3QUNA

Crystal structure of fosfomycin resistance kinase foma from streptomyces wedmorensis complexed with mgatp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
271
structure length
247
Chain Sequence
SGLVPRGSHMTPDFLAIKVGGSLFSRKDEPGSLDDDAVTRFARNFARLAETYRGRMVLISGGGAFFSLAGLTEATFEVKKRWAEKLRGIGVDAFPLQLAAMCTLRNGIPQLRSEVLRDVLDHGALPVLAGDALFDEHGKLWAFSSDRVPEVLLPMVEGRLRVVTLTDVDGIVTDGDTILPEVDARSPEQAYAALWGAMHTKLDALVTCARRGAECFIMRGDPGSDLEFLTAPFSSWPAHVRSTRITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical insights into the mechanism of fosfomycin phosphorylation by fosfomycin resistance kinase FomA.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Transferase
molecule keywords FomA protein
total genus 68
structure length 247
sequence length 271
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3qunA00
1OH9A 2JJXA 3S6GA 3B8GA 3K56A 2HMFA 3LL9A 2VA1A 2BNFA 4Q1TA 4AXSA 3S6HA 1OHBA 3AB4A 3ZZIA 2WE4A 3D2MA 4I49A 2WXBA 3K4OA 2BNEA 2RD5A 2CDQA 2W21A 4NDPA 2WE5A 3C20A 3QUOA 3LKKA 2J0XA 2J5VA 4A7WA 2OGXB 4USJA 4F6TB 2X2WA 3TVIA 4JZ7A 4NDOA 2BMUA 3L86A 3C1NA 3K4YA 3QVHA 4OLCA 2BNDA 1OHAA 2V5HA 2BUFA 2J5TA 2E9YA 2BRXA 2BTYA 3D40A 4JZ9A 4NDQA 3D2PA 4NDRB 3C1MA 2JJ4A 1GSJA 2AP9A 4NDOB 3T7BA 3NWYA 4JZ8A 2R8VA 2BRIA 3WWNA 3L76A 4NDRA 3ZZGA 3S6KA 4F6TA 3ZZHA 3LL5A 1E19A 2OGXA 2V4YA 3AB2A 3KZFA 4NDPB 2J0WA 3QUNA 3WWMA 4AB7A 1B7BA 1GS5A 3QURA 3ZZFA 2IJ9A 4KZTA 3EK5A 2J4LA 3K52A 2J4KA 3EK6A 3AAWA 3U6UA 2J4JA 2AKOA 2JI5A 3D41A 1Z9DA 2A1FA 4A7XA 1YBDA 4NDQB 3QVFA 2R98A
chains in the Genus database with same CATH superfamily
1OH9A 2JJXA 3S6GA 3B8GA 3K56A 2HMFA 3LL9A 2VA1A 2BNFA 4Q1TA 4AXSA 3S6HA 1OHBA 3AB4A 3ZZIA 2WE4A 3D2MA 4I49A 2WXBA 3K4OA 2BNEA 2RD5A 2CDQA 2W21A 4NDPA 2WE5A 3C20A 3QUOA 3LKKA 2J0XA 2J5VA 4A7WA 2OGXB 4USJA 4F6TB 2X2WA 3TVIA 4JZ7A 4NDOA 2BMUA 3L86A 3C1NA 3K4YA 3QVHA 4OLCA 2BNDA 1OHAA 2V5HA 2BUFA 2J5TA 2E9YA 2BRXA 2BTYA 3D40A 4JZ9A 4NDQA 3D2PA 4NDRB 3C1MA 2JJ4A 1GSJA 2AP9A 4NDOB 3T7BA 3NWYA 4JZ8A 2R8VA 2BRIA 3WWNA 3L76A 4NDRA 3ZZGA 3S6KA 4F6TA 3ZZHA 3LL5A 1E19A 2OGXA 2V4YA 3AB2A 3KZFA 4NDPB 2J0WA 3QUNA 3WWMA 4AB7A 1B7BA 1GS5A 3QURA 3ZZFA 2IJ9A 4KZTA 3EK5A 2J4LA 3K52A 2J4KA 3EK6A 3AAWA 3U6UA 2J4JA 2AKOA 2JI5A 3D41A 1Z9DA 2A1FA 4A7XA 1YBDA 4NDQB 3QVFA 2R98A
chains in the Genus database with same CATH topology
1OH9A 2JJXA 3S6GA 3B8GA 3K56A 2HMFA 3LL9A 2VA1A 2BNFA 4Q1TA 4AXSA 3S6HA 1OHBA 3AB4A 3ZZIA 2WE4A 3D2MA 4I49A 2WXBA 3K4OA 2BNEA 2RD5A 2CDQA 2W21A 4NDPA 2WE5A 3C20A 3QUOA 3LKKA 2J0XA 2J5VA 4A7WA 2OGXB 4USJA 4F6TB 2X2WA 3TVIA 4JZ7A 4NDOA 2BMUA 3L86A 3C1NA 3K4YA 3QVHA 4OLCA 2BNDA 1OHAA 2V5HA 2BUFA 2J5TA 2E9YA 2BRXA 2BTYA 3D40A 4JZ9A 4NDQA 3D2PA 4NDRB 3C1MA 2JJ4A 1GSJA 2AP9A 4NDOB 3T7BA 3NWYA 4JZ8A 2R8VA 2BRIA 3WWNA 3L76A 4NDRA 3ZZGA 3S6KA 4F6TA 3ZZHA 3LL5A 1E19A 2OGXA 2V4YA 3AB2A 3KZFA 4NDPB 2J0WA 3QUNA 3WWMA 4AB7A 1B7BA 1GS5A 3QURA 3ZZFA 2IJ9A 4KZTA 3EK5A 2J4LA 3K52A 2J4KA 3EK6A 3AAWA 3U6UA 2J4JA 2AKOA 2JI5A 3D41A 1Z9DA 2A1FA 4A7XA 1YBDA 4NDQB 3QVFA 2R98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OH9 A;  2JJX A;  3S6G A;  3B8G A;  3K56 A;  2HMF A;  3LL9 A;  2VA1 A;  2BNF A;  4Q1T A;  4AXS A;  3S6H A;  1OHB A;  3AB4 A;  3ZZI A;  2WE4 A;  3D2M A;  4I49 A;  2WXB A;  3K4O A;  2BNE A;  2RD5 A;  2CDQ A;  2W21 A;  4NDP A;  2WE5 A;  3C20 A;  3QUO A;  3LKK A;  2J0X A;  2J5V A;  4A7W A;  2OGX B;  4USJ A;  4F6T B;  2X2W A;  3TVI A;  4JZ7 A;  4NDO A;  2BMU A;  3L86 A;  3C1N A;  3K4Y A;  3QVH A;  4OLC A;  2BND A;  1OHA A;  2V5H A;  2BUF A;  2J5T A;  2E9Y A;  2BRX A;  2BTY A;  3D40 A;  4JZ9 A;  4NDQ A;  3D2P A;  4NDR B;  3C1M A;  2JJ4 A;  1GSJ A;  2AP9 A;  4NDO B;  3T7B A;  3NWY A;  4JZ8 A;  2R8V A;  2BRI A;  3WWN A;  3L76 A;  4NDR A;  3ZZG A;  3S6K A;  4F6T A;  3ZZH A;  3LL5 A;  1E19 A;  2OGX A;  2V4Y A;  3AB2 A;  3KZF A;  4NDP B;  2J0W A;  3QUN A;  3WWM A;  4AB7 A;  1B7B A;  1GS5 A;  3QUR A;  3ZZF A;  2IJ9 A;  4KZT A;  3EK5 A;  2J4L A;  3K52 A;  2J4K A;  3EK6 A;  3AAW A;  3U6U A;  2J4J A;  2AKO A;  2JI5 A;  3D41 A;  1Z9D A;  2A1F A;  4A7X A;  1YBD A;  4NDQ B;  3QVF A;  2R98 A; 
#chains in the Genus database with same CATH topology
 1OH9 A;  2JJX A;  3S6G A;  3B8G A;  3K56 A;  2HMF A;  3LL9 A;  2VA1 A;  2BNF A;  4Q1T A;  4AXS A;  3S6H A;  1OHB A;  3AB4 A;  3ZZI A;  2WE4 A;  3D2M A;  4I49 A;  2WXB A;  3K4O A;  2BNE A;  2RD5 A;  2CDQ A;  2W21 A;  4NDP A;  2WE5 A;  3C20 A;  3QUO A;  3LKK A;  2J0X A;  2J5V A;  4A7W A;  2OGX B;  4USJ A;  4F6T B;  2X2W A;  3TVI A;  4JZ7 A;  4NDO A;  2BMU A;  3L86 A;  3C1N A;  3K4Y A;  3QVH A;  4OLC A;  2BND A;  1OHA A;  2V5H A;  2BUF A;  2J5T A;  2E9Y A;  2BRX A;  2BTY A;  3D40 A;  4JZ9 A;  4NDQ A;  3D2P A;  4NDR B;  3C1M A;  2JJ4 A;  1GSJ A;  2AP9 A;  4NDO B;  3T7B A;  3NWY A;  4JZ8 A;  2R8V A;  2BRI A;  3WWN A;  3L76 A;  4NDR A;  3ZZG A;  3S6K A;  4F6T A;  3ZZH A;  3LL5 A;  1E19 A;  2OGX A;  2V4Y A;  3AB2 A;  3KZF A;  4NDP B;  2J0W A;  3QUN A;  3WWM A;  4AB7 A;  1B7B A;  1GS5 A;  3QUR A;  3ZZF A;  2IJ9 A;  4KZT A;  3EK5 A;  2J4L A;  3K52 A;  2J4K A;  3EK6 A;  3AAW A;  3U6U A;  2J4J A;  2AKO A;  2JI5 A;  3D41 A;  1Z9D A;  2A1F A;  4A7X A;  1YBD A;  4NDQ B;  3QVF A;  2R98 A; 
#chains in the Genus database with same CATH homology
 1OH9 A;  2JJX A;  3S6G A;  3B8G A;  3K56 A;  2HMF A;  3LL9 A;  2VA1 A;  2BNF A;  4Q1T A;  4AXS A;  3S6H A;  1OHB A;  3AB4 A;  3ZZI A;  2WE4 A;  3D2M A;  4I49 A;  2WXB A;  3K4O A;  2BNE A;  2RD5 A;  2CDQ A;  2W21 A;  4NDP A;  2WE5 A;  3C20 A;  3QUO A;  3LKK A;  2J0X A;  2J5V A;  4A7W A;  2OGX B;  4USJ A;  4F6T B;  2X2W A;  3TVI A;  4JZ7 A;  4NDO A;  2BMU A;  3L86 A;  3C1N A;  3K4Y A;  3QVH A;  4OLC A;  2BND A;  1OHA A;  2V5H A;  2BUF A;  2J5T A;  2E9Y A;  2BRX A;  2BTY A;  3D40 A;  4JZ9 A;  4NDQ A;  3D2P A;  4NDR B;  3C1M A;  2JJ4 A;  1GSJ A;  2AP9 A;  4NDO B;  3T7B A;  3NWY A;  4JZ8 A;  2R8V A;  2BRI A;  3WWN A;  3L76 A;  4NDR A;  3ZZG A;  3S6K A;  4F6T A;  3ZZH A;  3LL5 A;  1E19 A;  2OGX A;  2V4Y A;  3AB2 A;  3KZF A;  4NDP B;  2J0W A;  3QUN A;  3WWM A;  4AB7 A;  1B7B A;  1GS5 A;  3QUR A;  3ZZF A;  2IJ9 A;  4KZT A;  3EK5 A;  2J4L A;  3K52 A;  2J4K A;  3EK6 A;  3AAW A;  3U6U A;  2J4J A;  2AKO A;  2JI5 A;  3D41 A;  1Z9D A;  2A1F A;  4A7X A;  1YBD A;  4NDQ B;  3QVF A;  2R98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...