3QUNA

Crystal structure of fosfomycin resistance kinase foma from streptomyces wedmorensis complexed with mgatp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
271
structure length
247
Chain Sequence
SGLVPRGSHMTPDFLAIKVGGSLFSRKDEPGSLDDDAVTRFARNFARLAETYRGRMVLISGGGAFFSLAGLTEATFEVKKRWAEKLRGIGVDAFPLQLAAMCTLRNGIPQLRSEVLRDVLDHGALPVLAGDALFDEHGKLWAFSSDRVPEVLLPMVEGRLRVVTLTDVDGIVTDGDTILPEVDARSPEQAYAALWGAMHTKLDALVTCARRGAECFIMRGDPGSDLEFLTAPFSSWPAHVRSTRITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FomA protein
publication title Structural and biochemical insights into the mechanism of fosfomycin phosphorylation by fosfomycin resistance kinase FomA.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Transferase
total genus 68
structure length 247
sequence length 271
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3qunA00
3EK5A 3U6UA 2AP9A 2E9YA 3C1MA 4OLCA 2J5VA 4F6TA 3WWNA 2V5HA 3B8GA 2HMFA 3ZZGA 3K4OA 1YBDA 4NDRB 4A7XA 2WE4A 2J4KA 4JZ8A 3S6GA 3S6KA 3QUOA 2J4JA 2J5TA 4KZTA 2JJXA 2BMUA 4NDOB 4NDPB 4JZ7A 2VA1A 3D40A 3L76A 3QUNA 3QVHA 2BNEA 4NDQB 1B7BA 1OHBA 2OGXA 1OHAA 2AKOA 2J4LA 3KZFA 3QURA 3ZZIA 3AAWA 3T7BA 1GSJA 2RD5A 1GS5A 2A1FA 3S6HA 2X2WA 2BTYA 2JJ4A 3AB4A 2R98A 3L86A 2J0WA 3QVFA 3K4YA 4NDRA 3D2MA 4F6TB 2OGXB 3AB2A 3NWYA 4AB7A 4NDOA 3C1NA 4I49A 3K56A 1Z9DA 2IJ9A 2WXBA 3C20A 2JI5A 4A7WA 3WWMA 3LL5A 4AXSA 1E19A 4NDQA 2BRIA 3EK6A 3TVIA 2R8VA 3LKKA 3D2PA 2CDQA 3LL9A 3K52A 3D41A 2WE5A 2V4YA 2W21A 1OH9A 2BNFA 2BRXA 4USJA 2BUFA 2BNDA 3ZZHA 2J0XA 4NDPA 4JZ9A 3ZZFA 4Q1TA
chains in the Genus database with same CATH superfamily
3EK5A 3U6UA 2AP9A 2E9YA 3C1MA 4OLCA 2J5VA 4F6TA 3WWNA 2V5HA 3B8GA 2HMFA 3ZZGA 3K4OA 1YBDA 4NDRB 4A7XA 2WE4A 2J4KA 4JZ8A 3S6GA 3S6KA 3QUOA 2J4JA 2J5TA 4KZTA 2JJXA 2BMUA 4NDOB 4NDPB 4JZ7A 2VA1A 3D40A 3L76A 3QUNA 3QVHA 2BNEA 4NDQB 1B7BA 1OHBA 2OGXA 1OHAA 2AKOA 2J4LA 3KZFA 3QURA 3ZZIA 3AAWA 3T7BA 1GSJA 2RD5A 1GS5A 2A1FA 3S6HA 2X2WA 2BTYA 2JJ4A 3AB4A 2R98A 3L86A 2J0WA 3QVFA 3K4YA 4NDRA 3D2MA 4F6TB 2OGXB 3AB2A 3NWYA 4AB7A 4NDOA 3C1NA 4I49A 3K56A 1Z9DA 2IJ9A 2WXBA 3C20A 2JI5A 4A7WA 3WWMA 3LL5A 4AXSA 1E19A 4NDQA 2BRIA 3EK6A 3TVIA 2R8VA 3LKKA 3D2PA 2CDQA 3LL9A 3K52A 3D41A 2WE5A 2V4YA 2W21A 1OH9A 2BNFA 2BRXA 4USJA 2BUFA 2BNDA 3ZZHA 2J0XA 4NDPA 4JZ9A 3ZZFA 4Q1TA
chains in the Genus database with same CATH topology
3EK5A 3U6UA 2AP9A 2E9YA 3C1MA 4OLCA 2J5VA 4F6TA 3WWNA 2V5HA 3B8GA 2HMFA 3ZZGA 3K4OA 1YBDA 4NDRB 4A7XA 2WE4A 2J4KA 4JZ8A 3S6GA 3S6KA 3QUOA 2J4JA 2J5TA 4KZTA 2JJXA 2BMUA 4NDOB 4NDPB 4JZ7A 2VA1A 3D40A 3L76A 3QUNA 3QVHA 2BNEA 4NDQB 1B7BA 1OHBA 2OGXA 1OHAA 2AKOA 2J4LA 3KZFA 3QURA 3ZZIA 3AAWA 3T7BA 1GSJA 2RD5A 1GS5A 2A1FA 3S6HA 2X2WA 2BTYA 2JJ4A 3AB4A 2R98A 3L86A 2J0WA 3QVFA 3K4YA 4NDRA 3D2MA 4F6TB 2OGXB 3AB2A 3NWYA 4AB7A 4NDOA 3C1NA 4I49A 3K56A 1Z9DA 2IJ9A 2WXBA 3C20A 2JI5A 4A7WA 3WWMA 3LL5A 4AXSA 1E19A 4NDQA 2BRIA 3EK6A 3TVIA 2R8VA 3LKKA 3D2PA 2CDQA 3LL9A 3K52A 3D41A 2WE5A 2V4YA 2W21A 1OH9A 2BNFA 2BRXA 4USJA 2BUFA 2BNDA 3ZZHA 2J0XA 4NDPA 4JZ9A 3ZZFA 4Q1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EK5 A;  3U6U A;  2AP9 A;  2E9Y A;  3C1M A;  4OLC A;  2J5V A;  4F6T A;  3WWN A;  2V5H A;  3B8G A;  2HMF A;  3ZZG A;  3K4O A;  1YBD A;  4NDR B;  4A7X A;  2WE4 A;  2J4K A;  4JZ8 A;  3S6G A;  3S6K A;  3QUO A;  2J4J A;  2J5T A;  4KZT A;  2JJX A;  2BMU A;  4NDO B;  4NDP B;  4JZ7 A;  2VA1 A;  3D40 A;  3L76 A;  3QUN A;  3QVH A;  2BNE A;  4NDQ B;  1B7B A;  1OHB A;  2OGX A;  1OHA A;  2AKO A;  2J4L A;  3KZF A;  3QUR A;  3ZZI A;  3AAW A;  3T7B A;  1GSJ A;  2RD5 A;  1GS5 A;  2A1F A;  3S6H A;  2X2W A;  2BTY A;  2JJ4 A;  3AB4 A;  2R98 A;  3L86 A;  2J0W A;  3QVF A;  3K4Y A;  4NDR A;  3D2M A;  4F6T B;  2OGX B;  3AB2 A;  3NWY A;  4AB7 A;  4NDO A;  3C1N A;  4I49 A;  3K56 A;  1Z9D A;  2IJ9 A;  2WXB A;  3C20 A;  2JI5 A;  4A7W A;  3WWM A;  3LL5 A;  4AXS A;  1E19 A;  4NDQ A;  2BRI A;  3EK6 A;  3TVI A;  2R8V A;  3LKK A;  3D2P A;  2CDQ A;  3LL9 A;  3K52 A;  3D41 A;  2WE5 A;  2V4Y A;  2W21 A;  1OH9 A;  2BNF A;  2BRX A;  4USJ A;  2BUF A;  2BND A;  3ZZH A;  2J0X A;  4NDP A;  4JZ9 A;  3ZZF A;  4Q1T A; 
#chains in the Genus database with same CATH topology
 3EK5 A;  3U6U A;  2AP9 A;  2E9Y A;  3C1M A;  4OLC A;  2J5V A;  4F6T A;  3WWN A;  2V5H A;  3B8G A;  2HMF A;  3ZZG A;  3K4O A;  1YBD A;  4NDR B;  4A7X A;  2WE4 A;  2J4K A;  4JZ8 A;  3S6G A;  3S6K A;  3QUO A;  2J4J A;  2J5T A;  4KZT A;  2JJX A;  2BMU A;  4NDO B;  4NDP B;  4JZ7 A;  2VA1 A;  3D40 A;  3L76 A;  3QUN A;  3QVH A;  2BNE A;  4NDQ B;  1B7B A;  1OHB A;  2OGX A;  1OHA A;  2AKO A;  2J4L A;  3KZF A;  3QUR A;  3ZZI A;  3AAW A;  3T7B A;  1GSJ A;  2RD5 A;  1GS5 A;  2A1F A;  3S6H A;  2X2W A;  2BTY A;  2JJ4 A;  3AB4 A;  2R98 A;  3L86 A;  2J0W A;  3QVF A;  3K4Y A;  4NDR A;  3D2M A;  4F6T B;  2OGX B;  3AB2 A;  3NWY A;  4AB7 A;  4NDO A;  3C1N A;  4I49 A;  3K56 A;  1Z9D A;  2IJ9 A;  2WXB A;  3C20 A;  2JI5 A;  4A7W A;  3WWM A;  3LL5 A;  4AXS A;  1E19 A;  4NDQ A;  2BRI A;  3EK6 A;  3TVI A;  2R8V A;  3LKK A;  3D2P A;  2CDQ A;  3LL9 A;  3K52 A;  3D41 A;  2WE5 A;  2V4Y A;  2W21 A;  1OH9 A;  2BNF A;  2BRX A;  4USJ A;  2BUF A;  2BND A;  3ZZH A;  2J0X A;  4NDP A;  4JZ9 A;  3ZZF A;  4Q1T A; 
#chains in the Genus database with same CATH homology
 3EK5 A;  3U6U A;  2AP9 A;  2E9Y A;  3C1M A;  4OLC A;  2J5V A;  4F6T A;  3WWN A;  2V5H A;  3B8G A;  2HMF A;  3ZZG A;  3K4O A;  1YBD A;  4NDR B;  4A7X A;  2WE4 A;  2J4K A;  4JZ8 A;  3S6G A;  3S6K A;  3QUO A;  2J4J A;  2J5T A;  4KZT A;  2JJX A;  2BMU A;  4NDO B;  4NDP B;  4JZ7 A;  2VA1 A;  3D40 A;  3L76 A;  3QUN A;  3QVH A;  2BNE A;  4NDQ B;  1B7B A;  1OHB A;  2OGX A;  1OHA A;  2AKO A;  2J4L A;  3KZF A;  3QUR A;  3ZZI A;  3AAW A;  3T7B A;  1GSJ A;  2RD5 A;  1GS5 A;  2A1F A;  3S6H A;  2X2W A;  2BTY A;  2JJ4 A;  3AB4 A;  2R98 A;  3L86 A;  2J0W A;  3QVF A;  3K4Y A;  4NDR A;  3D2M A;  4F6T B;  2OGX B;  3AB2 A;  3NWY A;  4AB7 A;  4NDO A;  3C1N A;  4I49 A;  3K56 A;  1Z9D A;  2IJ9 A;  2WXB A;  3C20 A;  2JI5 A;  4A7W A;  3WWM A;  3LL5 A;  4AXS A;  1E19 A;  4NDQ A;  2BRI A;  3EK6 A;  3TVI A;  2R8V A;  3LKK A;  3D2P A;  2CDQ A;  3LL9 A;  3K52 A;  3D41 A;  2WE5 A;  2V4Y A;  2W21 A;  1OH9 A;  2BNF A;  2BRX A;  4USJ A;  2BUF A;  2BND A;  3ZZH A;  2J0X A;  4NDP A;  4JZ9 A;  3ZZF A;  4Q1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...