 2VL4A 3PWPE 3I9GH 1OHQA 2G5BB 4EKXA 4YHKL 3RHWF 4H1LG 3MV9D 4GXUM 3NN8B 1Q0XH 3LS4H 1T2QL 1T7YA 5TQ0L 1TFHA 5IROC 1IKFH 1REIA 2OJZL 3MMEB 1OP3H 3IFNH 1T1ZB 3GGWA 3L3OA 5GS2D 3BRDA 5HGHB 5DURB 4I4WA 1BBJA 1U93B 1F3JA 2A73B 2WBKA 2A77H 1QLEH 4QXUL 4JCLA 1QFWH 4LLYB 2LAGB 2FX7H 2IMMA 1ED3B 5ABDE 3KPQA 4XC1L 2P5EE 3S37X 4Z7UB 2AV1B 1T6VN 3OJMB 3TIDA 4LCCB 4ZXBC 1T1XA 3LQZA 2J8UE 2J2ZA 4PJGE 4LOUD 2UZIH 5HI4D 5LXGL 4HWBH 4M3JA 4R4FH 4KQ3H 3LD8B 2YD8A 3DVNB 3VXMB 1YEGL 3Q0HA 2J88H 5ADOL 2V2XA 4NN5C 4DFHA 2FJHA 4UQ3B 5CP3A 2OK0H 3UTQA 3WO4B 4NSKB 5FCSH 3MRFB 4IIQC 4I9WE 3DTXB 5H94B 1V3LA 1AH1A 3MV7D 4XC3H 3WIIL 1YDPA 4MD4A 3CDYA 2Z9TA 2R0LH 2KBGA 5IB2A 3VFNB 1RUPL 3VXMD 3GHEL 4JR9L 3K2UL 3EUUA 4PJHA 4EUPH 1K8DA 2Y23A 3PHOB 5AYUH 1NGPH 3SOBH 3MXVH 3DETD 5DGQA 5GGSB 1QNZL 2IAND 2OR9H 3WJLA 1JWUB 5DRNB 1C1EH 4M8QA 4QRTA 1NFDE 2WIIA 2DWDA 1CZ8L 3MUJA 3WHE0 4HGKC 2G2RA 1PSKL 3O41A 5CINH 2VLRB 4GKNB 1QG3A 4IRSC 3B83A 1KIRA 2GSIB 5SX5K 5BV7L 2IEPA 1PKQB 2JJSC 5CZKA 2XRAL 1RZKH 3ZYOA 1OT2A 1YYLH 4XTRC 1AGFA 5CEZD 1JYNA 4URTB 3STLB 4YX2H 5DT1H 5J0BA 2ZSVA 5FGCB 1EK3A 1SMOA 1SEBA 3W11C 2A6KB 1K3ZA 5K9JH 3STZB 3T65A 1HHIB 4HFUH 2L4OA 3PWNA 3QUKA 3JTSA 1GYAA 3CSBA 2H32B 2OX5A 4HGMA 1MCFA 4Z77A 3R1GL 5CZXC 2HAZA 4LPVA 1A1OA 1B0RB 1QVOA 3C9NA 4WFHD 4XAKD 4KJQC 1CFBA 1KB9J 2ILLA 1HXYB 1GH7A 4ZPTA 2IBZY 1BX2B 2FSEB 2A0LD 2VABA 4QF1B 4ODHH 1FL3B 2EDJA 3GMLB 4OJFH 5CEYB 1W72B 4EI6B 3Q5TA 4MAUH 4YEEA 5E8EA 1PZ5B 1RIUH 4NNYB 5TPWH 2DKUA 2OTUA 3AMKA 4P23A 4NOFA 2V2WA 4LSUH 3S3JA 2PTVA 5K9OA 1FG9C 4LL9A 2NY6C 3BZFA 1OAXL 4PTUB 3QZWB 4QOKB 3UBXA 2JE8A 1MHPL 1EHNA 1MHCA 3OPZH 1KJMA 2EKSB 1CTNA 5F7MC 3WMSA 2XYCA 4NM4L 3MJ9A 1U8NB 1U8LB 4A2MA 3PXJA 2MPAL 2RJMA 2ZUWA 1HZHL 4BKLA 1NGWB 5D1ZB 4YBLB 4KTYA 5CBAA 5BXFB 2NYYC 1FAIH 4M1GL 4X6CA 1JL8A 4YHOL 1EEQA 3VXSB 3HC0A 4XP9L 2CGRH 2VDNH 5DYOA 4ELMA 1P53A 1S7VA 4M62L 3TPKA 1PEZA 2E27H 1F4HA 4NQXA 4D0CB 4GW4B 5FYLD 3VRLF 4FFVD 3T0WA 4PJXF 3T3MF 1KENH 3AS0A 1LNUB 1WLHA 2P5WA 3BKCL 5HDBE 2WWMD 3U2SB 2QHRL 3HE6A 4MWFB 1YEKH 1AP2B 3C2AH 4EUPB 3CDGB 1X7QA 3F7YB 4G6AC 4RMWA 5IBTH 3PGDA 4WDIA 3P4MA 5H35A 2HFTA 1JHTA 2X89D 5FUZL 4U2ZA 2E9IA 5IVXF 3KPLB 3RX5A 1R0AH 1RZ7L 4HJGB 1KELH 3VFMB 4LHUG 3BKJL 2XTLA 2IG2H 1U2HA 3I6KA 3RWEB 5J57B 4Y5VC 1NGYA 1XGQA 4EXKA 3TO2A 3KYKH 1CLOH 1GVIA 2FYYB 2W65A 3NGBC 4XCEA 4NZRH 1QBMH 1T04A 2CIKB 4U6VL 1AJ7L 2DQCL 2FBJL 1U8QA 1XR8A 2XWJB 2ZOLA 3MYZA 1NUNB 1N7ML 2JCCE 3N1MC 3PP4H 5HYIA 4YBQD 1G9EA 3FT3B 4PY7B 4TOYL 1CGTA 4RQQB 1T03H 5IW6B 1XEDA 1IGFL 1I4FB 2HTLD 2FWOA 1GIGH 2VWEE 2HA1A 5CHNB 1M71A 1RUML 1YN6B 5D96C 5EORH 4FP8L 2BZDA 2BSSB 3CGTA 1Q9KB 3LH2H 1KPVA 5B4MD 1HHJA 4M9PA 1RAMA 3ULUF 3MA9L 5GRXG 4GMTH 4HHAB 3KHOA 4ZFZA 4NFBA 3TVMC 2QQLH 2HJLA 3DYOA 3FOMB 4NQEA 1R3JB 4I77L 5EU7E 1T4KA 1QOKA 1XFPA 4M7JH 3KYNA 4RFEA 3REVA 3WNMA 4KKNA 3WUWB 3S36X 5JQHC 1OW0A 2HTKC 5ICZA 3DXAB 4GRWF 2V7HA 3ARBC 4UT9L 5E1HB 3T2OA 1FFOB 1I7TA 3CVHL 1GAFH 1XH3B 3MRJA 4YC2C 2C3GA 5T5FL 1NMAL 4J8RA 1QLRB 4FQPA 2VYRE 1G9NC 3QFJD 4QRRA 4PJ8B 1VGEL 4NT6B 2C3VA 4RDQF 1FVEB 5L8KB 4YR6B 3BE1H 4BSJA 4IHOB 3OWEA 4ZFOB 3O9WA 5D7LB 5DFWH 3LKSB 4TUKL 4LLDB 3SDCB 1J5OL 4I48A 3OKOB 1ETZB 1W0WA 3OX8A 3QIUC 5DJ2B 4UT6H 1UGNA 1BPVA 3I02A 1FYTA 1YY9D 4MMZC 2BY0A 3MYJB 4RMQA 3F12B 3EYOA 2SEBA 2DLEA 2PYFA 4Z0BH 3C60A 3SDCD 5IOPB 1VERA 4QHMB 1OGAB 4KVCL 3RJDA 4MAYA 4ZTPL 4HH8A 3EO9H 1JJUA 4ZUUA 4NO2A 3SHSA 4L3EB 1MCQA 3I85A 3GEWB 3I2CL 3QUYD 4Z5RB 1ADQL 2QLVB 5JW4R 3U6RB 3QWOA 1JP5A 1FO0H 3JTTB 3ZYZA 5CCKH 4PJDF 4YDIL 1J1PL 1F3RB 4KK8C 4JO2L 3DX8A 1JGEA 1OGAD 1S78D 1A1NB 3ZHKA 2B0SL 5D7IB 1Y6NR 5DJ8A 2ZUUA 3GIZL 1HIMH 4CVXA 2VQUA 2LTQB 2Y7QA 4U4BA 3ULSA 1BD2D 1U8MA 3GSVA 1DBKH 1FFQA 4PBWD 3RWGB 3SKJH 2RFXA 1FZOA 4WW2B 4L4TA 4XCFL 3GSUA 3CLEL 2Z8WC 4UDUA 3W82A 5DK2B 5GZNC 5GGSY 3DURA 1UXSA 1IEBA 4NJAL 1WICA 1YEJL 4JY4A 1J05A 1MH5A 4MA3A 3JWOH 1CICB 4PJ9C 1DQDH 4C55A 3UTSA 5FDWA 4OF7A 3UYRH 3ZDYE 3G9VA 3IDYB 4OCRL 4R2GB 1H0DA 5C0DB 4HF5L 2HFGL 1YEDA 1FC1A 1MFEH 3HB3D 1FCCA 1WAAA 4WFFE 3KJ6L 5F7NC 1C08B 3VFTB 4XNUL 4F33A 1SJEA 4M1CD 1A6ZB 3ARDA 3D5OF 1YUHA 4BZ1L 1W0VB 1KJVB 1UWXK 4KJPD 5F1IB 2VZTA 1RUKH 1RZFH 3MLYH 2PUQT 2YSSA 4U1JB 1GL4B 3FQUA 3EJYC 4I2XA 1IT9L 4Z7VA 5D1XC 3RVWC 3QG7L 3O6ML 1A6VH 2BOCA 3DARA 1GHFL 5EB9A 2GUOB 1OQOA 4JG0L 4ZS6C 4WI9A 5K9KB 1K6QL 1GZPB 1ZHBA 3KPRE 4AIZA 2R69H 3ZKMD 3O2DH 2XKUA 2EEAA 1ZHNA 1A4JA 1CD8A 2DYPB 2GJ6E 1UB5A 3QDGE 1UG9A 3CFEA 2GJ6D 2I5YH 3S88H 4P49A 1JF6A 4DN3H 3U7WH 2QSCL 3OZ9L 4MX7B 4XPBH 3KPOB 4IDJL 1NFIA 2KQMA 1IC5H 3NAAH 4NZUH 3MV01 3U7YH 1Q9OA 5KVEH 4E41E 3A6BH 3MLUL 5J6GB 3U9PL 2JF1A 2UVFA 2BP3A 3BPOC 5C2BH 5JORB 3ARXA 1CXKA 3C8KA 5FYJL 5F72S 3T2NH 5MEPA 3TBWB 4HWZA 4JFXB 4PRPB 5F9WB 1R3LB 1TPXC 3NTCL 2GJZB 1ERNA 3L3DA 3QYCA 1X5KA 1A9EA 1HSBB 4PTTB 5JHDE 3VXPB 1EIBA 2A9MH 5BVJB 3HC3L 2FIKB 3O11B 4FTVD 2UUDK 4MJ5A 4X6EB 5GGUB 3DGGB 4PGDB 3B2UD 1GGBH 3ZTJG 4Q9QL 3I6LE 2I9TB 3LHPL 1AGDA 3CIQA 1U8HA 1QA9B 3D9AL 2LU3A 1XIWC 1BZ7B 2R1YB 3RWDA 4PV8B 2VQTA 3L5XL 3BXNA 1CBVL 4UBDC 3LZFH 3QG6B 1KOAA 2NZ9C 1NJ9A 5I1LA 3F7RA 5IB1A 3SGEI 2F58L 3LVEA 1RURL 5C0BB 2MCPL 1I9JH 1TIUA 4AJ0A 3VU2A 1RUAH 2BVOA 3QCUH 4HK3J 2K7QA 5SWSE 3G6JE 1IMHC 5HSFA 5E1AB 1JFQL 5DTFB 2MQCA 4KVNH 4XP1H 5C09A 3NIFE 2C1OB 4AEIH 1KCVH 1CG9A 2GCYB 3ESUF 9CGTA 1DQTA 4X6DA 5FXCH 4NKDB 3RP1A 3MODH 5C0BD 5I66B 4JKPL 5CBEB 5IEHA 2JJTC 4WEBH 4TPRH 3ME0A 2D4DA 4M5ZL 4MDIB 3RQ3A 1EEYB 5D2LF 1YEEH 2VDQL 1OAUL 2IADA 4GRLA 5DUPH 5GHWL 1BZ9B 4MJIE 4X6FB 3TZVC 5DEFB 1T7VA 2PYEA 1H5BB 2Q3ZA 3GMPA 5FKAA 5IBUB 1BF2A 3WHE1 2BJMH 3U30B 1EVUA 1ORQB 2UWEF 4GH7B 4UNVA 1CDHA 1P5VA 2BNRE 4JQXC 3TNNB 5MEOB 2VXVH 1NBVH 4G9FD 4WUUD 5F9AC 1OB1B 4M00A 2JIXA 3CFCH 4JFEB 4GKOA 3C5ZD 5I1EH 1RK0B 1MNUL 3SE9L 3WYRA 3WLBB 4KDVA 4H25A 5DMJB 1B9ZA 1PJ9A 3PWLB 3TJHD 3WEXB 3BSZH 2XZQH 3A67L 3J8F7 4OZIA 5ANMB 1JV5A 1XF2B 4HG4K 5I15L 2X4UB 3ARFC 1TJHH 4OCWL 3RHWK 1ZA3A 2AGJL 4LF3B 1JZ2A 2Y25A 1OSZA 3KPMB 5DS8B 2XFXB 3H0TB 4TRPL 3V95A 4S1QH 3FONA 4ZYKB 4IDLA 1RJZB 4I18B 3INUH 1TDQA 3SDDC 1MIEL 4OUUA 1X44A 4OZFG 2W9DL 1NAMH 3G04B 1AD0A 1ZGLA 4P2QE 1XF5A 1YMMA 4OT1L 3QP3A 4E42A 3BESR 2MHAB 3BGFC 3C2SA 5J4MA 1KEMH 5FUCE 4QTIL 5T1MB 3F8UB 4XBEH 4TNVF 3C5JA 4Q9BA 3UBXG 5C9KA 3WFZA 4V1DB 2VLKB 1KPRA 3MJ9L 5M95B 2CLVB 4O4YL 4PGBA 2IALA 5F96H 1JHKL 1Q9WA 1X9QA 3VFWB 1XZ0A 1ND0A 3CSYA 4HUMB 2YOCA 4Y2DB 5KVFL 2H3NA 3BZ4A 3RX7A 5L0QC 2XN9A 2BNUA 3BPLB 4PRDB 4BH8B 5DVKA 4GS7C 3E1F1 1ZHKB 4R90H 1IFHL 2AXGB 4LKCA 5AUMB 3MR9B 3K8KA 1JF1B 5C1MB 4Y2DD 5D7SH 2O5YL 4GSDH 3ZE0E 1MPAH 3PP3K 5K9QG 4U0RC 2AP2A 4Q7DA 2O5XL 5ESQA 4JANA 4L8DB 2E7HA 5C6TH 3QQ9D 2C3XA 5J1AA 5T1DL 2IPKA 4GQ9L 3IFPB 4AT6B 3H7LA 4PJBB 1AIFA 3IFOA 4U1IA 4PB0L 1A14L 1I1AB 3BVNA 4DVRL 1OP5K 4WI3A 3RKDC 1MOEA 3MGAA 1H3WM 3VA6A 2NW3A 2IWGA 5HYJE 5D2NB 2Z93A 3RUGA 3AU1A 1MY7A 3ZDZF 1EJ6A 3VD3A 4FG6C 3FQWB 3VGBA 2AEPH 3UJJL 1MY5A 5DQDL 1DN0A 4I0PD 4UAOC 1AGEB 1P7KB 1Y0LB 3WKMH 3GJFA 3QHFL 1JYXA 1S5HB 2R1XA 3PL6D 5I1DB 2FECL 5HDLA 3DV6A 5TQ2H 4U1NB 3FB5A 3BJLA 1F11B 2PR4H 4KRNA 3O45B 5D7KE 3HNSL 5FYJE 4PP2A 1KPUB 3WJLC 5ACMA 1D5IH 4UUJA 4XP6L 3DMMA 1IGIH 3H9SA 5I16A 4YFLF 1NQBA 2BVQA 2Z92A 1YPZB 2Z4QB 5FFLA 3OL2A 5GJSL 1HHKA 2EDYA 4DGYH 1IM9A 3KPPB 3DUSA 4K9EH 1HNGA 1FBIL 2EIBA 5FIEA 3MRHA 3O6FD 3D25A 1M05A 2LV4A 2YZ1A 2P8PB 5JPMB 1CE1L 5MENA 2P7TA 3AUVA 2WBJB 4CJ1A 3IXTB 2ZCHH 5DQ9A 2A6IB 3ECBA 5EIVA 5GJTH 1KT2B 2DS4A 4U1MA 3WUZA 4AEHH 1Y18B 3IRZA 1DANT 4QEGA 4PJHE 5EU6D 3CLFH 1NCCH 4KKLD 3SDXB 1ZOXA 4DJMA 1X5FA 3QHZH 4LSVL 1CLZL 1S5IL 4UV7L 1OAQL 4GG8B 2P44B 4WTZA 5HVGB 2JB6B 4P2RB 4XI5C 5DJ6B 1CDIA 1S3KH 4XP4H 1BJ8A 3GMQB 1YNTA 4W6XB 2C4FU 3T1FA 15C8H 4WU5B 3CFDB 5I76A 3RU8L 1UZ8B 4JEGB 4P23C 1WC7B 5IMOA 5LGJA 2IH1A 4X7TA 4OGXH 5AAMA 1KN4H 2DM3A 3W0WE 5M94B 4LCIL 2PW1B 3RAJL 4HWEH 2PKDA 4Q9RH 4K3DL 4LNRB 1AE6H 2OLDA 3JV5A 2ED7A 4AM0B 2AJXL 2BERA 2ADJA 4Y4KD 1GC1H 1G7MB 1YNLH 3OR7A 5ADPH 1B4JH 1DQJA 2FJGA 3OXRB 3DSFL 4LU5L 4ODSL 2IH3B 5B38B 4FFZH 5DVNA 4OLZL 4EVNA 4PRAA 4WO4A 3C8HA 3E6HA 4U1GB 4X5XB 3TCLB 5DHVH 5IESL 4ZO8A 1I9IL 3EYQD 1GZQA 2FBOJ 4P2OD 3BIAX 4NN6C 2IQAA 4WTWA 3X3GH 3T0EA 3GKWL 1EFXB 3BWUC 3L3HB 4PJFF 2VXQH 5SWZA 5FHBL 4RMUA 3RVTC 1R24A 1HQRA 2BHYA 5CKGA 1CWVA 4Y5XB 5IV2A 3CVIH 4JHAH 4OD1L 4HGWA 1RZJC 4YZFE 4M7LT 5T3XH 3SQBA 5HBBA 5DD6A 4R7NA 3C08L 3VFRA 2DLIA 4U1KA 2GAZA 4KJWC 2FX9L 5L8JB 2DLTA 2KQNA 3DX6A 5CLWA 4HKXA 3O8XD 2APFA 1IKNA 7FABL 4RWHA 5IVNA 5I30H 1NCTA 3WXWH 1M7IB 4X6CE 4OM1L 4D0BA 3V7MA 3Q6FB 2DD8L 1RIHH 4Y4FA 4ELME 1WBXB 3RGVB 3FQTB 1YJDH 1F6LL 3THMH 4L5FH 2Q8BL 1QRNB 5KANI 3BGMA 1HQ4A 2W92A 3QI9B 4NYLB 5T33H 3QIWA 1IAIH 4ELKB 2C1PA 2P5WE 4OLUH 4Z7UF 5E9DB 1T0NA 5EC1B 4C56A 4G8GB 5D1QA 4M48L 1G6VK 3U4BH 2EE9A 1SMAA 4DEPB 4NQCD 3U82B 1DZBA 1FZJA 1K2DB 1N59B 2IAMA 3RGVD 4ZTOL 2F8XC 3D39A 1HHGB 3MLSL 4EI5C 5A16A 5JW3H 5I17A 1T0MA 1JNLL 2HWZL 2WW8A 2ZNXA 4KUZH 1YEFL 2ICWA 2RCSH 3G6AA 4Q0XL 5E9DD 4OLYH 2BY1A 4G8GD 4GXUN 1IGCL 3MREB 4NQTA 2HMID 1KTDA 2E8YA 2CDEB 1OAZL 1HH9A 1A7PL 3EZJB 3UTPE 1D6VL 4C59B 3BHBB 3O4LB 3ARYA 4X80H 25C8H 4G42B 3TO4B 3QQ3A 4Y8DC 2IGFH 3NA4A 1KJ3H 3O3AB 3WDIA 4HIEA 1I7ZA 5I71C 2IPTH 5TFSH 1MCNA 1D5MB 1N8ZB 3ARSA 4JZJB 3PJSA 4FZ8L 1OM3H 5E08L 5KG9A 4KKBD 2GK0B 3BIKB 3K81A 3WLWC 1MCOH 3QUZA 1BIIB 4ZSOA 4J3UA 4J2XA 5MI0C 1MVUA 3GBNL 3FB7A 3GK8L 5I75B 3IJYA 3KJ4C 1JZ6A 4P57A 2EC8A 4OCSH 1UB6B 4IRJB 8FABA 4FQXA 3AC0A 3FCTA 4NQEE 4PGCB 1T21B 3C60C 3QO0B 5CSGA 4YHML 4MAYC 4PLJD 4D3CH 5F7HA 4QRUA 3CCHB 4JJ5B 4RZCB 4WU7A 4NO0B 2DQJL 1G6RA 5HI5C 2AXFB 2Y4SA 4IRZH 1LEGA 4HLZG 2NXYB 5JUEL 1NMCC 3IB4A 2E7MA 5HHNA 43CAB 1OPGH 1HH6B 4K8RL 2YD4A 4ENEC 3ESVF 3LV3B 4QRRE 5IMMA 1BFTA 4E0RB 1LP9A 3HE7A 3BKML 1CQKA 1R3KA 4FQ1L 4UNTA 3C6LD 1JGDB 2YXFA 4XNQB 4WHYG 5DLMH 4NKIL 4HWUA 4FZEL 3PWPB 4M6NL 3DUHA 3ROLA 1HCFX 1IAII 3E2HC 2W91A 4LCUA 4HKZA 3TNMB 3MRIB 4E5XB 1J18A 5D93B 1YN7A 2XXMB 1L7TH 5F6IB 1AXSA 4AYFA 1RUQL 3Q1SL 2X10A 4M7LL 4MYWB 3SJVD 1RI8A 4HZLA 2AJYL 5MEQB 3EGSA 4MLSA 3QAZB 1FL5A 3N1PC 1MFBL 4Q6IA 5IWLA 1RZ8B 1J11A 3KLAA 3A6CH 2J8UB 3MOBH 5FDYA 4PJGB 2V2TB 4K3EL 1EJOL 1F4WH 2YXMA 4ACPA 5CEXB 3QPQC 1IAMA 4L9LB 5EIIA 4RGMB 2AK4B 2EXYC 2KDGA 5ITBH 3ARDC 3WFCL 4UINH 4YWGH 4OFKA 4EJ1C 3D18A 1U92A 2EDOA 5IHBA 1N6QH 4X6BB 5A2FA 4EN3D 4F7MA 5DD1H 2EYTB 5J7CC 2X4NA 4WHYH 2AK4D 2BDNL 1ZLUK 1IEHA 4NNPL 3HMWH 1NBQA 2Q6WB 2QQKL 1RV6X 1T5XB 3MLXL 3DUUA 3QWQB 2GHWB 4WWKA 1NFDB 5IB3B 1CU4L 5IBLC 1JTPA 3N9GL 4KMTL 4EXPX 1YEIL 2OL3A 3TBTB 3TFKC 4WTXA 1I8IB 4ZXBB 1K8IB 3QFDA 4K7PX 3QUMB 1CT8A 3LOWA 3MRNB 4JPIB 1FJ1A 5HY9A 3WE6B 1WAAE 2AJZA 3SGKA 3AAZB 2DIBA 3QJHA 3I50L 5DRXB 5F9JB 5HJ3A 1VKXB 4O5LH 4NN5B 1TQBC 5DC4B 3P0VL 4XVSH 1NC4D 2DIAA 2OJZH 1H3TA 3L5HA 4IIQB 4HUXA 3DVIA 2J6EA 4N5EC 4ETQA 4I2XE 1ONQA 4Z7VE 4J4PA 5SX5H 5L2JB 3CFBA 1S7RA 1I7RA 2WUCL 3L3KA 4HS8H 4X8JA 3LN5B 5T1LA 1A7QH 1I3VA 3MNZA 3BQUA 4QO1A 2PTTA 2XKNA 4XWGL 1VADB 5SWQB 3U46B 4HIJA 4TVPL 3S96A 4X99A 5F1KC 2WQ8A 4CAGA 5ADOH 4HAFA 1UJ3A 4CRPA 3ZHDA 4D9RD 1NANH 4IRSB 4DQOH 2K1MA 1E6OH 2JB5L 1JZ5A 3ZE1E 1RZIB 3EDKA 3KR3H 4Y5YA 2CIIB 1QP1A 2PO6D 1KBGL 1RUPH 3GHEH 4MXQC 5AZEH 4K8RC 4FFWC 4LVOC 3RWFA 4Z18A 2CK0H 1SHMA 5F7EH 4WFGD 3P4OB 5JW4M 3K74B 4HEPG 5E8DL 5FO9B 3D2UD 3PQYA 4NQSB 1DUZB 4H20L 1T7XA 3LEXB 5I1GL 1P2CA 5GGRA 3WL9A 4XTRD 4G6KL 4U3HA 1A7OL 1CZ8H 5GISL 3CDCA 2E6JA 5CJ5A 5GS0L 4GRLC 3P11L 1IGTA 2OYPA 5JOPD 3W11D 5E5MA 3S3SA 3VMPA 2EZ0C 4GRMA 5E8NA 2NY3D 3KXFA 4HC1A 1MCHA 5IM7A 5ID1B 4ZG1A 1GOGA 2PNDA 4U33A 1KCUL 1JNHA 1ROWA 5D7JD 2VLJA 3SDYL 4ZUVA 4TNVK 5ALBH 2QQNH 3O2VL 1FE8L 2PW2B 1U3JA 4XNZC 5LBSL 3WNNA 5DXWA 2NY6B 4A6YA 2B1HH 4V2CB 4MNQA 4NQUA 1EAJA 3QIBD 4KI5E 4O2CA 5C09E 2Z35B 3QO1A 3DV4A 5B39A 4X6DE 4WW2F 1A9BA 3EDEA 4AH2A 3CPLA 4GG6A 1WWAX 2DQTL 3IDNB 4NDMB 4CU7A 1IGYB 1T66D 4P5KB 5F89B 3L3JB 4YXLL 1G9NH 4S1RH 3LSOB 1OVZA 3C6SA 1U58B 1S9VB 2W0FB 4P5MB 1CFSA 3MUGB 1RHFA 3ULVL 5L7XH 1QSEA 4WY7L 3VDAA 1FFPB 3ET9F 2H8PB 4KY1H 4L8SA 4J6RL 1EDQA 4J3XA 1VEOA 1CK0H 1YECL 4M03A 3LPGA 5CJBA 4APQD 5IJVA 2NYYD 3UO1L 4F7PA 4Y1AA 4U1HA 3OKYA 1EO7A 3GFUA 3F7VA 1AGBB 4GUPB 1CVSC 4D9LH 1U8IB 2YPKB 5K93A 4OV6F 1KNOB 2EIEA 2V9QA 2CDGB 4EDXA 1DBBL 1PAMA 4AK1A 5GZOC 4OD2B 4GQPH 2BNQA 4JRYE 4M1GH 3VXTA 1I3GL 2F74B 1WZ1H 2NZIA 3MSPA 3MCKA 1WEJL 3RL2A 2A2QT 4OFYA 4XP9H 4XNMB 1A6WL 2FJFA 2Y5TB 1TCRB 4M62H 5BZWA 2W0LA 3PWJB 2QL1A 3DO7B 3FZUC 2KUTA 4P9ML 4IS6A 4Y5VB 5I2IA 2Z8SA 1JGUH 4LHJB 1MQ8A 3TLRA 2C3WA 3K2MC 3LY6A 1LE5A 4BSWB 5FKPB 2QHRH 4N1EA 4TUOB 5IVXA 5KSAA 5SX4H 2YPVL 2Q86B 4BQBA 3NGBB 1PLGH 4GKSB 3MRBB 3GIVB 2X1QA 2VDKL 2F53E 4IOSD 1NH6A 3TBYB 3QDJA 5HHQB 2X09A 1G7IB 4OFPA 1JNNL 4FOMA 4HS3A 2JELH 1DL7H 5EZLB 1MCEA 1OQXA 3ZYIA 1HI6B 4PJAA 2O5ZH 3NA9L 1MI5D 3IDXL 2H2PC 3V9FA 2E8ZA 2HVKB 4M61A 1I8MA 3MRGA 2VSDA 2R9HC 1UM5H 2XN9E 2DDQH 3HUJE 4U6YA 4X83A 5D96B 2IFFL 3G5XB 1TLKA 1MCPH 3CH8A 3BEWA 4K07A 3NCJL 4MA8L 2WP3O 3VXRB 3UTOA 4JDVB 2VZ3A 3GSNA 3R06A 3P73A 3OGCA 2HVJB 3QBTB 2R8SH 5DUBA 3TVMB 1ODAA 3DMMC 3T3PF 4U49A 1HKLL 3IJHA 3VWKD 2HJKA 2HG5A 3RJQB 5KS9A 2AEQH 1MEXH 3V0VB 3ARUA 1R3IL 4QTHA 4HCRA 5JPNB 2CK2A 4XXDB 3ZYJA 4O51B 4XH2A 3VXRD 3CX2A 1K4CB 2D9QB 2O93L 1IGFH 3U4AA 3ARBB 2BSED 5C0AD 3VI3E 3ZKND 3FRUB 4YC2B 4XNYH 3U0TA 3PHQB 3AXLB 5CJOH 4RGOH 4TVPE 1IC4H 4ODUB 3NIGE 2J3SA 3RUGE 4JHWH 5JW5B 1YY8B 3DBXA 4XPHH 3QDMA 1GGIL 3MA9H 5E95B 4RGNC 3GSRA 3MJ8A 2OM5A 5DJ0A 1KG0A 4OF6A 1FLRL 5BRZE 3EO1A 4JDTL 1MFDH 4JJHA 2FIRT 1LK3H 3HRZA 2DI7A 4HS6A 3IDJB 1DLHB 2HRPH 3ARGA 2NXZC 4OCXL 4TN9A 3S3PA 3QIUB 4IOFC 5FM5M 5EO0A 1N5AB 1WCBA 2OQJB 3SY0B 3EOTH 1IQWH 1T2XA 4YAQA 5KJRH 1J8HE 4NUJA 3B4NA 2MKLC 3H9SE 1QR1A 2R56L 1J8HD 1IAOB 4HUUA 5DJDA 5IHUL 5BS0E 1NMBH 5C07D 5T5FH 2YPLA 4N8CL 1FFNA 4B41A 2ED9A 5BS0D 1I75A 1FZMB 3QIUD 3FQNA 5KVGL 4OD3L 4LEOA 2YKLH 4UOW0 2W0KA 3ILPB 3X14B 4TUKH 4JM4L 2FHFA 5MENE 4LSTL 4OLEA 3OKKA 4F15C 3HZKB 4RGNE 5SX4I 2DF3A 3ZTNL 2X4PB 5T1KA 3OB0K 4OLXH 4OCYL 3MRLA 1G7HB 3EYVA 2WWKT 4WO4C 5DJCB 5JHLH 1AD9B 4CU6A 2R2BB 5F7DB 2HLFD 4K7PH 4KVCH 2DMKA 1AO7A 2EECA 2W9EH 3GM8A 4PJ7E 4JZNA 5GRYA 2AW2A 3T0EC 1HKFA 2NY2C 3QJFB 5HGBA 3KPRB 3HAEA 4RIRA 3WFEL 4F7TB 3HZVA 3V8OA 4JO2H 4PD4J 4OGYH 4NZDA 1ZT7B 3F5WB 4PJ9B 1R5WA 3L5WA 5D5MA 4R96A 3RWCA 2B0SH 1LE9A 5EBMA 3GIZH 3ULVE 2R4RH 4F3FA 5IK3B 5FGSA 1KXQE 4JM2A 1NSNH 4E41B 3MFGB 3NIDF 3EDDA 1L0YA 4XHJC 2G60H 4XP5H 2F9BT 2IQ9H 2H6PB 4CJ0A 5HHME 2XACC 1KIQA 2GT9B 4C83B 3ROOA 1GXEA 2OTPA 1IKNC 4JPWL 1U91B 3MFFA 1YEHL 1YMHB 5IJKA 1B0GB 2NW2B 3TYGH 2COQA 4WNQA 4M3KB 5IR1A 3ZDXE 1YEJH 2GSGA 4PJ5A 1F4YH 4YHZL 4MB5A 4Y4FC 5JHDB 5D1XB 4P5TD 5EN2A 3MLRL 4Z76B 1X4ZA 3DWTA 3VI4E 3T0EE 3L95A 1PYWB 2W9LA 1DUYA 5EDXA 2MKWA 3QIWC 5SWZE 4AG4H 4D0DA 3U36A 4Z7QF 2H1PH 2Z31C 5D1QC 1J9CT 2X6MA 2P4AB 1T1YB 3V4PH 4CNIA 4UIKH 1E27B 4PJBF 3WIFB 1U3HD 2D7TL 2IAMC 3LEYL 1N4XH 4KHXH 5JNYA 3JXAA 1ZK9A 3MGOA 5CUSH 4QT5B 4ZS6D 2UUDH 1U9KA 2H2SC 1S8DB 4LDEB 3U4EA 3TT3L 4F9PA 2JK5A 4MCZB 4Y16D 3G6JB 5SWSB 3CVHB 4LLQB 3BPOB 43C9A 4OLWL 1DBMH 2F5BL 2QTEA 3O6MH 3KLDA 1KJ2L 3QNYB 3MRRA 5DJAB 2YHGA 4H0IA 1TPXB 4XPFH 3RZCC 4JFPB 5IT2L 1EHLH 3P9LA 2FEEL 2HJFB 1FH5H 3QUXA 2OL3L 4NHCL 4E9LA 3EYUH 5TDOB 3TA3D 4XRCB 4NKMB 5E6ID 1IC7L 3E6FA 3LKPA 3ARED 5CGYC 4QHUB 3ZE2F 1W8NA 4BFBD 1INDH 1YPZF 2QKIA 5J06A 2AERT 4MJIB 5GSVB 1ZLWH 1XIWB 4R4BA 4HMDA 3WCYA 5IB4A 1Z3GL 4C56E 3MLUH 5AZ2L 2ZJSL 4HIXL 5IFAL 2BNRB 2IPUK 3QUZC 1M6OB 2J6EL 5ESVA 3T2PA 3TV3H 1WIOA 2XZAH 3D39E 1JK8B 4QRQA 3NCEB 3CFIC 2Y6SD 1OP3K 3MRDB 3NTCH 3Q3GB 3LKOB 3MRMA 3EOBB 4FHBD 4NWUH 5MERB 3SPVA 1XIWD 5E99H 5L6YH 1KTLA 5C0IA 4QCIA 4WI6A 4WGWB 1S7UB 3VH8A 4UBDD 1H8NA 3L7EB 1LEKA 2YBRA 2CKBA 4FQXC 1D5XA 3GBML 3SCMD 3S8WA 1WWBX 2HN7B 4EZMA 3FO0H 5JIIA 3ZKSD 3SDXF 2XICA 3HCVA 4M6MH 5HYSA 1CD1A 2D31B 1XGTA 3T08A 1VFAB 5CP3H 1QKZH 3GJEA 3OF6D 4MB4A 1H3PL 1MFNA 3AVEA 4JPVH 4FN0A 4MD0B 4P2QB 4MZ3A 5EU5A 4WEMB 4ORGA 3BP5B 1FRGL 1MHHB 5JO5A 2F58H 4Q97A 3TZVB 1IQDB 3QSKB 3NFNB 5E00A 4YDJA 3PIQA 5IEKA 4TVSa 2R23A 1JUFA 1RY7B 1WIPA 3HE7C 3GMOB 4ZSOE 4HUWB 4PGEB 3BD3A 3QEGH 5ERWA 1QQDB 2YK1H 1T2JA 2F5AL 3V6ZB 4IOIB 4CU8A 1NEZB 1ZS8A 4JFYA 3FB8B 3U9UA 3O0RH 5EUOA 3I75A 1V7NH 5I1IL 4P9HL 3H6JA 4QYOA 3ARFB 4LHQB 4R4ND 4OBRA 3HNVH 4P3DB 2DBLL 1KLUA 1OAUH 4PS4L 1A2YB 4HC1L 4R26H 5F9DC 3F7PC 3QR2A 4N0RA 3UPRB 3SDDB 3ES6B 4U1LA 4MJ6A 3REWB 4Q6IC 3RTQA 3WXVL 5IWLC 2CQVA 35C8L 3B2VL 3IAQA 5F88B 1OF2A 4LCYA 3BGFB 5DJYB 1MLBA 1MNUH 1FG2B 3MBEA 2VIRA 3UC0H 1H3XA 5DEGA 1LO4H 3KWWB 3GSOA 5E2VL 2UVEA 3GMNB 1LP9E 2AI0L 5EC2B 4X9BA 1LO2H 3IDMA 1A0QH 5HYJB 5FM8A 3MOAL 5B39G 1OWWA 2ARJQ 3MA7A 3MRPA 3FOLA 1AHWA 3TIEA 5I18H 3LIZL 1BLNA 4UILH 4K55A 3LPFA 5L0QB 4OQTA 1LD9A 1WBZA 4GS7B 3VFPA 4Y89A 3D85A 1R5IA 2WZPD 4HIHB 3PDGA 4OT1H 4CW1B 3GGWB 1MJ7L 2BY2A 3L3OB 2VDML 4I4WB 5E70A 1P7QD 1SYVA 2ZCLL 4Q2ZA 1F3JB 1V7ML 1DR9A 5BQ7A 4WWKC 3K8LA 4OF5A 3W9EA 3VJ6A 3VXUA 5L9DL 1J0IA 5EZIL 5FHAH 4U0RB 2PXYA 2DLFH 1SEQL 3KPQB 5FK9A 2W0PA 3T0VA 4L4VD 5D70H 3LQZB 2DI8A 1JPST 3TH4T 3KYOB 4WHTA 2F54A 5IKCA 3SGKC 4BFEA 4Y4HC 2GITA 3GI9L 4L3CA 5KVFH 5F7KC 3W5NA 3RGHA 2V2XB 3NCFB 3GKZA 2FJHB 3O2WH 3TPUA 3UTQB 4DCQB 1J12A 4L8CA 5EFIA 4HUKB 5M7QA 3RVVC 4NRXB 1DBAL 4GO6B 4ZQKA 4UAOB 1CFQB 2FB4H 1YDPB 4MD4B 4X9IA 1DQQB 1F6AA 4GW1A 4HKJA 5H37G 5IB2B 3OJDA 3QPXL 4PJHB 1K8DB 3RKDD 3B9KC 3BQUC 1EH9A 1AQKL 4G6JL 1RZJH 1DTUA 4M8QB 4NQDA 4QRTB 5E4EC 2WIIB 1NGXA 1BFOA 5JQ6H 1A14H 2LU4A 2G2RB 3O41B 2QR0A 1DSFH 4UI2A 4DVRH 3BDXA 1UJ3C 3FO9A 2VDOH 4KRPD 1KIRB 4K7FA 4LLWA 4YXKL 4OGZA 1NC2A 1OCWH 5DQDH 4XVUC 1MAKA 2HYMA 4Y5YC 2A1WL 1AGFB 4GKZA 3GSNL 4MCYA 1JGLL 2ZSVB 4M4RA 5I1JH 1JVKA 1SVZA 3T65B 3HS0A 1MF2H 3PWNB 1DLFL 3TWCL 3ZO0A 3QUKB 3HNSH 3JTSB 4YHNA 4HCRL 2E7BA 4WIQA 1A1OB 4LPUA 1IL1A 1QVOB 3C9NB 4ZUSA 2ENYA 1F2XK 1JPTL 5I73C 2H9GA 1VGKA 5JXAH 5C08D 2NY0D 4AL8H 3CX5J 4ZPTB 3WJJA 3I3BA 4P9HC 2VABB 5HHOA 2BSTA 1RULH 4DN4H 5H37H 4F7EB 4LASH 4PRIA 4CN4A 3Q5YA 4XMLL 3IDGA 5F7FA 5J3HD 5E8EB 2BMKB 1EV2E 2WUBH 2B20A 2OTUB 3WS3A 4HFWA 1F6FB 4P23B 4JKKA 5K9OB 4P4RA 3BZFB 1DCLA 3UBXI 1HEZA 1JWSA 3GRWH 1T6WA 3UBXB 2Q8AH 5C3TA 1MHCB 4KTEL 1KJMB 1DFBL 4NCDA 1FIGH 5A2IH 4CUCA 5D72H 1L0XA 2XWTA 2JLLA 5A3IC 1QSFA 3RKPA 3KG5A 4LSVH 1CLZH 1S5IH 3SKUD 1OAQH 4RDQG 4W4OA 1L7IH 3MCLH 5BO1L 3PQYE 4BKLB 5DSCA 1KN2H 3P3YA 2NY5L 4TSCL 2FX8L 4MNHA 2VDPL 1CF8L 4X6CB 3HC0B 3RU8H 5DYOB 4ELMB 1S7VB 3KPSD 3HFML 1EFQA 4NQXB 4NN6B 3HI5H 4L8SC 3SGJC 3KXFE 3RWJA 3IU3A 2ESVD 5K9QI 4ODTL 4LCIH 2HT4C 3RAJH 5I1HH 2DTML 1PY9A 2VLJE 2J8UF 4S1DC 3ULUH 4JFDA 1SBSL 4PJGF 4TTDD 3W9DA 1TZIA 1QLFA 5E2TH 4PJIB 4UOW1 5CGTA 4M02A 1X7QB 2R4SL 3NZHH 4MNQE 5F3BB 3PGDB 4PJFA 3K4AA 4WDIB 4RAVA 3P4MB 4OM0H 5H35B 1JPFA 1JHTB 4GXVH 3NPZB 3W5MA 1FGVL 5IESH 1EMTH 1JPSL 2YD6A 3I6KB 3VFVA 1QFOA 3ZKXC 4PRHD 4QGTA 3FMGL 3GKWH 1NGYB 5IFJA 3L5IA 1XGQB 4O02L 3NCMA 3WIHA 1E4XH 4Y19D 3MV8D 4HQQH 1EUUA 3TO2B 4LPWA 2NY7L 4WI2A 5HGAA 2IBGA 5I8OH 5KSAC 2FECI 3DOSA 2ZCKL 5C6PB 1CXLA 2W65B 1QSEE 4OD1H 4XCEB 4XBGA 1T04B 2G5BA 1XCQA 2EKJA 2IBZX 1NFDF 1U8QB 4MQXD 1HK6A 1MJ8L 1XR8B 1CFVL 4LAQL 2ZOLB 2K7PA 4ODVL 1F4XL 1KLGA 3AS2A 1YNKL 3FN0L 4Y1AE 1DJSA 1BECA 5C0ND 4P2YA 2PF6A 2FWOB 3PGFL 3S4SA 2FR4A 3QEUA 1M71B 5DMKA 4EI5B 2CO6B 5DK3A 2BNQE 4PG2A 4NGHL 1KPVB 3BT2H 1F58H 4OM1H 4B50A 1HHJB 3MV7A 4JFOA 4YNYA 3D0LB 4F80A 4GLRI 4ZFZB 5AG8A 4WVRA 4H0HB 1G7PB 2HJLB 3VXMA 3WDJA 5E6YA 1S7SA 3NFSH 1PW3A 3FQRB 4EI5D 3MRQA 1SYSA 1WITA 3KYNB 4RFEB 3REVB 1TVBA 2D03L 3H9YA 5IVXE 2X05A 2IANA 2ZOKA 5CJQH 1DEEB 5ICZB 2V7HB 1CQYA 3TBSA 1NCDL 5I71B 3MLSH 3MRJB 1EHAA 5EWIH 1AXIB 2DI9A 2HWZH 1JNLH 3QDJE 4O2EA 1J0ZA 2YMXL 5KBNC 4J8RB 5HHXL 4Q0XH 1TVHA 3LKRA 4QRRB 4PJAE 1CFTA 4HPYL 3MXWL 2OP4L 5MI0B 3GDBA 3RWIB 4I3SL 1UM4H 1O0VA 3L7FB 3HLAA 4I48B 1BEYL 1FDLH 1D6VH 3RA7H 3ARGC 1W0WB 1BWMA 3KJ4B 3OX8B 4S10A 3I02B 1FYTB 5E0QA 1IJ9A 3OXSB 4PFEA 1FN4A 3EYOB 2SEBB 3O6LH 5KS9E 3C60B 4FZ8H 4EOWL 1IGJA 5HXMA 4MAYB 2NY5C 4RFOL 1OTSC 3KYAA 4U3XA 2AQ1A 3VXOA 2XA8H 3R8BB 4ZUUB 3ULUD 4WI4A 1FYTD 5ETUB 5HDBF 1QBLL 1NMCB 3QWOB 1I7UA 1UH2A 3BUYB 3TM6A 3S5LA 1JGEB 5ID0B 1NCAL 2CKBL 5CIPH 1VEMA 3PWUB 1U95A 2AJUH 2FCBA 3QDME 3VH8G 1ULVA 3KS0H 1MWAA 4Q74A 5DJ8B 4GRWE 1EO8H 3PG2A 5HI5D 1P84J 4CVXB 1CDYA 1LGVA 4DW2L 1CR9H 2Y7QB 1BHGA 3ULSB 4N1HB 1U8MB 3GSVB 5HYSG 2RFXB 1FZOB 3E2HB 5EOCH 4L4TB 1LO3H 4QRPD 4RISL 5MHSD 4N90D 3GSUB 5BCAA 4R3SA 1RFDH 4JRXD 4LLMB 1BMGA 3DURB 2EH8H 3RIFF 1UXSB 1IEBB 3WKNA 3B5TA 1UQSA 1P69B 4JY4B 2YPLE 3AMLA 5LGHL 1MH5B 2I27N 5BVPL 4MA3B 1A6UH 1JMXA 1HWGB 2DQFB 3O3EB 5FDWB 1U8LA 3UTSB 1E6JH 3LS5H 1H0DB 5BXFA 4NO3A 4YGAB 4FQ1H 1V5JA 1P4IL 1JGVL 4JM2C 4P46D 1V8HA 1YEDB 4NKIH 3H3PL 5IMLA 4PR5A 3HKFA 3BH8A 4F33B 1XGUA 1SJEB 2XA3A 4D0CA 4GW4A 1TJIH 1D6EA 3TCXA 3UTSD 2AXJA 3ARDB 3VD4A 1RJLA 1YUHB 1E0OB 1PEWA 5IJKC 3SQOH 2ITDA 2V5YA 1LNUA 3NH7H 2X89A 4F8QA 2YSSB 3Q1SH 3P9MB 3FQUB 4I3RH 3V0WH 4Z7VB 1D5BB 3LCYA 4PG9A 1NEUA 2AJYH 1IM3A 4YFDB 1AO7E 4MB3A 4PLKC 2BOCB 1A64A 1J0HA 1ZHBB 4H1LA 5HDQH 4AIZB 1T1WA 1JWMA 4CL7A 1ZHNB 1A4JB 1K3IA 1MFCH 4M1DL 4HJGA 1S9YA 2CJUH 4HXAL 1UB5B 3WHXA 3CFEB 1I9RH 1I1CA 3HG1E 4XPTL 5D8JH 4Z95L 5D5ME 5F1SA 1BWWA 5TE4L 1DQLL 3EYSH 5DMIL 1QFWM 1NFIB 1Q9OB 1NUFA 4OQTL 4F9PC 2FLRT 3O3BB 2EDWA 1NCNA 1R3HA 1U8PA 1EBPA 1FL6A 4ALAH 3P77A 3BN3B 3C8KB 1CD9B 3GZKA 4JPKL 3GUTA 1TQBB 1WBYA 3ISWA 4FMKA 5DJZA 1MHEB 3RY6A 4WCYL 1SM3H 2GY5A 4N0CC 2Y72A 3L3DB 2D7OA 5FYKL 5KVDH 1A9EB 3QUXC 4PY7A 4PJ5E 1PQZA 3MLVL 3B8SA 2EICA 5L2KE 4MJ5B 5E7FA 1CU4H 4JO4L 5CIPB 5IGXH 4LLVA 5I19H 1YEIH 2Z91B 1S7WA 1AGDB 3B6SB 2QADC 1GPOL 3RWDB 3SGDH 4JN2A 4EDWH 3BXNB 5HHVL 2P42B 1Y6KR 1AKJB 1VACA 3QQ4A 3I50H 1QYGH 3QULA 4F58H 4HHAA 3EJZD 1NJ9B 3K7UA 4BZYA 5I1LB 3FOMA 4YDKL 4YHYC 4Z8FL 2Q87A 2BVOB 3QFJA 3R0NA 2VO5A 1I3UA 1P5UA 1DN2A 1AKJD 5E5UB 1NDMA 1U6AL 1G9MC 1UWEH 2WUCH 1A6AA 3DX9A 5C09B 1CG9B 4UU9A 4P3CH 1ZLSH 4X6DB 4LSQH 4NM8L 4H88H 3UEZA 3BRFA 5IEHB 32C2A 3S35L 1UJTA 2YD1A 3G5YA 1L6ZA 4YPGB 4N8VG 2IADB 4GRLB 2XPGB 4FFWD 4D2NA 3GJFH 2G75A 3RX8A 2PYEB 2DQHH 4DOHE 3GMPB 3ELAT 1ETZA 3DSNA 3W2DL 4KPHH 5BOPA 5DJ2A 5E03A 3ZDYF 3ARPA 1WFUA 3KPNA 3DHMA 4GT7A 3QUYA 3QH3A 2X40A 4X7SL 3MYJA 2JIXB 3UZVB 4G6ML 3F62A 5DD5L 1LILA 3QRGH 1BOGA 1KV3A 5IOPA 4XNZB 3EO0B 5MP6H 1OGAA 4H25B 5F7WC 4QHNA 5TGBA 2YA1A 3OG4B 4OZIB 1MREH 4DKAA 4H20H 1JV5B 1BQLH 5I1GH 4XMKL 2CO7B 4G6KH 5E8PA 1VDGA 1OSZB 1BD2A 3F58L 4GMSH 2YD5A 5LAXA 2A9NH 5F8RC 2C9AA 2YEZA 3FONB 3NCYS 4OUUB 5DA0B 5E2UL 2DKMA 2EE6A 3KLHC 4ORZC 1OSPH 2P43B 3OQ3B 1F45A 3RTQC 3FHQA 4LGPB 1AD0B 1ZGLB 1XF5B 1YMMB 1H8OA 2XTJD 3SDYH 4E42B 3UTTD 4XVTL 3QEHA 2MWCA 4N9GA 3RWGA 4U7KA 5LBSH 4PY8J 4NJ9L 4PY8I 4HXBL 2HFFA 3L6FB 3C5JB 1BFVL 4YHPA 2YWZA 1AQDA 1YC8A 4MD5A 2QEJA 1KPRB 2VN4A 4PRNA 4KK9C 5TE6H 4PGBB 3VWJA 2IALB 3FB6A 1YMMD 2QQQA 4ZFGL 2BRRL 1AHWC 1XZ0B 1ND0B 3CMOH 3CSYB 3CMGA 5GS1A 3LDBC 2H3NB 3BZ4B 2XN9B 5CWSA 2BNUB 3GM0A 2UWEE 5EUOE 1E4KA 1KGCE 4DGIL 4F37F 8CGTA 5B3NA 3ZT5A 2ZPKL 4LKCB 2N7AA 3X11A 2X7LB 4TQEL 4WW1A 1U0QA 2F15A 2V5MA 4LHUA 2PXYC 2EEDA 4JFHD 1OTUD 1QO3A 4N5UA 2CUMA 1UCBH 2N1KA 4JANB 1GOFA 2VTFA 4M93B 2CRYA 3V4VL 1PD6A 5LQBL 5J1AB 4FQ2H 4U1JA 5JZ7C 5TF1L 4LMQE 2VAAA 2IPKB 3M17A 2EDHA 2DB8A 2D0GA 2GJ6A 4KKAD 3IFOB 4U1IB 4S1SL 3RNKA 3BVNB 2GUOA 4NWTH 1FORL 4I8DA 1QR4A 1QSZA 1TETL 4NC0B 2R0ZH 2Z93B 2ORBL 4X4XA 2FATL 3AU1B 3RUGB 5L88L 4ZUTA 2VXTL 5FA3A 3VFGL 4AMKL 3WIHL 4NQVA 3G6JF 1DN0B 5J8OA 1WGOA 4FMFA 1K85A 3GJFB 1GGCL 2P48B 4KXZH 3PUCA 2R1XB 3NIFF 1X5YA 5F9OL 1F8TH 4ZS7L 5IQ7L 5C2UB 4P4KD 4QHKI 4BH7A 3SE4A 4PP2B 1DE4A 3VE0B 5JR1L 5AD0A 4KJYA 5J1SC 4UDTA 4UUJB 4FTVA 3DMMB 3VXUE 5JORA 2EXWD 5I16B 2VERN 2D7NA 5FYKE 5ILTL 2BVQB 2R9HD 2Z92B 4JFXA 3OR6A 3MLWH 4YHLL 4GBXD 1JNNH 1HHKB 5LCVL 2NY4D 1IM9B 4CVUA 2F54E 2HH0L 5LKNA 4JLRA 2DN7A 4WFEE 3MRHB 3D25B 1FO0A 3EFFA 1VFBA 4X6EA 3LQAH 3DGGA 5MENB 2P7TB 3MTRA 1B6UA 4MA8H 3U0WL 3S34L 1GGYA 3BKYL 4RGNB 5DQ9B 3ECBB 1MCBA 2NX5D 4LDOB 4U1MB 3V52L 1OL0A 3FAWA 4LCWD 4TSBH 4XWOD 5C9JA 5T3ZD 1BAFL 1S7XB 2OTWB 2FD6H 5GIRA 4NP4H 3O4OC 3WJJC 2NXZB 4PGJA 4KGLA 2APXA 3ZDZE 4KK5D 3D69A 1PGRB 1RZGA 4R9HA 3TN0D 4DGVL 4NQDE 1P4BH 5B3JF 3FTGB 3T1FB 2J4WL 5I76B 4NZJA 3JWDL 2Y06H 1INQB 5CEZL 4JQIH 5IMOB 5LGJB 2EC9U 2IH1B 3AB0C 2XZCH 2NXZD 4X7TB 3K46A 3BN9D 4I3GA 4UMGA 2V6HA 4ZPVA 2ICCA 4G9FA 4WUUA 4KK6C 3BP6A 3C5ZA 1CGYA 2R15A 2HKHL 2ADJB 4F15B 1H15A 5HHMB 5DEFA 1H5BA 5EIQA 2FJGB 4L8BA 4W4OC 1DP0A 3GHBL 4HJJL 3UJIH 3RIAF 5C71A 1ADQA 3G6DL 2R56H 5E7BA 4CVZA 1BGXH 1M4KA 1RVFL 4EVNB 4PRAB 4WO4B 5IHUH 3E6HB 4H8WH 1Q1JL 4N8CH 3UROR 1GZQB 2FZ3A 5HHOE 1JHLH 1MQKL 3GO1L 3WN5A 2IQAB 2ID5A 4PRIE 3ZE0F 3L3GA 2NY2B 5ANMA 3O2DA 4FQJH 5SWZB 2I9LB 2ICEA 4M6OH 3S5LG 1R24B 1MWAL 1HQRB 1CLYH 4LSTH 5IV2B 4FXKA 5LG1A 4XHQA 4HGWB 1NBZA 4HMEA 3V2AR 3TGXA 1DVFD 4I18A 2AJ3A 3BFOA 5DQJA 2BCKA 5I9QC 1Q0XL 2G9HA 3LS4L 4WEUD 4KROC 5DD6B 4YUEL 4R7NB 3VFRB 1MJJA 2E6QA 2IPUG 4MQSB 1VPOH 3HC4H 2GAZB 3IFNL 1G6RH 3K8MA 4JO1H 3VFOA 1ZWIA 2YRLA 3DX6B 1LHZA 4Z9KB 4HKXB 1BQSA 2A77L 1QLEL 4YH6A 4YHIA 1QFWL 1ZVHA 2FX7L 1MSPA 1JPGA 2JTDA 1OAYH 4OBSA 5FYLL 1CFNA 4D0BB 4Z7WA 2VSCA 4QLRA 4Y4FB 2UZIL 1ZVYA 1X5JA 1S9WA 2X9YA 4XHJD 3IKCA 4KQ3L 1J1OL 4FS0A 5ISZD 4OF3A 4Y2DA 5DUMH 3BGMB 1HQ4B 4FABL 4BSVA 1OGTA 2J88L 2ADFH 1KCLA 4LSDA 2X41A 4HEME 3CJJA 3QIWB 2F19H 2C1PB 4WUKH 2OK0L 1T0NB 4LSSL 4C56B 1A7NH 2Z31B 4JFDE 4LOUC 5KZCB 5D1QB 2VXSH 1PG7W 2AXGA 4J7RA 5EUKB 5AUMA 2IC2A 4XC3L 4MNGA 1FZJB 2IAMB 5FOBA 2R0LL 1ZTXH 3D39B 2ADIA 4S0TD 4JPWH 5A16B 4C58B 2WIMA 1QSVA 4B7LA 5I17B 2ICWJ 1T0MB 3OJ2C 5C0CB 4PJFE 1II4E 4PG2C 4UIMA 5AYUL 4Q9CA 1NGPL 3G6AB 3SOBL 4JO3H 3VMNA 2CUHA 2Z31D 1FPTL 4I0PA 4EQ3A 4EUPG 1C1EL 3MV9E 4D8PA 1P6AB 1KTDB 3PL6A 4PJHF 3OKDA 5CINL 3RZCB 1HH9B 4EBQH 4M4PA 3Q2CA 5C0CD 2OSLA 3FO1B 1N6UA 3DETC 3QQ3B 4HH9A 5EA0H 1IVLA 4F57H 3SDAD 1RZKL 3IGAA 3QEQD 1EEZA 1FQ9C 4HIEB 1I7ZB 3ILQD 2CRIA 5GRUL 3LN9A 3BD5A 4YX2L 3PJSB 2HLAA 3RZCD 1FNHA 3DIFA 3MRKB 1MRFL 4I0CC 3QNXA 5FAAA 5KG9B 5HDOA 3O6FA 1KPUA 3JWDC 3QUZB 4OLWH 4ZSOB 5GS3A 5DURD 1JZ3A 1KCRH 1FCGA 1QBBA 1MVUB 2J8OA 4OAWA 4HD9A 4RWYH 3BYYA 3FB7B 1V3KA 4Z7UE 1LDSA 3IJYB 5J89A 3MV7E 3NVQA 2NTSP 4P57B 1ZEAH 1H9VA 1IC7H 1KFAH 4FQLH 4MAUL 8FABB 2DQIH 1LVEA 4FQXB 4MDJA 3VXME 3FCTB 1MVFA 1XGYH 2Y9RT 5EU6A 5JTWA 1RIUL 1PFCA 5TPWL 2UY6A 4QXGH 4K94H 1LK2B 1NAMA 2A0LC 1Z3GH 1JCKA 3PNWB 4BQCA 4QRUB 4X7CC 2IANE 3RIFK 5ALCH 4WU7B 4K3JH 1G6RB 2J6EH 1ZV5A 1LEGB 4UT7L 4FQXD 3OPZL 4G9DA 2Y07L 5F97E 5HHNB 4U6HA 3BMVA 1NCBH 1XAUA 1KCSH 5IMMB 2M1KA 1LP9B 3HE7B 4OF8A 5IF0A 2JB6A 4YZFF 1R3KB 4N68A 3LN4A 3W0WA 5CEZE 1FAIL 1O5DT 2CGRL 2VDNL 4Y4KA 3ROLB 5GRVL 3ALWA 3JVGA 2VLRD 4HKZB 4YDLC 2E27L 2X4TA 5HD8D 4EIZC 3T1WA 1WF5A 1YN7B 1C5BL 3B5HA 4N0YH 2N56A 2RQ8A 4WFHE 4X6CF 4XAKE 2C26A 2VQ1A 1FRGH 1AXSB 1PG7L 4ELMF 4HZLB 4P2OA 1YEKL 3IU4L 4I13B 3C2AL 1FL5B 4FFVC 4Q6IB 3SKMA 4FXGA 1Q8MA 3KLAB 4IJ3C 2WWMC 4OZFA 2VC2H 4OCNC 1FVDB 1R0AL 4PJIF 4JFFB 3WNOA 1KELL 4ONFL 2YD9A 3X3FH 5EIIB 2IG2L 2OJEA 4XX1E 3M45A 1N0XH 5C0JB 2V17H 3D18B 1U92B 1JYVA 1JTOA 4HC1H 2VR5A 2XQBL 4LSPH 3KYKL 1G7JA 3CSGA 5KSBA 4F7MB 4JFFD 4OB5L 3HI6H 1QBML 1WUNT 3O8XA 3M1BA 1KTKE 1AR1D 2X4NB 5F71A 3WXVH 3HRPA 35C8H 2I60L 5DGRA 3PP4L 4A6YH 4I5BA 4QOKD 1VSCA 4RRPG 4C4KT 2N7BA 3DUUB 4XPGH 1T03L 4WWKB 5J1TC 5EU4A 1PBYA 2UZXB 1UKQA 5FYLE 1F5WA 1GIGL 3B3IA 2OL3B 4JGUA 2ARJB 4Q6YA 2VUOA 4XCNA 5D1ZD 1RZKC 1LWRA 2YD7A 3MOAH 3QFDB 5DD3H 1CT8B 2D0FA 1FJ1B 2DAVA 5HY9B 2BVTA 2AJZB 4LPYA 2V7NA 4PP1D 3QJHB 4PV9A 2HTLC 4NQCA 3VXSD 4Y4HB 4GMTL 5HJ3B 3RGVA 3UZEA 3V6OA 1FNSH 4UQ2B 2QQLL 3BZDA 2VWEC 3DVFA 1NDGB 1P1ZA 5HYEA 3RY6C 2FRGP 2EE3A 4ELKA 3EDFA 3OAUH 4CN1A 5E9DA 1S9XA 3BD4A 4HUXB 2HT3C 5B4MC 1MJ7H 4XCYA 4ETQB 1ONQB 3VMOA 3CFBB 3LKNA 4Y4HD 1S7RB 1I7RB 3L3KB 4X8JB 1GAFL 2NR6C 5T1LB 3MNZB 12E8H 3B9KB 1I8KA 3BQUB 3EYFA 2X44D 3KNBA 5EBGA 4FQCH 5EU7C 1P6FA 2ZUSA 4HIJB 5DVOA 3IETB 1NL0H 5ENWA 4YO0A 3S96B 4X99B 3OAZK 4G5ZL 3LRGA 3J7HA 3NCBB 5E4EB 3QCVL 3BE1L 3GI9H 2D7QA 1UJ3B 4UB0H 3FO2A 5CZVL 3DVGA 1WZKA 3B9KD 2VRAA 4XAWH 3BHBA 4ZDHA 4JFQA 4GAFB 1AY1H 1BBDH 4UT6L 4Y5YB 5I1CH 5ACLA 5IFHL 1ZA6A 1CL7L 1QTYT 3BMWA 3CFJA 4I0KA 2BOBA 3C8DA 3EOAA 1NGQH 4Z0BL 3RWFB 5BV7C 1EPFA 5ELIA 2JJWA 3DYMA 4CBPA 3PQYB 3EO9L 3RNQA 4Z7OE 1P2CB 1YY9C 5GGRB 3WL9B 2HKFL 1J1XH 1XR9A 5DHVA 4JN1H 1XCTA 4K23H 5I73B 1FO0L 1IGTB 2UYLA 3K1DA 4X7FC 3EZ8A 5E5MB 2V5SA 2FO4A 4GFTB 4GRMB 2P8MB 5E8NB 2V5RA 3PHSA 3X17A 1DEDA 4G8FA 1T22A 3VXQA 4YXHH 1I1YA 2X9XA 5IM7B 2A1WH 3QUYC 3GSNH 2Q7NA 1C5CL 2VLJB 2DRUA 3UTZA 5DWUH 2EDRA 4ZUVB 4M8VA 3MGTA 3S37L 1DBKL 4ZO7A 2JJVA 3SKJL 4WWID 3MC0A 1HOCA 4HSQA 5EOQH 1DLFH 5FV1L 3QFJE 1S78C 3V7AG 4A6YB 1E4WH 4MNQB 3C6LA 4O2CB 1BF8A 1A7BA 3DXAD 3QO1B 2R2CA 3DV4B 4L3AA 5B39B 1A9BB 4Z7NE 2ZG3A 2WP3T 43CAA 4AH2B 4GG6B 2KPNA 2BVYA 4F37K 3JWOL 1DQDL 1N26A 3LMJH 3ZZ1A 3QQNA 1WTGT 5FA4A 2C3HA 4PJ8D 1QFHA 3C6SB 5C0RL 3H3KA 5HVFB 1CFSB 3CNKA 5AG9A 2QBWA 3RDTC 5D7LD 4XMPL 1MFEL 3SJVA 1QSEB 3RWHA 4L8SB 1OTTD 5IMKA 3N06B 5IJVB 5C0FB 2B2XH 4F7PB 4PJEA 1GSMA 4Y1AB 4U1HB 3VWJC