3QUNA

Crystal structure of fosfomycin resistance kinase foma from streptomyces wedmorensis complexed with mgatp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
271
structure length
247
Chain Sequence
SGLVPRGSHMTPDFLAIKVGGSLFSRKDEPGSLDDDAVTRFARNFARLAETYRGRMVLISGGGAFFSLAGLTEATFEVKKRWAEKLRGIGVDAFPLQLAAMCTLRNGIPQLRSEVLRDVLDHGALPVLAGDALFDEHGKLWAFSSDRVPEVLLPMVEGRLRVVTLTDVDGIVTDGDTILPEVDARSPEQAYAALWGAMHTKLDALVTCARRGAECFIMRGDPGSDLEFLTAPFSSWPAHVRSTRITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical insights into the mechanism of fosfomycin phosphorylation by fosfomycin resistance kinase FomA.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Transferase
molecule keywords FomA protein
total genus 68
structure length 247
sequence length 271
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3qunA00
4USJA 3QUNA 2CDQA 2BTYA 2J4LA 3C1NA 4NDRB 2J0WA 1Z9DA 3TVIA 1YBDA 2R8VA 2JJXA 3KZFA 3QVHA 1OHBA 2R98A 2VA1A 1B7BA 1OH9A 2BNFA 2WE4A 3WWNA 2WE5A 4JZ9A 2BRIA 3C1MA 4NDPB 2V5HA 4AXSA 2BNDA 3ZZIA 4NDOB 3ZZHA 2JI5A 4KZTA 2W21A 2WXBA 3ZZFA 2BNEA 3C20A 4A7XA 3S6KA 4F6TB 3AB4A 2OGXA 3D2PA 4JZ7A 4Q1TA 2HMFA 3T7BA 3WWMA 4JZ8A 2RD5A 2OGXB 3AAWA 2JJ4A 3QUOA 4OLCA 2AKOA 3QURA 3S6GA 3K4OA 1GSJA 2IJ9A 3D40A 2J4JA 2J5VA 2A1FA 3LKKA 3LL5A 1OHAA 2AP9A 4A7WA 3K4YA 1E19A 4I49A 2BRXA 4NDQB 3ZZGA 3AB2A 4NDOA 3L86A 3LL9A 3EK5A 2J4KA 4NDPA 4NDRA 4AB7A 2X2WA 2V4YA 3K56A 4NDQA 3D2MA 1GS5A 3U6UA 2J0XA 3QVFA 4F6TA 2E9YA 2J5TA 2BMUA 3EK6A 3D41A 3S6HA 3NWYA 3B8GA 3K52A 2BUFA 3L76A
chains in the Genus database with same CATH superfamily
4USJA 3QUNA 2CDQA 2BTYA 2J4LA 3C1NA 4NDRB 2J0WA 1Z9DA 3TVIA 1YBDA 2R8VA 2JJXA 3KZFA 3QVHA 1OHBA 2R98A 2VA1A 1B7BA 1OH9A 2BNFA 2WE4A 3WWNA 2WE5A 4JZ9A 2BRIA 3C1MA 4NDPB 2V5HA 4AXSA 2BNDA 3ZZIA 4NDOB 3ZZHA 2JI5A 4KZTA 2W21A 2WXBA 3ZZFA 2BNEA 3C20A 4A7XA 3S6KA 4F6TB 3AB4A 2OGXA 3D2PA 4JZ7A 4Q1TA 2HMFA 3T7BA 3WWMA 4JZ8A 2RD5A 2OGXB 3AAWA 2JJ4A 3QUOA 4OLCA 2AKOA 3QURA 3S6GA 3K4OA 1GSJA 2IJ9A 3D40A 2J4JA 2J5VA 2A1FA 3LKKA 3LL5A 1OHAA 2AP9A 4A7WA 3K4YA 1E19A 4I49A 2BRXA 4NDQB 3ZZGA 3AB2A 4NDOA 3L86A 3LL9A 3EK5A 2J4KA 4NDPA 4NDRA 4AB7A 2X2WA 2V4YA 3K56A 4NDQA 3D2MA 1GS5A 3U6UA 2J0XA 3QVFA 4F6TA 2E9YA 2J5TA 2BMUA 3EK6A 3D41A 3S6HA 3NWYA 3B8GA 3K52A 2BUFA 3L76A
chains in the Genus database with same CATH topology
4USJA 3QUNA 2CDQA 2BTYA 2J4LA 3C1NA 4NDRB 2J0WA 1Z9DA 3TVIA 1YBDA 2R8VA 2JJXA 3KZFA 3QVHA 1OHBA 2R98A 2VA1A 1B7BA 1OH9A 2BNFA 2WE4A 3WWNA 2WE5A 4JZ9A 2BRIA 3C1MA 4NDPB 2V5HA 4AXSA 2BNDA 3ZZIA 4NDOB 3ZZHA 2JI5A 4KZTA 2W21A 2WXBA 3ZZFA 2BNEA 3C20A 4A7XA 3S6KA 4F6TB 3AB4A 2OGXA 3D2PA 4JZ7A 4Q1TA 2HMFA 3T7BA 3WWMA 4JZ8A 2RD5A 2OGXB 3AAWA 2JJ4A 3QUOA 4OLCA 2AKOA 3QURA 3S6GA 3K4OA 1GSJA 2IJ9A 3D40A 2J4JA 2J5VA 2A1FA 3LKKA 3LL5A 1OHAA 2AP9A 4A7WA 3K4YA 1E19A 4I49A 2BRXA 4NDQB 3ZZGA 3AB2A 4NDOA 3L86A 3LL9A 3EK5A 2J4KA 4NDPA 4NDRA 4AB7A 2X2WA 2V4YA 3K56A 4NDQA 3D2MA 1GS5A 3U6UA 2J0XA 3QVFA 4F6TA 2E9YA 2J5TA 2BMUA 3EK6A 3D41A 3S6HA 3NWYA 3B8GA 3K52A 2BUFA 3L76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4USJ A;  3QUN A;  2CDQ A;  2BTY A;  2J4L A;  3C1N A;  4NDR B;  2J0W A;  1Z9D A;  3TVI A;  1YBD A;  2R8V A;  2JJX A;  3KZF A;  3QVH A;  1OHB A;  2R98 A;  2VA1 A;  1B7B A;  1OH9 A;  2BNF A;  2WE4 A;  3WWN A;  2WE5 A;  4JZ9 A;  2BRI A;  3C1M A;  4NDP B;  2V5H A;  4AXS A;  2BND A;  3ZZI A;  4NDO B;  3ZZH A;  2JI5 A;  4KZT A;  2W21 A;  2WXB A;  3ZZF A;  2BNE A;  3C20 A;  4A7X A;  3S6K A;  4F6T B;  3AB4 A;  2OGX A;  3D2P A;  4JZ7 A;  4Q1T A;  2HMF A;  3T7B A;  3WWM A;  4JZ8 A;  2RD5 A;  2OGX B;  3AAW A;  2JJ4 A;  3QUO A;  4OLC A;  2AKO A;  3QUR A;  3S6G A;  3K4O A;  1GSJ A;  2IJ9 A;  3D40 A;  2J4J A;  2J5V A;  2A1F A;  3LKK A;  3LL5 A;  1OHA A;  2AP9 A;  4A7W A;  3K4Y A;  1E19 A;  4I49 A;  2BRX A;  4NDQ B;  3ZZG A;  3AB2 A;  4NDO A;  3L86 A;  3LL9 A;  3EK5 A;  2J4K A;  4NDP A;  4NDR A;  4AB7 A;  2X2W A;  2V4Y A;  3K56 A;  4NDQ A;  3D2M A;  1GS5 A;  3U6U A;  2J0X A;  3QVF A;  4F6T A;  2E9Y A;  2J5T A;  2BMU A;  3EK6 A;  3D41 A;  3S6H A;  3NWY A;  3B8G A;  3K52 A;  2BUF A;  3L76 A; 
#chains in the Genus database with same CATH topology
 4USJ A;  3QUN A;  2CDQ A;  2BTY A;  2J4L A;  3C1N A;  4NDR B;  2J0W A;  1Z9D A;  3TVI A;  1YBD A;  2R8V A;  2JJX A;  3KZF A;  3QVH A;  1OHB A;  2R98 A;  2VA1 A;  1B7B A;  1OH9 A;  2BNF A;  2WE4 A;  3WWN A;  2WE5 A;  4JZ9 A;  2BRI A;  3C1M A;  4NDP B;  2V5H A;  4AXS A;  2BND A;  3ZZI A;  4NDO B;  3ZZH A;  2JI5 A;  4KZT A;  2W21 A;  2WXB A;  3ZZF A;  2BNE A;  3C20 A;  4A7X A;  3S6K A;  4F6T B;  3AB4 A;  2OGX A;  3D2P A;  4JZ7 A;  4Q1T A;  2HMF A;  3T7B A;  3WWM A;  4JZ8 A;  2RD5 A;  2OGX B;  3AAW A;  2JJ4 A;  3QUO A;  4OLC A;  2AKO A;  3QUR A;  3S6G A;  3K4O A;  1GSJ A;  2IJ9 A;  3D40 A;  2J4J A;  2J5V A;  2A1F A;  3LKK A;  3LL5 A;  1OHA A;  2AP9 A;  4A7W A;  3K4Y A;  1E19 A;  4I49 A;  2BRX A;  4NDQ B;  3ZZG A;  3AB2 A;  4NDO A;  3L86 A;  3LL9 A;  3EK5 A;  2J4K A;  4NDP A;  4NDR A;  4AB7 A;  2X2W A;  2V4Y A;  3K56 A;  4NDQ A;  3D2M A;  1GS5 A;  3U6U A;  2J0X A;  3QVF A;  4F6T A;  2E9Y A;  2J5T A;  2BMU A;  3EK6 A;  3D41 A;  3S6H A;  3NWY A;  3B8G A;  3K52 A;  2BUF A;  3L76 A; 
#chains in the Genus database with same CATH homology
 4USJ A;  3QUN A;  2CDQ A;  2BTY A;  2J4L A;  3C1N A;  4NDR B;  2J0W A;  1Z9D A;  3TVI A;  1YBD A;  2R8V A;  2JJX A;  3KZF A;  3QVH A;  1OHB A;  2R98 A;  2VA1 A;  1B7B A;  1OH9 A;  2BNF A;  2WE4 A;  3WWN A;  2WE5 A;  4JZ9 A;  2BRI A;  3C1M A;  4NDP B;  2V5H A;  4AXS A;  2BND A;  3ZZI A;  4NDO B;  3ZZH A;  2JI5 A;  4KZT A;  2W21 A;  2WXB A;  3ZZF A;  2BNE A;  3C20 A;  4A7X A;  3S6K A;  4F6T B;  3AB4 A;  2OGX A;  3D2P A;  4JZ7 A;  4Q1T A;  2HMF A;  3T7B A;  3WWM A;  4JZ8 A;  2RD5 A;  2OGX B;  3AAW A;  2JJ4 A;  3QUO A;  4OLC A;  2AKO A;  3QUR A;  3S6G A;  3K4O A;  1GSJ A;  2IJ9 A;  3D40 A;  2J4J A;  2J5V A;  2A1F A;  3LKK A;  3LL5 A;  1OHA A;  2AP9 A;  4A7W A;  3K4Y A;  1E19 A;  4I49 A;  2BRX A;  4NDQ B;  3ZZG A;  3AB2 A;  4NDO A;  3L86 A;  3LL9 A;  3EK5 A;  2J4K A;  4NDP A;  4NDR A;  4AB7 A;  2X2W A;  2V4Y A;  3K56 A;  4NDQ A;  3D2M A;  1GS5 A;  3U6U A;  2J0X A;  3QVF A;  4F6T A;  2E9Y A;  2J5T A;  2BMU A;  3EK6 A;  3D41 A;  3S6H A;  3NWY A;  3B8G A;  3K52 A;  2BUF A;  3L76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...