3QUQA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, an open cap conformation
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
225
structure length
225
Chain Sequence
HMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 83
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3quqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3quqA01
1U2TA 5IT4A 4YCMA 5AKLA 3ET5A 5AKIA 5ALVA 2C8LA 4NAVA 3R4CA 1RLTA 3OCZA 3IJ5A 4BX2A 5AI9A 2MU2A 4KNWA 1RMTA 5ALDA 4F72A 3ZWDA 4KX3A 1N9KA 3BA6A 3U26A 3NRJA 3L1UA 2BDUA 4HAIA 4UW9A 1U7PA 3NANA 1U2SA 1WVIA 2JAOA 3L5KA 5AKZA 2R8EA 4DFDA 1K1EA 1QH9A 4HGPA 5ALIA 4NFLA 3QU5A 5AKHA 2ZBDA 3E58A 4KNVA 3I1YA 3AR4A 5AVTA 4EZEA 2G80A 3ZVNA 5AKGA 1RLMA 5T41A 3K1ZA 5ALJA 1ZD2P 2ZOSA 3ZVMA 2AMYA 1XVIA 2G0AA 4QQFA 1RPZA 4BNDB 2W4MA 3WK9A 2GHQA 4UMEA 1IWOA 5AI5A 3DNPA 1ZS9A 3QGMA 2YJ4A 3MC1A 5AK6A 2GMWA 4UAVA 4HGOA 1L8OA 3A1EA 1T5SA 2HF2A 2FUCA 3EF1A 3ZX4A 2YMMA 3ESRA 1ZD3A 3J7TA 4B6JA 5AK5A 4EEKA 1SWWA 3SKYA 3ZI4A 3L8GA 4GIBA 1Z4NA 5AW8A 2WF7A 5AVUA 1YMQA 4ZEVA 2WF9A 2C8KA 4EX7A 2NO5A 3ONNA 2P69A 1WZCA 4HYTA 4G9BA 2GFHA 4RETA 1NF2A 5AM1A 3L0YA 1J8DA 5ALFA 3U13A 4UAUA 1RQLA 3GYGA 5A3SA 2D2VA 2C88A 3QU7A 5ALQA 4FYPA 4HGNA 1RMYA 3QU2A 2HEGA 3L0BA 2BDEA 3FZQA 3HLTA 3TLMA 3DV9A 4EENA 5ALYA 5AW0A 3QUBA 1MH9A 1EK2A 1T9ZA 4BX3A 5AM3A 2YY6A 3UMBA 2B1RA 4Y2RA 4CF5A 3I28A 4UMFA 4EELA 3A1DA 3KD3A 2RAVA 2HF7A 2O2XA 1RKVA 2X4DA 3OCUA 2I54A 4FE3A 2YMQA 4UM7A 4Y2YA 3I76A 3WK7A 2WFAA 1XP5A 4IG4A 3MN1A 4XPZA 2RB5A 2IOFA 5AVSA 4UATA 4OFZA 4I9FA 1RKQA 2ZXEA 5A3QA 1ZD5A 3M1YA 2FUEA 5AKYA 5AM2A 3IB6A 2NYVA 1YV9A 3ZTWA 5AM0A 2DQSA 4EX6A 1Y8AA 3B9BA 5AK3A 1F5SA 5AVQA 3VAYA 4ZEXA 1O03A 1YNSA 1L7NA 5AM4A 3OTQA 5ALLA 2G1AA 3QX7A 2YMPA 5AW4A 3MMZA 3SF0A 4C4SA 2P27A 1Z4JA 1Q91A 1L7PA 2HHLA 4G63A 4NV0A 1ZD4A 3EPRA 3ZX5A 2RARA 2RBKA 4AS3A 3NASA 4Y2QA 4Y2XA 3R09A 5AW7A 2YN4A 1Z5UA 2EATA 3E8MA 3WK6A 2YJ6A 3L0CA 1RDFA 3AR2A 5AIBA 4L57A 3SHQA 2WF6A 4Y2PA 4XQ0A 2QYHA 1CR6A 3UMGA 3L8FA 1KYTA 4BX0A 3QLEA 1NRWA 5AICA 4ZEWA 3W5AA 1RQNA 2EARA 2HO4A 4CF4A 3N07A 5AKJA 3WK5A 5AW6A 2YFYA 2WF8A 1Z4OA 3SMVA 4DWOA 3L8HA 3W5DA 4IFTA 4XE5A 1CQZA 2B0CA 1YDFA 1WPGA 4J03A 4UMVA 2CN1A 2WHEA 3WK8A 4XOUA 2FPSA 1L7MA 1Z4IA 2YMLA 2CFTA 5ALNA 1PW5A 1TE2A 2IYEA 1JUDA 4UASA 1TA0A 2JAWA 5AKEA 3DDHA 1TJ4A 5IS2A 4BEVA 5ALHA 1L7OA 4UMDA 3ESQA 3QYPA 2BY4A 4UARA 1TJ5A 5ALPA 2YBDA 4KYTA 3ZW7A 2FI1A 5AKXA 3L8EA 3OCWA 5ALOA 2B1QA 2MSNA 4Y2SA 1XPJA 2YJ3A 5ALWA 1VJ5A 4Y2UA 2HI0A 5AW2A 3WGUA 3N8GA 4YIHA 2VKQA 3NIWA 1RLOA 1ZJJA 2FDRA 3FPBA 3OCVA 2G08A 3IRUA 3L1VA 2PKEA 3ED5A 2QLTA 4Y2JA 4Y3UA 2ZBGA 2OBBA 2O9JA 4UM5A 5AI6A 5AIAA 3OCXA 2Q5EA 2YJ5A 2I7DA 3BWVA 3SD7A 4YGYA 3WKAA 3WKCA 2AGVA 3OPXA 3ZTYA 4NABA 2HOQA 2P9JA 4OD0A 3RF6A 2JAUA 3S6JA 1Z4KA 2G06A 4C4RA 2EAUA 2OM6A 3NUQA 1Z4PX 1Z4QA 1WR8A 4Y2TA 2PQ0A 5ALEA 1Z4MA 2FEAA 3D6JA 2B82A 3AR3A 2HCFA 3WKEA 5ALSA 3KDPA 1RRCA 4PNHA 3QUQA 4CF3A 1RKUA 5AVRA 1RC8A 3RFUA 3WK4A 4DW8A 2OYCA 3F9RA 5AVYA 3AR6A 3FPSA 1SU4A 3KC2A 4E88A 1Q92A 4L6AA 3QUTA 4Y2VA 3E81A 2R8YA 2WF5A 2OA0A 4BNDA 5AKKA 1U7OA 4MUMA 1N8NA 5AW9A 3WKDA 4YCNA 3FM9A 5ALKA 5AW5A 1Z4LA 1VFPA 5E0OA 3R9KA 4FFDA 2WM8A 3U7HB 2C9MA 2W43A 2I34A 2G09A 4KX5A 3DAOA 5AK4A 2ZG6A 4AS2A 5AESA 4YH1A 3SLRA 4HGQA 3SKXA 1SWVA 1EK1A 1LTQA 3W5CA 2G07A 3AR7A 4KN8A 2CFRA 4HGRA 4QJBA 1ZRMA 3KBBA 4CE6A 4BEWA 3W5BA 1QQ6A 5FP0A 3A1CA 3N1UA 3PGLA 3ZUPA 5ALMA 1RMQA 5AVWA 2CFSA 5AHXA 3UM9A 5JJBA 4BKMA 3ZVLA 3B9RA 3QU4A 2B30A 2IOHA 5ALRA 4NWIA 1ZRNA 5A3RA 4YIKA 3WGVA 2FPWA 4JDPA 1L6RA 3QU9A 4O8CA 3E84A 3CZ4A 3U7GA 1T5TA 3A3YA 4GXTA 3P96A 2W11A 1L8LA 2I55A 3PCTA 1QYIA 5AI0A 3I6BA 2JGAA 3KZXA 2B8JA 5AI8A 3N28A 4RESA 4BBJA 1QQ5A 1Z5GA 1Z88A 4CNQA 3ZU6A 3ZWKA 3OCYA 2PR7A 1TJ3A 3HYCA 5AM5A 5AVVA 4H1WA 1S8OA 3MPOA 1YJ5A 4YCLA 1ZOLA 1AQ6A 3M9LA 3U7EB 3L7YA 2GHTA 2FPXA 3U7FB 2ODAA 4JB3A 2MU1A 5AI4A 2HDOA 4OCZA 5AVZA 3AR9A 1QQ7A 1NNLA 4C4TA 2P11A 4J2TA 4UU0A 5ALZA 5AW3A 2I33A 3QUCA 2R8ZA 2IOFK 1S2OA 4BYGA 2AUTA 2AH5A 5ALGA 2ZBEA 3AR8A 2FPUA 1U02A 4L6CA 2R8XA 3FVVA 2C4NA 2HX1A 3PGVA 3ET4A 3QXGA 2ZBFA 3FGOA 3AR5A 2HSZA 2I6XA 3EWIA 3NAMA 3EF0A 4UU1A 1X42A 5ALTA 2FPRA 1YS9A 2NO4A 3UMCA 5AW1A 4F71A 2Q4TA 2JARA 2IA5A 3QNMA 4I9GA 5AVXA 3WKBA 4OHFA 5ALUA 3KOOA 1FEZA 1VJRA 3N5KA 4MWOA 2Q4RA 3NALA 2GO7A 3U19A 1O08A 5IT0A 4AP9A 3B8EA 5ALXA 3CNHA 1J97A 1LVHA 3PDWA 2B8EA 4DCCA
chains in the Genus database with same CATH superfamily
4ZAWA 4ZHQA 3ZJVA 1BH6A 3QRWA 4ZQGA 4FOOA 4OUDB 2IH4A 4R64A 2ZROA 2AU0A 3WGZA 3WYEA 2X13A 3B6JA 3F73A 4LJRA 3RRJA 2HIHA 1Y48E 4Z86A 3EZ9A 1UBOS 3D6TB 2MU2A 1DAHA 3QWHA 4HD8A 5EYPB 2FPPB 3MJDA 2DULA 4L95C 5K2OA 3UQYS 3AOEA 2V6IA 3HJBA 4D6YA 4RDIA 2UU9B 4DR4B 1RRGA 3ENQA 1L7XA 1DJQA 3QNWA 3TK1A 7ICVA 1JROA 4P58A 5K4LA 4TQGA 4NIMA 3FA2A 4NYIQ 1M34A 2WE7A 3FR8A 4KTTE 1LRLA 4EF6A 3P9CA 1M1NA 4KN5A 5CT5A 5EUCA 2ZS9A 1YE8A 1CUCA 1VBMA 4E7PA 1JQDA 2IV2X 1R37A 2PZGA 1N2IA 3FCUB 4ER0A 1YB6A 2C96A 1L7DA 1ENZA 3B20A 4PNPA 4D9NA 3VSAA 5KTNA 4EZIA 4CWAA 4I1RA 3ZWMA 4PS1A 4JKIA 4HNTA 4TSFD 1NKVA 1UXIA 2VQ3A 2Y1LA 4YCXA 5DHRA 2W2XA 4YWJA 4JI6B 4YT4A 4GUDA 1CJCA 3RKUA 4MS4A 1ZQVA 3E7FA 4DLEA 3OHPA 4XKJA 1RCUA 3H0KA 5TMDA 2C7VA 1JQAA 3HXPA 4GOOD 4KVAA 1MW9X 9ICAA 5LBUA 3TQIA 2P7IA 2R11A 4KE6A 5JATA 2KMDA 5K0EA 4XVRA 2YWHA 1CP3A 3QEMA 3WQBA 1G0NA 2GARA 3N4MB 2GMWA 4W7SA 3TD2A 3VO2A 1ZJ6A 3LIPA 1KQOA 4IJVA 4PFQA 2BSQA 4YRBA 1IONA 1YZLA 1ZD3A 5B1DA 4DEVA 3DXYA 5FR2A 3JQGB 1U2EA 3HCEA 4FWBA 2BM1A 4EGCB 3ZEIA 1SOAA 1UJ6A 5TQ0B 4D25A 4L85A 1MA3A 2QPAA 3FVRA 1NJYA 4BDTA 4HUJA 4CEIA 2DL0A 2DTDA 4NM2A 2LW7A 3C4JA 4P9NA 5CX4A 4GMDA 4R1NA 4OHOA 1ZQ1A 3IOMA 3VAZA 5CDSA 3G3EA 4NLCA 1WVMA 1NVBA 1RXSA 2LUOA 4J0GA 3CW2C 3NWPA 4TTQA 3ZBPA 5AHRA 4XVUA 4POOA 1RQGA 2EEPA 1BDMA 1FP2A 3EQ7A 3J81A 2Q1WA 5KFUA 3KWLA 3O7WA 1O95D 3E2PA 2W6JA 3H9CA 1EE1A 4BWFB 1JHXA 3BZKA 5C2JB 4KR3A 4IINA 5TPZD 1J5PA 4D5EA 1H66A 1UDCA 3QU7A 2EZXA 4AJJA 3VNBA 1FJGB 1QK3A 3JRWA 3EXIA 1TF5A 4JELA 4AM8A 3U1BA 2DCMA 4HB0A 1ZL2A 1N6RA 4HPWA 2WJ4A 1P2TA 8ICPA 1T8TA 1QPBA 4LGYA 5B55A 5CU7A 2IP4A 1Z2AA 3K16A 4OH1A 2GH1A 1G5QA 2Q5OA 2K4MA 2FMSA 1QIKA 3CH4B 2O2IA 2QRVA 2OBFA 3TTYA 4CIXA 3P0HA 1DGSA 4E5YA 3VC3A 4F9FA 1U4OA 3WHKA 3M7DA 1JRPA 4H7FA 1L3VA 5T67A 1ZAYA 3G9TA 1YVDA 3SEQA 4HSEA 4N49A 4LPSA 4UUBA 2PZLA 4GLXA 4BAGA 2E48A 4JK3A 3TADC 2GLEA 1JQLB 5J2UB 2YZNA 4IYRA 3DNMA 5TGDA 4P0QB 3I76A 2JF0A 1JVSA 3WK7A 3FNGA 1KVUA 3DZIA 1N2SA 4PE5B 5DM60 5J2TA 4NL9A 5FA5A 2R4QA 4CCSA 3JRNA 4CTOA 4KWEA 4Y2GA 1RG6A 1EUCA 1G5FA 4L0QA 4RHXA 1EHCA 1BX3A 4BGEA 5LQAA 3A4IA 4LVOA 1MB2A 1H23A 3BH6A 3KOZA 4QOHA 3VR5D 4FXPA 3W5UA 4YRCA 3L4KA 5KFPA 1A8IA 3I5AA 4MNTA 2VHXA 3AV0B 2PDAA 2CV2A 1UJBA 1D8AA 2UUAB 3G5LA 4DV2B 4X65B 1NX6A 8ICBA 3HM9A 1I6LA 5DYGA 1JDZA 4PCAA 3U3XA 4DVJA 1Z63A 1WA5A 3NHAA 4IIYA 1MB9A 3I9OA 4OBWA 2Q5QA 3QEOA 1WUIS 3RYFA 2KP7A 1XNSA 4JT9A 1RCFA 1ZQJA 2AL7A 3MTJA 1DPGA 2XA9A 3DFFA 1M2EA 4M2LA 2XB6A 3PEUA 2G1AA 2XE4A 5KYWA 4R65A 3SF0A 2IGTA 4L0DA 4BTEA 2GHIA 4NZZA 3VSDA 3SJZA 5P8WA 5EWJB 4RMGA 5K51A 3E03A 5SY4A 5CVTA 3AW9A 3HP1A 3V80A 4DYDA 3PR4A 4A10A 3JATB 3RYIB 1JEYA 4LC9A 1G5PA 4CIAA 2WKWA 5TF0A 2ZRCA 4Y2QA 1BU8A 3QBDA 3DSRA 1ODJA 1B6GA 3R09A 4QNNA 4B3HA 1FDWA 4IDPA 2AR0A 5EQJB 3TADA 4F7DA 4GOJA 3S8YA 1D6MA 3AQFA 5GVRA 2HWUA 4I2FA 2PFGA 2H7YA 4C8MA 2VIXA 3F3MA 5E0KB 2ODEA 4RNNA 3UT5B 5ESDA 2GEDA 3CF0A 1OAAA 4UZEA 5KG7A 4U2GA 5HZHA 3A4NA 4JMUA 5J2BA 1HA3A 3DPUA 3KTAA 1F4VA 2G71A 4L50A 5CNMA 3SHQA 1PJRA 4YJHA 1QCCA 4P4LA 2BYTA 4YT2A 4DQIA 2OZVA 3DPSA 1JYEA 3WQHA 3AQEA 3OZDA 3GLGB 4FYYA 1K8YB 4K6HA 7ICPA 3SQNA 1DEOA 2C3YA 1FA9A 1TVEA 4B9NA 4MZDA 1HEKA 5DGBA 1BX0A 3N07A 3KR1A 2E21A 5AFSA 1SUFA 3HR4A 3EVBA 4GVXA 3HKCB 4M1YA 4JLNA 2POCA 1JQKA 4AW9A 3C2KA 1ESNA 4RLHA 2WF8A 2A9OA 2AZTA 1OWMA 2CUTA 4JV1A 3OJLA 3A05A 3JTMA 4NENA 4Y2HA 5F2EA 4AF8A 4CCWA 3EXG2 2VTKA 3SE0A 3VPGA 4I0WB 2X7JA 1YA8A 2K8BB 1D9DA 4UB2A 2WT8A 2JCGA 2X6QA 3L02A 3P0IA 2FXIA 1O96A 4HDSB 5K0FA 4UMVA 1PJAA 3OPMA 1A8QA 2Y1GA 3F67A 1L4MA 4PRLA 4XOUA 5DHSA 1ODKA 2RHFA 1HLPA 2OCBA 1IN6A 4I9UA 2AJTA 2VYND 4D8VA 1PR6A 4RQ0A 5JRZA 3VO9A 1EJ0A 4YJGB 2VJLA 5JJCA 1KZ1A 1EFPA 1PW5A 1XWWA 4F1KA 4GG1A 5FV7A 4N0QA 2K2QB 2IY7A 5E6UA 3GDHA 1NYQA 5AKEA 3IHTA 4J1TC 2GPAA 5DLDA 1PS0A 2FEXA 5ALHA 4Q01A 3QYPA 2PLFA 3PX0A 1QX4A 2CVFA 2PUHA 5CLJA 1PUJA 1JP7A 3FOZA 2FZGA 4RQ8A 4B31A 3ZW7A 4Q6BA 3S2SA 4MDEA 1MN8A 5A05A 2A7QA 1DWPA 2C0PA 3DBLA 4G1UC 2XGGA 3E9MA 3AJ9A 3T7EA 3GMTA 3H0MB 2VF4X 4C3ZA 4Y2SA 1XPJA 3LDFA 4X7BA 3QKTA 4NBSA 4Q03A 2FP4A 3WADA 1EBBA 1UC5B 3IL2A 1I2AA 4MRRA 1P1JA 4X7RA 1VRCA 1RLOA 3PB3A 3O9MA 1Z6QA 3W5VA 3B6ZA 2FP4B 1TEXA 3I39X 2G0TA 2ZAOA 5FWYA 1EEXB 1YTUA 2X4IA 2HDWA 2J32A 4C89A 4QPDA 2JIZD 1J2TA 2FZLA 1ZP6A 2UAGA 1UBCA 5D3KA 1CY4A 3IPCA 4JJAA 4RTKA 1X1QA 3EXFA 1ZUHA 1M7GA 2EGHA 2ZSFA 5I9SA 4EFNA 3BK2A 1U4SA 3TVYA 2RHBA 5F3RA 4YMGA 4ZC8A 5A9TA 4J9NA 3HV0A 3NIDB 4QO7A 1RHMA 2DF4B 1KZ4A 1SIBE 2YJ5A 1DX6A 3P9RA 4MAAA 1JBQA 3FPCA 3NRCA 2LM4A 2B1IA 1Q1NA 3C3AA 4DZTA 3VR3D 3RVNA 2GJSA 4M7RA 1NM5C 4KYIB 1ZJNA 3SIXA 4ANFA 2RHJA 3DEIA 3IESA 1RM6C 4QZ9A 1QE0A 1YOBA 4U02A 4YLGA 4XWTA 1ABBA 4XW2A 2HNAA 2ZJFA 2E5WA 1KAGA 4RQ1A 4H27A 2H92A 3KEQA 3VU8A 1OXBB 4C3UA 3MJFA 1J07A 1VPEA 2VZ0A 2HHAA 1Q15A 4JUBA 5B1EA 2ZJZA 4EQ6A 1N32B 2QV7A 2AFVA 1ZM4A 1GGFA 3M6VA 2D0DA 3FKSD 3ROMA 3FLMA 3AU8A 5KINB 3AOGA 2BFDA 2QQGA 3KT0A 1S76D 3MUNA 3N5CA 1RFGE 1MQ8B 1T5OA 2ASJA 1E1QA 1QH8B 2IXDA 5CTAA 5ICSA 1JLKA 2K8AA 2QR5A 3DE0X 2KKPA 1HQYE 4E51A 2H08A 1SU4A 5EHNA 1P6UA 2V98A 3ESBA 2XT0A 4ZVNA 3BHJA 1M8FA 3TG8A 3JS5A 4UXHA 4L9AA 2JFOA 4GMKA 3NC0C 4LJLA 4BO0A 3VC7A 1PEDA 3NHBA 3HCFA 1WCIB 3CLTC 3DG9A 3PPIA 4BN4A 4EA8A 4MP3A 5E0OA 5HF6A 3UQZA 1ML4A 4B5KA 4FN4A 4M76B 2Q0SA 3OWHA 4BQNA 1I7PA 1SG6A 2NXNA 1C1XB 3FOCA 1U6KA 2QARA 3I2KA 3RRYA 1DAEA 3UH0A 5AESA 4OGLA 5FA8A 1P81A 4HGQA 1NTRA 3MS4A 1W4AA 1TYDE 2HRQA 5EP1A 4E13A 2AHOB 4GZ6A 4ROSA 4B35A 2DT8A 3RR8A 4Z6EA 3GUZA 1DIHA 1DRVA 2R6AA 2G6BA 2X0NA 3HFRA 2PUEA 4M9NA 3K2EA 2DKFA 2EVWX 3IEMA 5TZVA 2PFKA 1QQ6A 3H0CA 1I6MA 3IKLA 4HMPA 1XEWX 2WILA 3UMFA 3ZUPA 2RAUA 2B7BA 3N9IA 3RU2A 2LPMA 4BMCA 5BQ3A 2OFPA 4BMVA 5L40A 1YZNA 4X61A 2IP2A 2IDJA 3U3JA 3HB1A 4I28A 3NTOA 4MPJA 4Q15A 2XLBA 2J5QA 4KXXA 1SKSA 1I80A 2OXFA 2NSYA 4WJKB 2E37A 3KV3O 5JFOA 4UE3S 1UA0A 1KQ3A 4TVOA 4MUGA 1Q11A 5DXAA 3WNQA 1DL5A 4G9GA 4HRYA 2I4RA 4UULA 1UPHA 2IHKA 4OGKA 4EUHA 1F1JA 1YONA 1Z2EA 3FDIA 4F5QA 5TRTA 1L5HA 1E6LA 4O8CA 4INOA 1FNBA 1W76A 4LC1A 4YAKA 3LQ4A 6REQA 2G9ZA 3I9V1 2ACVA 1WPRA 4GX2A 5I51A 3P5BA 1CJSA 1V8DA 3UWDA 4F4CA 1XHFA 3HUDA 3RT9A 5C1OA 4HB4A 3WSTA 3FWPA 4LYYA 1ZM9A 3DW1X 3KQSA 1PSDA 1RWWA 3KWFA 1AK2A 1WUJS 1UEXC 1XZCA 3T3DA 3D8SA 3TQCA 5BUZA 2BQRA 1XF1A 2HV9A 1FQKA 4IDBA 5DVZA 1L3CA 3ADDA 3I6BA 1E77A 2RHMA 2ZWVA 2P4QA 3FVWA 4HY3A 4MWZA 1W73A 4Q4AA 1RZ3A 2J0EA 3A28A 3O3MB 3WFIA 1NY5A 5F1YA 4DNQA 5KMGA 4DLYA 2IS1A 4H3SA 1TAMA 4QT0A 5IFKA 2NU6B 2ZI6A 1JIXA 2BW0A 1NSYA 1SB3C 2P5SA 2XODA 3T0GA 1WY7A 4BOYA 2AC4A 1QIMA 4AG3A 5CB4A 4W1RA 2N47A 3D4BA 3ZXIA 4KLGA 4ESOA 1W2HA 5J2FA 1SRRA 3L6DA 3CG0A 3QTBA 4RHEA 5FI3A 2ZZMA 3R0JA 4TTTS 5F78A 1H2ZA 3DH0A 3LWMA 5LYJF 4KGVA 4YA6A 3ICEA 3NV9A 3ODPA 2O8CB 4MHSA 3MBKA 5CT6A 5L3SB 5TJ9A 2FPGA 3AUKA 1SPBS 4DHEA 4QZAA 4LHEA 3C14C 1RBZA 1S7CA 1B3BA 4FEYA 4JP2A 1HFKA 4LTNA 1SIJA 2HDOA 3TFSA 2ZRMA 1L5SA 1PK7A 3KZMA 2FHPA 2VDWB 3QVXA 4HEHA 2I7VA 2QJTA 3M4JA 1ZQYA 1PK9A 1Y1TA 4N3AA 4IHJF 3RVSA 4FINA 4UEOA 1JKJA 2Y4OA 5HKAA 1OBHA 5A1TA 2X3FA 1QGDA 2LP4Y 2Y05A 2H29A 2V7WA 2B21A 3ZUGA 5KPDA 4DR3B 1QHSA 4I2IA 4RZRA 2WINI 3TSAA 4PU0A 1R8YA 2W2MA 4QAQA 2N1MA 2WM2A 3OPYI 4RPLA 3OCJA 1Q19A 2YVQA 1QZZA 2A0XA 4A16A 3MLEA 4J9UE 4ZYYA 4G65A 1N5KA 2KHZA 5IJ9B 3H9GA 2G7MC 1WZIA 2J3MA 3FDSA 1ORWA 3CX7A 3EWIA 4HH0A 4IVNA 5EZ5A 4AJPA 4QWBA 5B2EA 4EGQA 9ICVA 3ZQJA 2ZSDA 4DLVA 3ZLJA 2WTXA 3SS9X 4U39A 1FRNA 2FE9A 4QU9A 3TLGB 2FMPA 4E94A 1KYVA 2W9AA 1DRKA 4N5HX 3W2GA 3EBOA 4J3NA 4ZMBA 2JARA 3EGXA 1NQTA 2CYBA 3TKLA 3GNSA 5TISU 1P2VA 3H8MA 1D9ZA 2H1IA 3GHHA 2ZR0A 1DOQA 4ND8B 2FPMA 3A9WA 3Q9SA 2ZIVB 5DGXA 3SYTA 4XX0A 3KOOA 5EFZA 4LKRA 5EGNA 2JLBA 2R47A 1NIPA 2MINA 2HMAA 3ZCXA 1WM1A 2G17A 1Q0UA 1CJTC 2QN3A 3PI7A 4G97A 1T3GA 1KC1A 1USIA 4W8OA 5DM70 4D46A 1EFDN 2H1CA 4L3WA 3A32A 4BNFA 5B7NA 3OHAA 4B43A 4PYJA 4JL6A 3TJZA 3DUWA 4D9GA 4HNVA 2XW6A 3KQTA 4RZQA 4TMVA 3EASA 4HN4B 4YK7A 4EM6A 1EXVA 3PR5B 4I5EA 2IKSA 4ENTA 1AX9A 1RSZA 1IM2A 2J6CA 3BEOA 4DAOA 1AV6A 1D2NA 1OGJA 2VJKA 2EXXA 1MOZA 3K5PA 4P98A 3SI8A 2CL6X 1XYYA 4OU4A 3GUHA 2RD2A 3PRYA 4Q12A 3PSPA 1YQEA 4HFRA 1AN9A 1TC1A 4Z4HA 3PGMA 1EA7A 4BQRA 3B52X 3MBIA 1DCMA 3O8BA 2BPGA 1Y8RB 3U26A 1FPMA 3VZSA 5HIMA 4U6QA 1PCXA 1VGRA 2ILVA 4G0WA 4KRYA 5THKA 3RAFC 3LYSA 3EMDA 2C2XA 4RA6B 3SBDA 3OZTA 5BUCA 4HGPA 1EDZA 4PTZA 1TQ8A 1MRZA 1DAIA 3RB6A 2VPPA 4TWJA 2PMFA 1UC9A 3BERA 2R60A 3VISA 2O3RA 3F8WA 4EB6B 4WBNF 1BQ3A 2ODWA 1FFYA 4BZQA 4ER5A 4MLCA 2WUEA 2ZOSA 1PQWA 3GV7B 3K8QA 1RAFA 3WMRA 1N3IA 2Z8ZA 3FSJX 2EU8A 1S9FA 1SHTX 3EH2A 5G3YA 4YPVA 2B34A 3OWOA 5EZYA 3KKLA 1C81A 4UMEA 2LTAA 2NAFA 1XTPA 3ZWVA 4EA6A 1QRUA 4ZIRB 5IW8A 2SKEA 2BFBB 4KO4S 1E2NA 1P1KA 5KFNA 1ZD1A 3MAJA 2IL1A 4MGKR 4R9SA 1JPVA 2R2GA 3SN6A 2DBVO 1L4HA 1YR6A 4UBBA 4IR7A 4FFRA 5BN4B 3RV3A 1O57A 1B42A 1W0JA 4UQPA 2D7DA 3UC9A 1S77D 1SU6A 3AB3A 3TINA 1UOOA 2EAOA 2OVBA 2AX3A 3IDAA 1M0TA 3JD3A 4HJXA 1RLJA 1Y9DA 2HHSA 1F3OA 1KOJA 3PSTA 1XXHE 3T41A 4A8TA 2SNIE 4S04A 2ZM5A 4BNGA 1XAJA 3MMXA 1H22A 2POQX 5K3SA 4FEAA 1ZNQO 1AV7A 4KVZA 2PA3A 4NJEA 1P1FA 5EYPA 1Z08A 3ROXA 5AVUA 2BF4A 5FWXA 5JD4A 1UPBA 3CRNA 3E3AA 4DL9A 1X6JA 3LPAA 2OLEA 4IJUA 4CCAA 4YG2A 2XD4A 2XZDA 3X1DA 5IASA 1F6DA 3ONNA 4I4NA 4B80A 2PT6A 3HBJA 5FKJA 5FQOA 5KNIA 2D4HA 2UYYA 3S1AA 4DCUA 3TAHA 2DKZA 3VDQA 4ESHA 2C20A 3BS5B 5AM1A 4CM6A 5THXA 2QLFA 2H3FA 4JQZA 4MP8A 4P80A 5HJ2A 2DR2A 4BNMA 3W77A 1Y5LA 2QZ9A 4JBYA 3U7JA 2I5PO 3WOVA 1NW3A 1XRMA 5FBRB 4CTKA 4HVLA 2KJ8A 2CRXA 1QAMA 3L7BA 4NLLA 4BUJA 3LKVA 1A5SB 3TIVA 1KYQA 3NDPA 2R751 3VI4B 3OY7A 3KEOA 2OHJA 3DLHA 3Q0EA 1GL6A 4AB1A 4RJ2A 4ZCQA 5E1OA 5JISA 1ENPA 4RHTA 3HLTA 1BXRB 4RCZA 3GLGE 3QSYA 2DLCX 3T3OA 3UCEA 2DPLA 1II0A 1MH9A 5KNCA 4II3A 1CQIB 2JH8A 1T9ZA 2C4UA 1SVSA 4D9FA 3PICA 4MV1A 4C7ZA 4UB4A 1A5AB 1H05A 4M49A 4O4IA 1JQJC 2QG4A 3K4QA 3LT4A 3RSCA 5JAUA 1UBSB 5JAZA 3I28A 4JASB 1JU4A 1ZK0A 3KYDB 4A15A 4BP9A 3W7AA 2UVQA 2BHSA 3GIKA 2GJAA 3QIVA 2XGMA 1QG2A 2PX0A 2IX9A 2LKCA 3WYFA 4KN4A 4JR0A 2NWQA 4ZV7A 3T34A 5I7HA 2NU8A 4C21A 3CLSD 3HRIA 3M6KA 5EJ6A 1DJPA 1ICEA 2PRIA 4LX8A 4N5NA 4DLNA 3M0EA 4QBTA 1E1KA 4ZMSA 3S4YA 4RNDB 3FFXA 2ZTDA 1V25A 3E7XA 4GGMX 1CULC 2Q6VA 1SBQA 3SJCA 3FNHA 1XU9A 1XE3A 3PXXA 3SVTA 2QTGA 4HDKB 3PCRB 3LCCA 5BQXA 1KI1A 2H2IA 4US8A 2CMFA 4CUJA 3N7AA 3OOSA 5TLSA 4OSEA 3E5NA 3I0MA 4DCMA 4YI3A 1FFDA 4C6SA 1YV9A 4CTJA 5AM0A 3O1HB 3RRGA 4GICA 4DDVA 4HWKA 5KSOA 2YL2A 4JLWA 5GZ6A 1NMQA 4XUGB 4O3RA 3SLKA 2ZTVA 5IIOA 1E96A 4EGFA 3A9RA 3FHJA 2JFHA 3OQNA 5BV2P 1XZQA 4MVJP 4P7GA 1L7NA 2QUBA 4KI7A 5GTDA 4IIEA 4Q3BA 3A0UA 3JQ7B 2BDPA 1Q0LA 5K0ZA 1NJSA 1HTBA 3O4VA 3ANLA 4GFDA 1RYZA 2WM9B 5JNRA 3T7DA 3UW3A 5KIAA 4UXJA 4UB8U 4O2AB 3E0XA 2YYYA 4EB0A 2VR1A 4PQEA 4PXYA 2OCGA 4FTWA 1JB1A 3F49S 2IZ0A 3T52A 5EL0A 4MV8A 1X77A 5EEHA 3SEZA 4QVKA 2FKNA 3N2ZB 1YASA 3PTZA 2HW3A 3HDGA 5J2EA 1DUSA 1HH4A 2G76A 3DO6A 1BE0A 3MERA 3MTDA 3OECA 3PVZA 2WTBA 3PFCA 4H4DA 4JJEA 2QWXA 3BIOA 4RE5A 3SR4A 3WHLA 5JI2E 1CEYA 3UJ9A 5J5CA 1YFJA 2H3ZA 1J49A 1HE2A 1ZH0A 1BPBA 2C57A 5EUMA 1IXZA 4ZVMA 8ICLA 1KYTA 1ORIA 3UV6A 3IQZA 5SYNA 2O23A 5AICA 1DQZA 1JDUA 1OLSB 4RMJA 5KWVA 3X44A 1E6WA 1R66A 5KU7A 1O0CA 3WLLA 1AKWA 2O5RA 3NEPX 3EOAI 1MU0A 4RD4A 1I32A 4BLTA 1Q0PA 4CF4A 3FMVA 3O38A 4LF4B 2JH7A 4CFZA 4MULA 1F20A 2H0AA 4H6VA 2W6ZA 4TN1A 2V1UA 1CHDA 4YRNA 2Z0MA 3LYAA 1R64A 1LFAA 1Y5MA 3NM4A 2C54A 1VC2A 4RQ4A 2J59A 4YJ3B 4RJTA 1CUUA 2QZ4A 3OQVA 4XDYA 1Y4AE 3GJ4A 3W5DA 3F9IA 1YIOA 2OQRA 3FYUC 4RQMA 1ZNYA 4G01B 4OQPA 2MRLA 4EPVA 5CA0A 3WDSA 2QJOA 3AO0B 3K2IA 3NCTA 2PL1A 4IILA 4UQLA 5JROA 1W36C 3H2SA 4MFAA 2BGIA 3K1TA 3L82B 1W0CA 4NBUA 3UF0A 5BN3A 2PVCA 4BO4A 3DMYA 5I7VA 1RXIA 2CFTA 2A9VA 1ZVKA 4BAZA 3C3JA 4N82A 2IYEA 4IVQA 1LI4A 4ARZA 2ZUCA 1AUXA 3QITA 5KHAA 1QHEA 3U56A 2Z6UA 3MWEA 1XTUA 2BLNA 4CV1A 1XCMA 3Q2IA 1LF5A 1N6PA 1JNXX 3D7KA 5DBEX 2A1UB 4P93A 3U61B 3WGLA 1KFKB 1TK3A 2XMDA 5INTA 1RP1A 1YZ3A 4FMCF 4MQUA 1J1UA 1SGWA 2EX0A 5EPOA 2AFHB 3K31A 2J41A 1K5OA 1O7JA 3AF5A 5HF9A 5KOJA 5IYZA 1T35A 1CDEA 1KDPA 3ASUA 4XCVA 5IMSA 4WBXC 2BV3A 5L1KA 2IWHA 1LZKA 1VL8A 1UP7A 3CVUA 5JJKA 4PRYA 2IEYA 2XH8A 3EQZA 4JBLA 3VR1A 3WZ2A 5LQCA 1RJEA 4CI0B 1I2DA 2E85A 3JQEA 4E07A 3C45A 5HZMA 1WQ1R 3NT2A 5GM1A 4YIHA 2Y0PA 1K86A 1VM6A 2ATVA 1T34A 5KFKA 2EHDA 1MIOA 2PKEA 1CR1A 3LXRA 4M36A 5CPBA 3ZIUA 5BPCA 4MW4A 1N60A 2A35A 5F5LA 5JNVA 3CUUA 4URYR 4O33A 2FUG6 1HUZA 1PBTA 3H19A 3MWEB 4RKEA 1OBVA 4R71A 1WB5A 3DC2A 3ADBA 3ZGZA 1I36A 2FQYA 1QE3A 3N7TA 5LUBA 2OCYC 1JKXA 3WGTA 3I62A 5AI6A 4XUSA 1KQFA 3AL0C 1IUKA 1SV0A 3KPUA 4HATA 1NHGA 2EWVA 3GJ8A 2GAOA 4AKGA 3ETCA 1N25A 1HX7A 3HKDA 3OD5A 3OOHA 5CA1F 4L4ZA 4QDKA 3UAVA 3T7TA 3GWZA 1A4RA 2QARB 3WICA 1IOLA 3ETHA 4D02A 3UPTA 2G4VA 3G0OA 1P6QA 4HNUA 2AV6A 4B73A 1JFLA 3MINB 1M54A 1N2CB 3H0LB 2YCBA 1CUFA 3W8DA 4ARBA 1ZJ4A 1ZK4A 3OZSA 2W6MA 2NVUA 2FWAA 2OCXA 5B3JA 3REOA 4AG5A 1I3LA 4GXJA 1CUWA 2G9RA 3JTEA 5ALEA 2ZKLA 4CODB 1TCBA 1B74A 3GPIA 3OICA 3QWAA 5JV5A 2VQFB 1R0ZA 4YRPA 2WA1A 2XRFA 1ZJMA 2VYQA 4CW7A 1H5UA 2E4UA 2P5TB 3FNFA 2OPBA 3F6SA 3MTIA 3TZEA 1F51E 5JS6A 2WTAA 4W82A 1ZQEA 4INJA 3CE6A 3SBEA 1RC1A 3TL3A 5IINA 1H1TA 2YKGA 5DBGA 2O8EB 4NBKA 4UB1A 3PNQA 2O1WA 1SIUA 2D6FC 1X14A 2RHCA 2QSUA 3HP6A 1TRHA 2YNMA 3Q11A 5TGZA 2O3JA 1P4AA 3QE0A 4NU8X 2O7VA 4KNYA 1SRQA 4OREX 1UANA 1C3EA 3M49A 2GF9A 4KLQA 3QM1A 4JZYA 1YRLA 4WX2B 4YO8A 4AWAA 1LBHA 1MVLA 3FC4A 2C22A 1I5RA 1ZI6A 3TZLA 3E81A 4MAMA 4MPPA 3WNZA 1TIKA 3GEPA 1E3JA 3LTEA 2VJYA 3EPJA 3WKDA 4BFUA 2ZJ4A 4R0MA 4ZARA 4ELUA 1YQXA 4AZWA 4DJEC 2C9MA 3L18A 5KVAA 3F6BX 3IUBA 3TNDA 2W6IA 1JI0A 4LFAB 5DBHX 4RK1A 1IZ9A 1ZUNB 4FC6A 4XWOA 1E6MA 1SXJD 2OCLA 3EWSA 5E4TA 1R10A 3PJGA 4GSYA 4KWIA 3GQVA 4CKYA 1OLUA 3NPMA 2R8PA 4CEJB 2EGGA 1AA9A 4NULA 2J0UB 4CE6A 2XKKA 5A4AA 3W5BA 3VR5A 3DHVA 5IKMA 3M5PA 3V7FA 1ESMA 1YZGA 1MD9A 1GOTA 1M9NA 4C4YA 2Q6OA 2G77B 4IIBA 5AVWA 1RPTA 4UB6U 1E6EA 2BC9A 3I2HA 5FNZA 2IHYA 1COWD 4EYQA 4UBMA 1XVVA 2HREA 2O0LA 1OXXK 4HQFA 4O29A 1IQRA 4ZVQA 4G5XA 3BJMA 2ESEA 4ZH4A 1L4NA 1SVOA 2N75A 3I04A 3V4VB 3E70C 4BUZA 1KYWA 2VYVA 1XQVA 2IK8A 3WGVA 2YOFA 1QFMA 3BL8A 4R51A 1O4WA 2C4MA 2JZOA 2H9YA 3AUAA 2F9FA 3COVA 3LWZA 2ZTEA 1UDWA 3C4QA 4NBNA 1HDZA 2Q1XA 3ZGVA 2WKQA 5FYDA 1GYPA 3I37X 5TXGA 1HE1C 5IF9A 3RAXA 3HR7A 4W9MC 4CHGA 4P4SA 1GDTA 4EJSB 2VDJA 1E9FA 2XGJA 2ZU0C 2W98A 5KTMA 2W9CB 1U04A 3V6MA 3WY9A 2F1JA 3FFBA 1GQRA 2GSDA 3ID6C 1CSEE 5BQPA 5DYWA 3HSSA 2MSDB 1J8VA 1DDGA 3PSAA 4BIMA 4DJJA 3QZ8A 2EFJA 2XNDD 2XD9A 3KXKA 1HFWA 1HORA 3PA6A 2PJZA 3C28A 4AMYA 2IP1A 2HRBA 3ABOB 4EB3A 1MNAA 4G2NA 3LBFA 5G40A 3UFBA 1P2GA 3BYZA 5HFJA 4B7CA 2PR7A 3UMRA 2VWPA 1WDKA 3RJHA 1GNQA 4NAHA 3UMMA 2O7QA 3EPLA 2CE2X 3RB8A 1U8TA 1Z6TA 3QOXA 2UXBB 5EMNA 2PX5A 2JLXA 3EPHA 4E6EA 2FB9A 1OVMA 1AVTA 3M9LA 2IITA 4HWGA 1PR9A 1D8TA 4BVLA 1Y6QA 1CJUC 1IG3A 2F3RA 3C4VA 3B6MA 1JDTA 4ZVKA 1WHSA 2AQIA 3C3MA 3I8OA 1UKBA 4F6RA 5JUWA 4YAOA 2GR9A 1IHPA 4XA8A 3CEPB 2O7NA 1B8PA 4EYHB 4P3YA 2DB3A 2WB1C 4M6WA 4ZHSA 2Y1CA 1N5XA 2IU6A 1RPAA 2NVWA 2DUYA 2KZMA 1MDBA 3IELA 1O6FA 4WXEA 1H93A 4HDNB 1GN8A 5CHEA 4BMXA 3U6BA 4BV2A 2XGPA 4YJ2A 3QVWA 4Q1FA 3U48A 2XCTB 5ER9A 3MD0A 4TYQA 2JEIA 1ZZEA 3CQ9A 4JB8A 3HH8A 3VH3A 1NXPA 1A8HA 2CB9A 2G88A 1P7ZA 2ZIGA 5EKSA 2FQQA 4WJ3B 1YJQA 3PGVA 3QEBZ 5G3ZA 2Z08A 3PLRA 2BTOA 2Z4TA 3EBPA 4NFSA 4KQ6A 2IHZA 2Q3FA 4MGHA 4JHLA 3K70B 4EW2A 3S68A 2FPRA 2PUJA 2MSKA 3MQ2A 1JR3A 1L4KA 1SN7A 2JW5A 2Q50A 4KSYA 1ZMOA 1AHPA 2JCYA 4E5PA 2VDQB 1MC1A 4URXR 1KE2A 1ACLA 1MJGA 3DAYA 4U5QA 4D4LA 1Q1EA 4K4HA 3CLRC 1I3OA 3U4IA 4O3MA 1J2UA 4BO1A 2XY7A 1HE5A 4OQDA 4URZR 1M6YA 4Z7NB 4DF8A 3P8ZA 1H8HD 4FZLA 3OQBA 4Q24A 2UZ1A 3V8EA 2PSFA 4WQMA 5CT8A 1X8XA 4BE4A 1KY4A 3UT0A 3R8FA 4LIPD 4ETNA 1PJCA 1SCIA 2X1HA 1QV7A 4J76A 4LYGA 2VA8A 3QEJA 4FFOA 3RYFB 5CEFA 4AKHA 4HUQA 4XD2A 4Q82A 4C7KA 1ZEMA 5B7GA 1O6CA 2EKDA 1Q1AA 1JPJA 4M0EA 1LVHA 1NRXA 3FCXA 3U1VA 4PLTA 1CEEA 1FXWF 1WUHS 1WW2A 2GD1O 2VG8A 4ID9A 5DLEA 1J5XA 1UBKS 2JAPA 3CUWA 3SDBA 3U9TA 3URKA 5IAAA 3TFOA 3VA7A 2JGDB 3OJEA 4YS6A 1E3EA 1DO8A 2R8BA 1YFZA 1J0BA 3RK4A 1KDHA 1RJGA 1N2BA 3MIZA 2JZCA 4F5WA 1YBVA 3EN0A 4LYEA 4L9RA 4TZ6A 1QHHB 2A14A 3B82A 4M9CA 3LUGA 1U7ZA 2I03A 1VBKA 3LQFA 1W85A 4I66A 4UHBA 1VPDA 3SGLA 4GLFA 3V8MA 2QAGA 4BNUA 1QTIA 4HAIA 1C30B 3BIFA 4JJGA 3AIOA 3D9QX 4P84A 5JEDA 5F9HA 1JIUA 4L4YA 4MYUA 1FUUA 1WVIA 1QYRA 3DW3X 4TMWA 5AT1A 4H17A 2DBRA 1MFPA 3LHDA 4UCFA 3CPSA 3EZGA 1I2BA 4EH1A 2J6TA 3DEFA 3OFJA 4H18A 2G4CA 4G0PA 4EG6A 3M4ZA 4NC9A 3GRAA 3Q6IA 5CB1A 4X24A 4UQOA 2F67A 3OOWA 5CUQA 5EY5B 5FLYA 2G80A 4J9LA 4M9LA 3AP2A 5MN5A 4Q7JB 3QBTA 3ZVNA 1N7GA 5ALJA 3TOCA 3MR6A 2GASA 2XA2A 2J3KA 1NK5A 1V0JA 3NOQA 1U0OC 3TMYA 1GSIA 1OWOA 2LGJA 3Q8QB 2GUGA 1A9SA 4L8GA 4UAZA 5E1BA 1RPZA 1X1SA 3B9JA 2CK3A 3NJ8A 3TG2A 2AJDA 3H86A 1LS6A 2FZKA 3TQHA 5IKXA 1QANA 3U4DA 2WAOA 3MC1A 2V74B 2RH5A 4YRJA 2VP4A 1YK1A 1M8JA 3CPHA 4G56A 2P9QA 1KL7A 4DMLA 3OESA 5JSKA 2AMJA 4JBNA 1JECA 1ZQXA 1OVGA 2FTKE 4RHUA 3V72A 5EE5B 2PZ8A 3SAJA 4CQLB 1TEZA 4EEKA 4B0OA 1L9XA 5E7IA 2BGTA 4I55B 4A1FA 3RU7A 2HPZA 3WRVA 4KAFA 4OMUA 4I6EA 4RKRA 4WZBA 3ZI4A 2YYAA 5IK2A 1MJFA 4K4IA 2W8BB 1E2QA 1C5KA 4EKNB 5K8TA 4C20A 3R3JA 3OZIA 5LDHA 1Y9EA 1T4DA 2WOJA 5BUSA 5K3OA 4MWGA 4HEA1 2JZBA 1UBJS 2J08A 4LMPA 4GI5A 5KTKA 3BRWD 5FFFA 1DZ3A 4WPGA 3BVPA 1S3GA 2LCIA 2I8AA 1NF2A 2WBLC 1NSFA 2A67A 2HAEA 4JODA 3L84A 4DPLA 1TT5B 4LHWA 5G5HA 3U13A 4PYMA 4V1CB 3T9EA 3MJVA 3F8TA 7ICQA 1DIAA 2ARKA 2GEVA 2VF5X 3HU5A 3EBLA 3I30X 3PSHA 4FYMA 4O5AA 5E6SB 3VU9A 4ARVA 3CP8A 3V8PA 5L7TA 2ZUFA 4DGSA 5BR8B 1NUQA 5DRTA 4WFKA 3QYFA 3PWKA 1DQNA 4RXMA 1VG0B 5BURA 1ISJA 4JS0A 1FJ2A 4MRPA 2WJGA 4KSBA 3TLMA 3DV9A 4G2TA 2QN1A 1JI3A 3LPCA 2GXQA 3E3NA 1IQ0A 4IHAA 4P0TA 3E9RA 2AG0A 4M1ZA 3QXXA 3RVLA 3ZY5A 1G8HA 1HOTA 3R9WA 4DQRA 1N5OX 1P1IA 4I8IA 2DBQA 5IFLA 3LZDA 2QRKA 3G6VA 1IBSA 4Y2RA 2XTNA 4AF7A 3I6MA 3UOAB 4J6EA 2WVHA 3WQQA 3GELA 1AQUA 3A1DA 3ZWYA 3GQCA 4IIJA 4ETIA 4MTLA 1N2HA 3TI7A 4FSXA 3RVMA 1J8YF 3EUB2 3LC7O 4R1PA 4DUGD 4PO9A 8ICYA 1QB8A 3DKVA 3V4FA 2XMPA 3T1HB 3KKEA 3BXGA 3MQ4A 1D7AA 4Q9LA 2XMZA 7ICOA 3AU6A 4K26A 2XGQA 2BH9A 2QTHA 5JH7B 2OBNA 3ZWAA 1UBTS 1W5AA 1W5EA 2EV9A 3QELB 5KG6A 4TXJA 2GX6A 1KI7A 3NT5A 1NJZA 4MVXA 2QAJA 3CLHA 1UWKA 3DUFB 3ZJ4A 1XHLA 3HRHA 3M5DA 4XQGA 3BXXA 4BDSA 5JANA 3LG2A 4NXMB 4JOSA 3OX3A 8ICRA 1KS9A 1TUGA 3AZQA 1UFQA 2QD3A 3PNVA 4ZAFA 5JAQA 3UBTA 5AK3A 2EZ4A 2M9NA 3GH3A 4HLNA 1HEUA 4HNSA 4PZCA 3WWOA 5C46F 4N8SA 1IWBB 3G6WA 3BKXA 3VAYA 4BO6A 5KOHB 3Q8MA 2NZVG 4QELA 4JEMA 3I2JA 3FTNA 3IIKA 2CXYA 3MFHA 1OA1A 2A8YA 1C2YA 3BJIC 1EFVB 2W6PA 2ZSBA 3C8HA 3JYPA 3GLFE 1JIVA 2AXTU 2VHTA 1F2UB 4OM8A 1QIFA 4M1OA 4BVFA 2O6LA 4XFJA 4DR6B 4BNJA 1MXHA 4TYNA 4RA9A 1SZPA 3NXSA 3M3DA 1Z83A 4RU1A 1XZFA 2ZS8A 2NZ2A 2HEIA 2IT1A 3KFLA 3R20A 2PTHA 4IUCS 4M0UA 3TNLA 5ICGA 4IZIA 1FNNA 2OENG 4L2IB 1UKVY 1WCIA 3V1YA 1Q0QA 2QLMA 4U7WA 2DR0A 3BUSA 2QGNA 3L0ZA 1RVV1 5KQMA 4FMCB 4AROA 1EAYA 1WEHA 4UNPA 1Z06A 3W90A 2QGZA 3KXDA 3RAGA 4ALJA 4C1NA 3E8MA 5B7QA 4JLKA 3WK6A 1CYDA 4TLAA 1PWHA 6Q21A 9ICNA 2NO7A 1ZD9A 1NVDA 4K6GA 1AXRA 4L74A 4CFYA 3U7RA 2BFMA 3C7TA 1H2WA 2BGNA 3ML1A 4MPRA 3R6LA 4R68A 1W59A 3OMWA 4ED1A 1II8A 3D0OA 2O5EA 3H2KA 4LAFA 3AVVA 1N5WA 1RKXA 1EUCB 3NRZA 2CWWA 3L7CA 1H3EA 1I10A 3N6XA 4G5YA 3AJRA 4YGXB 1RQNA 2EARA 1U0LA 4K9QA 4YXWD 1QVZA 3B0YA 2I4MA 4C0ZA 5FI5A 3WL7A 4R98A 3WWDA 2F3SA 2W2KA 3OC6A 4REQB 1T2DA 3WE7A 3QOYA 4OXYA 4CJXA 4TRRA 5J5VA 1SKBA 2HA0A 2QOEA 3MMNA 5ULLA 4UNRA 1DKOA 4LFBB 5JNTA 3NXKA 1CZKA 2OEPA 4UBLA 4WKGA 2X9NA 3JZAA 5LFAA 1V37A 2GGSA 2GNPA 3E3MA 2J6HA 1V5FA 5CLLA 5AVTA 2QRVB 1E2UA 1OFUX 4QJ3A 2AUMA 1ODCA 1KOGA 1Q7GA 3DMRA 2FPSA 4FGUA 5CMLA 4IQTA 1OXJA 2YMLA 4TTVA 5SY6A 3LWNA 3MGBA 5DKWA 1VA4A 3BORA 1OBCA 4ZGBA 2J6BA 2CZQA 3AEUA 4J9QA 1E4OA 2WPDA 4UASA 1G8GA 3F6RA 2CHVA 1ECCA 3PXEA 2F8LA 2KW5A 8ICCA 2PEZA 3EVFA 4L8LA 4WK6A 3ZU4A 4BAUA 4BU0A 3F2DA 1LDGA 1VCIA 2PUVA 3ESQA 4HDAA 1VYTA 4ZT7A 2G72A 2IYQA 2I78A 1JZSA 2LCFA 5HUJA 2LYHA 5KQPA 4MW6A 1E2JA 3D8NA 1NBHA 2IPAB 2QD4A 1GV0A 4MEBA 1M76A 1PV2A 1TPZA 3OSPA 1KN5A 3B1ZA 4S1WA 3VC1A 4KGDA 1VPWA 4RVFA 2VDKB 2C77A 2JKYA 1TAGA 1W4CA 1ZWKA 2JFFA 2HHWA 3C15C 1P9OA 3N8DA 2ZYVX 4BTLA 3Q8PB 4BZPA 1FBTA 4B3FX 4Q05A 3ZHBA 5HQ3A 5E95A 1XD8A 2JGDA 2XE7A 1Y4UA 3OIFA 3PPWA 4EY7A 3W1EA 1H4QA 2ZI7A 3RU3A 5EXEA 1TUBA 1ZUWA 3RSHA 4TUPA 2ISOA 2VYNA 1LPNA 2DTXA 1DG9A 3ELBA 1CLEA 3H97A 4V2UA 4WXPA 1XZJA 3O8QB 1Z33A 5FBKA 3GLRA 2OBBA 4FBTA 1Q16A 3R7FA 3RIXA 1JFFB 2FK8A 4QECA 2HW8A 3R0QA 3TX6A 1ONBA 4WUVA 5KG0A 1N9GA 3GJXC 2X76A 3WYDA 2JFZA 4IV0A 4QBHA 5AXCA 1SL2A 1EWVA 1OYVA 4N3GA 4R01A 2WU1A 3SC6A 4TKVA 3HJRA 2GBFA 5ESRA 2ZIFA 4LTMA 1I9CA 1TZ2A 1KRHA 4BVGA 4B3MB 5A0TA 2Q1SA 2Z2IA 1GIAA 3ZTYA 1MG0A 1AN0A 2JFYA 1DOZA 3HCPA 5J0TA 3PRJA 2AEEA 4G0UA 4KIFA 3P4UA 1JJBA 1XAGA 4C4RA 3K73O 4H1UA 3RTGA 5ISMA 5CDGA 2VTDA 4BCCA 4OHMA 4V1CA 2Z57A 2V8OA 3GT0A 4XIIA 3H8JA 1B4DA 3SFVA 4QKQA 3UO8B 2CLIB 3P0JA 1KAQA 3KDPA 4RHYA 4UTRA 4CMIA 1XP8A 3WMFA 3I5XA 3ELYA 3EGCA 4RFSA 2BKEA 4H2DA 2R62A 1H0KA 2OO7A 2RC6A 3IC5A 4J07A 1FTSA 1OFHA 3D3JA 4ND3A 4PLGA 2HYDA 2XKBA 4RWZA 3BBLA 3NNDA 4B6QA 4KXLA 3G5UA 4JLJA 2ETVA 2R44A 4EABA 2HA3A 3UAOA 3BQ7A 3IN5A 1EM6A 4L5JA 1TKDA 4RQBA 2JBAB 3G9XA 5JY6A 3RJ9A 9ICRA 1BGWA 2ZRIA 4D26A 4RUKA 5G0TA 3WI7A 4FMPA 1B73A 3PW5A 3OZXA 1PHRA 1EG2A 3P0RA 4R8LA 2V97A 2FJ6A 2OA0A 4GX5A 4MUMA 3LDUA 4DQPA 2KG5A 2HJWA 4F97A 2G9VA 1VRVA 4MA0A 1WUYA 1ZICA 2D54A 2YHAA 1VFPA 2VPWA 1DAKA 3BL5A 3V7YA 2H7CA 3A1UA 2XCUA 2KVSA 4EKEA 3W9YA 7GPBA 1E66A 4C7JA 1WBBA 3K15A 2ZRPA 4EMBA 3OD1A 5DULA 1GEEA 5LA6F 4B9MA 2V5AA 3OM9A 4KR0A 2H0RA 2H2DA 4B09A 2XCLA 1SWVA 4WNAB 2GZMA 3H9UA 3VDXA 2SBTA 1IN4A 3B2QA 3JXEA 4HXFB 4ICIA 2DHDA 5AVOA 2BGMA 1C0LA 4GPZA 3H3JA 5GY7A 2GBIA 1DJLA 4XEHA 3NYRA 1ZQBA 1QH1A 2Q1YA 5KFXA 3PUIA 3L93A 2P0EA 2L69A 4NCJA 2VJDA 3ZHXA 4EY5A 3ECSA 1LDBA 1TAUA 2BMAA 4PFJA 3I9NA 1U0BB 3U4AA 2JRZA 1SVNA 4M9ZA 2JH3A 2QX9A 8ICNA 4ITVA 4QE3A 2HB6A 2O52A 3IVGA 2O5VA 5GOTA 4GR4A 3R7WB 4C2TA 1LBQA 2QKQA 1LBTA 1NL3A 2PZBA 3E8XA 2V7GA 4BC1A 4MW7A 2LD4A 5L6LB 2FLNA 1KY2A 3QKRB 3K09C 4I5FA 3WLSA 3TARA 3QK7A 4ECWA 3MCVA 1QR2A 4G9EA 1P39A 3N0WA 4DC9A 2JKVA 4MKFA 5DNUA 4HWOA 3CSSA 3MJ4A 1KEWA 3U4QB 3G68A 4QZIA 2FGJA 2UVPB 2WJZB 3B7GA 3W3AH 3AM1A 3BF8A 1T8RA 1OYYA 2WJWA 2ZR8A 2DVMA 2RH4A 3JU3A 2P1RA 3E7PA 1JBKA 2DPYA 4BLUA 2ECKA 4QARA 3R7LA 4CL8A 4EITA 3DKIA 3C8DA 1G41A 1VXOA 3DEYX 1Q57A 3ZE6A 1E2EA 3HXOA 1L8LA 5JMWA 4DV6B 2ZSHA 1U8FO 4AI6A 1BNCA 1RE0A 4RZ3A 2C2YA 3M89A 4KDCA 4A3SA 5JZVA 4ED8A 2VXOA 3R9XB 2F9LA 1CS4C 3EAQA 3N2KA 7AT1A 1NJGA 1Z5GA 3HKEA 1GGKA 3GW8A 1K2VN 4CNQA 1LFDB 3AUSA 3RHZA 4AKSA 1V48A 1XVTA 1R0RE 2I2FA 3GVCA 4YB8A 4NMWA 4P5PA 3DKPA 3HGMA 1RP7A 3N8KA 3GGOA 3U3MA 3RH6A 4K88A 2IODA 4URHA 2JIPA 5AVVA 2MYPA 3TZQA 3VFDA 2O3UA 4BV3A 3PW0A 1S8OA 1DBIA 5DW0A 3AFMA 4AXXA 1Q7TA 1QGOA 2AEJA 2SECE 4KE9A 1JA0A 5FLKA 4L5BA 2F3QA 1VJTA 3C98A 5F35A 1ZZGA 4TTIA 3WIEA 4LF6B 4JB3A 3QLVC 4DV7B 1J0AA 2EW1A 3O94A 3MJTA 5TDHA 1AK9A 1W46A 3DV0B 3Q40A 4NL4H 3OO1A 2OFWA 3IA2A 4P4MA 3ZHOA 4MCAA 5E6RB 3KKNA 3E15A 1HOXA 1X9WA 4J49A 1HZJA 4OIFA 3EQ6A 3IEPA 3FYCA 1A69A 4R2IA 1CRQA 5ALZA 1CE8B 5NULA 4A2PA 1L9KA 1HNZB 3K05A 1IOZA 1XB2A 2QJFA 2QM7A 2VO1A 2IOFK 2A1IA 1GZHB 1YS6A 2YV1A 3AF4A 3MOIA 3P71T 2PGNA 4OJKA 4BZZA 2F2AB 1U1CA 5J0WA 7ICSA 3A9TA 3JASB 2RBGA 2JATA 1U02A 2ZCVA 2A78A 5BOLA 2V6GA 4DLTA 1DB3A 1YACA 2CMDA 2XUPA 3ISDA 3QE9Y 4GWKA 1EBUA 1PYDA 4UHCA 1XZEA 4HTFA 4XYBA 4MYHA 4RTOA 2NVUB 1JN0A 2JK1A 2XY4A 1X42A 2VDVE 3HSKA 4KMSA 3EZYA 3S2IA 3OPVA 3ZD9A 3R5SA 1TYBE 4O4JA 2A92A 3AWDA 4WSOA 5MFZA 2BOVA 3VX4A 3IKTA 3RVKA 3MJCA 4LZPA 4B76A 2XR1A 2Y9MB 2PL9A 2GM9A 2NXCA 3LO8A 1URJA 1CUBA 2NO0A 1ULAA 2XADA 1VLLA 3WNCA 1ZSNA 2OV4A 4CU5A 4RMHA 4O4LF 1NKEA 2JFVA 4QTXA 4Q7QA 2RDIA 3MEQA 4CRWB 4F4UA 3IP4B 2ECFA 3WAKA 4WMLA 1VJRA 5J2JA 1UXGA 2JHGA 3IKMB 4BNYA 4NV1A 4ZTUB 1P80A 3QJYA 5A5FA 1QCYA 2FOIA 1R8QA 3NW9A 5C5EA 5A6VA 5I7UA 3FUWA 4IIXA 4Y0AA 3DB1A 3FMFA 1QKKA 2C1XA 3OMLA 1QOQB 1D4OA 4YAIA 5JMOA 2R4UA 1ZQUA 1ZMTA 4JXKA 1P1BA 1R5OA 3G1TA 4ZDJA 3KWMA 4EGJA 5KQRA 1FRVA 2ONKA 5B3JC 4F5RA 2EKPA 1FTYA 3Q5EA 4Z4EA 5AKIA 4E2WA 4NAVA 4PNZA 3HJAA 3PEWA 4J1TA 5DYYA 5JDIA 5DU2A 4GKAA 1A7AA 4KNWA 5C5DA 4YP3A 2PRYA 1Z12A 3C1AA 2HL6A 3CT4A 4JDUA 2HT1A 2VP6A 4Q4CA 5L3VA 3B70A 4RV5A 4DQDA 5IP5A 5KJCA 4F45A 4MQEA 5CITA 1Y5IA 2X2FA 2JDIA 2ERYA 2R1TA 1P4GA 3N2GA 5K3FA 4KPFC 2LMRA 1REQA 3V1KA 3FF1A 3RADC 3KT8A 1ODFA 3LJKA 5L4SA 2GDJA 3GH1A 2JLCA 2KZ3A 3CWQA 4UFOA 3U5TA 3IDFA 5EKUA 4L08A 3AHIA 1A96A 3IIJA 1TLTA 1JXEA 2W37A 3OSUA 1J22A 1ZQDA 1TMOA 3MELA 4LOLA 3UW1A 5TT0A 4B4DA 1CDOA 2HVHA 2BKUA 2WUDA 1E5DA 2XXBA 4ZFNA 5LP6B 2HHTA 3LCRA 2TRSB 3IT0A 1RXVA 3OFND 4Y1RB 4EUNA 3H5OA 5A9SB 5IZCC 2X9VA 3RE1A 3H8WA 2V54A 2V6JA 3PR2B 4QQFA 5B4UA 3QPVA 3AJAA 4UQGA 1SOMA 3JAWA 3SNKA 4LJKA 2K89A 1PGPA 2QY6A 3DBVO 4WGGA 1QTQA 3D0QA 4Z9BA 2QK4A 4DWIA 1EPUA 4G8DA 1P8AA 2YJ4A 4Q4HA 1OH6A 3KKPA 2B20A 1X9SA 4M0LA 4N03A 4X54A 3V00A 3VMFA 3EF1A 1BE6A 2UYHA 4BGUA 2DETA 2ZSAA 3TW8A 3ZWQA 5AXAA 4Q43A 3IHQB 4B6JA 3I32A 4WLEA 1UBUS 4ZGGA 1SKUA 4NV3A 1VJCA 3NKLA 3TF5A 4RZUA 3C23A 2PFNA 1PJ3A 2FRXA 4MRMA 5IC4A 2FOLA 2CLCX 3DOIA 4EA9A 4AKTA 3T5DA 1X7ZB 3F5QA 3CBGA 2WC1A 8MHTA 2EZ8A 3KPYA 4RABA 4WL0A 4H7DA 1AK1A 3INRA 4EX7A 2P75A 4OQYA 4BZXA 4DE5A 3DEEA 3IVXA 3F97A 2GCGA 1EQUA 2ORYA 3IV9A 3KOMA 3GPBA 4PINA 2DF8A 4Z9FA 3O2SB 5E1DA 4O1HA 3RFFA 2C4KA 4F4DA 1ZKDA 1Q46A 2IPNA 1GSAA 4YJDA 5E38A 3WJ1A 3L0DA 3KB1A 1BEEA 4MB0A 1LI5A 4GKJB 4IUBS 2ZJ3A 5I9MA 2PGIA 4US2R 5A0LA 3B53X 2IIBA 1M6VB 4I2HA 4YX9A 4USAA 1ISIA 1LY1A 4E15A 3WMEA 1RM0A 2HA6A 3AN1A 2OGWA 3OH8A 4K1LA 4R2MA 1IOWA 1HL7A 2OZKA 2ZT7A 1Z1VA 3GBSA 3R8XA 4QEDA 3SC2A 1MHPA 3A4VA 2JANA 4QDJA 3RJJA 3TWOA 3CTMA 1PR4A 3IP1A 3QWIA 3QUBA 4LYJA 4LHVA 5J2GA 3TLGA 3TAQA 1F8XA 1U2RA 1YHZA 3ZIDA 2YY6A 1QP0A 1V8ZA 1WD7A 2Q3HA 1B41A 2IPXA 3PJFA 1Y6ZA 4TKUB 4RGBA 5ICMA 2BM8A 4FGJA 5TY0A 3TPZA 1XJ0A 3F47A 2BPOA 2RAVA 3A1TA 1I7NA 1NI3A 1XIVA 5CYPA 3SX4A 2F64A 2QMYA 4O59O 5JQGA 1GNLA 4UTPA 4FE3A 1W1IA 1KTQA 1MT3A 4EPTA 2CXOA 1GN9A 1PW7A 1PG5A 1XP5A 2NSHA 1H38A 1P0PA 2PL5A 1GUDA 2NIPA 2W2LA 1M0EA 5EOVA 1X39A 1RR6A 4UD6A 1Q21A 4G0QA 4PC3A 1P7WA 2RB5A 3CY6A 3WIUA 4DL3A 4AYBC 2C2RA 2H59A 2CV1A 1S1CA 3A3NA 2J87A 3IAEA 1NR5A 1NU6A 5FADA 1KJNA 1APBA 2HY7A 1F0MA 1QNLA 2ZAMA 3EC1A 2QRLA 3D6NB 3OI7A 2R18A 5AKYA 2Q9UA 3MWGA 4ITUA 4PONA 3EODA 5IKOA 4GM4A 3NC1C 1F5SA 1PZHA 3FMOB 1PI3A 3K96A 4KFSA 4MWTA 1AQIA 2GPNA 3GLKA 4B47A 3UQ0A 1GTZA 4RVUA 4OBBA 2P79A 2CLSA 3L79A 2R8IA 2ENWA 4P0PB 2A9FA 2X1MA 1IBMB 1SKYB 5KSYA 3UK1A 1ICIA 1RYHA 2ZQZA 4DWJA 2YIMA 2ZVQX 2YMPA 1U5BA 3D1JA 4JEHA 3FPGA 3ON5A 4TV8A 1Z4JA 2O1XA 5I9BA 2PSHA 2GZSA 4ARUA 2P6RA 3DTYA 4G26A 1QWSA 4W5HA 5KB3A 3SM3A 2MA1A 4EAQA 1JA1A 1QP4A 1P7DA 4IHJB 3QPWA 5KTSA 3UC5A 4BE7B 2QAGB 1MUUA 1AE1A 3TCXB 2JLYA 3C29A 2AE2A 5BR1A 4L7QA 3DBRB 4D42A 4RGQA 4QVIA 1DAPA 5AW7A 5JY1A 1RS0A 3HVKA 4TWZA 1SUSA 1X7GA 1KO5A 3LUKA 4GZLA 4WADA 4ZAVA 2VC2B 3ZVRA 4UNQA 3L06A 1JLLA 3IJRA 4Z7QB 1ZETA 1G3RA 3SCZA 3C6QA 3L0CA 3LRTA 3O92A 4UUQA 4QHTA 1JR3D 2XXJA 4M3NA 2OILA 4ZV4A 2OHIA 3D5QA 3DZGA 4Y2PA 2HIAA 1C8VB 2VPQA 4JMLA 2X40A 1NRWA 1R18A 2IYYA 2HHHB 1E0DA 5LQRA 1DAMA 1SZHA 2LPEA 3G89A 4GX0A 2RG1A 2PNJA 3RK0A 2H85A 3G5AA 2DFVA 4OQ4A 3EWAA 1WQ3A 3K72B 1Q14A 3OZEA 5ECDA 1WDMA 3WC4A 3HT3A 1W25A 4NFHA 3FCAA 3U39A 4RX1A 1AF7A 1SQGA 1Z16A 3KXLA 5J3JA 1Y81A 4L27A 1LC0A 5HF8A 2COUA 3VCBA 1RM4A 3AF0A 1OV4A 1JG7A 2HBKA 2QUIA 1XNRB 4LJXA 6LDHA 5KSWB 4A5OA 1H2XA 4AMBA 4PHEA 3BD9A 1VB5A 2XDWA 3KKOA 5REQB 1G55A 1T9HA 4QZFA 1LPSA 2J67A 5TVGA 1SC9A 1S0MA 4M9JA 1Q0SA 1Z39A 2I4NA 1U80A 1BKDR 2R00A 3CUYA 2WHEA 3F96A 4NJMA 3BDIA 5J8YC 2NRXA 1DKPA 1SXJE 2M9MA 3O4GA 5LOVB 2DY1A 1IY0A 1M7HA 1GSHA 2O8NA 3FGPA 2P3OA 2J0VA 3JYNA 1ZUNA 4UU7A 1OAOC 5LQJA 3NVVA 1GAXA 4LJYA 4JYZA 2PFOA 2QBYA 1M2VB 2NTJA 1N6KA 2AK2A 3DT8A 3FB1A 4OHCA 5FFNA 1QHIA 4YJ2B 1JDJA 1DBQA 2N9UA 1YOVB 1TJ5A 4FMDF 1SURA 1FMTA 3ND7A 4HAOA 4PCUA 1U7WA 1ECFA 4FYHA 1ZH2A 1GL3A 3NTRA 1OOEA 3BCUA 1IPFA 4JIMA 4KYTA 4UNSA 1L5NA 1TQHA 2QQEA 4HZUA 4FMDB 4OQZA 3N7PD 1B8VA 1I6KA 2VT2A 3L3BA 4DC1A 2OV6A 3KYBA 2XC9A 2UUOA 1Z6XA 3WLRA 4DB2A 1JPUA 3SF8B 1ZQAA 1C3LA 1PZEA 1U31A 4GGPA 4GOMD 3H2JA 2RDMA 1CK4A 1VJ5A 3VZPA 4BBAA 5U9CA 3WMXA 2O0JA 5TARA 4AS1A 4MGZR 5H7XA 3GIJA 2VKQA 8ICFA 3ZZ1A 5KYNA 4TZKA 1T3NA 1E94E 2GPSA 4WRRA 4E3ZA 2OLJA 4Y6PA 2Q9AA 3L1VA 2H57A 4PLWA 4YUZA 5L4LA 4ZD6A 2E18A 2VHCA 4J0DA 1M2NA 2CLEB 3K70D 4ALKA 1SKQA 4BEJA 2JGIA 3KYDA 2B9EA 3KTAB 3LX8A 3ZHYA 3FWZA 4WK4B 1P9NA 1F9EA 3UT6A 4DRXB 4D79A 1XA4A 4TXLA 3SHOA 2Y8EA 4KSCA 1TTPB 1YKSA 3GXOA 4FDLA 1F0NA 4Q3KA 2RSLA 4FWTA 2MIIA 1SHUX 4PGHA 2KWIA 3KQOA 3OCXA 5I8WA 3LA8A 1BG6A 3FHLA 4K9LA 4RZIA 1CQJB 1E64A 3BAZA 3GB9A 3QE4A 4EYKA 4YHBA 2FYTA 1IN7A 3FYHA 2NNLD 2FDCA 5LP6A 4Z0TA 3HGQA 3EXFB 5H80A 2ZJ5A 3WIBA 4Z1MD 4DOBA 2JAUA 2H52A 2X6RA 3ICWA 4LGMA 1Z4KA 3OPYA 4ZXFA 4JI3B 3WDLA 3CKKA 4YQWA 3QJ5A 4QDTA 3PGKA 3MWYW 2EZZA 4ZYUA 2FMIA 1I0LA 3MGHA 4KWHA 4OMFG 2CDBA 1QC5A 3RW9A 1CVLA 3PFFA 3PQ5A 4ZO9A 2FEAA 2RGBA 3KS9A 5EEGA 5BSGA 2CVZA 3OFKA 5GAJA 5ADWA 3DXFA 2G5CA 5EJIA 1MW8X 4YT8A 2DPIA 3FUCA 1VIDA 4C06A 1KO8A 1ZIXA 3D8BA 2GPYA 1E3WA 1KAHA 1UJNA 5CNKA 4J3FA 2R8JA 1JAYA 1Z8NA 2V0CA 4EY3A 4F84A 3MR2A 2QV0A 3W6UA 1OTYA 1ZRHA 1V8OA 4GPEA 1NZJA 4NQRA 5H9VA 3UENA 4W5NA 1QG0A 1XX6A 1ADGA 3RHTA 5CBPA 2MYTA 4XLLA 4C0JA 1TXGA 3BE6A 2CNKA 1LTHR 4DWVA 4GDMA 4I81A 3NVDA 2LR0A 1YVUA 3D6VA 3GOQA 2Q49A 4PTLA 4R8UA 1X7YB 5AW9A 1E7MA 1BX1A 1PR2A 1T0JB 3NETA 1D8LA 4N0PA 3RRMA 3CH5A 2QTLA 4P08A 6AT1A 2RGAA 4OQNA 2GDZA 4INPA 1F48A 4I4TA 4IIUA 4QBGB 4X0EA 2JIMA 1WZEA 4BMZA 2A0UA 3H1BA 4F3NA 4PZOA 3N0TA 1YQGA 5KOYA 3ZJUA 4DSNA 2EFHB 3MCTA 3V55A 4XGIA 1A97A 3CEHA 4KN8A 3BIXA 1OX5A 2CFRA 1B0PA 5JT1A 1P4HA 2QR2A 2ZI5A 3LUFA 4D1YA 1I7SB 2ID4A 1V26A 4O2AA 3TGPA 2IBKA 1KJZA 4FFBA 5I4KA 4ZOLB 4BNHA 1XRRA 3N1UA 4RPIA 3FYTA 4NNPA 1KI3A 1ZN2A 4LZAA 3HJNA 1DOAA 1U0EA 4M7OA 2P2GA 5DT9A 3VAAA 2VBGA 2OP0A 3ABQB 1E1YA 3SI7A 5J1SB 1ZOPA 1ADJA 1VFNA 4YUXA 2O2YA 4OQQA 3GZFA 1BD4A 2ZREA 5J2AA 4M8LA 4TQ9A 1VIYA 4HAUA 9ICWA 4U5XA 1NLYA 3QV2A 3CKLA 3A6KA 4KHZA 5J0PA 1YR2A 3GEMA 3KVRA 3RRXA 3GR6A 1T8UA 1W0KA 2BE7A 4CQMD 5IABA 1TO2E 5FPKA 1JWLA 3R7SA 2X0KA 4LWQA 3U4QA 5LOVF 3U7GA 4AY5A 8ICKA 2PS3A 5AP9A 3KZNA 2QJWA 2Z98A 2W2VA 4QBKA 4J9PA 2X1LA 4FQ7A 1SVKA 4RJLA 1Q8KA 1OROA 2HHJA 2WVGA 1H2AS 2XUAA 2ZJBA 3BB4A 2W11A 2V7XA 4UU0A 3RUAA 3S3TA 1J2MA 1VYUA 2B69A 2BGUA 3FFAA 4DTIA 4X62B 2QLLA 3IA7A 4ZTBA 2IMWP 3IURA 1UIMA 4G5RA 4OL9A 4QEZA 4S35A 3T54A 2PJDA 5COAA 3GGGA 2ISPA 4OLFA 5KFJA 3IAM1 5KNCD 1Y4ZA 2PUCA 3ZS9A 1LV8A 3C1UA 2CZGA 1RWXA 4MH0R 1WMSA 5KFDA 1DRJA 2FU5C 1BIFA 3I73A 2JIOA 2DUUA 2GYYA 1TRKA 4IO1A 2R25B 4N65A 2D7CA 4OSPA 3OIYA 3WHIA 3F1LA 4QUKA 3QTTA 1E79A 1SEPA 1Z6PA 3BGVA 4LHZA 4CL2A 1F4LA 2XTAA 2Q7DA 1QYWA 4OHZA 3IP3A 4BJHB 4F5YA 4Q93A 4LZJA 5TPZA 1AQ6A 2C2BA 4ALNA 2DWCA 1O4VA 1JFSA 4YMLA 2OCKA 1ZJZA 4J6FA 3RTAA 4DDUA 2Y2VA 3NDBB 1EFHA 3PZRA 2H9IA 2ZVPX 5A4KA 2YWEA 4M8NE 3N3AC 3BJRA 5SYMA 4QWAA 3A37A 1VG1A 3OIVA 1S4MA 1BAPA 2VSOA 2Q8NA 4UDYX 2C5FA 2IZ5A 4S1NA 2QN2A 3RVJA 4LHYA 1HSZA 2I2AA 3ZV6A 4JJKA 2XQGA 2WUWE 4LVSA 3U7IA 2BBWA 3B3AA 1Y3DE 2XUIA 3SSMA 3DKRA 1P33A 2E4ZA 2IF0A 2E4AA 2O7RA 4YAWA 1L4GA 2V3VA 1NBOA 5JD6A 7ICKA 3VM6A 1A95A 4MV5A 4PSVA 1J0DA 3ZCPA 1Y0BA 1XK6A 1T8YA 3MS2A 2HX1A 1HRKA 3DEAA 4ZYXA 4QWEA 1RLIA 2VP0A 3RSLA 2GPJA 1ZI9A 3STXA 1QIEA 2NADA 3M6XA 2WWXA 1Y98A 3PFHA 4GWLA 4ZA2A 3AUOA 5A5EA 3CONA 1CVRA 3L9XA 5KQSA 1TB4A 3NP9A 4OXXA 1HT3A 1T6ZA 2FSVC 3DTVA 3LX6A 4F3TA 2NLOA 1K9SA 3HYTA 3TLXA 1GRRA 2H5XA 2BM9A 4GVPA 1AMUA 1NWHA 4ECZA 1SCUB 4ZI5A 1KI6A 5AVXA 2F8SA 2B4TO 4E4TA 2CNNA 2HWYA 4GF5A 4LXIA 1KDOA 3BG5A 5IUKC 4F50A 1NK4A 1GEGA 2H63A 5LVAA 4H7HA 5BV0A 4C3OB 3LVVA 2AQHA 2C78A 1X0XA 4QVGA 5J40A 3NALA 4WJLA 4FLMA 3IOEA 3IE2A 3K6JA 4BRSA 1LK7A 1Y3BE 1KI6B 4AP9A 1YQTA 2ATLA 2WU0A 3AXTA 2OGZA 5ESXA 1OLSA 2PMBA 4E1AA 1AUQA 1DT5A 1QSYA 1A82A 3ABRB 4PHCA 4H35A 1VE7A 1K9VF 1O3YA 4I7EA 3BS5A 1RHJA 1WB6A 4B8ZA 2YQZA 4BVKA 4RV9A 3RSQA 3H8SA 2JGNA 3VH2A 3ZD8A 2VCHA 1LPMA 1A4UA 5JUMA 2ONJA 1KK2A 1Z9BA 1QK5A 1YZQA 4LSMA 4WT7A 5K4AA 5BWOA 1BE8A 1UCFA 1PEYA 2YXDA 1Y80A 1TKCA 1WB4A 2C0QA 4PHHA 3WQRA 4B7XA 1YQQA 3HVJA 3STYA 3WLEA 2XTZA 4QGSA 4D0SA 1MG5A 4UPVA 4B3TB 4P54A 3FIUA 1XN1A 2CWDA 2FW9A 2VHVA 3IODA 3BS7A 2MSLA 1O9BA 3NANA 3PJDA 3OJSA 1W1UA 2GCEA 1YGPA 2DKXA 1EZZA 1FNDA 2BRUC 2IEDA 2IHBA 2KX7A 2XAAA 3DMHA 1Y1KE 2YYSA 4GRIA 4NQZA 4K1XA 2GN4A 2KOBA 4G4JA 4TUSA 1PFUA 2LWIA 3NCHA 4MUBA 4TV9A 3M4YA 3VPSA 3X2FA 5ES4B 5THQA 4HAZA 4K0RA 3MDCA 2FSIA 1MF7A 4DMMA 3OKAA 4UHEA 3DF7A 3UANA 2AJ8A 2YJGA 4QUDA 4WBSA 1A9YA 5CM9C 2AVNA 2EEZA 2M1ZA 2ZP1A 9ICMA 1LX7A 5FBVB 4LX0A 2HD4A 4C5BA 4Q5IA 4EAAA 3G7UA 1GRNA 4ZK2A 4CMAA 1R6BX 4BMSA 4F5PA 4NXZA 2RK3A 4IG9A 3HZRA 3E3OA 5AYVA 3N6VA 4BNDB 7ICFA 5B57C 1IFXA 2ZBVA 4AECA 4O3SA 5IILA 4OJPA 3AUFA 5FUWA 3MWDA 1L1FA 1MAVA 4KHPB 3BTUA 3IILA 2P9GA 5JSHA 1ZS9A 3B89A 3LGAA 4HVCA 3P32A 1WXQA 1Z0DA 2RIRA 4EARA 5BOSB 4W5QA 4KO1S 3FSEA 4M7PA 4J7AA 1Z2NX 4P4NA 1L8OA 2PT7A 2VDPB 4V03A 3RVRA 2AJQA 1ZM3A 5C32A 1PWYE 3BFKA 3ZX4A 1WPXA 1N7JA 2XWPA 3MWJA 4PQFA 4Y0NA 3WP1B 4B3CA 5J0QA 4PH5A 2AXQA 3GZNA 3TAPA 4KU4A 4GFJA 4K8RB 2ZB4A 5GMOA 1NK6A 4MJ3A 2E0IA 2I1LA 4Q6WA 2AN3A 1B15A 4MEAA 4Y9TA 1SXQA 2BN4A 1H65A 4UTZA 4GIBA 4BLSA 5AW8A 3H5IA 3HBNA 1JE1A 1JXOA 2WF7A 1EQAA 1CG6A 1P5FA 1PJTA 4MRSA 5EWGA 2VSNA 3K9LA 4M22A 3D2NA 2Y1KA 2VPIA 4HWTA 1ELOA 2B94A 2Z3VA 3GF4A 3QLVA 3R3YA 3LQRA 2I2DA 5F12A 1IUNA 4AURA 1G5HA 3QF7A 1SBTA 4JQOA 2AOUA 4D6XA 1IMOA 4CGZA 2RAFA 4OXRA 4I27A 2I62A 2QSZA 2YNMD 3MCAA 3DFIA 1ZA1A 3M81A 4V3CA 4WKBA 1BXRA 3TL2A 4DJ5X 5JC8A 5I5EA 3KZOA 3IKVA 2Z1NA 2D2VA 3QOFA 2D6FA 4OK3A 1CU1A 3C39A 2CLMB 2SCUA 4RQ5A 1NK7A 1WIWA 2IBSA 2FEOA 2D13A 1A50B 1TVCA 3W1WA 2EP8A 3WNVA 1T3SA 3Q7SA 5HM8A 3QU2A 1FX0B 3TDNA 4PX9A 4V1CI 5M04A 1W4ZA 2W7PA 2Z58A 3BTOA 1OAKA 2XKAA 5IM5A 4KTVE 2C9OA 4OI0A 4OX9Y 1AC5A 1OY1A 2HJSA 1IL0A 1F8UA 1GU0A 1XCPA 3PDIA 4P4TA 4X64B 2EQYA 2PVSA 4PCVA 3T38A 2GZ2A 1P0IA 1N0HA 3BC1A 4C0WA 1I2MA 3UMBA 2BFWA 5CVEA 5FTNA 4O4HA 1VJ0A 2DPGA 2NV6A 3H2BA 4UMFA 3ZE2B 5KT3A 1OGIA 3VHLB 2E1EA 4IQ4A 4R2XA 4R1UA 3UGQA 4A6EA 1YDEA 3W6OA 1RKVA 1ACMA 5EHGA 1BH2A 3OCUA 4A36A 4HMOA 2C29D 4L4RA 3LSTA 5I45A 1PVRA 2W8ZA 2WFAA 5CURA 4LCBA 5EQFA 3IQDB 3WXMA 3K94A 8ICAA 3RYHA 2PKWA 1XZNA 1KZHA 1Q2UA 2W55A 3IR6A 4XPZA 3U4GA 1CPYA 3WHPA 4GEGA 2LRHA 5KFWA 2IOFA 1QV6A 2PUTA 3M82A 2WWWA 5AVSA 3HVRA 1SHLA 1C9EA 1DXOA 4R81A 4OM7A 8ICWA 1MQ3A 2FUEA 1S0OA 1BW9B 2ZJ8A 1HK7A 3H84A 4PPYA 4BNLA 4BQSA 1E3LA 5KVVA 4KPYA 2ZIUA 4GDFA 1LJ8A 3ETEA 3HY4A 3ETLA 4J9VA 4EHJA 5IANA 1KGDA 2F3UA 1JPNA 1ZOOA 5GWXA 1QORA 3NWJA 3E7DA 3VU0A 1CQJA 3TLEA 4FNOA 5HA5A 5FNVF 1H0HA 1NE7A 4LXGA 5J5AA 3RSZA 2J9GA 3UGTA 4F56A 2F1RA 2AFRA 3CIOA 5FOQA 2ZAIA 3K9WA 3OJOA 2JFGA 1XQYA 3MMZA 8ICGA 2H3EA 4JSTA 4LXQA 4U2FA 4F4IA 4Z3OA 3CLUD 4JFRA 3JZFA 5EERA 5GGYA 2BBOA 1P0FA 2EYUA 2Y2UA 4RFLA 2O3QA 4PCLA 1DXQA 2HA7A 2QG6A 3EPRA 1KSGA 1CDDA 3ZX5A 5LSAA 1TGYA 1ZH6A 1X1RA 4O2BA 4EA7A 3OQMA 2QZJA 3HXMA 3UOGA 3VQTA 3LPLA 5KOHA 5EP2A 1JEAA 2GZAA 4FKMA 5EP4A 3T7SA 1HURA 1NI4A 1H3NA 3F4KA 1PR0A 3ELWA 1JEQB 3FOWA 3WFZA 3UCFA 1M0WA 4TZTA 2P30A 2E2WA 1Y42X 2ACWA 2NACA 1NNEA 4QYSA 3LKDA 5DT2A 4FSDA 4D4GA 1IIRA 3PDHA 2RQ5A 2BQ3A 1B8NA 1ZQTA 1T2CA 1D3AA 4KPUA 5IAKA 4MA5A 4A8JA 3O26A 4ZXPA 3I8XA 2TECE 2XZLA 3UMGA 4TVKA 4O5OA 3LX4A 4S1VA 1NF8A 4BKRA 3IIMA 3OX4A 5KC8A 1EGQA 5MDHA 3PITA 1IZ8A 3UMVA 2XVZA 1YUNA 1OF1A 1OILA 3H13A 1EWYA 2HRCA 2H4FA 2Y71A 4OXQA 5B4TA 1NK8A 1P73A 1T2FA 5AKJA 3CF6R 3JVUA 4OYLA 3BE4A 4ED9A 1DXYA 1A9XB 1H4TA 1DUIA 4QGHA 1DCTA 3RC8A 2AJLI 2AN4A 3GDOA 5TS3A 1XSLA 2VSQA 5AJHA 3K8OE 1QRAA 1E1MA 4LDQA 4COOA 6PFKA 1Q0HA 3SMVA 2IPLA 4MKZA 4WINA 3SYKA 2C7BA 3L8HA 3NTVA 2RLTA 3GT7A 3LQYA 4L5CA 3WBFA 1U48A 2BEKA 2I9PA 2A1TS 1WPGA 3HWWA 3O95A 3I45A 3ZCQA 1MN6A 2ZPAA 3DKKA 4RY9A 1FU7A 1JU3A 2Q29A 5B37A 4NX2A 4EGAA 1ZQSA 4ENSA 5IZCA 3DOUA 3PS9A 4M8SA 1Z47A 4K9MA