3QUPA

Inhibitor bound structure of the kinase domain of the murine receptor tyrosine kinase tyro3 (sky)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
284
structure length
241
Chain Sequence
EDVLIPFTLGRMLGKGEFGSVREAQLVKVAVKMLSSDIEEFLREAACMKEFDHPHVAKLVGVSLRSIPMVILPFMKHGDLHAFLLASRIPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase receptor TYRO3
publication title Novel and selective spiroindoline-based inhibitors of sky kinase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 77
structure length 241
sequence length 284
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qupA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qupA01
3SXRA 3TZ8A 3W2PA 4BDCA 5DLSA 4TYIA 1RE8A 5KHWA 4FNWA 2WMQA 4E4LA 3GC9A 2W5AA 3HNGA 2JDSA 2W99B 5CNOA 4A06A 2XKEA 5LVMA 2PHKA 3FHIA 3FMMA 3OUNB 3SC1A 3ORPA 3IECA 4RA4A 4J53A 2YIXA 5AP7A 4C35A 3BE9A 3FL5A 5CQUA 5HG7A 4QP2A 2RSVA 2JKQA 3LFQA 4DCEA 1OBGA 3QA8A 4AX8A 2X8EA 3WOWA 5EFQA 3UJGA 4D55A 5CANA 4EH3A 3AC2A 4GL9A 2B1PA 2BILB 4FZFB 4ZS4A 2YLEA 2HXQA 4DBNA 4PDYA 2EXCX 3RAWA 5IQHA 5M09A 4O7NA 4I92A 5FP5A 4FZDB 5DEWA 2FSLX 2X7OA 4GG7A 3RGFA 3ZFYA 4AT4A 5DIAA 5BPYA 4NM3A 4AE6A 4ASZA 3VUDA 2J5EA 5FQDC 5HE2A 3LJ2A 4IVAA 2JFLA 4BCQA 1Y6BA 3CTJA 3ZRLA 2W5BA 2YEXA 2XNMA 1GJOA 2JIUA 2QLUA 4FUXA 4BDGA 3NYVA 3UPZA 3KULA 3VJNA 4RFYA 3C5IA 4GUBA 3W16A 2XNOA 1IASA 1T46A 1BX6A 3FLWA 2QOFA 2XK7A 3NZ0A 4ARKA 3IOKA 2QR8A 1BMKA 4CKRA 4RJ5A 3PA5A 3LFFA 4TYJA 4DH5A 2FYSA 4EK3A 2V62A 2J6MA 4UB7A 3FE3A 4H3BA 4BHZA 4RIXA 1WBOA 1URWA 2W4JA 3NSZA 5IQGA 3EJ1A 3F3VA 4AT3A 1YWNA 3DAEA 4L46A 5K0KA 5E4HA 5EG3A 2C30A 2QOBA 2VWBA 2VTHA 4YZBA 4JDIA 2QOCA 4PRJA 4WRGA 3W32A 5AIRA 4E8AA 4HGEA 2WMVA 4YR8A 4DFYA 2VX3A 3M2WA 3FMEA 4DEDA 3B2TA 3V6RA 2GNIA 4B4LA 1PMEA 4RVTA 2DYLA 1WBNA 2P2HA 5B0XA 2J2IB 4BKJA 4OTDA 4J71A 2ZM1A 3UP2A 5CZHA 5IA1A 4K1BA 4FG7A 2GS7A 3F6XA 4BCOA 1YOMA 3MA3A 3I5NA 4CFVA 3ZFXA 4YJNA 1ZYCA 5BVFA 3PJ1A 1O6LA 4XG8A 3QC4A 1KE6A 1UNGA 3HL7A 4G34A 5IUHA 3R22A 5CU6A 2Z7SA 1U54B 2OSCA 3R8UA 3ZLSA 1XR1A 1X8BA 4O7VA 4EORA 1H1QA 3ENMA 3BWFA 3QCXA 4EK5A 3LMIA 3WZEA 2PZRA 3COMA 2H8HA 3ETAA 3QX4A 4LRJA 4QMTA 3RTPA 4BDBA 5H8GA 3QTZA 1VR2A 3B8RA 4KINA 4DFZE 4ACGA 4QYGA 1JVPP 5DH3A 4PF4A 4J8MA 4PL5A 5DR6A 2JDRA 5GJFA 3BLRA 3WF9A 5JRQA 5K4IA 2PL0A 5ETIA 3RHXA 3I4BA 2PVRA 3GGFA 3CD8A 4L68A 2CCIA 1J3HA 5AP0A 2HZNA 1NVQA 4FTAA 4PTGA 3FPQA 5IISA 2BFXA 1YOLA 4FTKA 3MN3A 3I7BA 2QOLA 3G5DA 1VYWA 3NUSA 4W8EA 5FBNC 4LQMA 4C8BA 3FBVA 5HX8A 3MH1A 3Q3BA 5CVFA 1Y8GA 4UY9A 5FLFA 3LM5A 2V7AA 4ANBA 5AX9A 3QKMA 3G0FA 4MXCA 5EDRA 2QHMA 4XG4A 5CU2A 4KRCA 5IF1A 3MWUA 3AMYA 2HCKA 4DEHA 3KK8A 5AUWA 2GS6A 2O0UA 2W1GA 4JG7A 3FXXA 1DI9A 5LARA 2VTPA 2WTWA 3R1NA 3THBA 3QZFA 2XRWA 5TOZA 4AG8A 3DAJA 1E9HA 5CSHA 5FDPA 3WZUA 3R9RA 1NXKA 3ZM9A 4DN5A 2WMUA 3OWJA 5FXSA 4YJVA 3I6UA 2FH9A 3UGCA 4UMUA 2WMXA 4ASDA 3NUAA 4K11A 4ZY6A 2WB8A 3ULZA 1OUKA 4XLVA 1IA9A 3R00A 5JZNA 4MD8E 3ZSIA 3DA6A 4AN9A 4IE9A 2HW6A 5BVKA 3OTVA 4W9WA 4JBOA 5AP6A 4DINA 5EQPA 3LFDA 4BI2A 2WQMA 1BI8A 2A0CX 2Y4IC 1KV2A 3D7TB 4FEWA 3TTJA 2YWVA 4AGWA 4FG8A 4L44A 2I0YA 5DPVA 4BDFA 4MAOA 5AMNA 4U7ZA 3LAUA 5EQYA 4DF3A 2Y4PA 4EBVA 2H9VA 2UZBA 1JSVA 2X6EA 4QNYA 4OBQA 2W1EA 3DKCA 3EHAA 3JY9A 4R7HA 3V5JA 3LW0A 2HAKA 1PXKA 1BLXA 2C5VA 4ZEGA 2R3IA 5IDPA 5HBHA 3E92A 3C0HA 2YERA 3ZM4A 3S00A 2O63A 3OOGA 5A3XA 1U5RA 4WBOA 2WIPA 4ZK5A 4NJDA 4I6FA 5BVWA 2PE1A 3UYSA 3QD2B 4KKGA 2C4GA 5J7HA 4YSMA 3BYSA 3C50A 4JNWA 3OWPA 3HAVA 2JDOA 4O1PA 1J7IA 5CSXA 5ETFA 1OL2A 5BYLA 2QOHA 1WBWA 1YRPA 5GIPE 4GT5A 3KKVA 1WVXA 1LP4A 3BHVA 5FDXA 2PUIA 2VWUA 3KY2A 3DBCA 5BVDA 5CEKA 5IQDA 3QTRA 3TG1A 5IPJA 3C9WA 3E7VA 2JBOA 4FF8A 4FKPA 2X7GA 3DFAA 1Q8ZA 3UVPA 2QG7A 4JJRA 4BL1A 4BWXA 3PIYA 3LM0A 3AC1A 4FL2A 4X2KA 4U44A 5A14A 2JITA 2CGVA 3DPKA 1JKTA 4V05A 4EHZA 5CAPA 2YJSA 4BY9E 3P7AA 2C0TA 3PWDA 3R73A 2FSTX 4KAOA 4NT4A 5GZ8A 4BCIA 3IDBA 2BZKB 3NUXA 5HKMA 4BDHA 1APME 1P5EA 5H9BA 5HD4A 2JKKA 4EZ5A 4XOYA 3DLSA 4JOAA 4NYEA 4IJ9A 4O91A 2ZV8A 4D1SA 4TNDA 1YXTA 4USEA 2W06A 3OY3A 4S2ZA 4CT2A 3EL7A 4U3ZA 4MYGA 1Q5KA 4XG3A 3O23A 1WMKA 2GNLA 5GZ9A 4BZOA 3R71A 4HCTA 3U51A 2JFMA 1M17A 2UW3A 4FTOA 3C13A 4TNBA 3LIJA 5ANIA 3WZDA 4A4LA 2REIA 4XH6A 3F5PA 5L2WA 3AG9A 4G9CA 5ANGA 3ZZEA 4FEUA 4QMLA 2DWBA 4NFMA 3LXKA 4V0GA 3BGZA 5HESA 4FZAB 2AC3A 4WIHA 3TNWA 3OWLA 5HLPA 4YHTA 4GRBA 1OVEA 4FNYA 1R39A 4X3FB 4IZ5A 3QQGA 3MPAA 1ZYDA 4PMMA 4JQ8A 3S3IA 4HNFA 4I6QA 4C33A 3IS5A 1UA2A 1QPCA 3E3PA 2XNBA 3UNJA 4QPAA 3AD5A 4PPBA 4EH6A 2ZDTA 5L6OA 1UU9A 4FYNA 4KIPA 2QD9A 3DTCA 3ET7A 3KF7A 5JFVA 1ZYSA 5LVPA 4GCJA 4QYYA 2XM8A 4IBMA 2UZDA 1OIYA 3EQDA 2BHHA 4FKVA 5ANDA 3SW4A 2EXEA 4BCPA 5HLWA 1OKZA 2C0OA 4CFMA 3S0OA 5HU3A 1FGIA 1GZOA 3ZUVA 1JAMA 4AN2A 4YP8A 4G3EA 4FT7A 5HO6A 4XRLA 5M4CA 3F3WA 3MVJA 4HVIA 3I81A 4DA5A 2HOGA 3QYWA 2F9GA 5JK3A 4WNMA 5IQFA 3ZDIA 1BUHA 4BI0A 4EYMA 2G2FA 2X8IA 4O38A 3EYGA 1PF8A 3TJDA 3UQCA 4MF1A 3CCNA 4DFUA 3S4QA 4BTJA 2Z8CA 4CZUA 5IKWA 1H8FA 3KMWA 4ACHA 4FKWA 4EHVA 2IW9A 4FVRA 4LG4A 2BAQA 5M57A 1ZWSA 3G2FA 3WF7A 2PSQA 1WVWA 2XIXA 4C34A 1YDTE 5LWNA 4CFXA 4CMTA 3MTLA 3UO5A 3E93A 2FVDA 3MVLA 4F9AA 3VO3A 3SG8A 3QF9A 2NNWB 2BALA 3OXTA 3NNVA 4BCHA 3QTQA 4ZY5A 4IDVA 2IG7A 2IZUA 3PZEA 2BCJA 3LZBA 4D2RA 1MRVA 3EB0A 3FI2A 4L43A 4TN6A 4EH9A 4ENYA 3TM0A 3Q5IA 4RZWA 3V5WA 3IOPA 4YTHA 3RJCA 1UU3A 1B38A 3ZXZA 4ZXTA 4IFCA 4RJ4A 3HECA 2PVJA 2XKCA 1ZY5A 3UMXA 1BKXA 3O7LB 2XNNA 3BX5A 4N70A 4CRLA 3EQRA 5E1EA 1ERKA 1XHAA 4C37A 4WKQA 3IW4A 3ODZX 1J91A 4GEOA 4H1MA 4BTKA 4K8AA 4C61A 4C62A 4F7SA 1M7QA 2QOIA 4IW0A 4AZFA 5CLPA 3C4XA 2PZYA 5J8IA 2ZDUA 5C1QB 5LVNA 1REKA 4MXOA 4WSQA 3TIZA 4U97A 2J0JA 2CN8A 2RFNA 4RJ8A 4MBIA 4NTSA 4QPMA 3E62A 1YW2A 5FRIA 2GQSA 2F2UA 5AM6A 4KD1A 1JSTA 4CRSA 4W4WA 3F9NA 5J87A 4AGUA 4O86A 3EZRA 3HEGA 5E91A 5E8ZA 3TDVA 3VBVA 3AC3A 4JAIA 4D2WA 5HD7A 1Q8WA 4RX7A 1S9JA 4FEVA 4DEAA 1KOBA 4LM5A 4DYMA 5CAQA 2IJMA 4XP3A 2BTRA 2F7XE 2Y9QA 4C7TA 5FBOA 1ZAOA 4KKHA 3SX9A 1ZOGA 2W9ZB 4S31A 4XNEA 5DI1A 5DVRA 4JX7A 4YLJA 3DBFA 3FY0A 4O0RA 4M0ZA 5C01A 4EOSA 5HORA 3R0TA 5DA3A 4FV6A 4TWPA 5ANJA 5I9WA 2I0VA 3LPBA 2W0JA 2R3HA 2VWVA 4YO4A 3HP2A 4D2VA 4B99A 5EHLA 4G3GA 3PE1A 3PY3A 1CKJA 4IHPA 2Y4IB 1P4FA 2IW6A 4DGLC 3KVXA 3S1HA 4WOVA 3NCGA 2BDJA 5I9YA 3HV5A 5IA0A 3WARA 5E8UA 4C4JA 3LHJA 3ALOA 3IW5A 1S9IA 3KCFA 4UMRA 4H3QA 3HAMA 3AC8A 4HGSA 4PDOA 4D58A 4EH7A 4D5KA 4YUQA 4O7TA 4M12A 2XP2A 3KCKA 3OP5A 4WD5A 4F08A 5B7VA 2IPXA 3MBLA 3ZO1A 4IAZA 2E9OA 2WO6A 3RK5A 1XBBA 1KE8A 3GT8A 4WHZA 2CSNA 2W05A 3WBLA 3ORLA 3FZPA 5JKGA 4PMTA 3GNIB 4ANMA 5CEMA 3KFAA 1MQBA 2WMWA 4I24A 5LVLA 5KCVA 2BIKB 5DNRA 5F94A 3VUMA 5IH6A 3GCUA 2IZSA 5GINE 4M66A 3BYOA 3UG2A 3MFUA 4A9UA 1WCCA 4ZLZA 2HZ4A 5BYZA 3HRCA 4EK4A 4EONA 4EK8A 5EDQA 4O27B 4ANLA 3JR1A 1XJDA 4DBXA 2OIDA 3SXFA 2IN6A 5HE0A 2GTMA 4M3QA 4RRVA 3K3IA 2PE2A 3BU5A 3OZ6A 5EM5A 3W2SA 4EOPA 4TRLA 5AR4A 4AFJA 2J0LA 3POOA 2NRYA 3FLQA 3NS9A 4ZLOA 3VQUA 3UOKA 4M7IA 4GK2A 4YJTA 2VV9A 3DJ5A 3T8OA 4LOQA 4OTPA 4PMSA 4A9SA 2Z7LA 3Q32A 1YHWA 3A99A 4O1OA 4FEQA 3Q9XA 1XBCA 2YJRA 4WO5A 3U4WA 4Y5QA 1GOLA 5CXZA 3PLSA 5KNJA 2PZ5A 2VTQA 3U9NA 1WAKA 4JRNA 5EKNA 3SKCA 5L3AA 4A4OA 3TNQB 1GZKA 3PSDA 2OI4X 3W8QA 4CGAA 2IZRA 4FICA 3T9TA 4EBWA 5KMNA 2XIZA 3SGCA 2WEIA 4L45A 1SMHA 5KE0A 3P7CA 3L8SA 4HVDA 5J9ZA 3F2NA 3NLBA 4O22A 4F9CA 4M0YA 3HDMA 4CFUA 1G3NA 3M1SA 3PXRA 1Q41A 4IB3A 2XMYA 5EYCA 3H9RA 5LCJA 1J1CA 2BROA 3V6SA 3WIKA 4FKUA 3DFCB 1XH7A 2C6IA 3I0OA 2VU3A 3DK3A 3Q4ZA 3UPXA 4AZVA 4OTWA 2ZVAA 1P14A 2PULA 5M07A 2ITZA 4IMYA 4L00A 4U5JA 3SAYA 4BTMA 3SA0A 1SZMA 4HNIA 3R9NA 4EHEA 3C0IA 4Z9LA 3FJQE 2YIRA 3AGLA 4I21A 3R9DA 4HVGA 3RCDA 4W4YA 4W4XA 4TYEA 2WQOA 1PXIA 1ZARA 2CHLA 4BR3A 4UEUA 3FLZA 5DOSA 3GU7A 4BRXA 2PY3A 4R7IA 4YO6A 4DEGA 3BQRA 4O81A 5IQBA 5KX8A 3ORKA 3UG1A 4QMQA 2NO3A 1OPJA 1B6CB 5KBQA 2R3PA 4IM2A 1UNLA 4MWHA 4FL1A 2UVZA 2JKMA 2YCFA 2YWPA 3E8CA 3F88A 4I6HA 4RJ7A 1QL6A 3FSKA 4Z16A 2HELA 4JDHA 4A9TA 4B9DA 5HI2A 5CU3A 3GQIA 3POZA 3WE4A 1PYEA 1PJKA 3LVPA 2GNHA 2PMLX 1Y57A 2ETKA 2VUWA 3U4UA 4FG9A 1UVRA 4AA0A 3W2RA 2XEZA 4CCBA 3RK9A 4IJPA 1A48A 3QXPA 2JC6A 3KN6A 4QMNA 4V04A 3QRUA 2VWIA 4L01A 4FTIA 2X6DA 4TYHA 1H00A 2AYPA 3EQGA 4N6YA 4YC3A 4BN1A 3FYJX 3FXZA 3BYVA 4RIXB 1I44A 2E9UA 3O50A 2A19B 4E4MA 2B0QA 2XIRA 4GYGA 4F7JA 3OMVA 3CY3A 5J1VA 4EJ7A 3R63A 2OICA 1Y91A 2VWWA 1STCE 3OHTA 3QD3A 5CI7A 5K0XA 4JT3A 3OBGA 3AXWA 4KKEA 3EN5A 3UQFA 3U87A 3F3UA 4EYJA 2F49A 4YTFA 3BPRA 3FWQA 2R3LA 2C5XA 4EOJA 2ESMA 2JAVA 2YHVA 5G6VA 4BBFA 4IFGA 3TN8A 2UZOA 2NP8A 3FUPA 3MS9A 4ZZMA 1IAJA 5EQEA 2W1CA 1KWPA 4L3LA 4PY1A 3EN4A 1R3CA 3F69A 5BUEA 2KULA 4O83A 3M11A 2WMBA 3TUDA 5EOLA 2WQNA 3I1AA 5HHWA 5LQFA 1WVYA 2VO7A 3H30A 3MH2A 1HCKA 5HNBA 4NUSA 4IAFA 1PYXA 3C4ZA 3ZRKA 3TNHA 1YWRA 5M06A 2FA2A 2GMXA 4CLIA 2P3GX 5FTOA 5CYIA 5CT0A 4P90A 4Y85A 3SOAA 4AQCA 3O17A 3PXQA 2WIHA 4NWMA 3HV3A 4DLJA 5K5NA 4RQKA 4FK3A 1YDRE 1V0PA 3MI9A 2GU8A 4ONAA 4YHJA 4ZTSA 4BTFA 5J5SA 2B9FA 2XK8A 5DR9A 4JLCA 2VD5A 3NUPA 2ZJWA 3EFJA 5JQ8A 4F7NA 3UC3A 4NFNA 3VUHA 2C47A 2J5FA 2WTKC 2KTYA 3LCKA 2V5QA 4ZMEA 1K2PA 2WPAA 4MD7E 3ATTA 1NVSA 3LFEA 3EQFA 3A60A 5AM7A 4D4RA 1E1XA 5F1ZA 2FB8A 2UZWE 3UIMA 1VEBA 1JKLA 3RAKA 3FKLA 5IZFA 2ITQA 1CKPA 1XH5A 5IQAA 2UZVA 1ZZ2A 3I5ZA 3QHWA 4JAJA 2ITYA 3FQHA 4L52A 3ZSHA 3H10A 3DAKA 4L9IA 2XVDA 4GJ3A 3DXNA 2YCQA 4YZCA 3IK3A 1XWSA 2WKMA 4ZY4A 5J1WA 3G9NA 4YGAA 5AR3A 1VYZA 1SYKA 1PMNA 2IZTA 1GAGA 4QP4A 4IX6A 3QTIA 5KKRB 2QCSA 5AR7A 4RQVA 2PTKA 4MXYA 5JMSA 1MUOA 1TKIA 3VWAA 4D1XA 5IA4A 3L8VA 5I3RA 4AACA 1W83A 3LQ3A 4UXLA 1OL1A 3ZLYA 3FZ1A 4YJSA 4MKCA 3CPCA 3UOHA 3TI1A 3VS7A 2QR7A 3C4EA 1LPUA 3HA6A 3HRBA 4N6ZA 1LEZA 3RVGA 4DFXE 5CENA 5FG8A 4LOOA 3A62A 4M15A 3T9IA 5KMKA 3WZKA 4JX3A 4IIRA 4NK9A 4FA2A 4NU1A 4AZEA 3HMMA 4I94A 4ALUA 3AOXA 4P7EA 4RWJA 4HGLA 5KMMA 4FEXA 2R9SA 2FO0A 4AGDA 4CYJA 4FKJA 4F09A 4ZS0A 3DNDA 4AAAA 2XJ1A 4BGHA 5KMOA 4MTAA 2QO7A 3LQ8A 5HBEA 3COHA 4FIIA 2P0CA 5E90A 4IAAA 3ZS5A 3U54A 4GT4A 3OT8A 2OJFE 3VUKA 3BI6A 4D5HA 3RI1A 3VF8A 3C4WA 5KBRA 4GFGA 3RPYA 4GIIA 3UYTA 2PE0A 2XIKA 2JLDA 1SNXA 1UV5A 2W4OA 4MVFA 5JSMA 3CY2A 4EOQA 5FEQA 4FIGA 5DMZA 4R1VA 3K3JA 3HMIA 3W2CA 3D4QA 5I9ZA 4QQJA 4H58A 1M52A 3MIYA 4WUNA 3DS6A 3R1SA 2RFSA 2XNEA 3QTXA 3OFMA 4UMQA 4BWPA 3UBDA 2XUUA 1FVTA 2OZAA 4EOMA 4BBMA 3ULIA 3FXWA 4EH8A 4I5HA 5D7VA 3QYZA 4JDJA 2G01A 3FKNA 4FSNA 3PA3A 5D7AA 4BBEA 2PMOX 4I5MA 3IDPA 3NWWA 4YJOA 3VUGA 4FSWA 5GIOE 3BHUA 5TF9A 3PYYA 4HJOA 3R1YA 2B7AA 2UW4A 4ZLYA 2LGCA 2XCKA 3D0EA 4S32A 1BYGA 1Q8YA 3DK6A 4XEYA 5HU9A 3FMKA 2YAAA 4CYIA 4NKAA 4HCVA 4C3RA 1OKVA 3ZEPA 4UZHA 3MYGA 1YOJA 2BRMA 3G33A 4ZZNA 4WA9A 5HIEA 3CGFA 3VBYA 4ORKA 2OO8X 1SVEA 3TCPA 3DY7A 4RFMA 1IAHA 4ANQA 3ACKA 3AMAA 3IW8A 4C58A 4OW8A 1W84A 5E8YA 4ASXA 4F1OA 4IADA 4HYIA 2UZUE 4G6OA 3NGAA 2OJ9A 2JD5A 2C5OA 2WMRA 5BMMA 3U6IA 4LMNA 3VS6A 4OTQA 1GZNA 4QMUA 5FEDA 4B8LA 3CLYA 3VF9A 4BCJA 5IA2A 2UUEA 4DTAA 1Q3DA 3VBTA 3QALE 5DRDA 5HNIX 3FSFA 2GSFA 3H3CA 2XA4A 3QWKA 2Z7RA 4KIKA 5AEPA 4J96A 5AV3A 3N4VA 4ZTHA 5CX9A 1SNUA 1MP8A 2ITXA 3PJCA 4IWQA 4ZTRA 5I0BA 4N57A 2WMSA 3GU6A 4IVDA 2NPQA 3KRRA 4V0GB 4UN0C 4PL4A 3R1QA 3EZVA 2XBJA 2J4ZA 4IVBA 3TZ9A 2UV2A 4IX5A 4E93A 3EQBA 2ZB1A 1YXVA 2GQRA 3BU6A 4C0TA 2W1FA 4I93A 4JRVA 4LYNA 4PNIA 3SV0A 3VQHA 4ANSA 2PUPA 4BYJA 3LMGA 2YISA 4R5SA 3QQUA 3DQWA 4NCTA 2BAKA 4L6QA 4YJPA 5LVOA 2W1ZA 2OFUA 3GEQA 3ENHA 4NTTA 5AP2A 4FT9A 1IR3A 3PDTA 4AF3A 2OG8A 4Q2AA 2X2KA 3AC5A 3B2WA 3HUBA 3VBXA 1RW8A 1YXSA 2ZV7A 1IRKA 4AW2A 2QKWB 2WQEA 2VX1A 2GNJA 4FSZA 4P4CA 2VTRA 2PU8A 2R2PA 4CQGA 1UU8A 4DE4A 3LXPA 2W9FB 4J7BA 4PPCA 1M14A 3DBDA 3O7LD 2BZJA 2YDJA 3ZU7A 4E3CA 2UW5A 3G0EA 4RMZA 5DG5A 4FUYA 5JZJA 2ITTA 4D28A 1UWHA 4IB5A 2PVHA 3GCQA 2CGXA 3RAIA 5IEVA 2X4FA 2EB2A 2AC5A 3QTSA 3QZHA 5EDPA 2XM9A 2BRGA 3Q53A 4W4VA 2HZIA 4OTHA 3MFTA 3ORTA 3VNTA 4FT0A 3ZEWA 4U81A 5AJQA 4OTFA 4HVSA 4R8QA 2VTNA 3PWYA 2QO2A 2R64A 3DKGA 3Q9YA 4FZ7A 4DEIA 4APCA 4FV9A 3ZBXA 3EFWA 4JR3A 3PPJA 1E1VA 1QPEA 1UU7A 3TJCA 2BDFA 2VTOA 4I41A 4DC2A 3CBLA 3PTGA 2WTKB 3GUBA 3R01A 4F6WA 3Q4UA 5DRBA 2OH4A 1JQHA 3GCPA 3Q6UA 3ROCA 4MXZA 4LGDA 4NL0A 3LXLA 4XP2A 4U40A 5BVNA 2YM3A 3DOGA 2OF2A 1YHVA 2UW9A 3QRKA 3CXWA 4G6LA 2OXYA 2O8YA 2WTDA 3SOCA 3PXYA 4QPSA 5L4QA 2WTVA 3W18A 5LMKC 4LUEA 5HTCA 4QO9A 3PLAE 5IQCA 3NRMA 3NCZA 3LXNA 4M8TA 5AWMA 5CVHA 5HIBA 4AZSA 4F9YA 2QO9A 3BHYA 3PPKA 3QHRA 4KS7A 4U41A 5E1SA 5BMSA 4HYUA 3GCVA 2VN9A 5ITAA 3TACA 3CPBA 1REJA 4QMZA 5HTIA 1FOTA 3BELA 4YZDA 4U6RA 4A9RA 3DK7A 3QWJA 3KRWA 3U8WA 4QMWA 4FSMA 2C5NA 1PXNA 3IW7A 4TT7A 5HE1A 3SLSA 3QUDA 2UW6A 2XK9A 5EM8A 4RWKA 3DXPA 4I4EA 5G1XA 1FPUA 5E9EA 3ZFMA 4RIYA 4N4SA 3PRFA 4RC4A 4XG2A 5AR5A 2YDIA 3ZZWA 4DH1A 3UNKA 5H2UA 4YC8A 3R7OA 4JR7A 3SRVA 3L9LA 4EOIA 3ANQA 4CXAA 4YJQA 3JXWA 4AUAA 4Y46A 4QMYA 2IVSA 3IW6A 3D83A 3C0GA 4YPDA 3COKA 3CC6A 3O96A 4L3JA 4A9YA 1TVOA 3MB6A 3KXGA 2ZYBA 3L1SA 1Q8UA 4U79A 3C4CA 3HVCA 4PL3A 2OIQA 1Q8TA 1XKKA 4YJUA 2YZLA 1XQZA 1XH6A 3TNIA 1CDKA 3Q9WA 1BI7A 4JXFA 2ACXA 3R2YA 3UIBA 3ZLXA 5EHOA 3C51A 4LOPA 4BICA 3EN9A 3OCSA 3QZGA 1JLUE 4DLIA 3BU3A 5F4NA 2C0IA 2OBJA 3CSVA 2QVSE 2B9IA 4ZTLA 3FKOA 3GU4A 3WF8A 4AOJA 5AUZA 3RM7A 1F0QA 1DM2A 2GHLA 3RM6A 3FMHA 4EI4A 4PNKA 4KBKA 5EH0A 4EQMA 5M4FA 3GC0A 3N9XA 3SDJA 4QTDA 1NVRA 3VHKA 3OT3A 5L8LA 5TT7A 5T68A 4ZTMA 2VNYA 3Q2JA 5CSVA 4UWBA 3O0GA 1U54A 4LI5A 2CKEA 4FIJA 2R5TA 4O6EA 3ZRMA 5M56A 4RX9A 3TUBA 5CF8A 4IM0A 5K5XA 1DAYA 4DCAA 4MHAA 4OR5A 4DEBA 2R4BA 4ASEA 5JN2A 2I7QA 5C4KA 4Y83A 3RBWA 3OS3A 4GMYA 4O0SA 3LFBA 4MNFA 3QZIA 1KE5A 1A9UA 1WBTA 4FKQA 4OTIA 3R8ZA 4GT3A 3DQXA 2RIOA 4NW5A 3DT1A 4BDAA 4EH5A 3CKXA 3MFSA 4K18A 4RWLA 2VNWA 4OUCA 2WXVA 1H27A 2YZAA 4RVKA 3F5UA 4RJ3A 4Y72A 5HG8A 5B2MA 2RL5A 2C6LA 1KE9A 5HGIA 3GXLA 4I0TA 4UWYA 4G17A 4FC0A 5EYMA 2WMTA 3F2RA 5GNKA 5K4JA 2CLXA 2VTIA 1PMUA 2YIWA 4GU6A 1LEWA 3QCSA 4TPTA 3R9OA 3GU8A 4GYIA 4O21A 3V5LA 4PQNA 5DWRA 4I22A 4IZ7A 3NNWA 5TO8A 4B6LA 3OCTA 5C8KA 5KO1A 4LGGA 3BGQA 4IZYA 5JH6A 4DTBA 3G9LX 3PP1A 3FZRA 3PUPA 1OITA 4CFFA 4A07A 1H1PA 2IWIA 3GCSA 3KXXA 3Q6WA 5FWKK 3TDWA 5E7RA 2UW7A 2JEDA 3BEGA 4X2GA 1H01A 2ERKA 4E4NA 3DBQA 4CEGA 5BUJA 1H25A 4GVJA 4IAIA 4HPTE 2VO3A 2ZOQA 3C5UA 4I20A 4FKOA 5J9YA 1M2RA 4G3CA 2J51A 1SVGA 2QURA 4Q5HA 1OIRA 4U0IA 2ZAZA 2F57A 1GZ8A 1UKHA 4BI1A 4LL5A 3FLYA 2V7OA 2VGPA 3MIAA 4HPUE 5C4LA 3R8VA 3I6WA 4OTGA 4XOZA 3PXKA 3ZTXA 3ZYAA 4IB1A 4AGCA 4BDDA 3T3UA 1OL7A 3D94A 3KF4A 4XHKB 4ITIA 2PVYA 3D7TA 3CTQA 4F0IA 1U5QA 2E9NA 5T6KA 4CKIA 3TTIA 4D9UA 1P2AA 1ZMUA 3MPTA 4AE9A 4DH3A 2A1AB 3HGKA 4HOKA 4JG8A 4OAVB 3S2PA 3NNUA 3FZSA 4Q9SA 4OT6A 3ZO4A 4C36A 1DS5A 2W96B 2UZTA 4FBXA 4BF2A 4BGGA 5I9VA 4ITJA 4UX9A 3RINA 2R3FA 3GP0A 4XJ0A 4ZTQA 3HX4A 3NIZA 4LGHA 5AUYA 5GZAA 1XH8A 4APPA 2VTJA 4FSUA 4YHFA 1QMZA 2O64A 3VVHA 4BZDA 2GNGA 4CQEA 4NCTC 4QTAA 4YBKA 3T3VA 1F5QA 4F1MA 4RIWB 2CKOA 2OH0E 2QG5A 4IC7A 2Y6OA 2G15A 5E8WA 4QRCA 4FSYA 4IANA 3N51A 2B55A 2GHGA 2B9HA 2HY0A 4Y95A 3V51A 4BC6A 2XK6A 4F9WA 3P1AA 3P5KA 5ACKA 3QRJA 2F7ZE 3EOCA 1IG1A 3RZBA 1JBPE 4Y73A 3NIEA 3DXQA 2OJGA 4O7SA 1ZZLA 2C3KA 2E9PA 3P78A 2J90A 2CCHA 2ZV9A 3GVUA 3MY1A 3OOMA 4H39A 5A46A 5A54A 5CU0A 2J0MB 4AW0A 3UZTA 3HV7A 2ITVA 2Y7JA 3U9CA 2G2HA 3UP7A 3F61A 2W5HA 5HVKA 4AFEA 2VAGA 5HICA 4RWIA 3QQKA 2PUUA 2XEYA 1HCLA 4LL0A 2YM5A 5KMJA 1AD5A 1TQMA 3VHEA 3VW8A 2P55A 3G15A 4MCVA 4O0XA 2V0DA 3DJ6A 4FYOA 2XIYA 4G9RA 5CVGA 5E8TA 1SVHA 2VZ6A 2XF0A 5AUUA 4EHGA 4FK6A 4BFMA 3R7VA 2HWOA 1J7LA 2VWZA 3BBTB 2HXLA 3PJ3A 1UKIA 2I1MA 5HCXA 5KMLA 3QUEA 1B39A 3TV7A 1JPAA 1YQJA 4M84A 4NSTA 4UV0A 1OL6A 4BIBA 4QP3A 2R3NA 4FKLA 3VS2A 1J1BA 4AOIA 4NIFA 1RDQE 3R8LA 1PXPA 3LFSA 2PUNA 4GK4A 4K6ZA 1BL6A 4O84A 3HLLA 1KOAA 3JVRA 2WMAA 5E8XA 4CMOA 2HW7A 1Q99A 2OGVA 3F2AA 3DZQA 3F5XA 3TT0A 5HCYA 4YLKA 3ZUTA 5CAOA 1W82A 2CDZA 3MVMA 3IGOA 2HK5A 4CVAA 4U80A 2QONA 3KU2A 3D5UA 4NZWB 5JRSA 5A4CA 3P23A 4RIOA 3KEXA 4AT5A 2OZOA 2QHNA 3EN7A 4ITHA 3ZO3A 2R3JA 2QC6A 4FOCA 5AFVA 3D2KA 4TTHB 4D2TA 4DGOA 4O7WA 4EC9A 2HIWA 4FTLA 3RNYA 2WTIA 3IDCA 3B8QA 5CAVA 2VX0A 4GK3A 3Q96A 2DQ7X 3KXMA 4E1ZA 2G2IA 2B54A 2SRCA 4F0GA 4ZSAA 1JKSA 3DBEA 3ZCLA 1CTPE 3M42A 3ELJA 4S34A 4WNOA 3ZUUA 3IPHA 1AQ1A 5JFSA 4AZTA 2GTNA 4RC2A 1W0XC 1OL5A 2C3IB 4O2ZA 4L53A 4NM5A 2JDTA 4BGQA 1FGKA 2YIYA 2HWPA 4XBUA 2BTSA 3NX8A 2EWAA 4J99A 5DR2A 1OPLA 3V5TA 5IEYA 2E2BA 4M69A 2X81A 5IMXA 1PW2A 4U3YA 5DHJA 3GU5A 3BHHA 3FMDA 5AV1A 3EQIA 4EKLA 5J5TA 3FQSA 4XUFA 4ALVA 5DBXA 5AX3A 3UIXA 4C57A 1H28A 4KB8A 3MJ1A 3QGYA 5H8BA 3ZOSA 3UO6A 2IO6A 3WILA 4O2PA 4YNOA 1PHKA 4WG3A 4ZP5A 2ITPA 3KREA 2C1AA 3FMJA 5D41A 4RX5A 1PXOA 3KULB 3OWKA 3TL8A 2GQGA 4R5YA 4KSPA 5AAFA 5DN3A 3RNIA 4F7LA 3Q52A 3RALA 3VIDA 3OXZA 3FI8A 3QQFA 3NYOA 4DHFA 1KUTA 3QD4A 3EH9A 3NUYA 1ZXEA 3TXOA 5BNJA 4IXPA 4KS8A 2OXDA 4FOBA 4JBQA 3VS4A 4BWKA 4DGNA 3MV5A 3O8TA 3CJGA 4HZSA 2IVUA 4QYHA 3TNPC 2B53A 3UIUA 4BCNA 2AUHA 5JGBA 4CV9A 3QTUA 4ZMFA 3HKOA 3LFAA 1YI4A 4TWNA 4BDIA 4HVHA 4CZTA 2CMWA 1A06A 3IO7A 3OUKA 3QAME 2RGPA 3PPZA 4UALA 3RKBA 4DG0E 2PYWA 5FEEA 5CQWA 5HG5A 4E73A 4ANOA 1IA8A 3H9FA 3R6XA 5DYJA 3OVVA 3QTWA 3ORZA 1CM8A 3NR9A 5A4LA 3F7ZA 4GVAA 4R3RA 4YNEA 4C4GA 4JS8A 5KZIA 1O6YA 4O7RA 1JSUA 2BKZA 4XBRA 4U45A 4FGBA 4E5WA 3DB6A 1QPJA 2WOUA 3CQEA 4MXAA 3UMWA 3ZLWA 3QRIA 5EM6A 1AGWA 3UDBA 4A7CA 3BZ3A 3EQCA 5HG9A 3RPOA 4EOLA 4ANNA 2W17A 3A7JA 3BLQA 4GFOA 3QCYA 5LJJA 1CSNA 4QT1A 3A61A 3C1XA 5AP1A 3RPSA 2C6TA 5LMKA 4M13A 3EKNA 3ORXA 4X2NA 1Z57A 1H4LA 4XLIA 2XYUA 4BZNA 1PXMA 2YITA 3UQGA 2RG5A 3AQVA 4IB0A 4QYFA 4ALWA 2CNVA 5CEIA 3R9HA 2ZM4A 2YN8A 5C8MA 3FY2A 1ZY4A 4P5ZA 4YZNA 3NVMB 3QD0A 4GIHA 4M14A 5EHYA 2CNUA 3FMLA 4GG5A 4CTCA 4GSBA 4RGJA 5CNNA 5M4IA 4J95A 4YSJA 3QC9A 1XH4A 4DFNA 5BQ0A 3U6JA 1NY3A 4D0XA 3W1FA 2WNTA 1KE7A 4JQEA 3SQQA 4Z7HA 4D4VA 2ZMDA 3R7EA 4QOXA 4JBPA 3BEAA 2VO6A 3OD6X 3DCVA 4U43A 4MNEA 3WYXA 5IUGA 2UZNA 3UZRA 5DE2A 4EUTA 2GNFA 5FGKA 2FSMX 4FV3A 2W4KA 5AUXA 2PVLA 4J98A 4RJ6A 4NW6A 4MF0A 4M97A 3VUIA 3MH3A 4K77A 1R0PA 4XMOA 2BDWA 4QNAA 3EMGA 3R7YA 1Y6AA 2QU6A 2W7XA 2R0UA 3KB7A 3OC1A 4ZZOA 1UNHA 2RFEA 3PG1A 2P4IA 5M4UA 3W2OA 2FGIA 1XO2B 2OXXA 4FV4A 2ITNA 3VRZA 4LRMA 3ACJA 4D0WA 5AAGA 4OTRA 2YM7A 5E8SA 5EI8A 2JIVA 4B8MA 5JFWA 3H9OA 4C4FA 3VRYA 5E92A 4EK6A 4NM0A 4BB4A 2C5YA 4DT9A 2QNJA 4BDEA 5CEQA 3UC4A 4EWHA 3NMUF 4O82A 3L8XA 4Z7GA 4EWQA 4H36A 5K9IA 2R3RA 2YA9A 3REPA 3A7GA 1NW1A 1WBSA 3EKKA 3WE8A 1GIJA 5KZ0A 3WIGA 5BX0A 4EOKA 3R04A 3LOKA 3WYYA 1Q24A 3F5GA 3V8TA 4DFLA 3GFWA 3NYNA 3WZJA 3QQLA 2WFYA 3H0YA 5CSWA 3SHEA 4D4YA 5C8NA 2ETMA 4FTRA 2QOQA 4RBLA 3LE6A 3IKAA 4QMMA 3P86A 3ORIA 4EQUA 4O0YA 3WF5A 4JVGA 4BIDA 3KXZA 3KQ7A 3CP9A 4AP7A 3KXHA 1H08A 1H24A 5DT4A 5L8JA 2XS0A 1LUFA 1OZ1A 3P4KA 1FVRA 3FAAA 3MY5A 2XK4A 2GHMA 2QQ7A 4GW8A 4L7SA 2LAVA 3PVUA 3PJ8A 3DV3A 4R3PA 1OIUA 3V04A 4ACCA 4G16A 4EH4A 2CJMA 3PA4A 4FL3A 3GI3A 3FV8A 4R78A 4EH2A 4NJ3A 4UYNA 2QODA 3GENA 3ZSGA 4G1WA 4U8ZA 1T45A 3JUHA 5LXMA 1ZYLA 3R2BA 3TUCA 3E87A 3FDNA 4FTJA 4O7ZA 5CTPA 4HYHA 4BDKA 3N4TA 4IEBA 4ERWA 4F0FA 3QBNA 4PTCA 4ZJVA 5GJGA 2JIIA 4ENXA 3KRJA 4E6QA 4GKHA 3A7HA 2W1DA 4RIYB 3HRFA 4MBLA 3OEFX 2IVTA 3FI4A 5L6WL 4J1RA 5I9XA 1K9AA 3PSBA 3MDYA 4X3FC 4AS0A 5HO7A 3SRVB 2XH5A 4E6AA 4X0MA 2C6KA 1FMOE 1KSWA 3V8SA 4XG9A 4USFA 2ITUA 4WT6A 3TWJA 5J7BA 2P33A 5EW3A 2ZV2A 2YABA 3R83A 4FTTA 5TE0A 2PMIA 5FXRA 4FI1A 4XYFA 3BGPA 5AV0A 4IDTA 4H3PA 5J79A 3QKLA 5F20A 5IMEA 4EL9A 1YKRA 4XS2A 1ZOHA 5HZNA 4HGTA 4II5A 2F2CB 3R21A 4GKIA 1HOWA 2EUFB 3QGWA 3COIA 4TL0A 5HQ0A 1J7UA 3D2IA 3MGYA 3V01A 4H05A 1Q61A 3HDNA 5D12A 1ATPE 1OKWA 3E8DA 2WELA 3MSSA 5EOBA 3UE4A 3H0ZA 5IA3A 1UWJA 3PSCA 3R7UA 3CR0A 3PVWA 5FD2A 5J95A 4JBVA 4QP8A 3UVQA 4ZSLA 3DDPA 3PIXA 3BE2A 4FNXA 4BKZA 5D11A 2F7EE 5JGAA 3F3TA 2WEVA 4PTEA 3E8NA 4QQ5A 2ZB0A 4NH1A 4XG7A 2XNPA 3E5AA 3E7OA 1R1WA 2I0HA 2OIBA 2B4SB 1Q4LA 1K3AA 4YTIA 3TV6A 4KRDA 4N0SA 1G8SA 4QD6A 3HV6A 5FUTA 3EQPA 4WUAA 2Z02A 4PDPA 4D2PA 4FTNA 3EWHA 5C9CA 1G8AA 2YM6A 4HYSA 2BRNA 2HZ0A 4JL9A 5CU4A 4K33A 5T3QA 2QLQA 4CSVA 4K0YA 2C6OA 2H34A 4IM3A 5L6PA 1XBAA 1YXUA 3A7IA 2R3GA 1WBPA 3BYMA 3Q4CA 2XRUA 3MPMA 5ANKA 3MJ2A 4RX8A 3ODYX 3MESA 5LCKA 1MRYA 3CD3A 4TYGA 3VULA 3ZC6A 2GS2A 4X7QA 2I40A 2HYYA 4X2FA 3DGKA 4L8MA 3MTFA 5I5ZA 3R28A 3CE3A 3BBWA 2OF4A 2BPMA 2O2UA 3BLHA 4I3ZA 5HLNA 4GFMA 5HX6A 5IG1A 5AP4A 3RHKA 4IZAA 2BFYA 3D7ZA 3P79A 4LUDA 4HZRA 5HNGA 3LKMA 1ZYJA 3KMMA 4JG6A 3PVBA 3BYUA 2XCHA 3I79A 3Q4TA 4O0WA 5F9EA 4DH8A 3KVWA 5EW9A 4UMTA 4I0SA 2I6LA 2VO0A 4USDA 1JKKA 1LR4A 1Y8YA 2PZIA 2QU5A 4X21A 4QP1A 4E6DA 2GFSA 1URCA 4B0GA 5GHVA 2JKOA 2YM4A 3GC8A 4PUZA 4FTMA 3AT2A 4XRJA 5IUIA 4GS6A 3MY0A 4F1TA 3N4UA 4F63A 2BUJA 3AC4A 4Y5HA 2VTSA 4UMPA 2ETRA 2OKRA 2VGOA 4MXXA 1OI9A 2Y8OA 3O51A 4YJRA 4Z3VA 1OBDA 2VWXA 1M2PA 3SVVA 3GOKA 4QMOA 4FKTA 1GY3A 3D5WA 3OEZA 4U9AA 4M67A 1Q3WA 5AA8A 3QU0A 4BKYA 1RQQA 2BHEA 4FV5A 4QQCA 1ZMWA 4BIEA 4BCKA 2XJ0A 3VAPA 4L67A 3UNZA 2RG6A 1TQIA 3Q04A 1ZLTA 4KABA 4FVQA 5TKDA 2BZIB 5JT2A 4ZSJA 4I5PA 5EI2A 1V0BA 4YLLA 5CZIA 2X4ZA 3ATSA 2C1BA 2RF9A 4UYAA 4R7BA 3ZXTA 3D9VA 4ZJJA 1W7HA 4JQ7A 3A2CA 2X8DA 2IW8A 4XV1A 4F6UA 4PMPA 4FGRA 2P2IA 3NPCA 1WZYA 3KXNA 2YM8A 2A4LA 3BHTA 4PX6A 2PVMA 4C4HA 5LOHA 2XBAA 4QP9A 5IH4A 3FZTA 1YDSE 4K2RA 2R0IA 3ALNA 4FKGA 4MQ2A 1OB3A 2ZMCA 5HE3A 4FTQA 5IU2A 3E8EA 4XG6A 2UZLA 4OGRA 1OECA 1YWVA 3DKFA 2YIQA 2XNGA 3KGAA 4AU8A 2PZPA 3L8PA 5DT0A 3VUTA 5A4TA 2BZHB 5KHXA 5CWZA 3UTOA 4W8DA 3JYAA 4RLLA 3LLAA 2UVXA 2WU7A 1JWHA 3F66A 3GQLA 5CY3A 5AR8A 3TEIA 4FTUA 2IVVA 4E20A 3QCQA 2HENA 4OBPA 3PFQA 2X2MA 4V01A 1OUYA 3QLFA 4AWIA 3S95A 4W9XA 2WQBA 3R8MA 2X9EA 1EH4A 4JIKA 2QOOA 4F99A 3E3BX 1ZRZA 1G5SA 3MA6A 4ZJIA 5IQIA 2CPKE 4KWPA 4LFIA 4UBAA 4C3PA 3CGOA 3O2MA 3P08A 4MX9A 1MRUA 3F82A 3ZMMA 1L8TA 2QI8A 3OY1A 5AP3A 4ACMA 5AADA 4GH2A 3VC4A 2O5KA 5H3QA 1PKDA 3PZHA 4DG3E 3RCJA 3D15A 2EB3A 1YHSA 3F3ZA 3RK7A 4FNZA 3R30A 5EI6A 4BHNA 4ZIMA 3QQJA 4F6SA 3R8PA 1L3RE 3KA0A 4H1JA 4IAYA 4E26A 3FYKX 4M68A 3NW6A 4BCMA 3HV4A 4TXCA 2XB7A 4O7YA 4RVMA 5CF6A 2VTLA 3DLZA 4YBJA 4G5JA 3SD0A 4RVLA 3CIKA 4FE2A 2NRUA 5FXQA 4MQ1A 1RJBA 3MW1A 3DNEA 4NIFB 4RT7A 4FV1A 4QMVA 4QQTA 5A6NA 1FMKA 3NNXA 5EKOA 3ZC5A 5FTGA 2PVNA 3QRTA 4FR4A 2XYNA 2C3JA 2QKRA 4YZMA 5EYKA 2YDKA 3EYHA 3HMOA 4NKSA 5CASA 3GFEA 4QTBA 2WTJA 3HP5A 5L2IA 5AR2A 4NM7A 3TKHA 4FSTA 4C3FA 2CKPA 3QUPA 5D10A 4CLJA 1YXXA 2C6EA 3FI3A 3L9MA 3VJOA 2YFXA 3BKBA 3LFCA 4DGMA 5BUIA 4YC6A 3PRIA 4ZTNA 3JVSA 3CJFA 4R3CA 3LJ1A 2Y6MA 2BRHA 4CD0A 4I5CA 2VTTA 2G9XA 4S30A 5AA9A 5IEXA 2Q83A 3C4FA 4IQ6A 4X6RA 4GJ2A 1R0EA 4MWIA 3E88A 2OWBA 3PXFA 3TIYA 3ZH8A 4EKKA 4O96A 2ONLA 3BIZA 4QMSA 2VWYA 5I9UA 5C03A 4OAUC 4G31A 4WNPA 4X2JA 2J0IA 3QX2A 2ITWA 3W10A 5CAUA 2X1NA 4MH7A 2OFVA 1PRYA 3A4OX 4FT3A 4KA3A 1YVJA 1QCFA 3UODA 1F3MC 3EIDA 4IACA 4TY1A 5F95A 5EW8A 5AUVA 4CV8A 3NYXA 2WZJA 2BIYA 3DKOA 5TR6A 4M69B 4Q5EA 5HVYA 4ZSGA 4F70A 5IQEA 1PXLA 4WG4A 4RZVA 3PP0A 3FEGA 4CG9A 1ZMVA 3GBZA 1R78A 1OIQA 1PXJA 3CTHA 3E64A 2R3OA 5JGDA 5H8EA 3FHRA 3OW3A 2Z60A 3K5UA 4XV3A 1BL7A 3ERKA 3ZONA 4DFBA 2H6DA 5HO8A 4IWPA 5KUPA 4AOTA 2R3QA 3PXZA 4CG8A 3BCEA 3RWQA 3UVRA 2BKKA 4GU9A 3NAYA 4OLIA 5B2LA 1H0WA 4CCUA 4A4XA 3O8PA 2R3KA 4AA4A 5ANOA 3RPVA 4FIHA 4BVUA 4DH7A 3PVGA 2EVAA 3ORMA 2UW0A 3NUUA 5HEZA 3SXSA 4PV0A 3AD6A 3LCDA 4WNKA 3CEKA 4AXAA 1FBNA 3PJ2A 4MBJA 5L2SA 3AMBA 5DEYA 4ERKA 3VBWA 5M08A 4FTCA 3R02A 3G6GA 4RG0A 2OK1A 3BRBA 3KRXA 4TYHB 3ZO2A 5B2KA 2YCSA 3W8LA 2CLQA 4QTCA 3OW4A 2GDOA 5BVEA 4AN3A 3FQEA 2XKDA 2CN5A 3LLTA 1U59A 4QP6A 3ZDUA 3HMNA 1OGUA 2DS1A 3TZ7A 4C4IA 4G6NA 2R7BA 3P0MA 5AV4A 3RPRA 3I60A 1OPKA 3A8WA 3E63A 3ORNA 4GV1A 1FQ1B 4O0TA 2OJIA 5C26A 5CF4A 4MK0A 3RWPA 3GB2A 2UZEA 3QLGA 4F4PA 4K9YA 3EL8A 1ND4A 5C27A 4FZ6A 1QPDA 5HBJA 4TW9A 5JEBA 4CT1A 5ETCA 3VN9A 2PVKA 5A4QA 2RFDA 2Q0NA 5DFPA 3A4PA 2CGWA 4JDKA 2VTAA 3KRLA 3O71A 4KSQA 4TWOA 2A27A 4ZOGA 2OW3A 4BYIA 1TQPA 5LWMA 5KKRC 4EZ3A 5HCZA 3UO4A 4Z55A 2O3PA 1JOWB 4MD9E 4YURA 1W8CA 3R7GA 5HVJA 4P5QA 4FT5A 3QQHA 4OBOA 3HMPA 2R7IA 4PP9A 2I0EA 4S33A 2UW8A 5J9LA 3A7FA 3CQUA 2DUVA 2C6MA 2FUMA 4EEVA 4PPAA 3FPMA 4E7WA 2PVFA 5I3OA 4TKSA 4OT5A 4UZDA 3ITZA 4J97A 5FTQA 5EK7A 5EM7A 5CEPA 3C7QA 2WD1A 3QL8A 3VS3A 4DG2E 2EU9A 3MH0A 4G5PA 3WF6A 5AUTA 3K2LA 3KN5A 1XH9A 3VS0A 2ERZE 4X3FA 3UOLA 4I4FA 3Q60A 4MNEB 5K3YA 4C38A 3UOJA 2PWLA 3D5VA 1Q62A 3F7WA 3L9PA 3Q9ZA 4KIOA 3TKIA 4O0VA 4C02A 5IDNA 4I23A 1OMWA 4JIAA 1H0VA 1PMVA 2Z2WA 3OF0A 4EZ7A 5A4EA 2E9VA 4QP7A 1OKYA 3L9NA 2BR1A 2F4JA 4XV9A 4CZYB 5CEOA 1V1KA 1GIHA 3SW7A 1MQ4A 2Z7QA 2VRXA 3GOPA 4X3JA 4CNHA 3AD4A 3EFLA 2ITOA 4EQCA 3RZFA 1SM2A 4KUJA 4DT8A 3HYHA 3OCGA 4O7LA 3H4JA 2X9FA 5IH5A 3DDQA 2WTCA 4WBBB 4KNBA 4IWOA 1PKGA 3R7IA 3HA8A 4ACDA 2WOTA 4J8NA 4RPVA 5ETAA 4CTBA 3FL4A 3PY0A 2VTMA 4FV2A 4IX3A 4IX4A 1H07A 4QYEA 3VW6A 2ZM3A 1DI8A 2XKFA 4FX3A 4Q9ZA 5KMIA 3QXOA 4MEDA 2BVAA 4D4SA 4F9BA 2JDVA 4DTKA 2BRBA 5ACBC 5FM3A 4ZSEA 3V8WA 2X7FA 2C3LA 1WFCA 2W1HA 3VS5A 2QOKA 2OLCA 3IGGA 2GFCA 4PWNA 4BDJA 4C4EA 3RMFA 4EUUA 4LRKA 1O9UA 2C6DA 4G3DA 2R3MA 1WBVA 3QKKA 2CGUA 2G1TA 2X0GA 2J50A 4CFWA 3ANRA 5AP5A 4F65A 5CXHA 1H1WA 3W33A 3TKUA 4CFNA 1FVVA 3BV2A 2EXMA 1PY5A 2BAJA 5EYDA 3QA0A 5FM2A 4FKIA 4KBCA 3G90X 4E6CA 2B52A 3UZPA 2PMNX 4FSQA 3JPVA 4DAWA 3LCTA 2B9JA 4IVCA 5ICPA 4L42A 2YAKA 3P9JA 1IEPA 1H26A 2J9MA 4YZ9A 1VJYA 3FMNA 4UXQA 5ANEA 3DZOA 5DGZA 5HIDA 3TV4A 3LMHA 2XJ2A 3G51A 2OZAB 3NW5A 4FIFA 2GCDA 2HY81 5LMAA 3I0QA 4D2SA 3K5VA 3ROYA 4R1YA 4D9TA 4FSRA 4RA5A 3PIZA 4BCFA 4RC3A 3D14A 4P2KA 1I09A 4YMJA 4EJNA 3FLSA 5D9HA 3AGMA 1GIIA 3DTWA 2H96A 4LV5A 5DT3A 4U42A 4XP0A 2CKQA 2J7TA 4TZRA 3QFVA 3W55A 3DU8A 4E5AX 4G2FA 4AW5A 3RAHA 1M7NA 3NEWA 3G6HA 3MVHA 5M55A 2WHBA 2YCRA 3CS9A 3V3VA 4QTEA 3LJ0A 5E8VA 4LV8A 3NAXA 1O6KA 2X2LA 4WRSA 4E4XA 3GC7A 4EOOA 4FIEA 3P7BA 1YI3A 1NA7A 4B7TA 3OG7A 4QMXA 3DB8A 3LCOA 1OM1A 4FV8A 5CS6A 4CMUA 4FV7A 4YTCA 2JBPA 4YU2A 2YACA 3CQWA 1NT2A 1JNKA 1M2QA 2J0KA 4RIWA 4XV2A 2YLFA 3Q5ZA 4NEUA 5A6OA 4O0UA 4IC8A 3MFRA 2V22A 5JFXA 4FVPA 4G3FA 4IAKA 2OU7A 2XK3A 5A9UA 2ONLC 4ZAUA 3II5A 5CI6A 2C69A 4AA5A 4BCGA 4DITA 5CF5A 2C68A 3KMUA 3Q2MA 2FSOX 3KL8A 4FMQA 1U4DA 2RKUA 2WGJA 3IONA 3IQ7A 3JY0A 4FODA 3LCSA 4KIKB 4KIQA 4WG5A 3NVKI 3DJ7A 2O65A 3NUNA 4J52A 2CNQA 5HOAA 3PY1A 5L2QA 3LQ5A 3BV3A 2WAJA 1FINA 1Z5MA 4L7FA 3V5PA 5IA5A 3FZOA 5BVOA 3OTUA 4IWDA 4X6QC 1Z9XA 4C2VA 3W2QA 5HTBA 3OXIA 2Y0AA 3MB7A 1U46A 3O8UA 3CKWA 1DAWA 4AW1A 2W1IA 2PPQA 3VS1A 3OCBA 5BYYA 1GNGA 2XZSA 3SG9A 3RP9A 4R77A 3ZBFA 3WI6A 5M44A 4I0RA 5CT7A 4C59A 2PK9A 4IH8A 5AIKA 1CMKE 3FLNC 2V55A 3KC3A 3ZHPC 1YI6A 4UWCA 4YPSA 5GJDA 1P4OA 4JI9A 2JGZA 3LFNA 5D1JA 4C2WA 4D1ZA 4O6LA 3HUCA 4XCUA 4RLKA 3EN6A 4KBAA 5L2TA 4LMUA 2WU6A 4AZWA 3VBQA 3ID6C 5JQ5A 3EFKA 4RFZA 4TWCA 2BMCA 3FC2A 2Q0BA 4E5BA 3PE2A 3K54A 3NDMA 3OBJA 4DEEA 5AAEA 3U55A 1CKIA 4XX9A 3JS2A 4L3PA 4FV0A 4F64A 3TZMA 4Y8DA 3AT3A 2UVYA 1KV1A 2GPHA 3BWJA 4I1ZA 5M51A 1Q97A 5FP6A 4DGGA 4FKRA 3KK9A 1ZOEA 3NW7A 5LMBA 5M53A 3A8XA 4PP7A 3BQCA 4FKSA 3V5QA 3U6HA 3OROA 3PG3A 3AT4A 3HZTA 4I6BA 5CSPA 1W98A 5CALA 4WSYA 4EC8A 1VZOA 2OJJA 2A2AA 4HCUA 5AV2A 4CKJA 4PDSA 2JAMA 3I7CA 3EQHA 4RSSA 3FC1X 4R6VA 5I4NA 3D5XA 4GUEA 1V0OA 4QMPA 1H1RA 4HW7A 2X39A 5L8KA 4ID7A 3IG7A 1H1SA
chains in the Genus database with same CATH superfamily
3SXRA 3TZ8A 3W2PA 4BDCA 5DLSA 4TYIA 1RE8A 5KHWA 4FNWA 2WMQA 4E4LA 3GC9A 2W5AA 3HNGA 2JDSA 2W99B 5CNOA 4A06A 2XKEA 5LVMA 2PHKA 3FHIA 3FMMA 3OUNB 3SC1A 3ORPA 3IECA 4RA4A 4J53A 2YIXA 5AP7A 4C35A 3BE9A 3FL5A 5CQUA 5HG7A 4QP2A 2RSVA 2JKQA 3LFQA 4DCEA 1OBGA 3QA8A 4AX8A 2X8EA 3WOWA 5EFQA 3UJGA 4D55A 5CANA 4EH3A 3AC2A 4GL9A 1TFFA 2B1PA 2BILB 4FZFB 4ZS4A 2YLEA 2HXQA 4DBNA 4PDYA 2EXCX 3RAWA 5IQHA 5M09A 4O7NA 4I92A 5FP5A 4FZDB 5DEWA 2FSLX 2X7OA 4GG7A 3RGFA 3ZFYA 4AT4A 5DIAA 5BPYA 4NM3A 4AE6A 4ASZA 3VUDA 2J5EA 5FQDC 5HE2A 3LJ2A 4IVAA 2JFLA 4BCQA 1Y6BA 3CTJA 3ZRLA 2W5BA 2YEXA 2XNMA 1GJOA 2JIUA 2QLUA 4FUXA 4BDGA 3NYVA 3UPZA 3KULA 3VJNA 4RFYA 3C5IA 4GUBA 3W16A 1ST4A 2XNOA 1IASA 1T46A 1BX6A 3FLWA 2QOFA 2XK7A 3NZ0A 4ARKA 3IOKA 2QR8A 1BMKA 4CKRA 4RJ5A 3PA5A 3LFFA 4TYJA 4DH5A 2FYSA 4EK3A 2V62A 2J6MA 4UB7A 3FE3A 4H3BA 4O4DA 4RIXA 4BHZA 1WBOA 1URWA 2W4JA 3NSZA 5IQGA 3EJ1A 3F3VA 4AT3A 1YWNA 3DAEA 4L46A 5K0KA 5E4HA 5EG3A 2C30A 2QOBA 2VWBA 2VTHA 4YZBA 4JDIA 2QOCA 4PRJA 4WRGA 3W32A 5AIRA 4E8AA 4HGEA 2WMVA 4YR8A 4DFYA 2VX3A 3M2WA 3FMEA 4DEDA 3B2TA 3V6RA 2GNIA 4B4LA 1PMEA 4RVTA 2DYLA 1WBNA 2P2HA 5B0XA 2J2IB 4BKJA 4OTDA 4J71A 2ZM1A 3UP2A 5CZHA 5IA1A 4K1BA 4FG7A 2GS7A 3F6XA 4BCOA 1YOMA 4MUQA 3MA3A 3I5NA 4CFVA 3ZFXA 4YJNA 1ZYCA 5BVFA 2NYAA 3PJ1A 1O6LA 4XG8A 3QC4A 1KE6A 1UNGA 3HL7A 4G34A 5IUHA 3R22A 5CU6A 2Z7SA 1U54B 2OSCA 3R8UA 3ZLSA 1XR1A 1X8BA 4O7VA 4EORA 1H1QA 3ENMA 3BWFA 3QCXA 4EK5A 3LMIA 3WZEA 2PZRA 3COMA 2H8HA 3ETAA 3QX4A 4LRJA 4QMTA 3RTPA 4BDBA 3BLAA 5H8GA 3QTZA 1VR2A 3B8RA 4KINA 4DFZE 4ACGA 4QYGA 1JVPP 5DH3A 4PF4A 4J8MA 4PL5A 5DR6A 2JDRA 5GJFA 3BLRA 3WF9A 5JRQA 5K4IA 2PL0A 5ETIA 3RHXA 3I4BA 2PVRA 3GGFA 3CD8A 4L68A 2X0PA 2CCIA 1J3HA 5AP0A 2HZNA 1NVQA 4FTAA 4PTGA 3FPQA 5IISA 2BFXA 1YOLA 4FTKA 3MN3A 3I7BA 2QOLA 3G5DA 1VYWA 3NUSA 4W8EA 5FBNC 4LQMA 4C8BA 3FBVA 5HX8A 3MH1A 3Q3BA 3ML1A 5CVFA 1Y8GA 4UY9A 5FLFA 3LM5A 2V7AA 4ANBA 5AX9A 3QKMA 3G0FA 4MXCA 5EDRA 2QHMA 4XG4A 5CU2A 4KRCA 5IF1A 3MWUA 3AMYA 2HCKA 4DEHA 3KK8A 5AUWA 2GS6A 1G8KA 2O0UA 2W1GA 4JG7A 3FXXA 1DI9A 5LARA 2VTPA 2WTWA 3R1NA 3THBA 3QZFA 2XRWA 5TOZA 4AG8A 3DAJA 1E9HA 5CSHA 5FDPA 3WZUA 3R9RA 1NXKA 3ZM9A 4DN5A 2WMUA 3OWJA 5FXSA 4YJVA 3I6UA 2FH9A 3UGCA 4UMUA 2WMXA 4ASDA 3NUAA 4K11A 4ZY6A 2WB8A 3ULZA 1OUKA 4XLVA 1IA9A 3R00A 5JZNA 4MD8E 3ZSIA 3DA6A 4AN9A 4IE9A 2HW6A 5BVKA 3OTVA 4W9WA 4JBOA 5AP6A 4DINA 5EQPA 3LFDA 4BI2A 2WQMA 1BI8A 2A0CX 2Y4IC 1KV2A 3D7TB 4FEWA 3BL9A 4BJJB 3TTJA 2YWVA 4AGWA 4FG8A 4L44A 2I0YA 5DPVA 4BDFA 4MAOA 5AMNA 4U7ZA 3LAUA 5EQYA 4DF3A 2Y4PA 4EBVA 2H9VA 2UZBA 1JSVA 2X6EA 4QNYA 4OBQA 2W1EA 3DKCA 3EHAA 3JY9A 4R7HA 3V5JA 3LW0A 2HAKA 1PXKA 1BLXA 2C5VA 4ZEGA 2R3IA 5IDPA 5HBHA 3E92A 3C0HA 4AXFA 2YERA 3ZM4A 3S00A 2O63A 3OOGA 5A3XA 1U5RA 4WBOA 2WIPA 4ZK5A 4NJDA 4I6FA 5BVWA 2PE1A 3UYSA 3QD2B 4KKGA 2C4GA 5J7HA 4YSMA 3BYSA 3C50A 4JNWA 3OWPA 3HAVA 2JDOA 4O1PA 1J7IA 5CSXA 5ETFA 1OL2A 5BYLA 2QOHA 1WBWA 1YRPA 5GIPE 4GT5A 3KKVA 1WVXA 1LP4A 3BHVA 5FDXA 2PUIA 2VWUA 3KY2A 3DBCA 5BVDA 5CEKA 5IQDA 3QTRA 3TG1A 5IPJA 3C9WA 3E7VA 2JBOA 4FF8A 4FKPA 2X7GA 3DFAA 1Q8ZA 3UVPA 2QG7A 4JJRA 4BL1A 4BWXA 3PIYA 3LM0A 3AC1A 4FL2A 4X2KA 4U44A 5A14A 2JITA 2CGVA 3DPKA 1JKTA 4V05A 4EHZA 5CAPA 2YJSA 4BY9E 3P7AA 2C0TA 3PWDA 3R73A 2FSTX 4KAOA 4NT4A 5GZ8A 4BCIA 3IDBA 2BZKB 3NUXA 5HKMA 4BDHA 1APME 1P5EA 5H9BA 5HD4A 2JKKA 4EZ5A 4XOYA 3DLSA 4JOAA 4NYEA 4IJ9A 4O91A 2ZV8A 4D1SA 4TNDA 1YXTA 4USEA 2W06A 3OY3A 4S2ZA 4CT2A 3EL7A 4U3ZA 4MYGA 1Q5KA 4XG3A 3O23A 1WMKA 2GNLA 5GZ9A 4BZOA 3R71A 4HCTA 3U51A 2JFMA 1M17A 2UW3A 4FTOA 3C13A 4TNBA 3LIJA 5ANIA 3WZDA 4A4LA 2REIA 4XH6A 3F5PA 5L2WA 3AG9A 4G9CA 5ANGA 3ZZEA 4FEUA 4QMLA 2DWBA 4NFMA 3LXKA 4V0GA 3BGZA 5HESA 4FZAB 2AC3A 4WIHA 3TNWA 3W0RA 3OWLA 5HLPA 4YHTA 4GRBA 4DHZA 1OVEA 4FNYA 1R39A 4X3FB 4IZ5A 3QQGA 3MPAA 1ZYDA 4PMMA 4JQ8A 3S3IA 4HNFA 4I6QA 4C33A 3IS5A 1UA2A 1QPCA 3E3PA 2XNBA 3UNJA 4QPAA 3AD5A 4PPBA 4EH6A 2ZDTA 5L6OA 1UU9A 4FYNA 4KIPA 2QD9A 3DTCA 3ET7A 3KF7A 5JFVA 1ZYSA 5LVPA 4GCJA 4QYYA 2XM8A 4IBMA 2UZDA 1OIYA 3EQDA 2BHHA 4FKVA 5ANDA 3SW4A 2EXEA 4BCPA 5HLWA 1OKZA 2C0OA 4CFMA 3S0OA 5HU3A 1FGIA 1GZOA 3ZUVA 1JAMA 4AN2A 4YP8A 4G3EA 4FT7A 5HO6A 4XRLA 5M4CA 3F3WA 3MVJA 4HVIA 3I81A 4DA5A 2HOGA 3QYWA 2F9GA 5JK3A 4WNMA 5IQFA 4LV7A 3ZDIA 1BUHA 4BI0A 4EYMA 2G2FA 2X8IA 4O38A 1XMMA 3EYGA 1PF8A 3TJDA 3UQCA 4MF1A 3CCNA 4DFUA 3S4QA 4BTJA 2Z8CA 4CZUA 3UDTA 5IKWA 1H8FA 3KMWA 4ACHA 4FKWA 4EHVA 2IW9A 4FVRA 4LG4A 2BAQA 5M57A 1ZWSA 2Q83A 3G2FA 3WF7A 2PSQA 1WVWA 2XIXA 4C34A 1YDTE 5LWNA 4CFXA 4CMTA 3MTLA 3UO5A 3E93A 2FVDA 3MVLA 4F9AA 3VO3A 3SG8A 3QF9A 2NNWB 2BALA 3OXTA 3NNVA 4BCHA 3QTQA 4ZY5A 4IDVA 2IG7A 2IZUA 3PZEA 2BCJA 3LZBA 4D2RA 1MRVA 3EB0A 3FI2A 4L43A 4TN6A 4EH9A 4ENYA 3TM0A 3Q5IA 4RZWA 3V5WA 3IOPA 4YTHA 3RJCA 1UU3A 1B38A 3ZXZA 4ZXTA 4IFCA 4RJ4A 3HECA 2PVJA 2XKCA 1ZY5A 3UMXA 1BKXA 3O7LB 2XNNA 3BX5A 4N70A 4CRLA 3EQRA 5E1EA 1ERKA 1XHAA 4C37A 4WKQA 3IW4A 3ODZX 1J91A 4GEOA 4H1MA 4BTKA 4K8AA 4C61A 4C62A 4F7SA 1M7QA 2QOIA 4IW0A 4AZFA 5CLPA 3C4XA 2PZYA 5J8IA 2ZDUA 5C1QB 5LVNA 1REKA 4MXOA 4WSQA 3TIZA 4U97A 2J0JA 2CN8A 2RFNA 4RJ8A 4MBIA 4NTSA 4QPMA 3E62A 1YW2A 5FRIA 2GQSA 2F2UA 5AM6A 4KD1A 1JSTA 4CRSA 4W4WA 3F9NA 5J87A 4AGUA 4O86A 4JMQA 3EZRA 3HEGA 5E91A 5E8ZA 3TDVA 3VBVA 3AC3A 4JAIA 4D2WA 5HD7A 1Q8WA 4RX7A 1S9JA 4FEVA 4DEAA 1KOBA 4LM5A 4DYMA 5CAQA 2IJMA 4XP3A 2BTRA 2F7XE 2Y9QA 4C7TA 5FBOA 1ZAOA 4KKHA 3SX9A 1ZOGA 2W9ZB 4S31A 4XNEA 5DI1A 5DVRA 4JX7A 4YLJA 3DBFA 3FY0A 4O0RA 4M0ZA 5C01A 4EOSA 5HORA 3R0TA 5DA3A 4FV6A 4TWPA 5ANJA 5I9WA 2I0VA 3LPBA 2W0JA 2R3HA 2VWVA 4YO4A 3HP2A 4D2VA 4B99A 5EHLA 4G3GA 3PE1A 3PY3A 1CKJA 4IHPA 2Y4IB 1P4FA 2IW6A 4DGLC 3KVXA 3S1HA 4WOVA 3NCGA 2BDJA 5I9YA 3HV5A 5IA0A 3WARA 5E8UA 4C4JA 3LHJA 3ALOA 3IW5A 1S9IA 3KCFA 4UMRA 4H3QA 3HAMA 3AC8A 4HGSA 4PDOA 4D58A 4EH7A 4D5KA 4YUQA 4O7TA 4M12A 2XP2A 3KCKA 3OP5A 4WD5A 4F08A 5B7VA 2IPXA 3MBLA 1OGYA 3UDSA 3ZO1A 4IAZA 2E9OA 2WO6A 3RK5A 1XBBA 1KE8A 3GT8A 4WHZA 2CSNA 2W05A 3WBLA 3ORLA 3FZPA 5JKGA 4PMTA 3GNIB 4ANMA 5CEMA 3KFAA 1MQBA 2WMWA 4I24A 5LVLA 5KCVA 2BIKB 5DNRA 5F94A 3VUMA 5IH6A 3GCUA 2IZSA 5GINE 4M66A 3BYOA 3UG2A 3MFUA 4A9UA 1WCCA 4ZLZA 2HZ4A 5BYZA 3HRCA 4EK4A 4EONA 4EK8A 5EDQA 4O27B 4ANLA 3JR1A 1XJDA 4DBXA 2OIDA 1TZDA 3SXFA 2IN6A 5HE0A 2GTMA 4M3QA 4RRVA 3K3IA 2PE2A 3BU5A 3OZ6A 5EM5A 3W2SA 4EOPA 4TRLA 5AR4A 4AFJA 2J0LA 3POOA 2NRYA 3FLQA 3NS9A 4ZLOA 3VQUA 3UOKA 4M7IA 4GK2A 4YJTA 2VV9A 3DJ5A 3T8OA 4LOQA 4OTPA 4PMSA 4A9SA 2Z7LA 3Q32A 1YHWA 3A99A 4O1OA 4FEQA 3Q9XA 1XBCA 2YJRA 4WO5A 3U4WA 4Y5QA 1GOLA 5CXZA 3PLSA 5KNJA 2PZ5A 2VTQA 3U9NA 1WAKA 4JRNA 5EKNA 3SKCA 5L3AA 4A4OA 3TNQB 1GZKA 3PSDA 2OI4X 3W8QA 4CGAA 2IZRA 4FICA 3T9TA 4EBWA 5KMNA 2XIZA 3SGCA 2WEIA 4L45A 1SMHA 5KE0A 3P7CA 3L8SA 4HVDA 5J9ZA 3F2NA 3NLBA 4O22A 4F9CA 4M0YA 3HDMA 4CFUA 1G3NA 3M1SA 3PXRA 1Q41A 4IB3A 2XMYA 5EYCA 3H9RA 5LCJA 1J1CA 2BROA 3V6SA 3WIKA 4FKUA 3DFCB 1XH7A 2C6IA 3I0OA 2VU3A 3DK3A 3Q4ZA 3UPXA 4AZVA 4OTWA 2ZVAA 1P14A 2PULA 5M07A 2ITZA 4IMYA 4L00A 4U5JA 3SAYA 4BTMA 3SA0A 1SZMA 4HNIA 3R9NA 4EHEA 3C0IA 4Z9LA 3FJQE 2YIRA 3AGLA 4I21A 3R9DA 4HVGA 3RCDA 3KIOC 4W4YA 4W4XA 4TYEA 2WQOA 1PXIA 1ZARA 2CHLA 4BR3A 4UEUA 3FLZA 5DOSA 3GU7A 4BRXA 2PY3A 4R7IA 4YO6A 4DEGA 3BQRA 4O81A 5IQBA 5KX8A 3ORKA 3UG1A 4QMQA 2NO3A 1OPJA 1B6CB 5KBQA 2R3PA 4IM2A 1UNLA 4MWHA 4FL1A 2UVZA 2JKMA 2YCFA 2YWPA 3E8CA 3F88A 4I6HA 4RJ7A 1QL6A 3FSKA 4Z16A 2HELA 4JDHA 4A9TA 4B9DA 5HI2A 5CU3A 3GQIA 3POZA 3WE4A 1PYEA 1PJKA 3LVPA 2GNHA 2PMLX 1Y57A 2ETKA 2VUWA 3U4UA 4FG9A 1UVRA 2XAMA 4AA0A 3W2RA 2XEZA 4CCBA 3RK9A 4IJPA 1A48A 3QXPA 2JC6A 3KN6A 4QMNA 4V04A 3QRUA 2VWIA 4L01A 4FTIA 2X6DA 4TYHA 1H00A 2AYPA 3EQGA 4N6YA 4YC3A 4BN1A 3FYJX 3FXZA 3BYVA 4RIXB 1I44A 2E9UA 3O50A 2A19B 4E4MA 2B0QA 2XIRA 4GYGA 4F7JA 3OMVA 3CY3A 5J1VA 3W0MA 3R63A 2OICA 4EJ7A 1Y91A 2VWWA 1STCE 3OHTA 3QD3A 5CI7A 5K0XA 4JT3A 3OBGA 3AXWA 4KKEA 3EN5A 3UQFA 3U87A 3F3UA 4EYJA 2F49A 4YTFA 3BPRA 3FWQA 2R3LA 2C5XA 4EOJA 2ESMA 2JAVA 2YHVA 5G6VA 4BBFA 4IFGA 3TN8A 2UZOA 2NP8A 3FUPA 3MS9A 4ZZMA 1IAJA 5EQEA 2W1CA 1KWPA 4L3LA 4PY1A 3EN4A 1R3CA 3F69A 5BUEA 2KULA 4O83A 3M11A 2WMBA 3TUDA 5EOLA 2WQNA 3I1AA 5HHWA 5LQFA 1WVYA 2VO7A 3H30A 3MH2A 1HCKA 5HNBA 4NUSA 3AKJA 4IAFA 1PYXA 3C4ZA 3ZRKA 3TNHA 1YWRA 5M06A 2FA2A 2GMXA 4CLIA 2P3GX 5FTOA 5CYIA 5CT0A 4P90A 4Y85A 3SOAA 4AQCA 3O17A 3PXQA 2WIHA 4NWMA 3HV3A 4DLJA 5K5NA 4RQKA 4FK3A 1YDRE 1V0PA 3MI9A 2GU8A 4ONAA 4YHJA 4ZTSA 4BTFA 5J5SA 2B9FA 2XK8A 5DR9A 4JLCA 2VD5A 3NUPA 2ZJWA 3EFJA 5JQ8A 4F7NA 3UC3A 4NFNA 3VUHA 2C47A 2J5FA 2WTKC 2KTYA 3LCKA 2V5QA 4ZMEA 1K2PA 2WPAA 4MD7E 3ATTA 1NVSA 3LFEA 3EQFA 3A60A 5AM7A 4D4RA 1E1XA 5F1ZA 2FB8A 2UZWE 3UIMA 1VEBA 1JKLA 3RAKA 3FKLA 5IZFA 2ITQA 1CKPA 1XH5A 3PUFC 2AQXA 1ZZ2A 2UZVA 3I5ZA 3QHWA 4JAJA 2ITYA 3FQHA 4L52A 3ZSHA 3H10A 3DAKA 4L9IA 2XVDA 4GJ3A 3DXNA 2YCQA 4YZCA 3IK3A 1XWSA 2WKMA 4ZY4A 5J1WA 3G9NA 4YGAA 5AR3A 1VYZA 1SYKA 1PMNA 2IZTA 1GAGA 4QP4A 4IX6A 3QTIA 5KKRB 2QCSA 5AR7A 4RQVA 2PTKA 4MXYA 5JMSA 1MUOA 1TKIA 3VWAA 4D1XA 5IA4A 3L8VA 5I3RA 4AACA 1W83A 3LQ3A 4UXLA 1OL1A 3ZLYA 3FZ1A 4YJSA 4MKCA 3CPCA 3UOHA 3TI1A 3VS7A 2QR7A 3C4EA 1LPUA 3HA6A 3HRBA 4N6ZA 1LEZA 3RVGA 4DFXE 5CENA 4FJVA 5FG8A 4LOOA 3A62A 4M15A 3T9IA 5KMKA 3WZKA 4JX3A 4IIRA 4NK9A 4FA2A 4NU1A 4AZEA 3HMMA 4I94A 4ALUA 3AOXA 4P7EA 4RWJA 4HGLA 5KMMA 4FEXA 2R9SA 2FO0A 4AGDA 4CYJA 4FKJA 4F09A 4ZS0A 3DNDA 4AAAA 2XJ1A 4BGHA 5KMOA 4MTAA 2QO7A 3LQ8A 5HBEA 3COHA 4FIIA 2P0CA 5E90A 4IAAA 3ZS5A 3U54A 4GT4A 3OT8A 2OJFE 3VUKA 3BI6A 4D5HA 3RI1A 3VF8A 3C4WA 5KBRA 4GFGA 3RPYA 4GIIA 3UYTA 2PE0A 2XIKA 2JLDA 1SNXA 1UV5A 2W4OA 4MVFA 5JSMA 3CY2A 4EOQA 5FEQA 4FIGA 5DMZA 4R1VA 3K3JA 3HMIA 3W2CA 3D4QA 5I9ZA 3UDZA 4QQJA 4H58A 1M52A 3MIYA 4WUNA 3DS6A 3R1SA 2RFSA 2XNEA 3QTXA 3OFMA 4UMQA 4BWPA 3UBDA 2XUUA 1FVTA 2OZAA 4EOMA 4BBMA 3ULIA 3FXWA 4EH8A 4I5HA 5D7VA 3QYZA 4JDJA 2G01A 3FKNA 4FSNA 3PA3A 5D7AA 4BBEA 2PMOX 4I5MA 3IDPA 3NWWA 4YJOA 3VUGA 4FSWA 5GIOE 3BHUA 5TF9A 3PYYA 4HJOA 3R1YA 2B7AA 2UW4A 4ZLYA 2LGCA 2XCKA 3D0EA 4S32A 1BYGA 1Q8YA 3DK6A 4XEYA 5HU9A 3W0NA 3FMKA 3W0QA 2YAAA 4CYIA 4NKAA 4HCVA 4C3RA 1OKVA 3ZEPA 4UZHA 3MYGA 1YOJA 2BRMA 3G33A 4ZZNA 4WA9A 5HIEA 3CGFA 3VBYA 4ORKA 2OO8X 1SVEA 3TCPA 3DY7A 4RFMA 1IAHA 4ANQA 3ACKA 3AMAA 3IW8A 4C58A 4OW8A 1W84A 5E8YA 4ASXA 4F1OA 4IADA 4HYIA 2UZUE 4G6OA 3NGAA 2OJ9A 2JD5A 2C5OA 2WMRA 5BMMA 3U6IA 4LMNA 3VS6A 4OTQA 1GZNA 4QMUA 5FEDA 4B8LA 3CLYA 3VF9A 4BCJA 5IA2A 2UUEA 4DTAA 1Q3DA 3VBTA 3QALE 5DRDA 5HNIX 3FSFA 2GSFA 3H3CA 2XA4A 3QWKA 2Z7RA 4KIKA 5AEPA 4J96A 5AV3A 3N4VA 4ZTHA 5CX9A 1SNUA 1MP8A 2ITXA 3PJCA 4IWQA 4ZTRA 5I0BA 4N57A 2WMSA 3GU6A 4IVDA 2NPQA 3KRRA 4V0GB 4UN0C 4PL4A 3R1QA 3EZVA 2XBJA 2J4ZA 4IVBA 3TZ9A 2UV2A 4IX5A 4E93A 3EQBA 2ZB1A 4AAYA 1YXVA 2GQRA 3BU6A 4C0TA 2W1FA 4I93A 4JRVA 4LYNA 4PNIA 3SV0A 3VQHA 4ANSA 2PUPA 4BYJA 3LMGA 2YISA 4R5SA 3QQUA 3DQWA 4NCTA 2BAKA 4L6QA 4YJPA 5LVOA 2W1ZA 2OFUA 3GEQA 3ENHA 4NTTA 5AP2A 4FT9A 1IR3A 3PDTA 4AF3A 2OG8A 4Q2AA 2X2KA 3AC5A 3B2WA 3HUBA 3VBXA 1RW8A 1YXSA 2ZV7A 1IRKA 4AW2A 2QKWB 2WQEA 2VX1A 2GNJA 4FSZA 4P4CA 2VTRA 2PU8A 2R2PA 4CQGA 1UU8A 4DE4A 3LXPA 2W9FB 4J7BA 4PPCA 1M14A 3DBDA 4DDIA 3O7LD 2BZJA 2YDJA 3ZU7A 4E3CA 2UW5A 3G0EA 4RMZA 5DG5A 4FUYA 5JZJA 2ITTA 4D28A 1UWHA 4IB5A 2PVHA 3GCQA 2CGXA 4DDGA 3RAIA 5IEVA 2X4FA 2EB2A 2AC5A 3QTSA 3QZHA 5EDPA 2XM9A 2BRGA 3Q53A 4W4VA 2HZIA 4OTHA 3MFTA 3ORTA 3VNTA 4FT0A 3ZEWA 4U81A 5AJQA 4OTFA 4HVSA 4R8QA 2VTNA 3PWYA 2QO2A 2R64A 3DKGA 3Q9YA 4FZ7A 4DEIA 4APCA 4FV9A 3ZBXA 3EFWA 4JR3A 3PPJA 1E1VA 1QPEA 1UU7A 3TJCA 2BDFA 2VTOA 4I41A 4DC2A 3CBLA 3PTGA 2WTKB 3GUBA 3R01A 4F6WA 3Q4UA 5DRBA 2OH4A 1JQHA 3GCPA 3Q6UA 3ROCA 4MXZA 4LGDA 4NL0A 3LXLA 4XP2A 4U40A 5BVNA 2YM3A 3DOGA 2OF2A 1YHVA 2UW9A 3QRKA 3CXWA 4G6LA 2OXYA 2O8YA 2WTDA 3SOCA 3PXYA 4QPSA 5L4QA 2WTVA 3W18A 3O5AA 5LMKC 4LUEA 5HTCA 4QO9A 3PLAE 5IQCA 3NRMA 3NCZA 3LXNA 4M8TA 5AWMA 5CVHA 5HIBA 4O4EA 4AZSA 2QO9A 4F9YA 3BHYA 3PPKA 3QHRA 4KS7A 4U41A 5E1SA 5BMSA 4HYUA 3GCVA 2VN9A 5ITAA 3TACA 3CPBA 1REJA 4QMZA 5HTIA 1FOTA 3BELA 4YZDA 1W2CA 4U6RA 3DK7A 3QWJA 4A9RA 3KRWA 3U8WA 4QMWA 4FSMA 2C5NA 1PXNA 3IW7A 4TT7A 5HE1A 3SLSA 3QUDA 2UW6A 2XK9A 5EM8A 4RWKA 3DXPA 4I4EA 5G1XA 1FPUA 5E9EA 3ZFMA 4RIYA 4N4SA 3PRFA 4RC4A 4XG2A 5AR5A 2YDIA 3ZZWA 4DH1A 3UNKA 5H2UA 4YC8A 3R7OA 4JR7A 3SRVA 3L9LA 4EOIA 3ANQA 4CXAA 4YJQA 3JXWA 4AUAA 4Y46A 4QMYA 2IVSA 3IW6A 3D83A 3C0GA 4YPDA 3COKA 4O4BB 3CC6A 3O96A 4L3JA 4A9YA 1TVOA 3MB6A 4I6LA 3KXGA 2ZYBA 3L1SA 1Q8UA 4U79A 3C4CA 3HVCA 4PL3A 2OIQA 1Q8TA 1XKKA 4YJUA 2YZLA 1XQZA 1XH6A 3TNIA 1CDKA 3Q9WA 1BI7A 4JXFA 2ACXA 3R2YA 3UIBA 3ZLXA 5EHOA 3C51A 4LOPA 4BICA 3EN9A 3OCSA 3QZGA 1JLUE 4DLIA 3BU3A 5F4NA 2C0IA 2OBJA 3CSVA 2QVSE 2B9IA 4ZTLA 3FKOA 3GU4A 3WF8A 4AOJA 5AUZA 3RM7A 1F0QA 1DM2A 2GHLA 3RM6A 3FMHA 4EI4A 4PNKA 4KBKA 5EH0A 4EQMA 5M4FA 3GC0A 3N9XA 3SDJA 4QTDA 1NVRA 3VHKA 3OT3A 5L8LA 5TT7A 5T68A 4ZTMA 2VNYA 3Q2JA 5CSVA 4UWBA 3O0GA 1U54A 4LI5A 2CKEA 4FIJA 2R5TA 4O6EA 3ZRMA 5M56A 4RX9A 3TUBA 5CF8A 4IM0A 5K5XA 1DAYA 4DCAA 4MHAA 4OR5A 4DEBA 2R4BA 4ASEA 5JN2A 2I7QA 5C4KA 4AXCA 4Y83A 3RBWA 3OS3A 4GMYA 4O0SA 3LFBA 4MNFA 3QZIA 1KE5A 1A9UA 1WBTA 4FKQA 1W2FA 4OTIA 3R8ZA 4GT3A 3DQXA 2RIOA 3W0PA 4NW5A 3DT1A 4BDAA 4EH5A 3CKXA 3MFSA 4K18A 4RWLA 2VNWA 4OUCA 2WXVA 1H27A 2YZAA 4RVKA 3F5UA 4RJ3A 4Y72A 5HG8A 5B2MA 2RL5A 2C6LA 1KE9A 5HGIA 3GXLA 4I0TA 4UWYA 4G17A 4FC0A 5EYMA 2WMTA 3F2RA 5GNKA 5K4JA 2CLXA 2VTIA 1PMUA 2YIWA 4GU6A 1LEWA 3QCSA 4TPTA 3R9OA 3GU8A 4GYIA 4O21A 3V5LA 4PQNA 5DWRA 4I22A 4IZ7A 3NNWA 5TO8A 4B6LA 3OCTA 5C8KA 5KO1A 4LGGA 3BGQA 4IZYA 5JH6A 4DTBA 3G9LX 3PP1A 3FZRA 3PUPA 1OITA 4CFFA 4A07A 1H1PA 2IWIA 3GCSA 3KXXA 3Q6WA 5FWKK 3TDWA 5E7RA 2UW7A 2JEDA 3BEGA 4X2GA 1H01A 2ERKA 4E4NA 3DBQA 4CEGA 5BUJA 1H25A 4GVJA 4IAIA 4HPTE 2VO3A 2ZOQA 3C5UA 4I20A 4FKOA 5J9YA 1M2RA 4G3CA 2J51A 1SVGA