3QUQA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, an open cap conformation
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
225
structure length
225
Chain Sequence
HMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 83
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3quqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3quqA01
1LTQA 5ALPA 3HYCA 4KNVA 1T5TA 4Y2VA 1WPGA 5AESA 2ZBEA 2GMWA 5ALZA 5AVUA 5AVZA 4B6JA 4AS2A 4HGNA 3KC2A 3W5CA 3ED5A 3E58A 1EK2A 4BNDB 3WK7A 3QYPA 3NRJA 4XE5A 5A3SA 3ZVLA 3AR6A 2GO7A 3ET5A 4DCCA 2AUTA 2HO4A 4DWOA 2ZG6A 5A3QA 3EF1A 5ALGA 3RF6A 3WK8A 5ALUA 3I6BA 2G07A 1Z4IA 3OPXA 2FUEA 3QUCA 1MH9A 2FI1A 3P96A 2ZOSA 3AR5A 1FEZA 3QXGA 4OFZA 1TJ4A 4UW9A 2FDRA 4OHFA 2C4NA 2BDEA 2YBDA 3WKDA 4G9BA 4YIHA 2HOQA 1U7OA 1Z5UA 3L8FA 5A3RA 1U7PA 1RRCA 4HAIA 2CN1A 4ZEXA 3I76A 4YH1A 2EARA 5E0OA 3S6JA 2YJ5A 1J8DA 3MMZA 3NANA 1RKUA 5AM1A 3VAYA 3DAOA 4H1WA 5ALTA 3AR4A 2AH5A 2IYEA 3FPBA 3NALA 3F9RA 4Y2YA 1S8OA 4OCZA 2O9JA 4KX3A 3QU4A 3L8GA 3PGLA 3WK5A 3R09A 1ZD2P 3PDWA 5AM3A 5AM4A 5ALFA 4C4TA 1F5SA 1L7OA 4DW8A 1CR6A 3EPRA 4UMEA 5AW7A 4UMDA 3WGVA 4FE3A 4YIKA 4BBJA 3KBBA 3SF0A 5AVWA 1T9ZA 3SHQA 4NABA 5AVYA 2YMQA 4EX6A 2CFRA 5AVVA 2IOFA 4DFDA 3B9RA 4YGYA 1RMYA 3N5KA 3MN1A 3DDHA 3L8HA 1N8NA 2MU1A 3U19A 4BEWA 4ZEVA 5ALIA 1QQ7A 2Q4TA 4GXTA 2W11A 3ET4A 3EWIA 5AVTA 2BDUA 3A1EA 4CF4A 2R8YA 1YNSA 1SWVA 4ZEWA 5AVXA 2I54A 4FFDA 5AKGA 4IFTA 4UMVA 1L6RA 5AI5A 1QH9A 4HGRA 4UASA 4YCMA 4UARA 3MC1A 3J7TA 1RC8A 1LVHA 1U2TA 1NNLA 2AGVA 3A1CA 1YDFA 3SLRA 2JARA 5ALOA 1VJ5A 1IWOA 2ZBFA 1XVIA 3NUQA 2P27A 2NO5A 3UMCA 3NASA 5ALVA 2OA0A 2HCFA 2PQ0A 3QNMA 4F71A 2WF7A 2FPXA 2R8ZA 3FPSA 3L1UA 3OCYA 2YN4A 3KOOA 1TE2A 1O03A 5AIAA 2ZBGA 3IRUA 4EEKA 3ESRA 4UM7A 2PR7A 1ZOLA 2WF6A 5AW5A 5ALHA 4CF3A 1Z4PX 3ZTWA 3SKXA 2R8EA 1NRWA 2P9JA 5AKEA 4NFLA 4KYTA 1S2OA 1U2SA 3NAMA 1TJ5A 3AR3A 2RB5A 5AKHA 4UMFA 1RMTA 4EX7A 1TA0A 2OM6A 3OCZA 3OCVA 5T41A 3ZWDA 3QGMA 5AW6A 3I1YA 2BY4A 3R4CA 4JB3A 1PW5A 1QYIA 2GHQA 3ZX5A 4F72A 5AW2A 4Y2JA 5AI8A 2W43A 5AW4A 3W5AA 4I9GA 2HSZA 4Y2PA 4Y2QA 1TJ3A 3U7HB 1AQ6A 2B1QA 2YJ4A 1U02A 2MU2A 2O2XA 1XP5A 2CFSA 2WF5A 3ZWKA 2P11A 2WM8A 3L7YA 3SKYA 4HGQA 3FM9A 2OYCA 1L7PA 4KN8A 2IOHA 5AKXA 3L0YA 3L1VA 1RKQA 3ZTYA 2JAUA 5AI9A 1N9KA 3RFUA 4BKMA 3FVVA 5JJBA 2GHTA 4KNWA 3UMBA 2IOFK 3ZW7A 4UAVA 3KDPA 2B30A 5AW1A 1VFPA 1ZD3A 5AM0A 3E81A 5AKLA 5AVSA 2R8XA 1RLTA 5ALKA 5AW3A 2HF2A 3AR9A 5AK3A 2HEGA 2NO4A 1ZJJA 1NF2A 1CQZA 3ZVNA 2I55A 3M9LA 3N1UA 3WKCA 4BX3A 5AM2A 3QU2A 1J97A 1Z4MA 4BNDA 4IG4A 1QQ5A 2AMYA 1WZCA 5AW8A 2YMLA 3DNPA 2DQSA 2ZBDA 3QLEA 4CF5A 4XOUA 3AR2A 5AK6A 1WR8A 2GFHA 3QU5A 4UU1A 3AR7A 2MSNA 2IA5A 4XQ0A 3B8EA 1RPZA 3ZU6A 4GIBA 2B8JA 3TLMA 2G0AA 3QU7A 1EK1A 2WF9A 3E84A 1Q92A 1RMQA 2FPRA 1YV9A 2EATA 2W4MA 3OCXA 5ALEA 4O8CA 4HGOA 1SU4A 2QLTA 4Y2SA 4EELA 2HDOA 1VJRA 1SWWA 1Z4JA 3L0BA 3D6JA 1L8LA 1Z5GA 4UU0A 4EENA 2RARA 4RESA 2YMPA 3DV9A 4Y2TA 1L7MA 3W5BA 2I6XA 4QQFA 1ZD5A 1YMQA 1X42A 2HI0A 2G1AA 3OCUA 3UMGA 3ONNA 3W5DA 1JUDA 3ZVMA 3PCTA 2WFAA 2QYHA 5AW0A 2G09A 3WK9A 1Q91A 4UAUA 1T5SA 2NYVA 2YY6A 2JAWA 2JAOA 5ALQA 4EZEA 3WKAA 3L5KA 3SD7A 5ALLA 3N28A 1QQ6A 2FPSA 5AKKA 3A3YA 3BA6A 1Z4KA 2FUCA 2HX1A 2WF8A 3KD3A 1Z4LA 3WKEA 3QUTA 1KYTA 3WKBA 4CE6A 2ODAA 4I9FA 3ZX4A 4KX5A 3EF0A 4G63A 5AKZA 2VKQA 3ESQA 2FPWA 2D2VA 2YMMA 3MPOA 1ZRNA 4XPZA 2RAVA 1K1EA 5AHXA 2FPUA 2JGAA 4AP9A 5ALSA 4YCNA 3AR8A 2C8KA 4YCLA 1Z4NA 2B8EA 4OD0A 3I28A 2YJ3A 5AKIA 1Z4OA 1RQLA 4BEVA 1RQNA 1O08A 2C9MA 3CZ4A 1RDFA 1Z88A 4J2TA 4C4RA 4AS3A 3A1DA 2B1RA 5ALXA 2Q4RA 4NAVA 3FZQA 3N07A 3R9KA 3NIWA 2G80A 3N8GA 3UM9A 4MUMA 5AI6A 2WHEA 5ALDA 2RBKA 4QJBA 2P69A 5ALJA 4C4SA 1YJ5A 2X4DA 3U26A 4E88A 3U7EB 2OBBA 1Y8AA 4BX2A 2ZXEA 5IT4A 5ALMA 3KZXA 4Y2UA 5AICA 3SMVA 4CNQA 3IJ5A 4UM5A 3HLTA 3BWVA 2HHLA 2PKEA 2C88A 2HF7A 4HYTA 3K1ZA 2I34A 3QUBA 3QX7A 4L6CA 3U7GA 5AK4A 2FEAA 4Y2XA 5ALRA 1RLOA 3WK4A 1Z4QA 4MWOA 4JDPA 4HGPA 3ZUPA 4BX0A 5AM5A 3L0CA 1YS9A 3E8MA 4RETA 5IS2A 3CNHA 3U13A 4UATA 1L8OA 2YFYA 1L7NA 5AK5A 5AIBA 1ZS9A 3OTQA 4Y2RA 5AI4A 1ZD4A 2CFTA 4Y3UA 2G08A 5ALWA 3GYGA 3ZI4A 2I7DA 3U7FB 1ZRMA 5AVRA 2B82A 5AW9A 4L57A 2Q5EA 5ALNA 3M1YA 3WGUA 3QU9A 5AKYA 1RKVA 2C8LA 4BYGA 3IB6A 5AI0A 5FP0A 3B9BA 2G06A 4PNHA 3L8EA 2I33A 4L6AA 4J03A 1RLMA 3OCWA 2EAUA 5ALYA 5IT0A 3FGOA 2YJ6A 4FYPA 5AKJA 3WK6A 1WVIA 2B0CA 4NWIA 4NV0A 5AVQA 3PGVA 1XPJA 3QUQA
chains in the Genus database with same CATH superfamily
1OWMA 1UFVA 3BSFA 1XLVA 3A4TA 4WVFA 4JVNA 4D9BA 4L50A 5BWOA 5K0NA 1T5TA 4EUEA 5JQGA 5KX5A 1XNRB 1CXZA 1SVNA 3VO1A 1EHIA 4WXMA 1NJ5A 3KQMA 2YQZA 3IDSA 3D8UA 3DKKA 2PO7A 3AQIA 3P0RA 5K3DA 2I0FA 3RIYA 4ONEA 4UNPA 4MARA 1E0DA 3EZ5A 2MHCA 2YS7A 1CUZA 1BPZA 1T8SA 2FW7A 3N6RA 1G21B 9ICOA 4CLOA 1JKJA 3KYDA 2PBLA 5GOTA 3TLGA 2QDXA 3CPEA 3H87A 4MW4A 1OT5A 4XE5A 3W3ZB 5JPDA 4JI7B 2R751 2AFHE 4DUGA 2X2OA 5BW5A 3ZLUA 3BB1A 4MR7A 4MV5A 4QBGB 2QQEA 4POAA 1KEZA 3D0QA 1NVGA 1NASA 3QMWA 2G6TA 4JELA 1O9BA 4R1NA 5D3MB 3S44A 2V7QA 2D5AA 1R3UA 4URZR 1C5KA 4DYVA 2DWOA 1WB5A 2K2WA 4EYHB 1DC5A 1T24A 4OGLA 5L3VA 5B3JA 1K3UB 3AVWA 4YXMA 2WRZA 4X7MA 4ZVMA 3TZCA 2OYSA 2NT4A 4PSAA 5G0VA 1JIJA 1O8CA 4DILA 621PA 2VPWA 3QUCA 5THXA 3RFAA 4CFSA 5HQ3A 4UAJA 4KQXA 1YI0A 4WADA 3TDMA 2PX2A 4RFLA 3MUNA 1DI0A 1TYCA 1KKXA 1KSHA 1SULA 1Y3HA 5DBOA 4DWOA 1TZ2A 4QRHA 2CLMB 2C4NA 3C7TA 1SJ9A 2E3JA 4PPQA 3VZQA 1OH8A 3T7AA 2X9QA 2CV0A 1Y7IA 3H1BA 4G9BA 4C7VA 1XZAA 3N7TA 1ZQ1C 2IH4A 3E9DA 1BX1A 3AIMA 3VJKA 1K89A 3RUHA 1Y8RB 1V1MB 2I4RA 4MRVA 1K63A 4AWXA 3MWEA 3K71B 3W3AH 1K0FA 3G23A 5H0IA 2B69A 5HM6A 2XUFA 3DKIA 4ECUA 1ORWA 1KH3A 2E49A 5FUWA 1I4LD 4HAVA 1L7RA 3QQ5A 1K6MA 4UUAA 1UDAA 3N8NA 3BKWA 1JTFA 2PUEA 5CDTA 1X0XA 5CR9A 3T8YA 1U0BB 4FHFA 3OO1A 4WXEA 2C2BA 9ICGA 5AHKA 5I5GA 5KVCA 4OUKX 2VHJA 1QLNA 3ZWQA 4GBMA 4L9SA 4EHIA 2IV7A 1POXA 4ZZ0A 4HWRA 5KL1B 1I9GA 1MRZA 2J0UB 3RROA 5JVDA 1X9WA 1GDHA 2NXCA 1W5SA 3EXG1 1XQ1A 3FFXA 3GO4A 3MWKA 3EX7C 1K7XB 4P7KA 1HFKA 3D4IA 3H75A 4F11A 3G7UA 2RCNA 4EG7A 2O2DA 3LO5A 5FI3A 1C0EA 3EW7A 1Q0UA 3DAYA 2VAWA 5J8YC 2P90A 2GSWA 3K0HA 1DQYA 3NH6A 4HAYA 4YJ3A 5IBPA 3W2FA 1ZNWA 1IZYA 2C0QA 4FBUA 2I2DA 2PPVA 2WJJA 3PC6A 4C05A 2JJMA 3VPBA 1U0EA 4DFDA 5BXQC 4ED3A 5ICFA 1ZISA 2G04A 1VI6A 4EW3A 1A4UA 2PZFA 1HDZA 5I01A 4DMUB 1PJLA 4OB8A 1NDQA 5LXTB 1XRJA 1UINA 4JQSA 3SQOA 2HBLA 1BVRA 4HQOA 4ENTA 5U4XA 2ZSFA 3FHOA 1NX9A 3GHHA 5IM4F 3LIIA 5FB3A 2XB6A 1HIWA 2J31A 2QV0A 2FOLA 1E7YA 3PFIA 3QEJA 3QPVA 1G3IA 2QN7A 2WUEA 3N53A 9ICBA 5KTYA 4ZEWA 3TKLA 1V6AA 3NEJA 1HV8A 4B9UA 2HJHA 3F3MA 3LU1A 4PXYA 4EPRA 5L3QB 1Q7EA 2PO5A 2BVNA 2HY7A 2IEDA 4R84A 5DU2A 3MS7A 4Z7OB 4HDRA 2RGRA 4JI0B 3ZJ5A 3A6ZA 5C2JB 1E7WA 4R64A 1CY8A 2B25A 2Z2XA 5B1HA 1GA4A 3MC1A 1SBZA 4QD3A 1A82A 1N6NA 2UZIR 4Z1OA 3VKUA 3WNCA 1R6VA 3FCOA 3I6IA 4GOXA 4TQGA 3KQNA 1EINA 5C31A 5EWMA 3N7RC 3NM4A 2YYZA 1KK1A 1S89A 1GUZA 2ZPTX 1SBCA 2WSSA 4MR8B 1P5FA 2NO5A 4H1TA 3T79A 4IQUA 4FX2A 5ICSA 5ALVA 1NXOA 3RJ9A 4B80A 2LBPA 2WTUA 2VDJA 2ZDHA 3A58B 3LT5A 5ESRA 2HCFA 4PONA 4EL0A 2A92A 6REQB 3GNSA 4TT3A 4HHEA 1FRNA 1FPMA 1P1BA 1TU3A 3B1XA 3L1UA 3SHOA 5CDSA 2GXAA 3W79A 3IP3A 2C2HA 4EZ9A 2R8OA 2BHTA 1QP8A 2R5FA 4RGYA 5FJIA 3AUJB 4UNNA 3SQXA 1UDWA 3P4UA 3PVZA 4TKUB 4AJLA 1HMYA 4TMVA 1ADJA 1QFZA 3RJFA 4ZREA 5KFKA 1O87A 2JDID 4XX1A 4EEKA 3ORYA 1FRQA 4FEAA 4BN0A 4I2EA 4P84A 4FGSA 4CF3A 3O9VA 3DTVD 3H8MA 1A50B 1LUAA 5DK4A 2WJ4A 4G25A 3O75A 5AT1A 4B09A 2ZTEA 2SKEA 2FG6C 2Q5JA 4BNMA 4DARA 1ZH6A 5AMXA 2IPNA 5B64A 2VP2A 1Z15A 3B89A 4FBTA 4JSTA 2W5UA 1W5AA 1PR3A 2XODA 4CTMA 4RH3A 3RYIB 5DT9A 2FSVA 3DF7A 1MGPA 4UMFA 3WGYA 4YPOA 1VBMA 3LXUX 1EIZA 3B3GA 1UA1A 4EX7A 3MT7A 2Q50A 3P9SA 1EBFA 4I46A 4AJ9A 2QR2A 3ZDEA 3IHLA 4RWZA 1IULA 4QYMA 4P93A 1E1MA 5ISMA 3IOYA 5BNFA 3EUFA 2J9RA 3EZFA 4S0ZA 3CLKA 3T95A 2GHQA 1G4AE 1ODLA 4QZDA 1SL0A 3VR5H 3NC1C 3TD9A 5AW4A 2IBKA 3EG5A 1M2GA 7MDHA 3I39X 4BVAA 4I9GA 4TMWA 3QPDA 1LV5A 1Y8ZA 4A2PA 3LDGA 5ULLA 2I91A 1YB2A 4RLSA 3H2SA 3TLYA 5FADA 1D1PA 1NW3A 1ADCA 1OIVA 2AXNA 3AQ4A 4IJQA 1S5LU 2OMEA 5AJZA 2XUQA 4XDGA 3AFHA 1HURA 3ZWCA 3GFPA 1E5TA 4ASUD 2BFWA 4ECEA 4ZMRA 1YCFA 5CCEA 3PQEA 1W581 3ZWNA 3G2NA 1BDBA 4NBSA 4AECA 3PUYA 3RSSA 1PJSA 4HGQA 1Z0FA 2QTRA 1XRSB 1QO0D 1ORRA 3DKVA 3OA2A 1XA4A 2FW9A 1P80A 5E6SA 4KDFA 2A0KA 3G82C 3JPQA 3GZNB 1IWBB 3PX6A 1KSFX 2D8MA 2L0XA 4IRCA 2R3SA 3VDMA 5F1YA 1KH2A 4G65A 2ZIWB 2W2TA 5IH7A 4MMZB 4OAPA 2ZQYA 2V96A 1K86A 5K0FA 3AF2A 4F9EA 4C3OB 1FFSA 1K6XA 2KLHA 1XQYA 2IE8A 3R6LA 4FUQA 1TW3A 4LY6A 2R79A 1BG6A 2QD5A 4BUJA 2FJ0A 2XTZA 4KLAA 2IOFK 4PIVA 4R3WA 3UK7A 3W6ZA 1ZRHA 3IV6A 3G49A 4ZCMA 5HKLA 2PT6A 2R47A 3DXZA 5I3CA 3PIIA 1Z2NX 3VO2A 1GCUA 1FFYA 5C8DA 2EOAA 4BMYA 3RADC 4PWZA 1AB5A 2YWBA 3BRCA 4J9SA 3MPUA 5FI0B 4ENSA 1E1NA 4W9NC 1S6YA 1J2UA 3G85A 2HH9A 3H4IA 3OT5A 3OX1A 4MQ4A 1O9GA 2CVHA 3ZZ0A 5CA7A 5LQDA 3EVZA 4Y0NA 2PGJA 5F51A 4BX3A 4F5QA 2H2AA 2QT9A 3O26A 4FNMA 2BGUA 3IVCA 1C1XB 1MQSA 5AUNB 1Z4MA 3D31A 4JLDA 3UMVA 7ICEA 9ICCA 1J23A 4D9IA 3E9RA 2QBYB 3U1VA 1BROA 3ALRA 1QPZA 3P4XA 2AC2A 1WZCA 1UH5A 3DNPA 3CNBA 1Z13A 2G0NA 4IWNA 4YWHA 3W90A 2FGJA 3V1MA 1OA1A 1XO1A 2XAAA 2XUAA 2XUIA 3FN4A 3BZUA 3WL7A 3TM5A 3X44A 1UZAA 3E0QA 5FFMA 1QHIA 2VAMA 1WR8A 2X8BA 4JL8A 4UU1A 4JZKA 4MB0A 1XNQB 3LTNC 3KUUA 1KIMA 3FMOB 2QZZA 1JRLA 3UAXA 4CIVA 2FX5A 2VYVD 1P2TA 2WUVA 3Q85A 1HT1E 3FLEA 3UK6A 3JVVA 3TLMA 3FTFA 1OMOA 2P9YA 2WF9A 5KOJB 2VYNA 2P40A 2G8LA 2FPPA 1TUGA 4I1YA 4O2BA 4FXOA 5LXTA 3K0AA 1PLJA 3ZVKA 2Q28A 2DUMA 2VYND 2C1EA 1NM5C 1X7WA 2PX8A 3IX7A 5AP9A 2D3WA 1CR2A 1AV7A 1C3EA 1ZLYA 2JFUA 2VXOA 2JHPA 5DJ5A 1KAOA 3RC2A 5BSGA 1ZD5A 2C3OA 3GA0A 3ZBPA 4F91B 5KUTA 5J2DA 1QRUA 4DZTA 3RHFA 3UXMA 1I14A 1MABB 2O3JA 4FWIB 5J0WA 4I55F 4QJ3A 2WFAA 1D0SA 2NO7A 3TW0A 4B6FA 3CZCA 4U0JA 4BUCA 5KYTA 2QTBA 5JCJD 3QKRA 4Z9AA 1Y82A 2X42A 4X63A 4XQ8A 1L4UA 2NQTA 2XD4A 3OPVA 3QEBZ 4PGMA 4YAIA 2R8JA 4RAQA 1GN8A 2HJRA 1X7XA 3K2EA 2UDPA 5CK5A 2ZYSA 5KTTA 3AWIA 2IZ7A 1Z38A 2HWKA 2OP0A 2Z9BA 5AKKA 3MJ4A 4OSPA 5F1KA 2A1UA 1L4EA 1SUIA 3PVCA 2XR1A 5A1TA 4EDHA 5J4HA 3EJ6A 5J9FA 3NOXA 3QMPA 3SZGA 1S3GA 4ICAA 3C8ZA 5L6MB 3W5HA 5EWLA 5TF0A 8ICNA 2P5TB 4QODA 3IKLA 3KHLA 4BVLA 4XRGA 3CRVA 4U6NA 1PCXA 2BEVB 4Q3NA 1RBMA 3IBSA 2Q6OA 1UT5A 3PO5A 4X84A 4POOA 2IIPA 5DBCA 4FZRA 4L1KA 4HNTA 3BAFA 3SAGA 3TOSA 5KTKA 1FP7A 2EHDA 1LK0A 1P3JA 2JHGA 2KE5A 2VHTA 3GLSA 4ZXFA 3U7QB 4DM7A 3UT5A 5JVDF 2BYTA 1TKBA 1VZ3A 2V8BA 3OOHA 3GLGA 4NHEA 2HIAA 3REOA 4O2LA 2WT9A 4BP9A 3CS3A 3I09A 3ZZNA 1QWOA 4QEKA 3TAHA 3E9ZA 2GNPA 1RNLA 3RIEA 4EHDA 4GPTA 4N0PA 2DTEA 4JGIA 2VZ9A 3HCDA 1GD1O 3SVZA 3V8PA 1GAWA 2A9OA 4QZVA 1ED1A 3A4VA 1BXZA 2ECOA 1PTJC 1GPBA 1MPXA 1JZQA 1M2HA 3FVTA 4ITUA 4NOJA 2ODWA 4PNPA 4RF3A 1C1YA 1H1TA 2QLBA 3OKAA 4ECQA 1PGNA 2YJ3A 4TXLA 3RYFB 3TB6A 1UMDB 4CKWA 3INTA 3LOUA 2HPZA 4BLOA 5F7XA 2O8NA 2RDIA 4NULA 1A5AB 1QNFA 3UNXA 1P33A 1Y34E 1YR2A 1NKVA 4KAJA 2XHZA 4JEUA 5GWXA 3CR8A 4R2HA 1FFHA 1UKAA 4TL8A 5FBKA 2RHOA 2AG6A 5KFMA 5DWVA 2WTBA 4Z4EA 3DJFA 4NAVA 5E38A 3ASVA 4ERNA 4L9WA 4YAOA 4G09A 2HBRA 1QH1B 2CPRA 3UM9A 4IX1A 2YVUA 5D6NA 3SIXA 2WHEA 4EA9A 4XQCA 5EQDA 3AUAA 4O4HA 2GJ4A 2P3OA 4DLPA 5KJEA 3HKBB 1U11A 5BMOA 3FHJA 1D04A 5EEHA 3FJ1A 4UHJA 1NBOA 3DYBA 1Y8AA 4RT2A 1L5YA 4L51A 3S3TA 5B7PA 4GYWA 4ZHQF 5ALMA 2DE0X 3OEEA 4HK4A 1T5OA 1XKXA 2AQ8A 2K4PA 2OB1A 3VR5A 1YK1A 2GEDA 3C29A 4ND7A 1I2BA 1SKYE 4F3TA 2AZXA 3GIDA 2JJ1A 4MZXA 2GK3A 3IJ5A 4EY3A 5HILA 3D1VA 3KOMA 2QJOA 1EKXA 4PC3A 3OZXA 4YAGA 5KFBA 3T5PA 3NPMA 2QVGA 1M1YA 4RNOA 1VMDA 1ZICA 1E3JA 1VP3A 3PK0A 4DNPA 3WK4A 1L4YA 5K2MA 4DB4A 4BJ6A 1NOJA 3ZVRA 1XYGA 2M32A 3FVQA 3IALA 3ND6A 4KRGA 3SU8A 2XYRA 3VX3A 2PUGA 1FU8A 2XNCA 5AXAA 4GI1A 4UAZA 3IAM6 4NOLA 3DMDA 3TJMA 3U9LA 4ZDIA 2I78A 3U49A 3IDQA 1XVUA 2AEJA 3QKRB 1QV9A 3ADPA 3B85A 4F38A 5EMLA 5BSUA 1YFZA 4PLWA 1HKHA 3VU0A 2JAXA 4FQ8A 2YWDA 5CBPA 1V11A 1NMXA 2ZAGA 4LOLA 3SZOA 4MRNA 3IIIA 3TGWA 3N2KA 2WSSD 4P4NA 3P2EA 1R74A 5DBHX 1UEXC 2COUA 1REQB 1WUHS 4IIVA 4K9SA 1TFUA 1O94D 1Q0RA 1GV1A 2HTFA 4JROA 3R3XA 1DO2A 2QGFA 5FNZA 3IURA 2IS1A 3ILVA 3WI7A 2EANA 1SRQA 3HX0A 3INNA 5JS6A 1XMQB 5HGJA 1XKQA 3L9XA 2D5LA 4BYGA 4WA8A 2VLIA 4HH1A 4AO8A 1BE8A 3Q6IA 3KV1A 3ULKA 1BDHA 3TLXA 2WIAA 1QHNA 5LXTF 1Z08A 4M1WA 3TNYA 3O8RA 3H5TA 2IQ5A 2ZVQX 3CPSA 3EZXA 1UZMA 3KAPA 3I9NA 3QV1A 4YO7A 4ALLA 3TW6A 2W2XA 3CBGA 3GLHA 1KDZA 4BCBA 1A7KA 4CZ2A 1O4VA 2GK4A 2WZBA 1J25A 3B53X 8ADHA 4XPIA 1XTRA 2VTDA 2WWGA 1XK6A 4FZ3A 4GBJA 1BKSB 3KU1A 4JHXA 2ZT8A 1NAIA 1W5EA 2B4RO 5TY0A 3K9HA 3RK4A 4DG9A 5JDCC 2F48A 2E55A 3E2IA 3EVBA 1A2OA 4Q1AA 5C18A 1YDHA 4GRAA 3RVOA 5CM8B 1N6RA 3D4NA 1RXWA 1ZL2A 1H05A 2F8TA 1J2JA 1T2EA 2ZU0C 1D0VA 3R77A 1FF9A 2WHRA 3GJ5A 4REMA 5IILA 1NW9B 1GADO 1KHHA 3CZRA 1LTQA 4RD0A 2HNKA 2YIMA 3NHPA 4KR7A 1O5TA 2H16A 3HR4A 4J49A 4C8MA 3F7MA 3UUFA 4RJ2A 5AESA 3C3XA 3FIJA 3ZN2A 2FSIA 4PZ9A 3LS2A 4CEHB 1QYDA 4FS3A 3TEMA 3O5AA 8ICXA 2G76A 3JAKB 3KC2A 2V65A 4TTRA 4QPCA 4DT1A 1TPYA 5JZVA 4MV0A 4P4MA 2DPJA 1WCWA 2PTHA 4PO8A 4IIUA 4AIRA 2OFFA 3L07A 3UGKA 3EA5A 1NVBA 3T5TA 3BQ2A 3HB4X 4WECA 1XDUA 1C7QA 2PZLA 3RRHA 1ZOOA 2QI9F 4NDZA 2H0RA 3BHNA 3GDOA 1XZKA 2IIQA 4ZQGA 2IWRA 3TLKA 2XXAA 1AQJA 4DSAA 1CP2A 2WMDA 3I6BA 3R20A 4NE7A 5DBBA 1Z0SA 2FFRA 2H1RA 4AU1A 1CY6A 1NY5A 4X66B 1NN3A 5GGXA 2AFIB 2A8YA 3BWYA 3BCSA 3P9NA 3R8CA 4KPEC 2EWMA 3OLYA 1CEZA 1ZBQA 4I4LA 2IZ6A 3IMEA 5JDIC 4NIMA 5MDHA 1QLHA 2FW6A 4WCDA 5CPFA 2O05A 4I2BA 3PDIA 1K5OA 4UW9A 1EWTA 2YJGA 5BYAA 1MJ5A 4HBZA 3AYXB 1TQHA 4AJKA 2XE4A 3PUIA 4FW9A 1UOQA 1RRCA 1EK0A 2RK4A 2XIQA 4HWTA 1BZYA 4UVGA 4XLLA 4OY3A 4K4HA 3S6JA 2AXQA 2ORED 1J8DA 3MMZA 5B58C 4ENUA 1HFEL 1VHJA 1AQYA 1BMFA 1Z75A 2A6PA 2AOUA 2AW5A 1UIMA 1YB5A 4DLTA 5JD6A 3UMMA 5B5EU 3BRWA 2P9QA 1JEYB 4KMUA 1PN3A 3JRWA 3VC8A 1I1HA 2D7CA 2Q5CA 1Y3DE 2HW8A 1RYSA 4QHYA 1AUQA 2JIPA 4FFBA 4ER5A 2WYVA 4JJFA 4B9AA 2O3UA 3EMDA 1DUSA 5E3IA 4CM7A 4YDRA 3V32A 2FMXA 3ENKA 1VG1A 1PWEA 1YJCA 2GN6A 2Q1TA 4RA9B 4WKGA 5EMMA 2RK3A 3T6KA 4EUKA 5B4UA 1NSFA 5AM4A 4UQGA 1KGDA 1TJYA 2OXEA 3R74A 2WAMA 3TQQA 2QG9A 1UDCA 1CR6A 1GXSA 5GJVC 1ZUNA 4B3DA 4HMQA 1Y37A 3WYGA 2A1TS 4QFMA 1HNZB 2YFQA 4ECVA 1CEXA 3TLEA 4LFBB 5AVYA 4LE2A 4KXQA 5JO0A 2ZXIA 4ERXA 4EX6A 2I4IA 2AEEA 3AL3A 3B9RA 1ZR4A 3PTZA 4J43A 2GVNA 4YUAA 4HNVA 1KI7A 2JHAA 2Y68A 3B2EA 3DJYA 2AC4A 2PWBA 1O0SA 2NACA 3TQ1A 1IK6A 2NT3A 2QUJA 3VJMA 3K32A 2HHQA 3WRVA 1DEHA 1GPLA 3AFNA 3QKSB 4P0TA 2OOKA 2C31A 2BDUA 1OD6A 2JD1A 3A1EA 3G2HA 4MUEA 5DO9A 2Y0SF 5H81A 2BUAA 1T15A 4W99A 3USES 2B4QA 1D9DA 1ZL0A 3JZIA 4UE3S 5F5XA 3GJYA 4BVHA 1PSWA 5CEHA 1Z2DA 1YACA 3NWPA 4ZOBA 3U9SA 4H6WA 3ZKWB 2X0NA 4J9OA 3AX6A 3TGLA 4CDNA 3V2HA 4WEQA 4Q4AB 4QOFA 5IF3A 4KVFA 2DKOA 1VDZA 4LZZA 1T36B 1E6KA 1Q16A 4CLOB 4DXHA 5BSWA 2KJ8A 3COYA 1X87A 4YJ2A 3OMLA 4RTMA 1BXGA 1N61A 3FOBA 3QSGA 4ZV4A 4RTRA 2GPSA 2MSLA 2H1WA 4EH1A 3MW8A 2P2NA 1I4DD 1N1EA 2HVIA 2Z3ZA 4MUIA 5TGTA 4ZDKA 4LISA 1XNSA 2GN0A 4DVGA 1V25A 3KT8A 5J2BA 4FBMA 1KYWA 1L4BA 5IABA 5DKWA 2C54A 2OA0A 3OZBA 5JCXA 2PMZC 1GO2A 4RQMA 3K6RA 4OJNA 3W8NA 4Z4CA 4DJ5X 2WV9A 3FUCA 4HDNB 4DFJA 1LQUA 1P17A 7ABPA 1XWFA 3MBKA 3NHMA 3NHWA 5DNWA 3DFKA 3WE7A 1D5CA 5FOVA 1C9MA 4G2TA 5HE8A 1VIMA 1AJEA 2J5QA 1B42A 2B8TA 3HCOA 3UCFA 1XEXB 4RTJA 3OCJA 3C5GA 4R1PA 3H2BA 3WHKA 1MQ2A 4R8SA 1V4VA 4TV8A 3NEAA 4X1OA 1YT3A 3D7RA 3QZ7A 2NZ2A 4EUFA 1ZOLA 4RYLA 1ZQXA 5K03A 1A9SA 1UJ6A 3A6PC 1ZKMA 3ZTWA 4C5CA 5GONB 4KR3A 4B74A 4I14A 1PYGA 3B13B 2H18A 4FFOA 4O3RA 2CK3A 2PDAA 4I5IA 3LZCA 5FFFA 3QPAA 5IF9A 2OO7A 1U2PA 4YR0A 3DE4X 3MWYW 3D8BA 3U17A 3BIFA 3T5DA 3BQTA 4WLEA 4BMDA 2VQ3A 3V7JA 1D4AA 4YMIA 1P2DA 1IMOA 4UD2A 1RMTA 1JAZA 2CUZA 4WDRA 4F4IA 4W5QA 4DQPA 2BFBB 1J00A 3ZWDA 1B1AA 2CZQA 4TWIA 1ORTA 5K4AA 4PAGA 2Q2VA 3WISA 4FN4A 4BU1A 2JEOA 4ECTA 3ZX5A 2VA8A 1PV1A 2IHMA 1UADA 1ZGHA 4Y2JA 2DBRA 2EX0A 2JBHA 2O0HA 1J2NA 3ENWA 3GAMA 3N0VA 4LTMA 3RTCA 4XIYA 2PSEA 3RU7A 5KU1A 2RAUA 2UKDA 2VHWA 5JY1A 4LTDA 1USKA 3Q7QA 1OBHA 1ZQWA 3W4IA 4BO5A 4MUGA 5FR2A 2PZKA 5JZOA 3WP1B 2ISCA 3PSFA 2QB0A 5DM1A 4XWKA 2IX3A 4MR7B 1RQXA 3K2BA 3OZUA 3V7NA 2CFSA 4MPDA 2OCDA 4DKJA 5KYUB 3ASYA 1UPAA 2W8LA 1OSNA 4EA7A 5IWCA 4TKLA 4LF5B 2P11A 1N6KA 4XYLA 3HNRA 2UZ1A 2CJFA 3E3MA 1G19A 3PFCA 4MEYA 3QLJA 3JQRA 4J75A 4LBYA 4B6OA 3CINA 3U4GA 5K05A 2HQSA 3CLRC 4QPPA 1L5QA 1GARA 3IKMB 4FYMA 1JMYA 4PF1A 2PMFA 2H07A 3GRAA 4CTOA 1UBMS 3L0YA 3FNHA 7ADHA 4TZ0A 4ZZ2A 2EDUA 1RRPA 2TMKA 1M2VB 4WZAB 1C7JA 3NNSA 1Y5LA 3NHYA 1P7YA 2NZUG 4HNUA 1IBRA 1GYRA 3SEAA 2AIRA 3FWNA 4ZYTA 5DX1A 2YX1A 2RH8A 1S2NA 2JDIA 4KWCA 5A71A 3GD5A 2VJCA 1YS7A 1L2TA 1Q3VA 3SDBA 5L3SA 3CV3A 1DIGA 5HQJA 4PX9A 2QKQA 5JHHB 2BLLA 4JNCA 4EARA 2IEZA 3UGQA 1CVRA 2R8XA 3O92A 1T2NA 2I1LA 4IFIA 4LZOA 1KDRA 4Q4AA 3MT0A 5ETJA 4QTYA 4HQFA 3R5SA 3DDZX 2JEGA 3J81A 3NXSA 1HE1C 5E1OA 4E22A 4DLEA 2OPBA 1C7IA 4M55A 1IBMB 3EGDA 4WRRA 4L78A 1J33A 3KTAA 4UBKA 1MMFB 2BCQA 2WSIA 3AP2A 3QKWA 4GBED 3CSDA 4K9OA 4PO9A 3PJDA 1ULUA 4WZBA 3BZCA 3RS7A 3LBNA 1LV7A 5CLFA 5JTUA 2JFHA 1HEKA 3N2GA 3HCEA 3C1OA 1XPUA 1CDZA 5TARA 4QTZA 1IM2A 3BMNA 2KICA 3DZHA 4P54A 1AS0A 2YRWA 3D0KA 1N77A 1IBKB 4OSEA 1JA9A 4DR3B 2BOVA 5CRXA 1BD3A 3MMSA 2Y9TA 3NJ4A 4WDQA 3T3DA 3BWDD 3D8RA 4RIHA 1HT3A 5NLLA 1QYVA 1DBWA 3T5KA 2DWQA 1YKSA 2GD6A 5BUCA 5JARA 5JAMA 2XMPA 4FFRA 2WWTA 2XXAB 5LIRA 2PUHA 4WV3A 1CY0A 1XPRA 3N8IA 1B8VA 1DQPA 1A0OA 4ZJUA 2W6NA 2W8BB 1MTZA 2AOWA 1SC3A 2MSNA 1CHDA 2KB0A 4GFJA 2J5BA 3VUFA 1MBZA 3O3NB 2NU7A 4W7HA 4I81A 2FPLA 1D6MA 1ZD1A 2AR0A 1QB8A 1RYDA 1Y7TA 2VDNB 1JPJA 3P71T 4CR6A 4ER6A 3ZLJA 2PIAA 2W98A 3OX2A 4BEJA 3L1KA 3BILA 3NHJA 3ZIAA 3OCXA 1R0BA 1XX6A 4PL2A 2CBGA 2ZK7A 2JGNA 3D6JA 1DC6A 1RI1A 1DLJA 1Y98A 4H2DA 2R5WA 4U2BA 3TBKA 4IP0A 4EVSA 5JSQA 3LWDA 4RESA 3H18A 3L40A 4Q45A 3EFHA 5LQSA 1JQEA 2EEZA 4TUQA 1PT8A 3D0RA 3A4LA 2AJBA 4YC7A 5BVHB 3H04A 2W6ZA 5EP1A 1ZSYA 5J0YA 3C97A 1DIAA 2K7ZA 3QWBA 3V1TC 4HQLA 3AQEA 2WJPA 4MZDA 4YJDA 4P4UA 4GR5A 1PK7A 3CRQA 1T8TA 1CVIA 2VF2A 2VDPB 5A0FA 5EOZA 5C8YF 1M6YA 1BQEA 3GVXA 3UT5B 3ZY2A 4II3A 1WM1A 2NYVA 2QSYA 3JZDA 4WK0B 4B44A 4QDOA 4KQGA 2IW1A 2W7OA 1KMQA 5ECDA 5TPWA 3SC3A 5DNUA 2XZOA 4E32A 2RHTA 4G0OA 5CM2Z 4E5VA 1C20A 1O6GA 1SXJC 2FPSA 3GZ4A 2GZDA 5KPDA 4B45A 2NP7A 4L74A 4I36A 3KQPA 3KUDA 5GQSA 2NU6B 3JPNA 5ARBA 3V7FA 2LXNA 1M8PA 1G1MA 3TKYA 1DCKA 2C2MA 1QXSA 1AUOA 2PRKA 1WP4A 3KVRA 4KI0A 2JK1A 4U2DA 3ZWWA 4L85A 4YQEA 4S1VA 2WVHA 2KEYA 1HDOA 2A57A 1RXIA 3TAXA 2ZRMA 2MR6A 2V4MA 1TEZA 2VOJA 4KO2S 4EATA 4NHOA 4TN5A 4P98A 5CA0A 2R11A 5JSZB 3OAAD 5AQEA 2OGTA 2JV3A 4YJHB 1XZFA 4OI4A 4BO3A 2Q3JA 2WE8A 4HTFA 2OBLA 4RQ2A 4PAOA 1OE0A 3SXJA 4CM8A 1DIBA 4IFBA 4LPSA 4JC0A 1CUUA 1QHEA 2MWMA 3CXRA 1TUIA 2D0IA 2FHPA 4XXHA 5CT8A 4CL0A 1OLOA 1XZLA 5H9VA 4FM9A 4PLZA 2IYVA 2P8SA 2QRMA 2ZI9A 3AR8A 5AVOA 4CKEB 1QVZA 4LRXA 1M0WA 1PYOA 4CLHA 4FR5A 5P21A 1OYWA 2A3RA 3P5SA 1HC7A 3MGBA 1LSOA 3V33A 4NLKA 1MB9A 3GJ0A 4L0DA 3SR4A 3QPWA 1RQNA 3SEIA 3UW3A 4F9GA 1BQ4A 2BEUA 1O08A 1QORA 1KYIA 2ZBPA 4EPYA 3T99A 4I5EA 3KQTA 2HQOA 3F7NA 3HL4A 3SQWA 2V0GA 4J2TA 3AIIA 5GIPE 2H2DA 2HT1A 1H2XA 3OM9A 3L8DA 4DWJA 3EUEA 5LBTA 3A7EA 3C3WA 4BNTA 3ZD6A 3H3JA 1NZFA 3OX4A 1BGXT 1KDPA 1KGSA 2EFCB 1G8PA 3LK6A 3N8GA 3R24A 4OBXA 3R7LA 3A1TA 5KSOA 1ZPDA 1SIUA 2IWHA 2QXUA 4FGKA 1M73E 2NZWA 2WQZA 3INRA 4X7PA 2C3PA 4MVJA 3SYNA 4U6SA 3UEOA 5TC4A 3AOGA 3V7UA 4Z6EA 4RK5A 3LM8A 3WA7A 3SFZA 2JK0A 1T8PA 1CBUA 4KAAA 4KO8A 1J90A 1EUQA 3T5HA 2HT6A 8ICQA 1E0AA 2M6KA 1ZJMA 4COOA 4DR1B 2H1IA 2PRIA 3HDHA 1UPCA 2NPIA 1RHMA 5D49A 1J7KA 3QHAA 2F3NA 4CNQA 1FO4A 1FYVA 3IOMA 3HRDD 4QDKA 3WMRA 4RK4A 5HZKA 2M0NA 2NVOA 4FYIA 2F8KA 3X2EA 1RSZA 4FT2A 4YASA 5EWJA 1GNVA 1C8KA 2ZUWA 5C53B 2AD1A 1P44A 3D2NA 1D6NA 4HKTA 1JG7A 3OFJA 1YZGA 4LXTA 1FDWA 2LYBA 2I2WA 2YW2A 2JATA 5AM5A 3F9CA 1G3MA 2DERA 1FYDA 2VYCA 4GMHA 5P8WA 1DKLA 1ATZA 1AMUA 3THYB 1SCKA 5KT7A 1EFKA 1TEVA 4GLLA 1KJYA 1DKQA 3EDRA 4MFFA 4UD6A 3W5JA 1IEXA 2MSKA 1DEOA 5E79U 2HHJA 3OM1A 5HF6A 5IAGA 4CG0A 2CT8A 3EQ9A 3OE7D 1TIPA 2G1PA 1J0EA 1Y63A 4M36A 3ZYCA 3HFGA 3UTDA 4IFEA 1SCDA 4OHKA 1Q77A 3FHCB 4TTIA 1Z00B 2G83A 4YXWD 1C9YA 1UR5A 1W96A 2FEMA 2OM2A 1LI5A 4FVTA 3SOPA 3GEBA 4PZ0A 5H80A 1QIFA 2C03A 5CEEA 3IPCA 4IV8A 5IHXA 2J6IA 3EXIA 4I99A 2W6ID 3G17A 1H42A 1MEOA 2IOYA 1RS0A 1M7GA 1PZFA 1MG0A 2HRBA 4I1IA 3M2PA 2GR9A 4RVDA 3T3GA 4CQNA 3SQNA 5ALNA 1GQSA 1JILA 2ORYA 2WVAA 2HA3A 2YXNA 5DMHA 5HRAA 3IB3A 5BRJA 4QZGA 2P3SA 2DWCA 4J9PA 4HXGA 4MKZA 5SV2A 3V2UA 5AI0A 2W83A 3QEMB 4R9UC 1CRWG 4OYYA 3BTOA 1EBBA 1R15A 2JGJA 3DBRB 1V8FA 4PNHA 5D5HA 8ICEA 5IM4A 1E4YA 1VL8A 3T0FA 2YV5A 4EY8A 2I33A 3IAEA 2H06A 3QEOA 4Y1RA 5F1PA 3FI9A 3FPHA 5TQ0A 3O47A 4OHWA 2IUTA 3KSRA 1KI2A 1VYHA 3GJ7A 3OPMA 4C89A 1NUUA 1UFOA 2HHCA 2OCPA 2Z04A 4IPTA 2V98A 5EEGA 4LZJA 4ECRA 4EVIA 2VK2A 3PD0A 2DFDA 3HXKA 4LNAA 3W5SA 1R64A 3P94A 5K7SA 3K4HA 5FNVF 1B8PA 4YAUA 1JN3A 3Q8WA 4ISBA 2BZ1A 3YASA 1E60A 1EWQA 3Q6NA 2HQBA 3DTVA 5J2CA 1R0RE 5IULC 5LKAA 5G1PA 1FRVA 8ICYA 1N9GB 4JKOA 4AJEA 3KQUA 4J7XA 3T1HB 3GB9A 4J9KA 3HN6A 3ZY3A 2VNHA 4MLDA 3OBIA 5M7EA 4DRYA 3PQDA 3M89A 4A2WA 1WZEA 2XIDA 3BFJA 3PX2A 1XG5A 3L7DA 3F49S 5IUKC 4IF6A 3W2HA 3ICQB 1X7YA 3I4LA 3W5CA 3DAGA 4L5AA 3PWKA 1EK2A 3NKVA 5AVKA 3UA3A 2ZTUA 3C28A 4LJ9A 2P35A 2Y93A 3OM8A 1L5KA 1ZP6A 2OENG 1XGKA 3RFFA 3QH4A 1NHWA 2O8EB 4J9QA 3ET5A 4NFYA 1ZQYA 2HJGA 2BRUA 2Q07A 1YMVA 1JEAA 5FPHA 4REOA 5JH7A 4CIYA 8ICOA 4M88A 5H9WA 3RT7A 3KJGA 1RFGE 1HLDA 4KMMA 4WUTA 2ZJFA 4O2AB 2G07A 3PIRA 3VOTA 4RUCA 3W77A 1IZ0A 2HRZA 1UAYA 4OI1A 5AUPB 4X1YA 4QM6A 3NT2A 3MR5A 1GY8A 1TK2A 1FXSA 2KWIA 4IDBA 2FK7A 5G4KB 4D80A 2YJTD 4LXXA 3P96A 4RGBA 1E77A 2UVWA 2EZ4A 2ZW9A 1RR6A 3AYZB 3PXXA 5T57A 5GM2A 1K7EB 1ODTC 3KQQA 3M6MD 1XUOA 4HGZA 4IW3B 1VLQA 1PUIA 3ICPA 5KQGA 1U7PA 3RU3A 1R4NB 1E66A 3GFGA 5DASA 4N49A 4E4TA 3UWDA 4FOLA 4IWXA 1PFQA 2Y66A 1EHYA 3QBTA 1HJPA 1ZUHA 4R3NA 4XWAA 5J4VA 4K9MA 4ED0A 3LVWA 3B0XA 1JDBB 5KYGA 3SVTA 4AYBC 3EISA 1QIEA 3FPBA 3NALA 2OXRA 3Q3HA 3PNCA 4RBNA 4Y2YA 4I2HA 1RPAA 1U9IC 2J33A 4OQPA 2D2IA 2PH3A 3VU3A 2IBSA 1TA4A 1N2EA 4ZCSA 2F67A 1JJBA 5IT5A 5JALA 2QMOA 1X39A 2X7JA 3WK5A 1TC2A 1ZD2P 3HLYA 3PDWA 3CH4B 1G3RA 1SUWA 1W19A 4Q9JA 1IQRA 1TD9A 5KNBA 1C4KA 1KZ4A 2G1KA 5LLTA 5J2TB 3PC4A 1YRAA 5EXPA 1PEKE 4IDPA 4IM7A 3EUAA 1F8FA 5K6AC 1PT9A 1YKGA 4KQMA 4CMKA 4DNXA 1E9SA 1GTVA 3CLUD 4R16A 4DF4A 5EHQA 5KVAA 3VVMA 4LHZA 3T3MB 1JFRA 4BU0A 3DHEA 2PYDA 1GNSA 3IJRA 1YRQA 4XVRA 4NM2A 4CMCA 1E1KA 4R2MA 4OJ5A 1J2YA 2V58A 1KC1A 3DC7A 4ARZA 1TZBA 3MN1A 1YB4A 3S2SA 4Y1RB 3ETDA 3UJ9A 2MU1A 2ETVA 2H48A 2PEZA 4IY1A 1CUAA 4WNAB 5JCPA 4YRGA 4ZEVA 2NP6A 2WIBA 2CSUA 1ID8A 1WF6A 2YRFA 1Z6GA 1JYSA 2LD4A 2GNAA 1YBMA 1B73A 1E9FA 3A4NA 2QMEA 3TSZA 4LJSA 1KEPA 4S05A 1LZLA 7AT1A 1BPEA 1MFPA 1NX6A 2P0YA 4IDNA 4QWAA 1ISMA 2WG2A 3O4IA 1SWVA 4IGIA 4OP1A 4TXJA 1R2QA 1UAAA 4G0QA 4YUYA 2I54A 3UAWA 2ZR7A 1OGJA 3PCXA 3TJZA 4DQLA 3FYUA 5A0VA 3ESCA 2WNHA 5FBZA 3R7WB 1D7AA 5BWCA 5DDIP 1NF9A 4UARA 5KOHB 1S77D 2OQ2A 2Q2NA 3PUKA 3JWPA 4U7DA 4YRSA 2RHCA 3CU5A 1RXYA 2NLOA 1BQ3A 1YHNA 2FWPA 2QB1A 2RHLA 3A1CA 3BK2A 4HLUC 4J3FA 4LYAA 4BIMA 4KLQA 2FFHA 2VRBA 3H11B 3FOAA 3T5BA 4LHWA 3N39C 3SE7A 4JVOA 1W29A 2DFPA 5J5VA 1GP2A 2BW0A 4KRFA 1FSPA 4OK6A 1S7CA 1H0RA 2RGCA 2AI1A 1CNFA 3C4VA 3MNFA 3ZI7A 3DO5A 1L5HA 4ZICA 1XSEA 4TYNA 4DS3A 2BFAA 7ICGA 4RE6A 4FOSA 4OU5A 3ICXA 3RVLA 4RCZA 4Y9TA 4L3VA 3C6MA 4O5AA 4EECA 1OLUB 3OKCA 3T34A 1ZWLA 2AZMA 3DZJA 4HC4A 4Q1FA 4ITVA 4XR9A 3IAAA 2BGWA 4ESVA 1U6IA 1PZXA 3GFVA 2Y0EA 4FYHA 4MKGA 4U1RA 5D1HA 2ISSD 5A2QA 4PGAA 4Z99A 1O03A 2AJDA 2X6RA 3N59A 3DW1X 3WGKA 1JVNA 2XGOA 2ZB8A 3STXA 3ND7A 4XCXA 3PTAA 4J90A 1L5RA 4P3NA 1NR5A 4D45A 2J4CA 5JT1A 4G6ZA 2IPAB 1GGHA 4BB9A 2PRJA 2NUAA 2A0UA 1Y8CA 2FLVA 4LW8A 1YE8A 4WN3A 3DLAA 2JJ2D 2QKYA 3O3MB 3SOZA 5LSAA 1HUOA 2RE8A 3UVEA 5KCMA 4Q21A 3K1TA 4PG4A 2ADOA 2HDWA 4D98A 3SVLA 1DX4A 1ZD9A 4LV5B 5BOMA 5EIFA 3AM1A 3KXLA 3NBXX 2VJDA 2YWXA 3DPSA 1H2EA 1XMXA 2IHBA 2NU9A 1QQTA 4F3NA 5EJ9A 3OCZA 5IFLA 3H5IA 3U3MA 1NOKA 3EODA 1C3LA 3DLPX 4KNYA 3SXUB 1LH0A 3L8MA 4Z54A 4K6OA 1RWXA 2BCUA 4EYOA 4F72A 1Z00A 2HHAA 2WJYA 1M2VA 3NDPA 4PCVA 2WYOA 5AI8A 3MGIA 3TQRA 4RVUA 4AO7A 3M83A 3REQB 2ZRDA 1IEVA 3NC4A 1WHSB 4FHGA 4IHAA 3W04A 4CPDA 4W5TA 1U5CA 3H9BA 3P2IA 3DD5A 3O0TA 1C29B 1Y6JA 2CXRA 2W71A 3MCUA 4II2A 4X1KA 1G3QA 4IQVA 1XC7A 4HH0A 5BN5A 4JSRA 5I9NA 4F93B 4AY2A 4GNRA 5U4QA 1WBDA 2IS2A 1YZUA 3QFHA 3W34A 1Z2EA 3VKGA 2GLXA 4DL2A 3I5XA 2H4ZA 2A0WA 1V7CA 4QEDA 4WJZA 5D1NA 1I3NA 1I6WA 3R9XA 1D8LA 3BCRA 3ZDAA 4B8YA 4EG3A 2HCTA 4PQRA 3ROMA 1ZH2A 1JEYA 1S5PA 3WB2A 2UUOA 2LCFA 2VDWA 4RIGA 3UHPA 1RRGA 4IYRA 4HNGA 4R8UB 4DQQA 2EGUA 3DTTA 2L42A 3AF6A 1DQZA 1A04A 2OZLB 4J6EA 2K4IA 3VOBA 2D0OB 1LX7A 3R5TA 1T91A 4RQTA 1T4GA 2IFTA 1W6RA 3BSYA 1N56A 5AWFC 4KXNA 1PQWA 2QTCA 4BQNA 4UAVA 1JSZA 4Z51A 1ZUNB 2C29D 1UANA 2HR1A 1CJCA 1EGQA 1TF2A 2ZVDA 4HQNA 4OQDA 1BRTA 4JU9A 4EGJA 4ZT2A 3UQ0A 5AKLA 1EFUA 2Z83A 1XZPA 3ZLBA 1GITA 3J81k 2EQAA 1N3YA 2C3YA 1FQKA 1RLTA 5ENVA 4IH4A 4AN0A 1IVSA 1V39A 3DHWC 1QCDA 3DGFC 3TG8A 3W5VA 5CAEB 4A82A 5HMMA 4ZYVA 1K8RA 1YSCA 2ILTA 4BLQA 1QNLA 4YQYA 4XCVA 2GAJA 3NRZA 2E7ZA 2GZHA 3ICOA 4L08A 1CUBA 5I7FA 5KTPA 4JNKA 5FA5A 4BNVA 1HYEA 2EKBA 1T3TA 4MSUA 4ASUA 3OC0A 4WOCA 4CODB 3B0YA 4A73A 1W4AA 3CTMA 4HX2A 1JIUA 2QE7D 3I52A 4RIIA 1EUCB 4BFWA 3B1ZA 4ZMBA 5L51A 1NXVA 1IDN1 1P7ZA 2PSHA 3S28A 1LC3A 1T9GS 3K0KA 2DH5A 3BL5A 2CB0A 3RB6A 2DKNA 5JPIA 3W2TA 4BFSA 4FGZA 2FN3A 4EG1A 4QXPA 1CC1S 5JNUA 2AHOB 1GL3A 1U1DA 1MV5A 4FGLA 5FL3A 1KMHA 5EHXA 1IM5A 8ICSA 4LKOA 4O5OA 5CP8A 4NXMB 3B7GA 4I1RA 1IOVA 5EQFA 1TKRA 1PFVA 3CRNA 3ZHOA 1BU8A 5THQA 1F7UA 3P45A 2WA2A 1U0OC 2IS4A 4GUAA 2DC1A 2BKAA 2O8CA 3U3DA 3G0BA 1V6CA 3HKEA 5HF5A 5HJ5A 4MI3A 2K7FA 3AVOA 2FPRA 3HDTA 1SEPA 2IYXA 5CR0A 3K9FC 4OJPA 1CUIA 1PF7E 2HDOA 1Z6TA 3K5WA 5SZHB 1UBNA 2DECA 1L8LA 2E89A 2XF2A 4HDNA 1W87A 4GXIA 5DNVA 1Z5GA 3EZ9A 3BMQA 2J4FA 4LZDA 4G1VA 2V55B 4AZSA 4ARBA 4GWLA 4M8KA 2XLCA 3NYQA 4JI4B 1X42A 4F12A 2HI0A 4G5HA 4CEJA 4RS3A 4NU8X 2HJVA 4HP8A 2H3HA 3K09A 5CB1A 1H2WA 2BD0A 3PCTA 4H59A 4WLUA 1Y6FA 1SRRA 3AKCA 1XD8A 4TLCA 3TQSA 4BNUA 1Q91A 5IKPA 5LQMA 4Q01A 4F2RA 4O2BF 2B4TO 3BK7A 3UPUA 5KWSA 2OBXA 1I7NA 3ZE1B 3B5JA 2J9XB 4ZVQA 4AURA 3WKAA 4M9QA 1TK3A 2GF0A 4B6GA 3ZD9A 3GY0A 3UYKA 1Z3CA 3AEUB 3EYAA 2OTCA 2QRVA 5BMVA 4DCVA 4E14A 1NK8A 1P72A 1K9VF 3BA6A 4BFCA 5JYBA 2RKOA 1M0TA 2C9YA 1U1CA 3ZV7A 3WRXC 2X23A 2YICA 4M9NA 5KFRA 5KT4A 4MIEA 1N1MA 3WL6A 4JC4A 4GKKB 2YVQA 4YRCA 3DHNA 2FY8A 5KG1A 5HHHA 3NVYA 3QUTA 2Y1IA 1EAMA 2Y6VA 3ELUA 3MA0A 3QFCA 3BREA 4I9FA 4CCYA 1JDNA 1UP6A 2J9FA 3ESQA 2F17A 1IHXA 5KFWA 9ABPA 4USAA 3SIPA 4UUNA 2IVZA 5ENZA 2YMMA 1JXMA 3W06A 3KSAC 1RPJA 1ZRNA 3LHKA 4FFVA 3PXGA 3N58A 1IXSB 4JOCA 3W7VA 5IMBA 3C7KA 2IUEA 3QPUA 2ZM5A 2HK7A 1L9KA 3TEFA 4GKJB 4JUFA 1THMA 4AMYA 4IH1A 2N75A 4YCNA 3V6KA 4JL5A 2J3HA 2PFNA 2Q3CA 4Q18A 3P52A 1NJFA 1PL8A 3NH9A 2GILA 4C0JA 2C82A 1OJLA 2ZULA 3ACBA 3UJDA 2H57A 4UVEA 1CYEA 2C5FA 3HVKA 3I64A 3RBEA 2NTJA 1ZCAA 3I5YA 1U4NA 4PG6A 1PG0A 2OR3A 5K0EA 3QSYA 3L18A 5EMKA 2F9FA 4GP7A 4UNSA 4KTVE 4DQUA 4I2NA 4C4RA 3RUDA 2N0SA 2FTKE 4ZVNA 4D41A 1WDTA 2G5GX 3L6RA 5DPMA 5EE5B 2VSQA 3W5UA 1VIAA 2ODEA 1PS9A 3RS0A 3DOCA 4PX5A 4ESEA 1X1SA 2GBIA 2JMGA 2P69A 1TECE 3VI3B 2GZMA 4YJKA 1DAPA 3PV8A 3PIDA 4RTPA 1N3IA 2E8OA 2FWBA 2H54A 3HCRA 3GARA 4EBBA 2D1YA 1PL0A 1XMIA 2XT6A 4E2FA 4E88A 2Z6AA 1NJXA 1AZSC 3E70C 3STTA 4HS9A 2FZEA 4Q4JA 1AQIA 3BFXA 3MJHA 2BHRA 5M29A 1UMDA 4CKWB 4RIEA 7ICMA 5E4FA 3NTXA 4GZ3A 1DXYA 2Y3IA 5DM2A 1ZQMA 1U0NA 1G9SA 1NZDA 4O4LA 3RH6A 4PAQA 4O5EA 221PA 4GYYA 4ZYWA 3HLTA 4A8PA 4HUTA 4MK4A 4EF6A 2HHLA 3ENQA 2DQZA 4EJFA 4NM1A 1USIA 4NMWA 2V7XA 4BV2A 3MFHA 3QK7A 3VH2A 1TMKA 2A94A 1DKOA 3AU6A 2ZLBA 3B3FA 4IOKA 1V38A 2CXNA 3U09A 1RLOA 1TM7E 2PI4A 1XVLA 1KW4A 3CSSA 4JJKA 4B87A 3IEMA 5LQNA 2QN1A 3ZQ6A 5K3AA 5A5DA 2I6UA 3C6ZA 1UHUA 3L0CA 3EG9B 4L3OA 1XQXA 5I9BA 1Y8QB 1IN5A 1NOMA 5CITA 3L82B 4K9NA 4RQ0A 1O94C 9ICLA 1OF1A 2DUJA 4MROA 2XTAA 4J7AA 1EE1A 2GBFA 3ORHA 3U3XA 2A4KA 4WUVA 5L7WA 4FZLA 4RQ8A 2PGAA 4KQ6A 1W5BA 1M33A 4RPXA 4G86A 2PGOA 4QNNA 1CEQA 3QJYA 1HE8B 1GQRA 2MYNA 2PCJA 2AR9A 3PCRB 3M1IA 2RGWA 2Y05A 5K2OA 4F4XA 1ODIA 1Y9JA 2Q3BA 2MRLA 2G08A 4K40A 3THSA 4D3XA 5A5VA 1M7HA 3C7CB 1HG0A 3IO5A 4PGHA 4W6QA 2UXBB 2XGQA 4IXDA 2FWJA 5DX8A 5KVQA 2C5EA 1C3JA 1KJIA 4A6PA 1K6JA 4P4TA 1OFUA 4XWOA 1RTKA 2Q5OA 3DZ8A 3ZDZB 3H2KA 2W03A 2Q5EA 2QW8A 1T6ZA 3DOIA 3Q5EA 3QLVC 3EPGA 3ASUA 4CN9A 3HJBA 2P4SA 1IXRC 1GPKA 3OZRA 8ICGA 3TZLA 1EVKA 3EDMA 3U3RA 4BQSA 4E5MA 1U45A 5FOUA 5CTJA 4Z7NB 3V4PB 3V6HA 4PYMA 5HKOA 1P4GA 1XZEA 3F5FA 5EZSA 1ZCZA 5L1KA 1NE7A 4L07A 2XVZA 4GECA 1EG2A 1DTWA 3FKSD 5D87A 1H69A 2BI7A 3WWDA 1E96A 3UBMA 3UENA 4BZQA 2NTYC 4GI3A 4HAUA 4LNHA 1P9LA 4WY8A 4JXKA 5JIBA 3S2GA 1IL0A 1UBKS 3LGSA 4ECSA 4HSGA 1REQA 1G21A 2GZRA 2QTHA 4NWIA 4QZAA 4X8MA 4ZALA 2FMKA 4DQXA 5KNBH 3HDGA 3HB7A 4H7EA 4LRYA 2W70A 1RXUA 5CGZA 3N7UA 4I3GA 3T38A 4YA6A 2I4NA 4CV1A 3DE3X 4YQFA 1QRTA 2GLEA 4YJFB 5GTDA 1E5XA 1ZZGA 2D2EA 1YAJA 1WNFA 1YZVA 1PX0A 2DH6A 2G25A 4UUQA 1CUEA 5KT2A 1AGRA 3HWWA 1JFFB 2B94A 2CDBA 3RJMA 4E33A 1F4LA 3CUEF 4AICA 2H4FA 3KUKA 1L4FA 3DR3A 1U80A 2VQ6A 2W2OA 2WABA 3GJ8A 3PHIA 3U81A 4WXYB 3R3HA 3ZDQA 5A7HA 1JR3A 2Z8ZA 4D9CA 3TNDA 1ZQSA 4FE7A 3RRYA 3WK7A 1S10A 3K0EA 5J2FA 1EUYA 2I3ZA 1Y9DA 1DPGA 3MRTA 5FQNA 1DVRA 4IIJA 2Z2JA 1AX9A 3R40A 4GOLD 2CFCA 1NJ8A 2I7VA 2BP7A 3PPYA 1VE1A 4P0PB 1W7AA 2GAOA 4Y6GB 1TVMA 3MINB 4XUDA 3NS1A 1PRYA 1FBTA 1RYRA 3IBGA 4D0SA 1F4VA 5EIBD 1YU6A 3FSGA 4FX5A 4H0FA 4OA8A 1Z5VA 3BL8A 4I4IA 4O2AA 4D4MA 1B15A 4Q7LA 4XJSA 1QP4A 5HUJA 1VZ2A 1XV5A 2AQ4A 4LZAA 4JX8A 5EUBA 3LAWA 2J9FB 3CZAA 3W6NA 4KR6A 1Y6ZA 5B1DA 3SQDA 1K4MA 1JSRA 2J7PD 3AEQB 4HDMB 3HE3A 3V9AA 2RAFA 3I2GA 3NIBA 3G2KA 2YIVX 1N4DA 2BDEA 1ZQHA 3OSZA 3C3MA 4O25A 1ZJNA 4TMXA 4OF4A 7ICJA 4EHFA 2ALZA 1OC2A 1PUJA 3WZLA 1LLFA 3G5TA 4JOSA 2VN8A 4AF8A 3ND5A 3PW7A 4EL5A 2C7QA 3WQRA 2H1VA 2C2XA 3VJLA 4B17A 4Q9KA 1E7QA 5J3JA 4IO1A 4IINA 2WWYA 2UYCA 3WLKX 2QYTA 2R6HA 4P08A 5AM1A 4WKCA 3IN5A 5IASA 2ONYA 4R1OA 3I23A 2PMKA 1IK4A 4GX2A 2O2YA 4LXYA 2O0LA 3QI2A 4N3AA 3X1JA 1BWPA 1GOTA 3EGVA 5TGDA 1YBFA 1PVDA 3DF9A 2AWNA 1HE5A 2W8ZA 2DLDA 3CUWA 4BECA 2WPDA 3SSNA 1O8BA 3ADOA 3G13A 4IHKA 4LNUA 4O4IB 4RK6A 3S7TA 4ND6A 1W88B 4DA0A 4RPYA 2QNIA 3CKKA 4IAOA 1QSSA 4F4CA 2J45A 4WKBA 2WJVA 1O58A 3ETNA 4N0QA 5FWDA 4UAYA 2QUKA 2WJGA 4RKWA 4A0FA 5LP6F 4ARVA 3B2QA 3SKVA 4DA6A 4JD5A 1JE1A 1YZNA 2WIFA 3OHMA 4H4EA 3WMWA 2UU9B 1NPTO 3VH1A 2QTTA 5LZ9A 4O3PA 2CWDA 4KC0A 3L92A 2CFRA 2EG5A 4DLUA 2A5FA 1RP7A 2PFPA 1WOYA 4KW7A 5KHAA 5IDXA 3U60B 4N76A 4D0LB 3WIUA 1E7MA 3KTQA 2QP3A 3RGWS 3LCVB 4BEWA 3M6XA 1VYUA 3CF6R 1NVEA 2CCGA 13PKA 1V9LA 2CXTA 3F3SA 4BJ5A 4BWYA 4U6QA 2DYKA 1MNQA 5DIZA 3WYAA 1ICEA 3JRNA 5L9AA 3DMYA 3OFNA 4NBNA 4TWZA 4DV1B 1W1IA 4LBZA 1I6KA 2PKQO 1Y0BA 2PH7A 2PZMA 1A9XB 1P31A 1D03A 3RWMB 1EP3B 1QGYA 4KTQA 1MORA 2ZETA 2I4MA 4OXIA 4KVZA 3FIUA 3SX2A 1L6RA 1V95A 3EGXA 1QH9A 4JYMA 5IIIA 5AJYA 3LCCA 3BMXA 3THXB 3H2YA 2JIRA 2BZSA 2QTNA 3KJQA 4JV1A 3H99A 4CG3A 5LOVF 5LJIA 3L43A 3E9MA 2GA9A 1L7BA 3EEIA 4PYLA 4UCWA 1WCLA 4CIBA 5LUAA 3GUCA 1JT2A 3MTIA 3C3JA 4MHSA 1FP2A 2UUBB 1VJ5A 1MIHA 4ED8A 3GLTA 4IR7A 4BQOA 2KVCA 1U2GA 1JEQB 2WLSA 5L1JA 4FJ2A 3WB0A 3OETA 2ZJ8A 4P3OA 3I32A 1ZVJA 5IKMA 1RYNA 3LPDA 2XYQA 2GM5A 3TZQA 1V5EA 1Q0PA 2JW5A 4C4OA 1QOPB 4GL2A 4M1SA 2FSGA 1P0MA 4XR4A 1T0BA 3A6JA 3ITEA 3R5JA 2OY0A 3C7AA 5G0WA 4UZSA 1AKRA 2M2IA 5EJ2A 2I8AA 4CT0A 3KWMA 1P4RA 5FEMA 3AY3A 4D9FA 5LL6P 3JVDA 1KEUA 3MWGA 2PUWA 3GRKA 4R9RA 5LYJA 4X54A 2E5SA 2IDMA 4MGIR 1TT5A 2VHYA 2WTFA 1PZEA 3CW2A 4GU5A 1EJ0A 4WK4B 3F8WA 2WF6A 3NFYA 1SHZA 4DDUA 5LZ7A 5KYXB 1Z4PX 3AHDA 3FYHA 2FZWA 1FTNA 1LK5A 2R8EA 3DDOA 3L84A 1LTHR 1DTWB 2OGZA 3RG2A 1QFSA 2CMDA 4NFLA 3WICA 4QOEA 3B52X 2O8EA 2WB1C 1S2OA 4XUEA 4Q1EA 4BOYA 2AZ4A 2RD2A 5JG7A 1XJ5A 2WTXA 3KKKA 3DEJA 4LPKA 4EA6A 4HRYA 1FMCA 1X6JA 2IZOA 2R86A 3P20A 4IS3A 4Y7DA 3V7WA 4C29A 1MVNA 1QC5B 1UOEA 2QTFA 5GINE 1HUQA 1DKPA 6AT1A 1U0RA 3JQ9C 1CDDA 3O94A 4OQFA 2IT1A 3Q2OA 3QGMA 4G36A 4RD4A 5H3LA 5AW6A 5GVSA 1IN6A 4UUMA 2XIJA 3L79A 1QH0A 3LX8A 5FBRB 1C2YA 1LB2B 4DFPA 3P4YA 2HBYA 3PFGA 4XWYA 1EFTA 2FMFA 5DHAA 3W2IA 2Q27A 1YFLA 3E9NA 4M60A 2X5NA 3W5AA 2K6GA 3ABSB 3D7LA 4AK9A 3Q7EA 3VYRB 3CEJA 1PVVA 4PPYA 4IVQA 1VI5A 2H9IA 1T9GR 3UTCA 1J0AA 4FSHA 1A9YA 3IXQA 1F60A 1ZM2A 1K9SA 2PT9A 4LJ6A 1KJQA 2O4UX 2JG3A 1BYIA 5SY9A 2J67A 2AXPA 3DBVO 3KAJA 3P2YA 1GPMA 4ID9A 3RC1A 2BFCA 2J3MA 3TW8A 4E3ZA 4EFLA 1PR1A 2BGMA 2ZS9A 5FV7A 2XB2A 2PZEA 3BTVA 4I7EA 5TV2A 2FMQA 5A7GA 1IPFA 3L7YA 4B7AA 2NVBA 3GRRA 4JBWA 2WU4A 4YXFA 1XEFA 2FJ6A 2YC4C 1Z16A 4MQEB 4RM2A 2GM4A 3E9EA 5IEBA 3SGLA 2QVZX 4XIJA 1GL6A 3PC8A 1SL2A 2CL7X 2Q3HA 2XUZA 2ZSBA 821PA 1NR7A 1U0TA 3PR1A 3ZTYA 1Y89A 4I9NA 3HKCA 2J46A 2C5GA 1SB3C 1YHZA 2BGRA 1CJKC 2FUNB 3MCAA 3FVVA 4KAXA 5ES3A 5ELXA 3HL0A 1W36C 2H51A 3IBFA 3A70A 4M9CA 4Z49A 5TDHA 1Q0QA 3D6NB 3WQBA 5JANA 4B0OA 4PZUA 4Z1MA 4M9ZA 1YIDA 4YMMA 3FB4A 4NMHA 5JXGA 1SV4A 2RI6A 2YZ2A 1JHOA 3CLRD 3GP5A 3D2AA 4ZEOA 3SJ7A 3UMJA 4CIWA 1D9XA 1HTWA 1IYZA 4TLDA 4MQEA 2W3RA 2WJ6A 2AD5A 1MD9A 4F21A 3MSCA 2QLNA 2QUHA 2DSTA 4IDGA 3R9IA 5BOLA 1Q44A 2OK8A 4FNAA 1BWSA 2EBHX 3FSRA 1C9EA 2PVSA 3WKCA 1WP9A 5BN4B 5AFSA 3NT5A 2ZXUA 2QU8A 1IIPA 3C74A 4AX4A 4BO8A 4DLAA 2Q5HA 4E03A 4LXUA 2AMYA 4EFMA 4I28A 1IJFA 2GVDC 2X5XA 3C8MA 4CKZA 2O1WA 3KR1A 3NNNA 3Q1LA 4ZU3A 3RREA 1I2AA 1VE3A 1TNDA 2PAFA 3FYUB 3HU1A 2CHGA 4AMUA 5LP6A 1OFHA 2G7MC 1FMTA 2QL7A 5DBEX 1RW4A 1XCMA 1T3LA 4NDNE 3MINA 4RF4A 5IBRA 4J7CA 1USWA 3M4ZA 1PAUA 2FRDC 4G97A 5CW2A 5LKRA 5EHIA 1VB5A 4KLFA 1JDBC 1QK3A 4EBCA 1T1GA 1NFQA 2F62A 3AR7A 3ODGA 3I1IA 4CRXA 1PJ2A 2JRCA 4HB0A 4GAEA 1PK8A 2IU6A 1BWQA 2P2YA 5SICE 4UNIA 1MN6A 1PHRA 3KSZO 4X92A 5DOVA 1AKMA 3BF8A 3WLQA 2QRZA 4E08A 3A4MA 3RH5A 1HDYA 4EZBA 4B6QA 4X20B 1RJ9B 1VJRA 1SWWA 1YK0A 4MV6A 1M1YE 2HHHB 3AVVA 1GA6A 1I9CA 4MQBA 4B4WA 4YCAA 1PR0A 3AI3A 4ZOLA 4LFAB 3VTAA 4LS3A 1GYPA 1GYQA 1JQ5A 4M86A 2HIHA 2AVDA 1BRMA 4OKNA 3ZD7A 4CUZA 2OLJA 4OFBA 5EPEA 5T4HA 2YYAA 5IAEA 4C08A 2PEYA 2E9SA 1KI4A 4Q7EA 5FOQA 4CETA 1MJGM 2JH3A 3GXBA 2LCIA 2QYHA 4RJTA 3L0IB 3WQSB 2R68A 3FPCA 4D8UA 1TX4B 4E31A 1NQXA 1QGAA 1YZQA 2PWZA 3OZIA 2AX4A 5JCOA 5J43A 2HDHA 4O0IA 2GD0A 2WKQA 5JH7F 2FP4A 3L6UA 5FO0A 2J0VA 2NUTA 2QXYA 2XUJA 4R66A 1E9DA 1T34A 3OFVA 5CIQA 3RTAA 1RHRA 4QFBA 1G8MA 2A5DA 4FFBB 3OQBA 3F73A 4ZD6A 4DR2B 3TOVA 2OESA 1N9ZA 1SC6A 1ZN2A 2XT0A 2Y1KA 4GC9A 5I7SA 2EZYA 2FWMX 3J81j 1KU6A 3DO6A 3HU5A 4LGVA 1GJRA 2C9DA 2YWGA 1JX6A 3F96A 3I2YX 2D1QA 4YJFA 4RTLA 1Z4KA 4NCBA 1NUSA 4KZPA 5EGSA 2RI1A 3RIHA 1ITZA 3DXFA 3NTQA 4HWGA 3SV3A 3UH0A 1N5LA 5FXMA 1NC3A 4DQSA 2WTAA 4DOCA 2DHDA 5CA0B 3WLIA 2JZBA 3G2JA 2E1FA 1ORVA 3B7WA 3LO8A 3PFWO 1OZGA 4D82A 2QAIA 3IC5A 1B3BA 2HLDA 2ZJ7A 3N74A 3MJVA 3MB8A 4M9RA 4FKZA 3D2BA 1WEHA 2Y1GA 5KMGB 4HXFB 4OUDA 2AQKA 2LYHA 1U48A 1IONA 4UCFA 3F8TA 2K8AA 1YR9A 3NT4A 3ZCUA 4ZI7A 5F7OA 3GUHA 3OFND 4YJGB 1ZCJA 3RQSA 2PZJA 2D7JA 5F76A 9ATCA 3FHTA 2O0MA 4X93A 5LLDA 3DAHA 4XD7A 5ER9A 4EB6B 1PR2A 4P7FA 1ZVQA 1EXNA 2PLWA 3HB5X 3F6YA 1B1CA 4ZC1A 5IAJA 1I0ZA 3WLHA 1D9ZA 4MS3B 1I01A 4TRRA 4UHCA 2BE9A 5GIOE 3GLIA 1SKSA 4M8IA 5HQ3B 3R5XA 1O97C 3CH5A 4PYNA 4WJKB 1J2TA 2PFKA 3RSFA 3GAZA 3BWMA 3RS2A 4F6RB 3MABA 3FZQA 3A0BU 4F5EA 2NMVA 1JQLB 3STVA 3G5MA 3ZE8A 4DMLA 4MUMA 1J70A 3DAFA 3ENNA 4RJJA 3GCGA 4CR7A 4X90A 1NQVA 4R9NA 4WOKA 3V1NA 4OBEA 1SKYB 1XCOA 4XWGA 3KKOA 1S3FA 2ABWA 2PN1A 3T7SA 1RP1A 2HSDA 1DRKA 2UVDA 2VNAA 1AKNA 2ZIUA 2VT7A 4ALJA 5L53A 4BX2A 5K6TA 1X7GA 1LV8A 2DBQA 2WTNA 1YOVA 1CV2A 3IVAA 1GN9A 3QELB 1UT6A 4M1YA 4R6XA 2O20A 1T9DA 5G3ZA 1CUYA 1JALA 4Z7QB 4D02A 2J3JA 5EMHA 1ZQLA 5H3CA 3KZNA 5LQKA 1OX4A 1SL1A 2SBTA 5KL8B 3EFOA 4KI7A 1A8HA 4I8XA 2P7IA 4V0OA 1VI2A 1DX9A 3ER8A 1CY7A 3HSYA 1VJ1A 4F8YA 5J0TA 3DMTA 1J1IA 1KAEA 3SHFA 4BWGA 1H0HA 1Z4QA 2ZUVA 1QBGA 1NSYA 3QVMA 2R7KA 5JRTA 2Q5QA 3AEXA 5BSRA 2ZDQA 4M0DA 3BIJA 4JI6B 3ZUPA 4EY6A 2ON6A 4DLWA 1NYTA 2Y0DA 4LHVA 4EHBA 4KFRA 2AKAB 2X13A 3PLRA 4GPD1 2Y1OA 1H65A 4B9NA 5E6UB 1LJUA 5LP1A 4Q6WA 4D8XA 1XZNA 3EFBA 5JR3A 2V7GA 5AJHA 1OPRA 4ZMSA 1KQOA 3L9WA 1YVEI 1F14A 5C1IA 3QMMA 2FMTA 1P1CA 5B7GA 4X9XA 1W73A 4D0GA 4UNQA 1Q2XA 1Q0SA 4PZCA 4ZO9A 4C07A 5JXIA 4ZQIA 3E82A 3BXHA 1Y1QA 4Y3UA 4UVDA 5ALWA 4EI2A 3A3KA 2F77X 3MCVA 2H11A 3PU6A 1CRZA 2PU5A 1UP4A 4NVRA 4TQRA 5EN4A 4YAKA 2QTVA 4OHUA 3V6MA 4C6SA 5FI1B 4KPFC 3CT6A 2QGZA 5EZYF 3Q3GE 3PRKE 3KPUA 4G85A 4MJLA 5CCDA 4MFAA 1DZ3A 1DAEA 1HOTA 3PPVA 4EB3A 1SUPA 4MPTA 1DIHA 4RTOA 1BSVA 1CQJA 1LA2A 5IXJA 1SU6A 3NHKA 3GCZA 2A9VA 3QWHA 3GVPA 3HCCA 2EF1A 3QVVA 1R7RA 2EKPA 3B9BA 4UEWA 3VDNB 4BATA 1IJKA 2W0MA 1OV6A 3BJYA 4P2HA 2BDTA 3AJEA 1QLJA 1T4BA 3A3PA 2EZTA 3QX9A 1PFYA 4P86A 4E0BA 1SXQA 1VL0A 2ZUBA 2CLIB 4DLRA 4URXR 2I66A 2RQ5A 1DJLA 3DP9A 4G1BA 1T0UA 5HUQA 1SC9A 3IEXA 3OIVA 4KQ9A 5I4CA 1CUWA 1XU7A 4EKNB 1TTPB 5ICGA 3CF4A 2IYYA 2FPPB 4N01A 4FHCA 4B3HA 2V54A 3JD1A 1T5DX 1HY3A 1VA4A 2CDCA 1RJ9A 3M81A 4L5IA 4R51A 5D51S 3JTEA 2Q3DA 1D7OA 2GCEA 2VXBA 4QXQA 4MWTA 4W5NA 3R9XB 3NTRA 5JRZA 2XJ4A 1PG5A 4FFMA 5KNDD 1YB6A 4ZPJA 4TRMA 3FAZA 2HU2A 2XKBA 4DSJA 2H3QA 4I5FA 1GL9B 4Z2YA 3GBVA 4TUYB 5T8KC 4INPA 5BY2A 9ICIA 3FRHA 2JLWA 5EYPA 1HDCA 4FEEA 1GUAA 3LQ2A 4OHYA 2Y92A 3GD7A 3NONA 3NV9A 2GZAA 1MC5A 3P2KA 1CQIA 1MVOA 1MXHA 1SNYA 1II0A 4DJJA 2EZUA 1T25A 3IHTA 5A3SA 1X3LA 4W5WA 4DLSA 3VHRA 2QM8A 3B78A 3EXEA 4V0MA 3ZHVA 1Q57A 4EUSA 4UNRA 2ID7A 2PUCA 7ICHA 2J5XA 3KQWA 1V0JA 3MWEB 4HDKA 5K1ZA 4TKVA 2QD3A 3CWZA 4YJ3B 4Z7JA 4DIUA 1L7XA 2CLLB 3FWPA 3RRGA 1CS0B 2XA2A 3HG7A 4KUGA 4HWOA 1M34A 2JGKA 4NNPA 4C4AA 4F5WA 3LBFA 2GCIA 1OAAA 3GGCA 5KYNA 2PAAA 3L6DA 5G2OA 3NBMA 1IUOA 1ECCA 1BN6A 2ECQA 1QRDA 3GJZA 4JMPA 4UTZA 4ENRA 3OU6A 4C5BA 1NVFA 1FNBA 5KTSA 2KIWA 1VXRA 2C9CA 3CEMA 2GBCA 3AILA 3LQ4A 4S3MA 2K8CB 4HH4A 2XDQA 4IQWA 3G0CA 4X6YA 1EX7A 3W1EA 3O83A 4PINA 3BX1A 4OHFA 3L2OB 3WTBA 2Y4OA 4V0QA 4DCOA 1PGPA 2FZKA 4FO6A 3IMFA 1U7OA 3RODA 1BKYA 3LOPA 3WMGA 5C51B 1JIQA 3ICVA 4OAQA 5CVTA 3MIZA 3I76A 1ECGA 1KA9H 4GD3Q 1JLLB 3C98A 3KAKA 3O0DA 4V0NA 4YUWA 3HBMA 3H4BA 1UJ5A 4FIDA 4I50F 3LA8A 3KFVA 3VAYA 3ZLTA 1HQKA 2JASA 1EXWA 2CNKA 1SPBS 3LXMA 3FB1A 3BSSA 1S8OA 2VRNA 3VZRA 4BWFB 3F5MA 1IBLB 4WQMA 1CEEA 2CVZA 4YB8A 3C21A 1IB6A 1ZONA 1I3KA 4M37A 2VJMB 3HA3A 3E8XA 4Y9UA 2XCLA 3WIEA 3FPEA 5JUWA 4DFMA 2JLAA 3A6EA 5AM3A 5LA6F 3W78A 4BV8A 4F8JA 1GAJA 2XDYA 3V55A 1GNPA 1QF7A 4HMPA 1XTKA 1JLLA 2B37A 4UMEA 1F8XA 3TSAA 1HX7A 4GX0A 3UKOA 3KZCA 5FX2A 2FSHA 1U8TA 3ANSA 3IIMA 4G9GA 5D3MA 1S2GA 1OW5A 1HWYA 4G1MB 1N4AA 3M9NB 2D5BA 5DXFA 3GF4A 2YMQA 1W4CA 1MJFA 1N2HA 3C43A 3I0NA 3NVDA 4HNRA 4JLBA 3EZ7A 4A4DA 1LBHA 3TIIA 2CC2A 2E5WA 2I6GA 2P8JA 2ZDGA 3EWNA 1ORHA 2FW1A 3DCJA 3N5KA 3ZV3A 5BV2P 4HAOA 1I4TD 3DDHA 4BKUA 4N6GA 4DA4A 3PLNA 1FFGA 1U3DA 2YCBA 2LMRA 1W48A 1L3BA 3AHIA 3BQ0A 4UM9B 1KL7A 5JYCA 3INGA 2IHKA 4TM7A 2W11A 2A9RA 2E4XA 2XEDA 4C7XA 2XCTB 1CD5A 4CF4A 1E64A 1KY3A 1M1YB 2YV3A 3OTHA 4XRHA 4RQAA 1FXUA 1FX0B 1SVUA 1R50A 2YB4A 2ZRNA 1JROA 5DF1A 4E30A 4YFVA 5K0TA 1XVTA 4YMTA 4EY7A 3ZEAA 2HOIA 4TV9A 2Z2YA 2I5PO 1DBSA 3WVNA 3DFZA 1Y4DE 2CF6A 1F5NA 2WD9A 4FWBA 3A8TA 4LQ4A 5T3UA 1U2TA 2ZRKA 4XGQA 3ZV6A 2AGVA 3E4CA 1JYFA 3NVMB 4WERA 4OREX 4L8FA 3SLRA 3NVWA 4QAQA 3Q7RA 4R81A 4D79A 4ZT3A 4UJ5A 2VJ4A 4WCFB 1KIFA 2LZ0A 2CHFA 2XW6A 4OQQA 2ATEA 1MQ9A 2C94A 4RVHA 1OBVA 1V6SA 1T1RA 2JCSA 4WMLA 2PQ0A 4P81A 4CGZA 4F5PA 1WDWB 2ODPA 3OLQA 2WHPA 2CXUA 4NCAA 1VLZA 2R8ZA 2AHRA 3G02A 4JXZA 3H5AA 4A8JA 1LFAA 3T1VA 1GQFA 1K2VN 3DV0A 1E3WB 4Q3CA 2DAPA 2R7MA 4NBVA 5GMOA 1VSTA 4OL9A 4D4LA 2B9EA 3HGQA 4GBGA 5IBCA 2B2XA 2MDTA 2QPOA 1GGVA 1UUFA 3JQCA 4Q9AA 5JWOA 5C4IA 5FA8A 3C1AA 3VZSA 4Z9FA 3MTBA 4M89A 3AUFA 2RHBA 4QWDA 2ZI5A 1XSLA 1X70A 1Z0AA 4PBTA 4EYIB 2NVWA 5CVCA 1SCJA 2I3DA 4F2WA 3JWHA 2GF9A 4ARCA 2M6SA 2XOKD 4AROA 5AKEA 4L75A 4B9EA 3PXBA 3GOQA 2DPLA 3EY4A 4GL4A 1NJGA 4M0LA 4ECYA 3WY9A 4ZCIA 2IYRA 2G1UA 2W37A 3LUHA 4JQCA 1KVSA 4YDHB 2WFZA 3KHUA 1NYLA 3MERA 5HW0A 2WB2A 5TEWA 2VBFA 2PLRA 2NUBA 3P97A 4B8ZA 2BY4A 3SG0A 1KEJA 2UVVA 2FFJA 5K8CA 1T2VA 5BOSA 1OC4A 3EWSA 3CLHA 3I45A 1WB6A 1DQNA 2ZRFA 4PS1A 4BFVA 2XKJE 5E1MA 5G41A 2VCEA 3CB2A 3SC2B 2F9LA 4GM1A 1P9RA 1Q0TA 1DGQA 4CKCB 2H9AA 3L93A 4Q3EA 3EHEA 4X60A 4JAVC 1KJNA 1LDGA 5HA5A 3FDJA 1EAYA 1ZQRA 1TJ3A 1NUAA 1VPTA 4I6JA 1YTLA 2HL6A 1K4YA 2Z5LA 2ZYGA 4C5AA 1U02A 4JYZA 5JFTA 4XFDA 4TZ6A 5FOXA 3PHHA 1OZ0A 4JX9A 3KEFA 4HYKA 5K3CA 1JEOA 2ZROA 4DKXA 4UE6A 3SKYA 3AUYA 3G6YA 1MENA 1RYEA 3URKA 3ZW9A 1H1LA 3ZPXA 3LCMA 4ESHA 1KY5A 1WL8A 1RWKA 2PUJA 1U94A 3CR3C 3BORA 3CG0A 3EXFB 5G02A 3OPYB 3TO5A