3QUNA

Crystal structure of fosfomycin resistance kinase foma from streptomyces wedmorensis complexed with mgatp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
271
structure length
247
Chain Sequence
b'SGLVPRGSHMTPDFLAIKVGGSLFSRKDEPGSLDDDAVTRFARNFARLAETYRGRMVLISGGGAFFSLAGLTEATFEVKKRWAEKLRGIGVDAFPLQLAAMCTLRNGIPQLRSEVLRDVLDHGALPVLAGDALFDEHGKLWAFSSDRVPEVLLPMVEGRLRVVTLTDVDGIVTDGDTILPEVDARSPEQAYAALWGAMHTKLDALVTCARRGAECFIMRGDPGSDLEFLTAPFSSWPAHVRSTRITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FomA protein
publication title Structural and biochemical insights into the mechanism of fosfomycin phosphorylation by fosfomycin resistance kinase FomA.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Transferase
total genus 68
structure length 247
sequence length 271
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3qunA00
2CDQA 1GS5A 1Z9DA 2J5TA 2V4YA 2IJ9A 3L86A 4F6TB 2V5HA 3T7BA 4NDRB 1GSJA 3QURA 2BNEA 3NWYA 4Q1TA 3QUNA 3ZZFA 3AB2A 2JJ4A 2BRIA 2HMFA 3LKKA 3TVIA 3ZZIA 4A7XA 3K56A 3WWNA 4JZ9A 1OH9A 2J4JA 4F6TA 3WWMA 2BMUA 2VA1A 4NDOB 3ZZHA 4KZTA 2WE5A 2BUFA 3LL9A 3C1MA 3C20A 3C1NA 3EK5A 2OGXA 3QUOA 2E9YA 2J0WA 3EK6A 3L76A 1OHBA 4NDRA 3S6GA 4USJA 3D40A 3AB4A 2J4LA 2J4KA 1YBDA 2BNDA 2AP9A 4A7WA 3D2MA 2X2WA 3ZZGA 1OHAA 3K52A 3D2PA 3U6UA 2RD5A 3D41A 3AAWA 4I49A 2A1FA 3KZFA 4NDPB 2J0XA 4NDOA 3QVFA 2BNFA 2WE4A 2J5VA 4JZ7A 4AB7A 3S6HA 3K4YA 4NDQB 4AXSA 3LL5A 2BTYA 2AKOA 4OLCA 2WXBA 2R8VA 3K4OA 2R98A 2W21A 2BRXA 1B7BA 3S6KA 4NDPA 3QVHA 4JZ8A 2JJXA 4NDQA 2OGXB 3B8GA 2JI5A 1E19A
chains in the Genus database with same CATH superfamily
2CDQA 1GS5A 1Z9DA 2J5TA 2V4YA 2IJ9A 3L86A 4F6TB 2V5HA 3T7BA 4NDRB 1GSJA 3QURA 2BNEA 3NWYA 4Q1TA 3QUNA 3ZZFA 3AB2A 2JJ4A 2BRIA 2HMFA 3LKKA 3TVIA 3ZZIA 4A7XA 3K56A 3WWNA 4JZ9A 1OH9A 2J4JA 4F6TA 3WWMA 2BMUA 2VA1A 4NDOB 3ZZHA 4KZTA 2WE5A 2BUFA 3LL9A 3C1MA 3C20A 3C1NA 3EK5A 2OGXA 3QUOA 2E9YA 2J0WA 3EK6A 3L76A 1OHBA 4NDRA 3S6GA 4USJA 3D40A 3AB4A 2J4LA 2J4KA 1YBDA 2BNDA 2AP9A 4A7WA 3D2MA 2X2WA 3ZZGA 1OHAA 3K52A 3D2PA 3U6UA 2RD5A 3D41A 3AAWA 4I49A 2A1FA 3KZFA 4NDPB 2J0XA 4NDOA 3QVFA 2BNFA 2WE4A 2J5VA 4JZ7A 4AB7A 3S6HA 3K4YA 4NDQB 4AXSA 3LL5A 2BTYA 2AKOA 4OLCA 2WXBA 2R8VA 3K4OA 2R98A 2W21A 2BRXA 1B7BA 3S6KA 4NDPA 3QVHA 4JZ8A 2JJXA 4NDQA 2OGXB 3B8GA 2JI5A 1E19A
chains in the Genus database with same CATH topology
2CDQA 1GS5A 1Z9DA 2J5TA 2V4YA 2IJ9A 3L86A 4F6TB 2V5HA 3T7BA 4NDRB 1GSJA 3QURA 2BNEA 3NWYA 4Q1TA 3QUNA 3ZZFA 3AB2A 2JJ4A 2BRIA 2HMFA 3LKKA 3TVIA 3ZZIA 4A7XA 3K56A 3WWNA 4JZ9A 1OH9A 2J4JA 4F6TA 3WWMA 2BMUA 2VA1A 4NDOB 3ZZHA 4KZTA 2WE5A 2BUFA 3LL9A 3C1MA 3C20A 3C1NA 3EK5A 2OGXA 3QUOA 2E9YA 2J0WA 3EK6A 3L76A 1OHBA 4NDRA 3S6GA 4USJA 3D40A 3AB4A 2J4LA 2J4KA 1YBDA 2BNDA 2AP9A 4A7WA 3D2MA 2X2WA 3ZZGA 1OHAA 3K52A 3D2PA 3U6UA 2RD5A 3D41A 3AAWA 4I49A 2A1FA 3KZFA 4NDPB 2J0XA 4NDOA 3QVFA 2BNFA 2WE4A 2J5VA 4JZ7A 4AB7A 3S6HA 3K4YA 4NDQB 4AXSA 3LL5A 2BTYA 2AKOA 4OLCA 2WXBA 2R8VA 3K4OA 2R98A 2W21A 2BRXA 1B7BA 3S6KA 4NDPA 3QVHA 4JZ8A 2JJXA 4NDQA 2OGXB 3B8GA 2JI5A 1E19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CDQ A;  1GS5 A;  1Z9D A;  2J5T A;  2V4Y A;  2IJ9 A;  3L86 A;  4F6T B;  2V5H A;  3T7B A;  4NDR B;  1GSJ A;  3QUR A;  2BNE A;  3NWY A;  4Q1T A;  3QUN A;  3ZZF A;  3AB2 A;  2JJ4 A;  2BRI A;  2HMF A;  3LKK A;  3TVI A;  3ZZI A;  4A7X A;  3K56 A;  3WWN A;  4JZ9 A;  1OH9 A;  2J4J A;  4F6T A;  3WWM A;  2BMU A;  2VA1 A;  4NDO B;  3ZZH A;  4KZT A;  2WE5 A;  2BUF A;  3LL9 A;  3C1M A;  3C20 A;  3C1N A;  3EK5 A;  2OGX A;  3QUO A;  2E9Y A;  2J0W A;  3EK6 A;  3L76 A;  1OHB A;  4NDR A;  3S6G A;  4USJ A;  3D40 A;  3AB4 A;  2J4L A;  2J4K A;  1YBD A;  2BND A;  2AP9 A;  4A7W A;  3D2M A;  2X2W A;  3ZZG A;  1OHA A;  3K52 A;  3D2P A;  3U6U A;  2RD5 A;  3D41 A;  3AAW A;  4I49 A;  2A1F A;  3KZF A;  4NDP B;  2J0X A;  4NDO A;  3QVF A;  2BNF A;  2WE4 A;  2J5V A;  4JZ7 A;  4AB7 A;  3S6H A;  3K4Y A;  4NDQ B;  4AXS A;  3LL5 A;  2BTY A;  2AKO A;  4OLC A;  2WXB A;  2R8V A;  3K4O A;  2R98 A;  2W21 A;  2BRX A;  1B7B A;  3S6K A;  4NDP A;  3QVH A;  4JZ8 A;  2JJX A;  4NDQ A;  2OGX B;  3B8G A;  2JI5 A;  1E19 A; 
#chains in the Genus database with same CATH topology
 2CDQ A;  1GS5 A;  1Z9D A;  2J5T A;  2V4Y A;  2IJ9 A;  3L86 A;  4F6T B;  2V5H A;  3T7B A;  4NDR B;  1GSJ A;  3QUR A;  2BNE A;  3NWY A;  4Q1T A;  3QUN A;  3ZZF A;  3AB2 A;  2JJ4 A;  2BRI A;  2HMF A;  3LKK A;  3TVI A;  3ZZI A;  4A7X A;  3K56 A;  3WWN A;  4JZ9 A;  1OH9 A;  2J4J A;  4F6T A;  3WWM A;  2BMU A;  2VA1 A;  4NDO B;  3ZZH A;  4KZT A;  2WE5 A;  2BUF A;  3LL9 A;  3C1M A;  3C20 A;  3C1N A;  3EK5 A;  2OGX A;  3QUO A;  2E9Y A;  2J0W A;  3EK6 A;  3L76 A;  1OHB A;  4NDR A;  3S6G A;  4USJ A;  3D40 A;  3AB4 A;  2J4L A;  2J4K A;  1YBD A;  2BND A;  2AP9 A;  4A7W A;  3D2M A;  2X2W A;  3ZZG A;  1OHA A;  3K52 A;  3D2P A;  3U6U A;  2RD5 A;  3D41 A;  3AAW A;  4I49 A;  2A1F A;  3KZF A;  4NDP B;  2J0X A;  4NDO A;  3QVF A;  2BNF A;  2WE4 A;  2J5V A;  4JZ7 A;  4AB7 A;  3S6H A;  3K4Y A;  4NDQ B;  4AXS A;  3LL5 A;  2BTY A;  2AKO A;  4OLC A;  2WXB A;  2R8V A;  3K4O A;  2R98 A;  2W21 A;  2BRX A;  1B7B A;  3S6K A;  4NDP A;  3QVH A;  4JZ8 A;  2JJX A;  4NDQ A;  2OGX B;  3B8G A;  2JI5 A;  1E19 A; 
#chains in the Genus database with same CATH homology
 2CDQ A;  1GS5 A;  1Z9D A;  2J5T A;  2V4Y A;  2IJ9 A;  3L86 A;  4F6T B;  2V5H A;  3T7B A;  4NDR B;  1GSJ A;  3QUR A;  2BNE A;  3NWY A;  4Q1T A;  3QUN A;  3ZZF A;  3AB2 A;  2JJ4 A;  2BRI A;  2HMF A;  3LKK A;  3TVI A;  3ZZI A;  4A7X A;  3K56 A;  3WWN A;  4JZ9 A;  1OH9 A;  2J4J A;  4F6T A;  3WWM A;  2BMU A;  2VA1 A;  4NDO B;  3ZZH A;  4KZT A;  2WE5 A;  2BUF A;  3LL9 A;  3C1M A;  3C20 A;  3C1N A;  3EK5 A;  2OGX A;  3QUO A;  2E9Y A;  2J0W A;  3EK6 A;  3L76 A;  1OHB A;  4NDR A;  3S6G A;  4USJ A;  3D40 A;  3AB4 A;  2J4L A;  2J4K A;  1YBD A;  2BND A;  2AP9 A;  4A7W A;  3D2M A;  2X2W A;  3ZZG A;  1OHA A;  3K52 A;  3D2P A;  3U6U A;  2RD5 A;  3D41 A;  3AAW A;  4I49 A;  2A1F A;  3KZF A;  4NDP B;  2J0X A;  4NDO A;  3QVF A;  2BNF A;  2WE4 A;  2J5V A;  4JZ7 A;  4AB7 A;  3S6H A;  3K4Y A;  4NDQ B;  4AXS A;  3LL5 A;  2BTY A;  2AKO A;  4OLC A;  2WXB A;  2R8V A;  3K4O A;  2R98 A;  2W21 A;  2BRX A;  1B7B A;  3S6K A;  4NDP A;  3QVH A;  4JZ8 A;  2JJX A;  4NDQ A;  2OGX B;  3B8G A;  2JI5 A;  1E19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...