3QUQA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, an open cap conformation
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
225
structure length
225
Chain Sequence
HMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
molecule keywords INORGANIC PYROPHOSPHATASE
molecule tags Hydrolase
source organism Bacteroides thetaiotaomicron
total genus 83
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3quqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3quqA01
1KYTA 2JAUA 3DV9A 1TJ4A 1QQ5A 5AKHA 3PGVA 2FPXA 3ESQA 3N07A 4UU0A 5AW9A 3CZ4A 1ZD3A 4BNDA 2WF6A 2B30A 4CF4A 1CQZA 3PCTA 3WK4A 4GIBA 4HGPA 2YMPA 1LTQA 2YJ4A 3W5DA 3N1UA 4H1WA 1EK2A 5AW3A 2EARA 3W5AA 2Q4TA 4CF3A 3NRJA 4EENA 3QU2A 4QJBA 4Y2TA 4ZEWA 4BEVA 4UW9A 1NRWA 3P96A 1YS9A 2QLTA 5AI6A 3L0BA 3ZVLA 1ZRNA 4Y2VA 3E8MA 2C4NA 4PNHA 2IOFK 2ZBEA 3I1YA 2ZBDA 4AS2A 5ALDA 4F71A 1WR8A 2O2XA 4Y3UA 5AIAA 4FFDA 4BX2A 4HYTA 3OCVA 5AESA 2FUCA 3SLRA 1U02A 2C8KA 2ZG6A 4I9FA 4Y2XA 2G07A 2FPUA 4HGOA 5ALLA 1RPZA 1VFPA 3WKEA 1U7PA 1Z4PX 3UMGA 3A1CA 3AR8A 1ZOLA 2JAWA 4NV0A 5ALVA 2HDOA 1WVIA 2OM6A 4CE6A 5AI4A 1QYIA 4C4RA 4EZEA 2YY6A 4DFDA 2OA0A 2YJ5A 3E81A 3PDWA 1TA0A 5ALTA 4YH1A 3OCZA 3WK8A 3HLTA 1YNSA 5AM2A 4XPZA 3U26A 3OCWA 3WKCA 3L7YA 5AVZA 4UATA 1Z4MA 3L8EA 3SKXA 2QYHA 2NO5A 5AVUA 1Z4NA 3EPRA 5ALJA 3AR4A 1TE2A 5ALQA 4EEKA 4CNQA 5ALKA 4UAVA 1QQ6A 1N8NA 3AR6A 2BDUA 2G08A 2WHEA 3R9KA 2FDRA 4IG4A 4DCCA 2WM8A 4UASA 3NIWA 3N8GA 3D6JA 3UMBA 1RKQA 3OCUA 2HF2A 1Y8AA 4BX0A 2IYEA 3MMZA 2GMWA 2GO7A 3N28A 5AI5A 2WF7A 2YJ3A 3L8GA 5ALIA 3QUCA 4EX6A 4L6CA 2W4MA 2YMQA 3ET4A 3B9BA 5FP0A 2ODAA 2HOQA 5AKYA 1YJ5A 1L7OA 2O9JA 4NWIA 5AW6A 1LVHA 3U7FB 4G63A 3ZWKA 3SD7A 3QU4A 3SF0A 2ZBFA 1F5SA 3L8FA 2HHLA 1J97A 1XVIA 1PW5A 1Q92A 1SU4A 4O8CA 1Z4IA 2RARA 4DWOA 4C4SA 3VAYA 4B6JA 5ALEA 2FPWA 3QXGA 2FI1A 2B8EA 4OD0A 3UMCA 2HEGA 2OYCA 3M1YA 3FZQA 1VJ5A 3E84A 1ZD5A 3OTQA 2P11A 2X4DA 4UMEA 2EATA 1Z4JA 4YCLA 5AVSA 4Y2JA 1JUDA 3MN1A 5AKXA 4Y2SA 2PKEA 3ZVNA 1MH9A 3U13A 5AK3A 3ZWDA 3B8EA 4EELA 3FPSA 2AMYA 3RFUA 3NALA 2G06A 2R8EA 5AM4A 5AVYA 3WGUA 3SKYA 5AW4A 3FVVA 1X42A 4BBJA 2CFSA 4EX7A 5AW0A 2I55A 5AM1A 5AM0A 4NAVA 3L8HA 4ZEVA 5AK6A 1U2TA 2G09A 4L6AA 4UMDA 2B82A 4E88A 4MUMA 5AVQA 2WFAA 1WZCA 3WKDA 5AKKA 1ZJJA 3AR9A 1RMTA 1U2SA 2YMLA 2B1QA 3IB6A 1RLOA 5AW7A 5AVVA 3WKBA 2I54A 2RBKA 4KNWA 1O08A 4YGYA 4UMVA 3K1ZA 3L1VA 5ALRA 1YMQA 2I6XA 3J7TA 1XPJA 3ZX5A 5AK4A 3WGVA 2OBBA 3BWVA 2C88A 1YV9A 4Y2QA 3ZW7A 3AR3A 5ALMA 2G0AA 1J8DA 3ONNA 2D2VA 4UU1A 3FM9A 2YBDA 4IFTA 3QYPA 3S6JA 4KNVA 4RETA 4Y2PA 5AM3A 3WKAA 3I6BA 4XQ0A 4OFZA 3UM9A 2HSZA 3KOOA 4J03A 1L6RA 5AKJA 3I28A 3B9RA 3ZX4A 2AH5A 4UARA 4DW8A 1WPGA 4KYTA 1K1EA 5ALOA 3SMVA 5AVRA 5IT4A 2YN4A 4F72A 2W11A 1TJ5A 2GHQA 3DAOA 3HYCA 3ZUPA 4XE5A 5AW1A 1L7MA 1RKUA 4UMFA 5AK5A 1Z5UA 3U19A 2R8XA 1Z4OA 1RMQA 2RAVA 4XOUA 1N9KA 3KBBA 3MC1A 3KDPA 3AR5A 2B1RA 2HX1A 3A1DA 1CR6A 5AKLA 1Q91A 3A3YA 3I76A 1RDFA 1XP5A 3U7HB 4UAUA 2JGAA 3ZTYA 1L7PA 2CFRA 3WK6A 3IRUA 1Z88A 5T41A 3IJ5A 2P27A 2ZXEA 2GFHA 5JJBA 1T9ZA 5ALHA 5AI0A 1T5SA 4Y2UA 2IOHA 5IS2A 3QGMA 5AKGA 2C8LA 1QH9A 4FE3A 4OCZA 3ESRA 5A3QA 1Z4QA 3ZTWA 3L5KA 2GHTA 4Y2YA 2NO4A 5AKIA 2HF7A 1EK1A 5ALUA 4KX3A 4J2TA 3CNHA 3QLEA 4KN8A 1Z4KA 2I7DA 4HGNA 5AW2A 2P69A 3WK5A 3ZU6A 3EWIA 1U7OA 1YDFA 4AS3A 1O03A 3AR7A 4YCNA 5AW5A 1T5TA 2FPRA 1RKVA 1L7NA 2W43A 4ZEXA 3U7GA 5AVWA 3EF0A 5AHXA 3ED5A 2HCFA 2HI0A 3FPBA 3W5BA 2P9JA 3L0CA 5AKZA 2MSNA 4NABA 2G80A 2ZOSA 3WK9A 3KC2A 2I33A 2I34A 1RLMA 2PR7A 5IT0A 2NYVA 5ALNA 1NNLA 2BY4A 3NASA 1S8OA 3QU5A 4NFLA 3WK7A 3QX7A 2CFTA 3QUQA 2FUEA 2IOFA 3AR2A 2DQSA 4G9BA 3NAMA 4QQFA 2R8YA 2YFYA 1RRCA 4MWOA 5A3SA 1L8LA 2WF9A 2WF8A 5AVTA 2IA5A 3QUBA 3A1EA 4BKMA 4BX3A 3QU9A 5AKEA 3NUQA 1ZD2P 2EAUA 4YCMA 2JAOA 1FEZA 3ZI4A 3PGLA 1NF2A 3OCYA 3OPXA 3L1UA 4L57A 4GXTA 3ET5A 3R09A 3SHQA 2R8ZA 2ZBGA 4HGQA 4BYGA 5AM5A 3N5KA 3GYGA 2YJ6A 1QQ7A 2Q5EA 4JDPA 2G1AA 3FGOA 4HAIA 2FEAA 5ALFA 5AVXA 4YIHA 3QU7A 1RLTA 2MU2A 2FPSA 2B8JA 1RQNA 5AI9A 2RB5A 4RESA 5ALZA 3NANA 3DDHA 4BNDB 1TJ3A 2AUTA 1RQLA 4UM5A 3DNPA 4JB3A 4CF5A 5A3RA 4AP9A 3KZXA 1S2OA 3MPOA 1VJRA 4OHFA 3F9RA 4C4TA 3RF6A 3QUTA 3U7EB 5ALYA 4YIKA 1RMYA 1IWOA 4I9GA 1L8OA 3TLMA 1ZD4A 4HGRA 4UM7A 5ALWA 4FYPA 5E0OA 2CN1A 3R4CA 4KX5A 5AW8A 5ALSA 5AIBA 2HO4A 1SWVA 5ALXA 5AICA 1AQ6A 3M9LA 2C9MA 2PQ0A 2BDEA 1ZS9A 3KD3A 5ALGA 2AGVA 1SWWA 2VKQA 3QNMA 4BEWA 3W5CA 3ZVMA 1ZRMA 1Z4LA 1Z5GA 3E58A 4Y2RA 3OCXA 3BA6A 2YMMA 2WF5A 5ALPA 3EF1A 1RC8A 2B0CA 5AI8A 2MU1A 2JARA 2Q4RA 3L0YA
chains in the Genus database with same CATH superfamily
2K5UA 1GYQA 4K6MA 3EC2A 1ECFA 2QLLA 1MV5A 4MAFA 3PFKA 3QVGB 4TUSA 2WIBA 2G9NA 2JEIA 3E82A 3OZIA 1QLHA 4LF4B 2GF9A 1CETA 1M5RA 3AESB 1VI5A 1PR6A 3BXZA 4CLRB 4ZCPA 1JQ3A 5INTA 1S96A 3IUSA 1PSDA 4R1SA 3GFKB 1VXOA 2VDPB 4WK0B 1GRNA 2LTAA 1CVRA 1F1BA 2WTFA 1NW4A 3T1QA 4EP1A 3QYFA 3GJQA 1IWBB 4L9RA 1YS1X 3IUMA 5IT5A 1JIJA 4UC0A 2RJNA 4TSFA 3ZDFA 2LI6A 3P2EA 4D57A 3DMTA 5I7SA 2YYSA 2HSWA 5IKMA 1XRSB 3TXYA 1UKBA 1QTQA 1K5GA 3ZU2A 4DV4B 5E9QA 2WTXA 2IHZA 4AG3A 3ZE2B 9MHTA 3B2QA 2DMRA 4S1NA 5CM2Z 3U17A 1E0JA 1TEXA 4QZBA 1X70A 3DDWA 1KQ3A 1M0SA 2VI5A 3OUZA 4JQSA 3PC6A 2QR5A 4D4JA 3PNQA 4B73A 2HOQA 2NQ8A 3NYWA 5JQGF 1CJCA 3KVOA 1OIVA 4XH9B 3D6NB 3I32A 4FFSA 3BCRA 2REQA 3C1ZA 4UUPA 2XUJA 1C1XB 1FNSA 2C77A 4M9XA 2NT4A 3HILA 4ZCMA 2MMCA 2JIZA 5DISB 3DAGA 4Y2SA 4H17A 2W7OA 4B3MB 4EELA 4XKJA 5JECA 2IYVA 4B6PA 4RLQA 3K9WA 3K4GA 5JG7A 4CM8A 1H23A 4B7CA 2WM9B 1TGVA 3V48A 4E51A 2VP0A 4HX5A 4ENSA 1JYSA 3IAAA 2JJ1D 2GUWA 3EZ7A 2OFPA 3H4IA 5EKTA 1ZM9A 3A6DA 3MT8A 4S12A 4O29A 1PEKE 4R8UA 4WE3A 3EA5A 5I4KA 3BDIA 3PHGA 3IIIA 2XAUA 3WZLA 1D04A 3L2OB 1M2KA 5J47A 1G8GA 4DAEA 3ZD9A 5A7HA 2DGZA 1S5LU 3RH4A 2GHQA 2I7CA 1L1EA 5KYWA 3U1TA 1BMQA 4YROA 1RMQA 4O3QA 2JEJA 1VHWA 4YP3A 3D8TA 1KQOA 5E9WA 1E2DA 1E96A 3RUIA 1XTBA 1UWLA 4L02A 2WYVA 1L1RA 2Q4DA 2Z8XA 3EGDB 2X1HA 3S81A 3TRJA 4ESHA 4DS5A 2EZXA 5JISA 3I52A 1NXTA 3IILA 1VJ1A 4FE3A 4NJMA 2DJ5A 2AC2A 3IDOA 1SUDA 1NLYA 3LX4A 1VP9A 4MRMA 1FS6A 1J5XA 4UZEA 3ONWA 2WTUA 4Q43A 3DFZA 4F86A 3A26A 3VKGA 4Z49A 4L1KA 2AGOA 3ML1A 3RR7A 4XASA 5FKJA 4EY7A 4N4AA 2AKAB 3EA4A 3IP7A 4B7XA 3MYRA 3PE6A 3RRZA 3OCYA 1GPMA 2ZR0A 2BM0A 2GBPA 1MPTA 2ZSEA 2VQDA 2D0DA 1WMFA 3PX0A 4BRSA 2RONA 1YKGA 2WSLA 5CT5A 2XNKA 1C7ZA 1VI2A 3V7JA 2JFUA 3AUTA 1EUDB 4ZVKA 2QVBA 3LY5A 2C78A 2YWJA 3JWGA 1SC6A 1VFNA 3RF6A 1UJMA 2FUKA 1XXHA 4DEXA 3LCUA 4FYPA 4YQWA 7ADHA 1QDUA 4M54A 3GRRA 2P3QA 1QK4A 2EQAA 2VLBA 3PL1A 1XDGA 3JATB 1DBRA 3JQDA 1YOVB 3G2PA 5KYXB 3I9NA 3JD4A 3WQRA 1BXZA 3MWEA 4PSCA 4OVKA 4PSUA 5AW9A 1HA3A 1NURA 1U5BB 521PA 3E70C 1MAVA 1ONOA 3LS2A 1XLTC 2ZKIA 4Z9AA 4UHEA 3WGIA 2AQIA 3QZ7A 3DHEA 3AU6A 3NEYA 4LHWA 4XQ9A 1PNVA 4JYZA 4W82A 3JPQA 3SPXA 5C7OO 4K8RB 2BHSA 1TK5A 2X0DA 4UREA 1HMYA 2A0WA 1EHYA 3OLQA 2ZATA 5GJCA 5F23A 4ZV9A 4FFDA 3A1NA 1XK6A 1FMFA 1N33B 1HEYA 4V2UA 3KVRA 2P7HA 1ZC3A 1TQ6A 2ZZKA 3AR8A 4DQVA 4GC5A 3P27A 2J6CA 2GZSA 4ZHSA 1CERA 2VLIA 3KX2A 1JT2A 5EPEA 3ZXYA 3EOZA 4MVJF 2IEDA 2NRTA 4GR5A 3QVJA 4FHCA 1GPNA 1TE2A 5ALQA 2PAAA 1Y4UA 5SYMA 4DCCA 1VE6A 3I5MA 1GG5A 1X94A 1I7SB 4R2KA 2A3VA 3TINA 1R6BX 1UL1X 3H6GA 4BMYA 2QD5A 3TM5A 1R16A 4M2YA 2WNIA 3S68A 2A67A 4ER5A 2WZDA 5FIUA 4Q3NA 2KMLA 3A6FA 3ZWVA 1V4VA 1QTRA 3BXEA 8ICVA 1W48A 2EV9A 3PFCA 1CJBA 3FZQA 3I4LA 3X1XA 1J20A 1D8TA 3EXFB 1N2OA 4R66A 9ABPA 2J6HA 3UXEA 4C76A 1GKKA 1GEEA 1U45A 5DVZA 3MW8A 3AO0B 3O8NA 1JH9A 1X42A 4NBNA 1L7QA 1KY2A 5BPFA 2JG3A 1QAOA 3B51X 2RGAA 3IM1A 4RDXA 1N4DA 1E1RD 5ARBA 2GCIA 4UB2A 3ROEA 4AO7A 2J3JA 1LTKA 3KHSA 1T1RA 2PO7A 5DNWA 1L7DA 5K3CA 4QZVA 3RJIA 4M1QA 1V0JA 4PV7A 1HG1A 1YO6A 2CEAA 3HZHA 2B3TA 1OYWA 3JAKB 2VJKA 2HQBA 2P6RA 4GZ3A 2GSDA 1WW2A 4RU9A 4URWR 3SY8A 4U7FA 4F9EA 4YRKA 2QRKA 2DFDA 3P9NA 8ICWA 4I3HA 1RYFA 4PSAA 1QJCA 3A6JA 1QV7A 1XCBA 2H52A 3OZEA 4JVLA 3AZQA 2D6FA 1Z4KA 3TLXA 4NU5A 5HUJA 2PIDA 3OQPA 3WFZA 1RW4A 2XV1A 1A77A 2W43A 5KTKA 3C23A 5JC8A 3IOBA 4KQWA 4M46A 1SUCA 4EIWA 5DGHA 4R1MA 1F0NA 1J5EB 4YLGA 1CE8A 3ZJ5A 1II8A 3ANSA 1AOXA 3HRKA 3FE2A 4YJ3F 1OREA 1RRCA 3LUDA 5CX1B 3OLCX 3TQ1A 1U0JA 1AVTA 3D4IA 3BVPA 1S7CA 3E27A 2G4CA 2GYUA 1H8HA 5AM5A 3LF2A 2D1FA 1YHYA 2OWDA 1KO1A 2VK4A 4P7GA 1XAIA 2PRKA 4P7JA 2FFRA 1XCJA 4HFNA 4RANA 3MRTA 3K8QA 1Y6GA 8ICKA 3OD1A 1CT9A 1FZTA 4GPBA 3U4QA 3QKRA 3L6UA 5JYDA 3A70A 3KL4A 2YHIB 4YIKA 5NULA 2CMFA 4FS8A 1SWVA 1Q74A 4AZWA 3ESYA 1WCIA 4RGYA 5A4IS 5CJPA 5JAQA 4NS4A 3MCVA 1A9YA 5EIFA 5L4NA 2WWWA 3BZBA 2F9FA 4TVSA 4RK0A 3FBGA 5J2BA 3J80A 4MWEA 1YDHA 2YW2A 2VRNA 2A9FA 4QEKA 1WB9A 4JBLA 4OHYA 5I9MA 2FWAA 2IH5A 4GIBA 2AMFA 1Z7WA 3LBAA 3TJRA 3R40A 3DMRA 1OFVA 1S9DA 4S1OA 1SHJA 1MQ9A 2D0OB 2R7MA 5A6VA 1I4WA 1JALA 4D2IA 1F8UA 1ZXXA 4PX2A 2QM8A 4XRGA 2D13A 2VT6A 1FX0B 5JJCA 1MO4A 3ER8A 1OJLA 1L4FA 1PK1A 2X9QA 5IIOA 3H0RB 1SXPA 1C9YA 3VSBA 5M7EA 2HAEA 2YY6A 1Y8RA 2OA0A 4A0QA 1NKEA 1JNYA 4UDXX 1YS2X 5BW8A 1NMSA 2NO1A 3T3NA 1SG6A 4KQ2A 7ICIA 2NOAA 3OIGA 3D7SA 4TKVB 1N2JA 5J2EA 4PW0A 2HHTA 4TURA 4MR9B 1I0ZA 3GGSA 2NUTB 2SKDA 3WVNA 4LDPA 4P4PA 3GC6A 1F2UB 4BASA 3VZPA 2C54A 1EHCA 1GGMA 4P32A 1NYLA 3P94A 1M73E 4BO5A 3MIZA 1FDWA 5EQJB 4QWDA 1WSWA 3E15A 3KTQA 5ESXA 1FO4A 4LZDA 3QU4A 2ZRNA 1DE0A 4B4WA 3P0RA 1HFEL 2R5FA 3CB2A 1G38A 5EWJB 1U9IC 1QU2A 4E1BA 1HG0A 3TTTA 5CR0A 4NEHB 3AHCA 1JUDA 2OMEA 5AK3A 3RSFA 3WMWA 4WUVA 3AG6A 2QMEA 3O2NA 2P35A 4CI0B 2P2DA 1QIFA 3PW4A 4RNDB 4ZOLF 1KDOA 1TF7A 2P2LA 2E21A 2DE0X 4QNNA 2CCJA 1RP1A 3BHMA 3U60B 2QGFA 4I36A 2R6R1 4IDEA 1O8CA 3L4BC 3IBFA 4LXXA 3LLCA 1T8WA 3ZS9A 2E37A 1V6SA 3UCEA 3NDRA 3DL7A 1AN9A 2ZT8A 4QULA 1VIDA 3IAEA 3D54D 1GUDA 4B3FX 1IE3A 4PC2A 1Q84A 3KO8A 3CMMA 4JYCA 4CKCA 1U2DA 3BFJA 2RMKA 3L8DA 4D96A 3LXRA 2QE7A 2OHHA 4DYHA 1OLXB 3K6JA 1SUEA 2BMFA 1I1OA 3B1JA 3RVKA 1DTWA 3HU3A 1S0MA 1IBSA 5JO9A 5LZ9A 5LQKA 1COWD 1Z6ZA 3LC2O 4J7XA 3S40A 1JEAA 3D5EA 4FEGA 1T25A 3NORA 4E6EA 4OHZA 2G83A 2PX2A 2KICA 1AV6A 1HDCA 2R18A 5TB5A 2RIRA 5JSKA 5EPUA 4L4YA 3HGQA 1PNTA 1BG6A 3IAM1 1WB5A 2ZOSA 2XNCA 3ESAA 3LA8A 5F7OA 3K0FB 5DT9A 2O7RA 2WUVA 1A2BA 2DQSA 4FGJA 3AVYA 4WN9A 4PZ9A 4L5IA 4GGMX 4MGIR 2BFEB 3PXXA 4DBLE 3IUYA 2UVDA 1BAPA 3EAGA 4EUEA 2QJTA 2H9AA 4A2WA 3OX2A 4A9AA 2V9ZA 1DAIA 1B0XA 5EWEA 3VU3A 3UT5B 2CZCA 3DZFA 2GLUA 3INRA 5CLFA 1QANA 1J7JA 1T36B 1UCFA 1X7ZB 1VPLA 5FV7A 3BHNA 1RI5A 4F4WA 1XAJA 1U8EA 5FAXA 3SYZA 3MAJA 3PGXA 5A62A 4RJ2A 5J0YA 5ALGA 4FN5A 4DMHA 4QYSA 2B8TA 4JEMA 1A2QA 2R84A 4Y2RA 1EB8A 3TW4A 3UG6A 3JD3A 1QVVA 3FGZA 5CW2A 5BWOA 2BGLA 3GT3A 2ORYA 1B73A 3MS7A 2AW3A 3SQOA 5AXCA 3HGTA 1I2AA 2HWYA 4ITUA 2WB1C 1KK1A 4LN1A 1V4BA 4LZPA 1PYOA 2DULA 4Y6QA 1Y6JA 5KNCH 5JUWA 1WCXA 5IUJC 1PTJA 1AS3A 2XEXA 4PNPA 2GPSA 3ZIUA 2PSEA 4RSRA 5C3UA 5H0IA 4FZ3A 1U1CA 1G1MA 3BD9A 4QHYA 1GZHB 3PC8C 5GIPE 2HA5A 3WLTA 4BKUA 5J2TF 4DT1B 3OHSX 2IL1A 1GPLA 1G4HA 1XX6A 1ZOLA 4HWGA 3JPNA 2D0PB 2VCYA 3OHMA 1XS9D 2Q07A 5L7YA 5J4KA 2YTZA 3CNBA 2O8DA 2BQUA 3SJUA 3BIXA 4J75A 5J2UB 3IEIA 3C3WA 4XIJA 1E4EB 3I04A 5ILGA 4NONA 1Y42X 4UHKA 4R9VA 3R5HA 3RIEA 3UKDA 2NV0A 2RBGA 2REBA 5H8WA 1KK0A 2PG3A 3NAQA 4M8IA 3N7PD 4HT3B 1DJLA 3CLSD 2PFKA 4FI3C 5FYQA 2ZT7A 4G8BA 1X87A 3JYNA 4UU7A 4QW9A 2CD9A 2VP4A 3OE7D 4DG9A 3D1JA 1CDOA 3PEEA 3OFJA 3NHMA 5TRTA 4YPVA 2XWQA 5J4LA 4RF5A 2UVWA 2PYIA 1I2CA 4M0AA 2GPYA 4DPLA 1P61B 1LFDB 4PLYA 3V4SA 4E33A 4YRIA 5JE8A 4UB3A 1SBNE 1JVSA 3N7UA 3LYAA 1DWOA 5BUCA 3TO5A 4G4IA 2C2EA 3C3EA 1K8QA 3EG9B 4DR6B 5B2FA 4DSFA 3H0KA 3JXEA 2O2SA 2CY0A 4XWOA 1RBQA 1XMVA 1Y5RA 2A0KA 4JK3A 5AVVA 3RANA 4ZPJA 2XRMA 2HSDA 1YF3A 4O2BF 4RPYA 3UV3A 1NVTA 1ZRHA 5J2DA 5IVKA 3LLMA 1L3VA 2A3NA 1JS1X 3BX1A 4WBNA 3AFHA 4UXJA 2XCSB 4MUXA 3M6UA 4HXYA 2PJUA 4R7TA 3MSCA 4DQ0A 2B2CA 4DZZA 4RZIA 1W19A 4EF4A 1S3IA 4GR4A 5MFPA 1KJWA 3T7AA 1SURA 1VZ2A 2IKQA 1ODSA 5J8YC 1QV9A 4ZVNA 1D1TA 1SY7A 1NQTA 2Q1YA 4WADA 4HAWA 1NIJA 4AZ3B 2HTEA 3CM0A 3NEJA 3KELA 3LWLA 4LX0A 4IJUA 2E49A 1FSSA 3V8QA 3V97A 4RULA 2DLDA 3HUFA 2FPOA 3DYVA 3IMEA 4L5AA 4H7DA 1B15A 4LS3A 4KGVA 1BMFD 2H59A 1UBEA 1CF2O 1XVUA 3C7TA 4BNLA 1C30B 4TQUS 4LF7B 1WUIS 3PVSA 1WXEA 4KO8A 4QQFA 3LO5A 3A0BU 2PX0A 3OPYA 4COKA 1OY1A 4N8DA 2XCLA 5KOHA 5DNDA 2HIHA 4D8TA 1X9GA 2NUAA 3RC3A 2PUFA 3UATA 4HDCA 4OF4A 1ZD8A 1A82A 3H1BA 3GGOA 3F53A 4J9KA 3A4NA 3EF3A 4KEAA 3GEBA 5TJ9A 3QPDA 1C1DB 2VATA 3DZCA 4ZU3A 4ENWA 4LRYA 1KTVA 4DG8A 4DN6A 5KX5A 4QYIB 1XMSA 1GFWA 1NVWQ 1P5HA 1JMSA 3MOSA 4KR9A 1R9NA 1E5XA 4GX1A 4LBVA 4ADSG 4TTTS 4P6VF 5IBRA 3VR6D 2QW8A 3L0YA 5KFAA 3DLCA 5B3JC 3N05A 1KFDA 1NP6A 4PSDA 2Z2XA 4MIEA 3NTXA 2AVDA 1E9VA 1ZQCA 3GZ4A 1H5UA 2F90A 4YTEA 3BUSA 4FO6A 3FWHA 1UPAA 3A4LA 4KSCA 3R3JA 4C0ZA 4AQDA 1JHRA 3IYLW 2OO5A 2WJ6A 3JASB 3PR1A 5CNKA 2IJGX 3RV3A 2IYNA 2JGLA 3F3YA 4ZYTA 4TV8F 3FMPB 1ANKA 4NM1A 2VP5A 1HMPA 2ATVA 3SZ3A 4QPCA 2IWRA 1RKXA 3A3OA 2C4VA 4UBLA 5C7LO 4YV1A 3BH7A 3V8MA 4M9SA 2WICA 4LX8A 2K8AA 4DL6A 2EQYA 2BGJA 4AM8A 1AKEA 8ADHA 4O59O 5FL7D 2HJHA 2XDQB 3O1LA 2BRUA 4K6GA 1TJPB 3P9YA 5JDIC 5IFLA 4KACA 1HOXA 2ZUTA 3GK3A 4E07A 1NJ6A 2RIPA 3GBPA 3SZMA 3ZD8A 3GA7A 1NW7A 4G09A 1JWLA 2PUTA 1AXEA 4HPJB 3FHTA 3MA0A 3AEUB 3MCAA 2R7KA 4QZ9A 1M2WA 3ZKWA 4ZI7B 1FNDA 5ALEA 1W36D 5C8VA 5GVSA 5A1JA 2C59A 3WZ2A 2C57A 3TRFA 3C4QA 4QO8A 1AKRA 2YXPX 3ZDAA 1N5JA 1FE8A 1MC4A 4TT8A 1WW3A 1UFKA 2QAGC 2XT6A 1JR6A 1JXEA 4C8NA 1LTHR 4BFWA 3MDCA 3FPSA 3HA7A 2XQIA 1Y1QA 5AM1A 4M47A 4XCQA 5H4HA 4MS4A 3Q8XB 2XGSA 3PIRA 3ZJ4A 5FOSA 1NNI1 1NRXA 2IXEA 2FX3A 2DLNA 3S2FA 1LPBB 3ZX5A 1E9BA 4AUNA 4YP0A 3RKRA 2O3QA 5C8XA 4OQEA 2H4ZA 3VR5A 4YACA 3NG1A 5EL0A 1IXRC 3RT7A 5IVDA 3DT6A 3U9LA 3R5XA 4JSTA 1L3CA 1ZAYA 2PQ6A 4X1KA 4BU0A 2W22A 5LQDA 5JO0A 3OJUA 1T3ZA 4MGYR 4I4CA 1L5UA 1HE4A 2CYCA 3PT5A 3A6ZA 4JUDX 1NV9A 2FSFA 4QHTA 2O8CB 3QGMA 1WU8A 4IVNA 3E9EA 4OHWA 4R2JA 1U1GA 5BW5A 2GHTA 4UCFA 1Q22A 1P81A 3DMNA 5B3LA 2FRXA 3RVSA 4KPEC 1YIOA 3A6KA 2X23A 2Q0HA 1C7FA 2JD0A 2KSQA 4BEJA 3ED5A 1HEKA 1MDBA 1EA5A 3II6X 5EP4A 2R60A 1R5BA 4XR9A 3PEWA 1M7HA 1KI2A 2OGTA 3IPAA 1GQRA 1JDPA 4ARUA 1TF5A 3HJBA 5T64A 2VHYA 9ICKA 1U0LA 2FJ6A 4UB5A 3PNKA 3ZW8A 1NF2A 4XYEA 2NZVG 5LKAA 1KS9A 4BYGA 3G0GA 3PL5A 3ZU4A 3DVLA 4IXMA 4HDNB 4CG1A 1DPFA 4JCOA 3ZWYA 1OGJA 2BFDB 2PIAA 1TM3E 1O54A 1ZP6A 4LQCA 1S3FA 4PGAA 2OHGA 1QB7A 3LCJA 3AM3A 2BEUA 2DBQA 2IU3A 5CXQA 2Z9BA 3TLMA 4M0LA 3GDFA 4NBVA 4KODA 1ZK1A 1PFYA 4DGQA 3CH7A 4TTAA 2CF6A 5JVDF 3TUJC 3UJPA 5KFHA 3KYCA 3JWEA 4JAVC 4ASUD 2R1ZA 3PU6A 3PTZA 2I65A 1RC8A 3R6TA 5DSTA 4UD6A 3RS0A 2QXYA 2ID4A 4G1UC 3EPKA 1WDMA 3NV7A 1GVHA 5IC5A 3M6MD 2LPMA 2VZLA 1DQNA 5KBYA 3RLIA 1OWMA 5LC1A 3EIQA 3G2KA 3NRJA 1SOAA 3QU2A 2WT8A 3H17A 2I22A 3WL7A 2I2XB 3E2MA 3BF7A 2I4LA 4ON9A 5A5FA 4AS2A 2H51A 1ZONA 1HEIA 4JT8A 3A2NA 5IF3A 1C1HA 3GDOA 3DA8A 2VBGA 1XQ6A 3UCFA 3MGIA 1M8KA 2VF8A 3GQVA 2HQ1A 5EOZA 2I3ZA 2ZQZA 2VJBA 2KB0A 2W8BA 2DWUA 2BHNA 4IIYA 9ICPA 3FVWA 3WWEA 2VHQA 5BNFA 3TANA 4PBRA 2G5HB 4R8RA 4BLPA 5SYAA 5IYZA 4FCVA 1Q57A 4EG6A 1RIIA 5L3QA 4G4JA 4MO2A 1FTQA 1LJUA 1H69A 2G17A 1GO3F 3ZVKA 1IJKA 1IEWA 3OCUA 5IUKC 1OH6A 1YZKA 1TLTA 5L7TA 3T3DA 1O77A 1TIKA 1VRVA 1BMDA 3MINA 3LQQA 1Y98A 4KLMA 2OCLA 3MMXA 3AEXA 4H1UA 1Q0UA 1GU7A 1Y5LA 1UQTA 1ZQYA 1LBHA 2AXQA 1TV9A 3NHBA 3SHTA 2I99A 1SQ0A 2V5AA 5IJXA 1UODA 2ERCA 3KS9A 5YASA 1IZ7A 1IRIA 4DWOA 1YZQA 2ERYA 2JRZA 1XTSA 4ZVRA 1NX9A 4WJKB 4WZ6A 2BYTA 4XIFA 3KTAA 4R84A 5JS6A 4DJEC 2KWIA 5KFLA 4EF5A 4KPUA 1TADA 5L7WA 2IDMA 1PT6A 4GZMA 1W36B 5KI6A 3UOAB 2KSOA 2WFAA 1Y4SA 3WKDA 5JQWA 5EUCA 3AR9A 4Z4HA 3H0CA 2ZRQA 4LJLA 2GCGA 3LY7A 3MMNA 4DUGD 3HP6A 3VR3A 2UZAA 2OP1A 3IP1A 3KUDA 1I7LA 2ERXA 4CEJA 3BG5A 4AG6A 4WVLA 3T9AA 4FSDA 1H4TA 5CFNA 2IV7A 4H6VA 4NESA 3LUHA 2DY1A 1NK9A 2YV4A 4LA4A 4ZO9A 2DPMA 1SBIA 4LK2A 3DAFA 1UMCA 1DTSA 2G3YA 1CQIA 1WKCA 2AL7A 1TCVA 3H5LA 1G8MA 3PGKA 2YV2A 1DC7A 3HO1A 3HV0A 1DZ3A 2R4TA 2G9RA 4M1SA 1MGPA 4CKZA 3CFYA 2RAFA 1AS0A 3A6LA 1AKQA 1R0RE 4MHSA 3LECA 4V3CA 4HN2A 2BEWB 3ZEAA 4DUZB 1DX9A 3BD8A 3GMSA 2X9NA 1ISJA 5ULLA 3RHZA 3ILHA 4E32A 4Q6BA 4WLFA 3P20A 3BE6A 4AULA 3O4GA 2PNJA 4ZQCB 4EVIA 3KV1A 1WVMA 2PR7A 5EKUA 2FKAA 1JILA 4W5JA 1KNXA 3CP8A 4UNQA 1RPAA 5D6OA 4OJ6A 2AJBA 3GZFA 3SF8B 4FKMA 3R3UA 3R6GA 5EMHA 1E4OA 2R8ZA 2A14A 2EW2A 1QHFA 1YAJA 2G1AA 3UXHA 5LA6F 3NHKA 4Y67A 2MU2A 1FUIA 2RBEA 3IHKA 4IQTA 1CUHA 4F9FA 1WUYA 4QWWA 1KI6A 1QTMA 3QF4B 4WBXC 2JEZA 2IP1A 8MHTA 5KFNA 1ZI9A 4R9RA 4FW8A 3JV7A 2G63A 1Y3DE 4Q4HB 4RVUA 3VH1A 1OROA 4Z86A 4D46A 1JHOA 3ZOKA 4TKUB 2AEEA 2PLNA 5DKFA 3EQZA 4B6EA 1CUAA 3VBEA 2EYUA 4XD2A 2PKCA 1M67A 1VG8A 3R7AA 4NMWA 3THXB 3HP1A 1GD1O 1ZJWA 3IFSA 4KCGA 5JCOA 2XMQA 1UADA 4EWLA 2GTIA 1PDOA 1R18A 4B6QA 3VKUA 1RXVA 1O6GA 3N1UA 1VIVA 3ACDA 1DQYA 2IUSA 1BGVA 4C6SA 2HEIA 1KNQA 3NCTA 2W8LA 1MEEA 2E4AA 4HEJA 5TPZD 1YR2A 3R0QA 3UC5A 4UPVA 1YBHA 1WR8A 3NOQA 2QX4A 5TGZA 4JJ4A 3ABOB 1G20A 4GMKA 4CL0A 1R0YA 2OFWA 1GCAA 3UUFA 1MJHA 4PHTA 2OHFA 3D81A 3EPGA 3DTTA 5JU5A 4BNNA 1XTKA 2D3TA 2G9ZA 4K9DA 2ZROA 1N8SA 5HE9A 4R05A 3VO1A 3PUYA 1JTEA 4ZARA 3RBAA 5JH7A 2XGOA 5BQFA 1F8YA 3FI9A 3NYIA 4BO7A 2WHEA 4A8EA 2WZCA 1NP3A 1ZZEA 1Z06A 2CLHB 4WLUA 1QC5A 2IYEA 2GO7A 2ZIXB 3FZYA 2C2RA 1XDZA 2PZAA 3NHJA 4O3FA 2Y8EA 2IH4A 1QF7A 3RG2A 2HKIA 1ZSVA 3O74A 1OB2A 3LPMA 2HHLA 4IIJA 4LK3A 4MUIA 3BB3A 4DM7A 1K6JA 2R8BA 5JMOA 4EYHB 1VJ5A 1JDBB 2OVBA 1A50B 3R0IA 1USIA 4UTNA 4BO6A 5L1JA 5JSFA 4WDRA 1SV0C 2MSWA 2QRMA 2HO5A 1UMBB 4FSHA 4HATA 3JQGB 5A9RA 2GCEA 1H38A 2HMVA 1WXFA 3HCRA 4QUBA 2YRXA 1SK8A 3O9MA 4AF6A 1WXDA 4EK9A 8ICHA 1A9TA 1FC0A 3MBYA 2H1VA 3ZUGA 1OI2A 2YKGA 3T7CA 3GJ6A 4BLSA 4D45A 1ZR2A 4EUHA 5CGQB 3RJ5A 4UFPA 2AX4A 1T4BA 2JR5A 5F1YA 3HMQA 4AJLA 2Y67A 2FMFA 4ZEMA 2X7JA 3EMBA 4OPMA 1KAMA 1JG4A 4OI4A 4J03A 2UZ1B 1VRWA 1JHUA 5HOEA 2G8LA 5ECYA 4GL4A 5FO0A 3R7WA 3W8RA 1Q14A 4F1WA 5CJJA 5LL6P 3ULKA 3QVSA 3RH5A 2QG9A 2HBMA 4TMWA 4JC5A 2YNMD 4NPHA 4NDAA 3K94A 2ASLA 5CB4B 4PSVA 1XP5A 2HK8A 4WXHA 3R8XA 4AXXA 4NMXB 4IR7A 1ECCA 3QBDA 3A28A 3K6SB 3MGBA 5I51A 3F6CA 2Q6VA 3A0RB 4R1LA 4X6YA 4FLEA 3BCSA 1NFQA 3U3KA 2YIVX 3T4UA 3LFTA 1JU9A 3WMRA 1ISHA 1OHHA 4YCCA 1QPBA 1TK8A 4M9JA 1YR8A 4JYMA 1A9XB 2FQWA 2P9YA 1NOMA 1JE0A 3B2EA 2YYZA 5EWGA 4I55A 1YHNA 4EBEA 1KVTA 4DOCA 5ER9A 1EBUA 5LBUA 2I4OA 1FX1A 2RHTA 3KK0A 1V1JA 3CO5A 3E4CA 3DAHA 2C4WA 3DC7A 3VPXA 4QWMA 1F3LA 4B8YA 3X1MA 4MUFA 2NT3A 3DEHA 2VHZA 3MS4A 3P9CA 1TTTA 4YAWA 2BVNA 2HA2A 4REQB 3AF2A 4HNAA 1XD2A 5EHIA 4CLHA 3L1JA 1IN1A 1SKAA 4HGRA 3B13B 1PO7A 5I9TA 1DXSA 2H5IA 2MSEB 4WOJA 1EDEA 1YKSA 4XQEA 2Y0EA 2F1JA 1N36B 1SGWA 1JZQA 1XRLA 3AHHA 1FVOA 2TMYA 1JAIA 4GXIA 1Z5GA 3P5BA 2K4EA 3DBRA 1QRSA 1UBSB 3G5TA 1EG2A 4D44A 5F2OA 2YN2A 3GLQA 3QVKA 4KVGA 2C5SA 1AS2A 1RYRA 4FT2A 4LYDA 2YY7A 1T2EA 1U7ZA 1XKTA 5JJ5A 1WIWA 4O2RA 3ZE0B 3SXUA 1GDHA 2Y92A 1JJFA 2O05A 3C21A 4QGHA 3N87A 4H3KB 3K9NA 2VPTA 1JPVA 3TRDA 4D43A 3K9FC 1QIDA 4K9PA 1XO0A 5LOVA 5L9AA 5AQEA 2BTQB 2Z7JA 5AESA 2WMDA 2YWEA 4EEXA 2RLTA 5FNVA 1DOHA 1EFPB 4LBYA 5JHGB 4L08A 3PUVA 4IKEA 3IQGX 1SZPA 2XOKD 3ZQJA 2WJ4A 1U9CA 1RWWA 4BVLA 3HWRA 5L3RA 2WUEA 2A9PA 1HYEA 5AM2A 2H7YA 1OYOA 3LT2A 3GFTA 1RCUA 4I2GA 4MSUA 1H3EA 1XVAA 3UPTA 1D2RA 2O0JA 2A6PA 3OURA 2Y0SF 3HUDA 4X91A 5BQ3A 1OX6A 5AI5A 2WDPA 4XWWA 4JUZA 2WG1A 4G3XA 3TCKA 1QZXA 2B25A 3LWBA 5AOVA 4O02B 1QXSA 4AC9A 1W4BA 1P62B 1KYVA 4AMYA 3TZKA 4DFPA 1L5ZA 1BXGA 2FMPA 5HDQA 4LHXA 4JKYA 2GNAA 1KSJA 3RJMA 4J0HA 3AZOA 4DILA 5IAOA 4DM3A 1PGOA 2W6OA 4ZRNA 4RFVA 4F5DA 2GPJA 1VDZA 4OYHA 2R9VA 2XB9A 1W581 2F62A 5KFGA 2ZWPA 4MR8A 3F96A 4Q7JB 4MYCA 4DZTA 4JUAA 5IU6A 1AUPA 1NT4A 4LZZA 1N8TA 4LVCA 3TXAA 2VTBB 3CG0A 4EW1A 1DIAA 4DWWA 4MLPA 1IONA 3CXRA 3H83A 3BEOA 4HRVA 421PA 3RVLA 3J81j 1E7SA 2WU0A 5DBEX 3FNFA 2YJTD 4RLFA 2JGKA 4EQ6A 3NM4A 4PLHA 1A4XA 4P3OA 4Q9HA 2GBLC 1QWOA 3NS7A 3CNQS 4ECVA 5KINB 1CJMA 2DPYA 3TSWA 2R66A 2AFHE 1C7EA 1MJGA 1T3LA 1BH2A 1O57A 1DC3A 2V7VA 4Y6OA 3AR5A 2ZCJA 2FFQA 4M9HA 4P0PB 1KBOA 5FR2A 3R9IA 3ILSA 2N9UA 1ISPA 5TMPA 1F14A 4UJ5A 4KQGA 4D98A 1QPZA 3K16A 1KTIA 4C0XA 2C20A 1R0BA 1H4SA 4DWIA 1LJLA 2JCVA 5EZYB 4EHFA 4PN7A 1E2MA 2NX2A 2AGPA 1SZHA 3KB1A 2IEYA 2Q5LA 2E5SA 1Z0KA 4IS2A 3F46A 4CR8A 4I2AA 3KUXA 1M6NA 1JN0A 2HH9A 1II9A 3ORHA 1ZGJA 2XWSA 2J45A 5CR9A 2A58A 2XUPA 1OSNA 1SC1A 3OZXA 2C5BA 4JX8A 2YC2C 3SN6A 1TIBA 2COUA 4FFLA 5I3ZA 3WWCA 2W2VA 2IIVA 3UGQA 1MHPA 2ZBGA 2RHLA 5BSGA 1ZH0A 3WIUA 1FNCA 4HPWA 1OILA 3DWEX 4D4IA 4EJMA 4GO1A 3U6BA 4OKSA 1GPBA 2X3YA 3RG8A 2KKVA 1RJ9A 3M89A 1S2OA 3OPVA 3F9RA 1C8BA 4FN4A 4QFMA 4KXMA 2A7QA 2VN8A 3SJAA 3IOMA 2HHSA 2AS0A 1IZZA 3R9XA 4F2WA 3M9LA 2X5OA 3E7XA 1ISFA 5J29A 1YQWA 4EKYA 4UBCA 4NKRA 5JLAA 2K60A 4BKRA 4B47A 1QJ4A 4N5LA 1GNLA 2OILA 3VZBA 4J9NA 4MI1A 1FXWF 2A7XA 3IIEA 1G5PA 3RIHA 1F0PA 3QA9A 2XW6A 1H42A 1N57A 4F12A 4OEHA 4MS3B 4LHSA 1ZQSA 1RPJA 3ETRA 4UEOA 1CUYA 1SC3A 4YMNA 3LNCA 4RZRA 3ZD6A 4Z4FA 1ESDA 4BLVA 4DQPA 3F9CA 2CLCX 5I5GA 4GM4A 3UWMA 3WWZA 3DXZA 4EY8A 4BX2A 3FXAA 3G0IA 2IUTA 1XEXB 4IUBS 2BJHA 5LYJB 4UAGA 3S28A 3OT5A 3IIMA 4DRXA 5FFNA 4A8TA 1GOTA 2JI6A 1SOWA 5AO9A 3RB6A 4O4HB 4S3MA 4QZDA 4MYDA 5IWCA 2RKOA 2ADFA 3AC0A 4GH5A 2GD0A 2E1PA 4P2GA 4EHKA 1UP6A 4N82A 4Y7DA 1FU4A 2PMBA 4BV3A 4BO9A 9ICHA 4TSFD 3SOPA 3ABRB 1IMJA 4CMGA 4K2AA 4G8CA 1DG3A 1B8OA 4HQ6A 2AGQA 5DGAA 1B0PA 3OM0A 4MV9A 3MDAA 3RU3A 4OH1A 4ZU6X 4G63A 1LI4A 5BUSA 3AP2A 1UZMA 4TLBA 4QDUA 3A1WA 3U9TA 1N5OX 5BOVA 4F6LA 1ENOA 5GJWC 3EZGA 1EWYA 1RYUA 4BKQA 1R4MB 1J39A 3M8SA 4BNIA 1V7QA 2VDOB 4XPIA 3B52X 2UAGA 5KFEA 1X38A 5AVSA 4PQGA 1PV4A 3WRWA 2GZHA 3LV8A 2RGWA 1UBNA 3LY9A 4EI2A 4N5MA 3F3MA 4K9MA 2Q6OA 1I33A 1QFZA 3SEFA 4CMIB 2MINA 1AQYA 4AJPA 1TQ8A 4FNMA 1K98A 2JIZD 1MX9A 5DBIA 2X0IA 4GP7A 1RYHA 3GP8A 4BN4A 3M5DA 1ECBA 1EE2A 5K3BA 4W5WA 4P4SA 1O08A 1CUSA 4K6KA 5CG2A 1CRZA 3EH1A 3WGVA 1XC9A 3RJEA 5B7NA 2O7NA 5ES3A 4L27A 2OTCA 4TWBA 3ILYA 2IYSA 4BN5A 1ULAA 2VSNA 1HDOA 2FFHA 2NGRA 1R4NA 1JWAB 2V59A 1RYNA 1WY5A 2TSYB 3MJVA 2FLVA 3ORQA 1JKIA 1MHTA 3I6ZA 5DOVA 5DBFA 1VMKA 2DTEA 2PQ2A 1A8PA 3TEJA 4ZVTA 4O4JA 2HV9A 2G7ZA 2B0JA 3IBYA 2QV0A 3KZMA 1GNQA 2WMYA 4EZ9A 4EGJA 3Q12A 5FTLA 2P2GA 4LYGA 2W5UA 4G07A 2VNIA 3PF9A 4Y1RB 4F4HA 4TPKA 3ZK9A 1RLMA 4AX4A 2PSHA 1S8FA 4TL8A 1I6LA 1E0KA 1S8OA 2FG7C 2A4KA 4YJKA 1PL8A 1FVHA 1S97A 3BS7A 1U9JA 2AX3A 5A3SA 9ICIA 3AUXA 1G3RA 2I4MA 4IUYA 5DOZA 5IX8A 3QY0A 1JT9A 2V8OA 1Q12A 3QPBA 6AT1A 1UKYA 2HHJA 3B9JA 1CLUA 1UANA 1H2WA 1TO1E 4RFLA 4F3CA 2CE7A 2QTVB 4IJKA 4M36A 4CODB 3R23A 4DY4A 2PU5A 1NL3A 3NNDA 5KU7A 4B44A 2ZYHA 4R16A 2NADA 1UOPA 5HUHA 4RTOA 2GO1A 3EMDA 1RHRA 3ZC3A 3ESZA 1AO3A 3X1DA 4ALJA 4GKBA 3EBLA 3REQA 2RJ3A 2QN7A 2NYAA 3A10A 1S4QA 3WDKA 4J43A 2B0CA 2A86A 5EINA 4ZVLA 3H86A 1NATA 3B12A 1NI3A 5LMCA 3EHEA 1JNXX 4O3NA 2TRSB 4ZAVA 3GELA 2P6UA 5LN1A 3WB1A 2PLRA 4UPEA 4Z6FA 2J0UB 2FUNB 5F2KA 5P8WA 3TQIA 1RTTA 4QU0A 2RHMA 1U4SA 1BWPA 3RJFA 1PJAA 2Z83A 3RKSA 4Q24A 5JRJA 3I45A 1NKBA 2OBYA 1LK7A 2CRXA 1RYDA 5BMVA 1CFZA 1LD3A 1GKLA 4EECA 1PL7A 1Y8QB 2WINI 3JQEA 2YCLA 3H5TA 4F3NA 1HDGO 5CA7A 2JHCA 4EBCA 3DEIA 4RZ3A 3HN7A 3W6ZA 1JRPA 5J2HA 3F4BA 3JALA 1LXCA 4LYHA 4PO8A 3JQ7A 1OXKB 4D6XA 2GTHA 1DRUA 2X7XA 4H59A 1LV7A 2BGKA 3NHLA 3WSTA 4KLGA 5BT9A 4NZOA 1R12A 4DJAA 4CL2A 4PL2A 3PMNA 1DJQA 3T54A 3UBMA 4C21A 3DXYA 2PI5A 2WF7A 1QFMA 3GGJA 1FYXA 1V41E 1C4WA 2IZZA 1CS4C 4TWIA 3I04M 1XPUA 4GE3A 3QUAA 1D2HA 3QUSA 2ZRLA 3PJFA 4FHDA 5CEFA 3LYSA 1JPNA 1V37A 2IU4A 1MENA 3RYIA 5TNXA 1FU8A 2J3KA 3ESDA 1P29A 4GKAA 1PGPA 5HF8A 1LDGA 3RVPA 5TDHA 4NI5A 1W7AA 2EZUA 4OLAA 4QRIA 3ZCRA 1UBJS 3L6CA 3RAJA 3L7CA 3WYBA 5JASA 1F4PA 2N0SA 1B6SA 3ZNQA 4LXYA 3KSUA 2I1LA 4WUTA 5GPBA 1U3DA 4R01A 2NV2B 3AU2A 4G41A 4KNWA 1U0NA 4A1FA 1N2CA 5A6SB 2WKRA 2Y6VA 4REMA 1XMIA 4LAFA 3MR5A 3DZ8A 4W9RA 3OTHA 3A32A 4EJ6A 2XCRB 3TWOA 3PKJA 1EVQA 5SICE 3W3AA 1UXHA 2VS1A 1XTPA 1A1SA 3SNHA 1GNSA 1XD8A 5DEOA 1BDHA 4G56A 3CLRD 3ICXA 2NUPA 3N2GA 4C14A 4CM8B 3NLLA 3RRHA 3CR7A 1B41A 1L4HA 1CR6A 1E7RA 1JXAA 5B57C 8ICXA 4JZYA 5KYUA 1UEXC 5EQDA 1MJ5A 1X0VA 2UUCB 1I4EB 3G49A 5CNJA 4EZIA 5CYPA 4KUGA 3ZU6A 5AW5A 4D8WA 2RHWA 3FPLA 4B3DA 4G65A 2Q3BA 4Z53A 4DLTA 1C0EA 3GH3A 4WPGA 1QTNA 2IIQA 3JSXA 5DGIA 2F17A 1YMUA 1U65A 3AIKA 4K46A 3WBBA 3BE8A 3KUCA 1OVMA 4YMTA 5JEDA 1RPTA 3FDFA 1XRJA 3CKKA 6GPBA 1VG0B 2RKBA 2QUZA 5KFFA 1K0FA 3ZIAA 1HPLA 3RU7A 2FN9A 5FQNA 5IINA 4IXTA 4PQYA 1N2XA 4NJMB 2Y4NA 4N3GA 4MW9A 4MV3A 3AP1A 3MPUA 4IFBA 1FK8A 3K9LA 3UMMA 4F8RA 1YB5A 2EYQA 4IOMA 3CONA 4X7PA 5TY0A 3V7KA 1JP7A 2BMEA 5DGTA 2WK1A 3RD5A 1NZDA 5AIBA 2RGUA 4Q9IA 3U4CA 3PA6A 3TI0A 3U44A 4AKIA 3AERB 3WL4A 1FUKA 3PTAA 1KERA 3K0KA 2YWCA 3GY0A 2VKQA 1KH2A 2XZPA 2GPBA 3PG5A 4IZ6A 1F51E 2CNLA 2FEKA 5HS6A 2WZBA 3D2QA 4JI2B 2ECPA 2JLSA 2JARA 3GDXA 1CJKC 1XXHE 1IV8A 3K2BA 3D4PA 1D1PA 5KCZA 5THQA 5FWAA 1QIGA 2AC4A 4R40A 3L7KA 2QBYB 4BVEA 5J58A 3HUEA 3SIXA 2AQ0A 5HZKA 2ZJOA 1XXHB 3AJ8A 2F1KA 3QY9A 1YT3A 5AVKA 3FCYA 2QN9A 4B8WA 3MFQA 2BUCA 1DINA 1RHKA 3TIIA 5AR1A 2EWWA 3VPAA 1E7YA 1IQUA 4KQ6A 3DWGA 9ICRA 5DU2A 2YJNA 3IOCA 3C2KA 3VOBA 1N3LA 5EJ2A 3ETCA 4RHYA 4U3JA 2RDIA 1K88A 5FUQA 1SKMA 2OHVA 4PGYA 1E2GA 2ZBVA 3WG9A 3PXDA 3A31A 4R7GA 1QONA 3AXTA 3DPIA 3X2FA 1C5KA 1GDTA 4NHEA 2NACA 1KK3A 1Y8AA 1E6MA 1AHPA 5LUBA 5AWFC 3UBTA 3CZRA 4B43A 4I4LA 1N5KA 2M1XA 1U94A 4F3YA 1W59A 3LAWA 1WU7A 5BSKA 2B4KA 1F48A 2ORWA 1WL8A 4L28A 3ZHQA 4ECTA 3VKHA 2WJVA 1C4OA 2O1SA 2WV7A 4ED9A 3I62A 5F35A 1ZMTA 2HSEA 1Z68A 1P74A 4P98A 2RH5A 3SYRA 2LCIA 1E94E 1V25A 3EUEA 4G5OA 2A2ZA 1NJYA 3HPOA 4XTCS 4UBBA 4AS1A 3PRHA 4UBOA 4NBKA 5KTYA 3E3NA 3UJNA 2C7GA 5C0YA 1O6CA 4BQQA 5AK6A 1U2TA 3W6PA 1H2YA 1KZ7B 2J4DA 4X95A 3DKPA 4K7JA 4Q01A 3GT4A 2JI8A 1PR1A 4CTOA 4EBDA 1A96A 1KEEA 1KEKA 1FSFA 1XZJA 3ZWQA 1XKQA 2VP9A 4H0CA 3I2HA 2JCSA 2ONKA 4N40A 1AGRA 3V4LA 3TCNA 4D9JA 1ONSA 3C1YA 2C3PA 2JLQA 4QTUB 4GICA 4L76A 2LDXA 1P6QA 1UT5A 2YIMA 3UJHA 6LDHA 1NUTA 4KYIB 2FW6A 4B2IA 1P0PA 2AOTA 1PT5A 2QKQA 2F7SA 3UICA 2HX1A 5KQMA 2AJCA 1CUDA 2IEIA 2QE7D 2LM1A 2F59A 4QUIA 1SXIA 2C5HA 3KD2A 1D3AA 3C5HA 3T94A 2NZ2A 1F12A 1EFCA 1WZUA 5ICFA 3L0SA 5IVPA 4I2CA 1XNJA 3PK0A 3FNGA 1HY3A 2P68A 4B6RA 1QSYA 2IYUA 1OE0A 4N7BA 2XO7A 3WK9A 4JHLA 2IUYA 4Q9JA 4U7CA 4ECZA 2Q28A 5BNWA 4G9GA 2FUEA 1DAPA 4CL3A 1NR7A 1RRGA 2XVXA 3DGEC 3UH1A 3KYIB 5K0EA 4J0FA 3IKTA 4LBWA 4I5DA 3SK0A 3ZXXA 2GBFA 3H5NA 3OOJA 4IBOA 2VF2A 5SZIA 3QYJA 4KWHA 2E9SA 1YZVA 4A2PA 1S01A 5CYFA 5BW4A 8ICNA 4QTTB 4GQAA 1RQLA 5EXTA 3LOUA 2PGIA 3W90A 2N46A 2K7FA 3MLEA 7MDHA 1NBIA 1OI7A 4R8LA 1Z62A 4RTQA 5ALYA 5IH7A 2Q5IA 4FLMA 3KKKA 3ABQB 1II8B 5FOTA 2IGBA 3R4CA 3FTPA 2Y1EA 2QTTA 2QZJA 3ZQKA 3BK7A 1YQTA 5JYEA 4ED1A 4UXIA 4N41A 3OMLA 1UWKA 2PFOA 3WC4A 1OV4A 2NTNA 4HLDA 3FAZA 2AUMA 3S55A 2ZUSA 621PA 3LNTA 1PHRA 1DL5A 5LQRA 3EZYA 1TK9A 2H7VA 3CT6A 1JR4A 1NT2A 1GL3A 4WCFC 1PX2A 1ZEJA 4TZ6A 3JYHA 3VNSA 3S8MA 5FWNA 1Z6QA 4CN9A 4TV9B 1KEZA 3TZEA 2KTQA 4I50A 5FBHA 2WFZA 1Z3CA 4ER0A 4B4VA 3DEJA 1KETA 4MW5A 2VJDA 4HGYA 5EKXA 2V74B 2KM1A 2Q3JA 4U5QA 5HMLA 3DOHA 4FHZA 2XXJA 5C51B 2BCRA 1YGPA 2QQEA 1WCIB 2F3SA 2CUZA 3GLFA 3K75D 1U02A 2ZG6A 3AKCA 2G07A 4DL7A 1QRDA 4PONA 3CLTC 1U1FA 2M6LA 5JNVA 2O59A 3WBJA 5ALVA 3TI7A 1OXMA 3EJ6A 4K05A 2HT6A 1C7RA 1OFGA 1P0QA 5CA0B 4JP1A 1V9LA 5DNCA 4B9TA 4KE6A 2RH8A 4DQXA 2REXB 3R7FA 1Z4NA 4N0QA 2O2HA 4FKZA 1EFVB 1Z26A 3NR2A 3FCOA 1W0KD 1T0UA 4PHDA 1ONNA 2GI4A 3IB3A 2HDWA 3N28A 3Q87B 2Y99A 4HLNA 3CH6A 4U6QA 5K09A 1DIGA 4ARIA 2GNOA 4MPJA 3DLTA 2O1EA 1WHSA 2I2BA 4WFQA 1NMZA 4K26A 3H0LB 1GN8A 1CY2A 2PBZA 5CVEA 5EY5B 3VDMA 4EYOA 5DBHX 1PK1B 1N2EA 5LIRA 1JIUA 4YP7A 5DM1A 4KKXB 4DLNA 1CUGA 1IUKA 3ZCXA 5TQ0B 1U8YA 1EQAA 1NLUA 3H9JA 1XSNA 1KDRA 2QTBA 3UMCA 5K3FA 2ZPTX 4RADA 3M1YA 4LFBB 3E84A 5TMBA 4RPHA 2WJ3A 4RTMA 1I1HA 5MDHA 1U0OC 3BEDA 3PJDA 3SC2A 5IIIA 2ZWMA 4D02A 1XMOB 3ZI0A 4M88A 4ZEVA 4YCBA 2ZM6B 3ME5A 4E5NA 1SFRA 2OAEA 1ZM7A 4MO9A 1M8GA 5AW7A 1LUAA 5TLSA 2H63A 3EEOA 4Q37A 5F7JA 2KV2A 2ORVA 2O0LA 4EKNB 4BU1A 1SB8A 5ALMA 3A1SA 2FEWB 1MB4A 4HRXA 2NU6A 3UQZA 5HKAA 1PT7A 3CIOA 5B2ZA 5JJKA 1UPBA 3I9V1 4LPSA 2P2NA 1FRNA 2GZDA 1DUSA 3TZHA 1KAOA 4AFNA 1H85A 1K4KA 1YUNA 3VI3B 4X5OA 2DFTA 2PRZA 3SFTA 2EIXA 3EGVA 4U5XA 4AUKA 6REQB 3W9YA 2R7NA 3PEVA 2HQRA 1KRXA 4HSEA 2F3UA 2QVYX 3DNMA 3AFIA 3FIJA 2NM0A 5CP8A 5H5JA 1T2CA 4PXAA 4RQBA 5JCJA 2Q2WA 3PC2A 1T4GA 4QXQA 2CVHA 3G2MA 1I9CA 3PQ2A 1J5PA 2OGSA 1LZLA 4DNOA 4CKCB 1WMBA 2UVRA 4FIDA 3MABA 1KP2A 5ECWA 4MAAA 3RM3A 2QU7A 4G9BA 2P30A 2C5GA 2JA1A 1DTWB 1PT9A 1P4GA 1A88A 4OSEA 3M8RA 4Y9RA 3OPXA 4Q4DA 1N25A 1GGVA 3SQLA 1DKPA 2VT3A 1UP7A 5HA5A 5AJHA 3C14C 2C2HA 2QTWB 5ALFA 2W83A 5LQNA 1RLTA 1F4LA 4BLQA 5NLLA 4G5YA 2POCA 3ZDQA 2C7PA 4EY3A 3ADOA 4QZEA 1WQ3A 4FBTA 3PLAE 2OGZA 4HDKB 3HHPA 3DDUA 5J0PA 4NL4H 1VJRA 4GXJA 3CG4A 3PX2A 2JL1A 5JARA 5ALWA 2IU0A 2J59A 4X3CA 4FDAA 3WJ2A 5LP6F 1N2ZA 2YOHA 4CUZA 2XC9A 4R2HA 4IS3A 1YXMA 4YRLA 4ZH4A 3RTAA 1DAOA 2DOKA 2FLPA 3LHDA 4TWJA 4OQMA 5IHXA 2I5HA 2P1DA 4PFSA 1GCGA 4B0OA 4JV5B 1ZY2A 4INOA 4JLBA 3W06A 1S02A 3QG5A 3PI7A 3DVSX 3A14A 2XUGA 1Q1AA 3CR8A 3EVTA 3VNUA 2O23A 2XTMA 4IGAA 3G79A 2WJWA 2SICE 5JS2A 3F6RA 4JJKA 1WKVA 3RABA 4C6TA 3O0TA 5CMLA 2Z2JA 4ZDWA 1UHUA 1TZKA 1J22A 1JVNA 4GF5A 2BCQA 1U8TA 4CLOA 1XFDA 1YJ8A 4BFSA 2R87A 4FD2A 2ZXFA 3DZIA 1VKZA 1N5IA 1Q8KA 2ZTLA 3HLTA 3U26A 4F4ZA 3UVEA 3SJBA 4GYKA 4B87A 3F8WA 2ZQYA 4N6OA 4GPIB 5B36A 5CFPA 1JFFB 2BH9A 3MUFA 2HA4A 1JQAA 1FJ2A 2XH8A 2QLFA 2GJ9A 3GLRA 3O47A 2CNNA 5TE9A 4A8JC 4E70A 3WADA 1F2VA 1N5DA 3C2QA 2FP4A 2IZ6A 1QMGA 1YJ5A 3SC6A 1W0JA 5CDYA 1NSTA 4PLFA 3KZ1E 1W88B 2FG5A 3V8VA 5CB1A 4O8CA 1N32B 2HM7A 3T1NA 1VG9B 2HD4A 1WEKA 5D2CA 2FWNA 2XDAA 2DPXA 2D8AA 1P39A 3LFHA 2OXTA 4ZVPA 2O8DB 4UCWA 3B9PA 2IT1A 3EGEA 1GT6A 4CEIA 2GKOA 3GJZA 3K71B 3P52A 2GX6A 2G06A 2JPDA 3VH3A 5AW4A 4GVLA 4DL3A 5LIPA 4CRWB 3HVKA 4E08A 2JASA 4F8EA 2VAPA 3HYTA 4G86A 4YR2A 3P8ZA 4URFA 2B83A 2R6HA 4ALLA 4YMHA 2IA6A 2PS9A 1UPHA 1X2BA 3ONNA 3L6OO 5A5GA 4DWVA 1FNBA 3I6BA 2JAQA 5H9WA 4IOLA 1GP2A 2JGNA 3B9RA 4UARA 4QNRA 2NPFA 1DEHA 4YR3A 2Q45A 3ADCA 1BE1A 4IGIA 1Y9AA 3X0DA 4C7VA 4YJDA 1WVGA 2AMVA 3GFBA 2WKSA 5FF9A 1NK6A 2CHGA 2BFBA 2G25A 4X6UA 3RIGA 1CP2A 2ZRKA 3PUKA 4RA6A 2OCBA 1Z75A 2P62A 1NZBA 1XAGA 2H57A 3Q10A 1J2TA 2ZUVA 3UTDA 1X86B 1U11A 1IPEA 3U31A 1Z00A 1O9BA 1G3IA 3CGWA 3H87A 4R64A 2H1OA 5KG6A 5FFMA 5LQCA 4Q1AA 3IDAA 3RJGA 4YP1A 3U7GA 4B9AA 1BN7A 2V03A 1RWXA 3PSTA 4RT2A 2VJMB 1XNHA 2W6JD 9ICCA 1W85A 3QVXA 1KN5A 3X2EA 2B1GA 3RNOA 1NOJA 3N0TA 4NFLA 2WDZA 4ZZ3A 3RJJA 3F90A 5FPKA 3GIDA 3TB4A 5L4LA 2ZJ6A 2Y1GA 1MX1A 2AF3C 1KMQA 1QDEA 4JC4A 5KAPA 2WAQF 4KK3A 4M2LA 4R1OA 2QT9A 1C2TA 2WI8A 4HAIA 4LFCB 3W1EA 5K3OA 2Q99A 1U63A 4RYLA 3W77A 1LPSA 5J8YA 3HLKA 3ZZTA 3OU6A 1C29B 2FWJA 4NIMA 3QHAA 3EFHA 3EXHB 2NU9B 1J0CA 4HEA1 4HWOA 1XTIA 2AN5A 1WWUA 2WVAA 2OECA 2WIGA 1YQ9A 2RH9B 1LNSA 5THXA 3ZHVA 2CMKA 3SDBA 3OAAD 7ABPA 4YCAA 3LC7O 4KV9A 1YGYA 2R11A 2ZRBA 4CKYA 1MZPA 5ALPA 3HJAA 5KWJA 4UHFA 1TJ4A 3N75A 3AETA 4QZIA 4FZLA 3CISA 2HREA 2OYSA 1PCXA 3DCYA 3MLBA 3KKMA 1CRQA 2VSXA 3MOGA 1L4GA 2Y1OA 1I2BA 3T5AA 5LXTA 4YRMA 4Z2AA 2Q4BA 1NJ5A 3D6TB 1AN0A 1U8AA 4JJ8A 5J2GA 1H2FA 4LNUA 1TYAE 4K2HA 4M76B 1V35A 1T5LA 5GV8A 4MGKR 5EWLA 4FDVA 5DB9A 3T12A 2M9NA 1M5TA 3A2MA 3P2IA 1DQPA 3W2GA 4UTVA 3ZS8A 3U9SA 1NF8A 3WQBA 1XTVA 2I6QA 1ZJZA 4ZHQB 1BEEA 1IAVA 1LSSA 1MA7A 2ARKA 3NWBA 1IIRA 4C4RA 4IIBA 2BGWA 1K3TA 1W0CA 3TNFA 4U7JA 1EFAA 4DR1B 1RT9A 1U2EA 2QNIA 1JYFA 5H16A 2HJ9A 4LY9A 1SVUA 1NUAA 4FYHA 2GUGA 4I2HA 3ANLA 4HH3C 1E89A 2W3RA 5B3JA 5TXGA 1Y3CE 3X2SA 4JI8B 2LWIA 2ZB4A 4P3NA 2FQXA 5JTUA 2BGIA 2XA9A 5CB8A 2RJOA 5EE0A 4GYWA 3W7VA 3G8DA 2C61A 1BFUA 5B5SA 2QUHA 1DEAA 2ZIGA 4D9BA 1PIWA 1N6IA 4MKZA 3UQYS 2J3MA 3N4MB 4YRTA 4HDMB 1RWOA 4FYIA 2JEYA 2BONA 2NZUG 2QX9A 2RAUA 3H18A 1MRNA 2GQ0A 5C8ZA 1UR5A 2PD4A 2BLNA 1DGJA 3IURA 1W4ZA 1SA0A 2DR0A 4UPDA 2X1MA 3NX4A 1IN7A 3HJEA 1XYYA 4GPAA 4OBWA 4LJ9A 5G0SA 4Q4AA 2KHQA 2CHUA 3WB2A 3FN4A 4F4YA 4PN3A 3QMVA 4KR3A 4MB0A 4BVHA 3R6WA 1SXJD 4MUYA 3QLJA 4E4TA 1L5GB 1J0DA 4DFKA 5DWDA 1MA0A 1AV7A 4RE6A 5BWNA 2CGEA 1NQUA 4XXHA 1BKDR 2NPIA 2VNAA 2ZYIA 5AKJA 5G53C 1ZN9A 2JFHA 5E6SB 4DW8A 2XSZA 4JJGA 2YN4A 4UNIA 3VR3D 4M4SA 4DIFA 1FP2A 5I9BA 2QSUA 2ZULA 2I78A 4O2AB 4MS4B 1KEWA 4NZMA 1IVSA 3SR0A 1MJGM 5CRIA 4Q3AA 5L3SB 1GUAA 3UHAA 3WO0A 3W2TA 5T57A 1MAWA 3B6IA 5J0TA 3VVCA 2VSYA 1U98A 3ELDA 1K2WA 3QNUA 4BE7B 2EL9A 5A3QA 4TLLB 3CLKA 4HLUC 1NX6A 3BMQA 2LBOA 5REQB 2DT5A 5KVCA 1YCHA 4LWOA 4ZK6A 1U7OA 3OOWA 3H3JA 3RH6A 3G2IA 2F44A 4KPGA 3HDJA 3JQCA 1H1DA 3I2GA 4XR4A 3HR8A 1ODTC 4BNXA 3QBTA 3V32A 1CIJA 1EBBA 4LTDA 2GRUA 10MHA 1G4UR 2FSGA 1CPYA 2NMVA 4X8MA 3PWZA 2R2GA 1JIVA 1AA9A 3DHVA 4AP5A 3D31A 4RC9A 3QUBA 4BKMA 4NJEB 3VHXA 5JJIA 3T0IA 4OA8A 2PBRA 1VC2A 2OHXA 3KQPA 4UHCA 1XDDA 1OX4A 1OV6A 4YRFA 3FGOA 3K53A 4LDZA 4NCAA 4DANA 5ABPA 5KSYA 3CZMA 5H70A 1NMYA 5A0FA 4HYKA 1GSIA 5LNK6 3FNEA 4TWAA 1EUCA 3IUJA 1JF8A 3SEZA 1USVA 1SQFA 5KKNB 3EFOB 3N53A 3RC7A 1J09A 1L7EA 2B1JA 2FU5C 1IDOA 1T9HA 4URZR 5AJWA 3TF5A 1UBLS 1LS6A 3EG5A 1QR2A 2Y9TA 1W4RA 2FMHA 4WH0A 2WSBA 4AMGA 4C1NA 1SRRA 4J0GA 5LDHA 5JAOA 4OSOA 2A0UA 2Y0PA 4CQNA 1B16A 5KQSA 4RTSA 2BAGA 2ANBA 4DSIA 3ON5A 1SUBA 3RS3A 3K1TA 2XGGA 2HMWA 3NHSA 5H83A 1VSUA 3FX2A 5EIWA 5K6AC 2Z6QA 2PRJA 1QGUB 3LO8A 4JQYA 3KXLA 2BEUB 2EBWA 1OWPA 5IWAB 2PY6A 2O6KA 1ND5A 1XZMA 3RNLA 2XKKA 1JQEA 2C4NA 4LRXA 3U7JA 4TXLA 1KEUA 1L4EA 1KR5A 4HP8A 3RYCA 3KYCB 3L7AA 4BECA 4Y2XA 1A8QA 3RGWS 3DBHA 5JI3E 4F4IA 4L8YA 3ASZA 3KAKA 1D2CA 1A3CA 2ASDA 2J85A 4F8YA 2DUUA 1QYIA 3F74A 3QLUC 2WFMA 4MFFA 4XVQA 5BXQC 1U2ZA 3LA6A 3LFUA 1RNLA 2YJGA 4BQNA 1VKNA 5ECGC 4LXGA 2J7PA 4P4OA 5AVUA 3WA7A 1MQSA 4G36A 5KTNA 2FE4A 1VL6A 2FN4A 3KT8A 1ZD1A 4NP6A 2PM8A 4ATNA 2G5PA 4F5WA 3VHQA 1JAXA 1QDLB 3DVAB 4BNFA 1GL9B 3SVLA 1O94A 1NQAO 1JI7A 4FXPA 4QQ8A 5T4EA 3JQ9C 2GZ3A 5AHKA 2GETA 2IE0A 3M6AA 2AFHB 3RLFA 1IUPA 2QL9A 3UW3A 4QXMA 5IYZB 4DLRA 3JQRA 3GEPA 4Q3KA 3LQ1A 3WX0A 1AB5A 1PL6A 5EZ6B 5DX8A 3U13A 4DM4A 1ZVKA 3Q2KA 3T5MA 3ZHCA 3WHIA 2OYRA 1URPA 2GB4A 3AQEA 2E18A 2GJ8A 2XWJI 4PXYA 3NB0A 3KHRA 2DQKA 2PL3A 2FYTA 4P0QB 4C7BA 3DB2A 4NBRA 2HA6A 2P8SA 5KT6A 2ZRMA 2ENWA 3KQNA 1P72A 1SXJE 5CCBA 2P78A 1MSWD 2ES4A 1DX6A 1A4RA 3BIWA 4R6WA 4FBUA 2J31A 5EXSA 3KTAB 1R9GA 3OLXA 3OA0A 1HSOA 4OO1J 2H3EA 3RV4A 1SXJB 2ADMA 1TJ5A 4XE5A 2OGWA 5J5VA 4BY9E 1Z4OA 5CP2A 1XHEA 1XVLA 1EDDA 5A05A 1G21A 3NDPA 4XRHA 4PG7A 2Q1TA 4Y2UA 3PI6A 5I45A 2NTJA 3MAGA 3ZGXA 5BSUA 5ITZA 4LRTB 1Y1TA 3EWNA 2WD7A 2WVJA 3LX8A 2FETA 3I5AA 3EGCA 3KAJA 1ZQ1C 3JRXA 3E61A 4FZ5A 3HO6A 3SQWA 3JYLA 3F5SA 3H4MA 4CKXA 2B5OA 2OPBA 4GOXA 5E1MA 2WAMA 9ICWA 4PTZA 1UMCB 2XUFA 1CQIB 3C3YA 3AL0C 1YE3A 2A84A 2QJFA 1GGHA 3T95A 1OHHD 1ZD2P 4JMLA 2JAOA 1ZI8A 5IZCC 1OKKA 1ECPA 2ST1A 3WYNA 3BIJA 4S35A 4NAHA 2XGJA 3L7NA 4ZT7A 5IARA 4IHJA 5J0UA 2HXSA 5U4XA 3KJNA 2XCTB 2FRDC 3ICEA 4G25A 2GK7A 3NVVA 1J0BA 1C9NA 1OA0A 3CZ9A 4ELUA 4QJIA 4G01B 2G1PA 4CZ2A 2AQHA 1VPTA 2BDEA 5ADUS 3KD3A 5G5GA 4WOKA 4DLBA 3AVTA 2EAMA 1UAGA 1ZM2A 2HJGA 2QDXA 3RYHA 4ECWA 4GRIA 2AUNA 4UE3S 1CEQA 2P4EA 4FBLA 2V0CA 5ED4A 4HJXA 4C3OB 3AFMA 4XVUA 4LGMA 2YZGA 2YINC 3CVJA 5B1EA 4MCAA 1T0IA 1JHYA 2ADOA 3VC2A 4QBKA 3Q5EA 4XZ3A 1K5OA 4DA0A 2YJ4A 2W93A 4FFBB 3PNBA 4KZKA 2EOAA 3CA8A 2GVZC 1IXKA 1NQXA 1JQ5A 2NTVA 4BTLA 3C1TA 1CF9A 2XYHA 4R0NA 3AF5A 1S2NA 4PGGA 3REGA 5BN3B 4P5DA 4HEHA 3WAGA 1EAMA 3EAFA 4ROSA 4UAYA 5J0WA 1Z0ZA 2G71A 3M3HA 3E9RA 1DCTA 2PUWA 1W1WA 1AO0A 5G4KB 2FZKA 4EZEA 4V0QA 2Z58A 3ENWA 1TA0A 5ALTA 3GUYA 1G20E 3K20A 3HXTA 1V6CA 4CQJA 3OSUA 1XCPA 2FN7A 1L8AA 5K9ZA 4JT9A 1RXSA 3FVQA 5KREA 3B3JA 3NKFA 5KTSA 1I3CA 4G6ZA 3OF3A 4F56A 2D5LA 4AL4A 1CZNA 1YHZA 1T5BA 1GG2A 4QDTA 3SJ7A 1QR6A 2MUTB 4HUTA 1SKSA 2B4RO 1PQWA 2RI0A 1V8BA 3R7LA 2CDCA 3KEOA 1U3TA 5CDHA 3RJKA 4IDCA 1Y0BA 5JH7B 4TMFA 1IBCA 3MRVA 4MZXA 1M6WA 2YFKA 3UG7A 5AKXA 3LE8A 1Z33A 2O54A 3D4NA 2UDPA 4ABTA 2Z2ZA 1WO8A 3NJ4A 4MXDA 5SZKB 2R6DA 2NZYA 2EG5A 4I4TF 4K03A 1IQPA 1V85A 2OFXA 3DTYA 1SBTA 3OFKA 3QX3A 4XDZA 5CFMA 1GN9A 3RVJA 5BYKA 4HNQA 3UZUA 3UPDA 2ZREA 3ONVA 3W8DA 2LYBA 3NGMA 1TZJA 5BSMA 2O2ZA 5SYNA 4QECA 5A9SB 2IXFA 1L6RA 4O1HA 2Q3MA 3C2LA 1TRHA 3H2KA 4ZTBA 1PAUA 1G6OA 3UHJA 5AK5A 3JQAA 4RVDA 5IKXA 2FN3A 3DMHA 4QLOA 1RDFA 5CIQA 4HMPA 1C3XA 3EZ6A 3N2KB 1SV0A 2Y0SC 5KG4A 4EGCB 9ICSA 2XICA 1THTA 5ER6A 4MCHA 4V03A 1YFJA 1ABBA 3N2YA 3I72A 3JAWA 2EFJA 4UZSA 2VAVA 1DG1G 3H16A 1BXRA 5DLQC 4WI1A 4GLBA 2A19A 4B35A 9ICFA 4FW9A 3RFTA 1PWYE 1YDWA 3KC2A 3M83A 1UAAA 1E2LA 3H2ZA 4WJZA 3MFHA 3INTA 1JQLB 2E1RA 4Z4EA 3IP5A 2VHEA 1SRQA 1ZQQA 2O2DA 4E3ZA 2H8KA 3O2QB 2CJXA 3UO8B 4LMAA 4IUDS 3ZU3A 3QI2A 4AYBF 4LHYA 3ABIA 3H2BA 1PFQA 1DOAA 4E09A 1AKUA 5AI9A 3QWFA 4DMUB 4IRUB 4LGYA 4LF9B 5F9FA 1UT6A 4QOIA 3UWKA 2UZ3A 3MGAA 3JW8A 2BEJA 5CG1A 4I9GA 2B6HA 4CN8A 3QPWA 5DHUA 1F7UA 4BFUA 3TOSA 4B45A 7ICEA 3TLYA 2O3TA 4I1RA 4IR9A 2WVGA 3DDNA 1KJYA 4HSGA 3TFSA 2LR0A 1T0PA 2ZKLA 1OTHA 2FPPA 5BUQA 4D42A 3NIDB 5E3JA 1UK6A 2LIVA 1ZNZA 3KIPA 4YD1A 4UQLA 2OB1A 3OOEA 1ULHA 2VJYA 3C6MA 1JEQA 1SUSA 2VJAA 4L7QA 3NGXA 4KQJA 1DBPA 2VA9A 3UA4A 2GN9A 3B7WA 4XA8A 3B38A 2GKGA 5HGXA 2HPZA 1Y8CA 2VYNA 2D62A 4UHDA 2ZZMA 1QF6A 4EKGA 1J21A 4PNHA 2P7IA 5J2AA 1XB2A 2AN3A 3HCBA 1HNWB 3STXA 3RUAA 3W1VA 1L5RA 5M5BA 1RPZA 1J00A 3OTOB 2HL6A 1I94B 1UDCA 4PIVA 3IPXA 1ZAKA 2KW5A 4J4HA 4QZ8A 1H3NA 2REQB 2JAPA 1PGQA 1UJ5A 3JPYA 4O25A 4ZT4A 1DDIA 3SXUB 1GUYA 2PWYA 3FAKA 2QLJA 1T5HX 3OSNA 4Q1CA 2L2QA 4RJIA 2O19A 1ESEA 4EW2A 4C05A 2GMWA 1U7XA 1XQVA 2VTDA 2HCTA 2LD4A 3O1IC 3GDHA 2WIFA 1GGFA 2ATXA 3SS9X 3ANXA 2G40A 4YXMA 2J3DA 5LD2B 4B2YA 1US8A 4OD0A 2X8WA 2QP9X 4D3SA 3L01A 2G72A 1SBQA 1ZCAA 4R8UB 3UK2A 1S5PA 4EG5A 1PR0A 1XSLA 4B7ZA 3N0XA 1FSPA 1DEOA 1X92A 3PITA 3DONA 2Q46A 4K87A 2WNSA 5KYWB 4ED7A 1Q0QA 2MSLA 5FPPA 3U62A 1SXQA 4N8SA 1SC4A 3L3BA 1BVRA 2GN8A 2XTZA 4YRCA 3IP9A 3LX6A 5HPYB 3SQIA 3ZGLA 1X66A 3ZG6A 4EY6A 3N7AA 1NW9B 2UXBB 5ALRA 4NXZA 4UQGA 1EWVA 1BXGB 3LYHA 4DDWA 3P2KA 4RMGA 1AA6A 2AYXA 4ZV4A 1QV6A 3DBLA 5JROA 4HUJA 4Q03A 1CX9B 3FWZA 4MRMB 2ZIEA 4YMOA 4R8SA 3QFFA 4OLBA 3RB4A 1H8HD 2KPOA 5K0NA 1AUOA 4JUCA 3EPHA 2CNWA 1X1DA 4H7JA 2BW0A 1PNOA 4RHCA 3ICVA 4F97A 3DKRA 2OQIA 5F3XB 2QU8A 3DZKA 1TTPB 1UJCA 1LPOA 3JPTA 1QBGA 3FYSA 3T3HA 4WGGA 2Q3EA 5EP3A 2KFZA 4RJKA 3HDTA 1PFGA 3OJCA 2GOYA 3V7LA 2F3PA 5ICCA 4ZEXA 2P9JA 4EQ6B 2XCQA 2B4QA 1I4LD 2NZXA 3T7KA 2OCAA 4US2R 2ZB3A 2H1WA 4ZOCA 3FPFA 2C98A 3NFRA 4DNQA 3SC4A 1T9AA 1SBCA 4G0OA 5DIFA 3GGDA 1NG9A 4YFKA 4GM1A 4Q1FA 4W6ZA 3VU0A 5JYBA 3HXKA 2VPZA 1UF9A 1P2UA 2QW1A 3Q6IA 3FHCB 2GBLA 3N70A 3O8CA 3FJ1A 1Z7GA 2R47A 1BJRE 1ZA2A 3ZHUA 2JHAA 3PENA 1Z8NA 3M6LA 3MWEB 5A4KA 4M9UA 3TOZA 4F8JA 2E8OA 1PQPA 1FQJA 4BUJA 3KHLA 1K0UA 2AOUA 3RS9A 4RNMA 4KIFA 3NKVA 3HCWA 2AQ8A 3ICOA 4UOQA 4JR1A 3VYRB 2ZWOA 7ICSA 3Q7QA 4LMRA 5ERYA 4C8LA 1XLTA 3F2IA 5EQTA 4W4TA 1RPLA 2XXAA 1V1MA 1GM5A 3GAMA 4Y98A 3TGLA 1GT91 4C6RA 2OV6A 3CRVA 1WV0A 2JK1A 4KMMA 1Z8HA 4DCMA 1Z0SA 2YRWA 1BO6A 1XCMA 1VLQA 2M1ZA 3TSAA 2PUEA 1H2XA 2ZSBA 4A6EA 1LWNA 1TJYA 3E7PA 1R4AA 5IVHA 1QU3A 4XGIA 1H2ZA 4UW9A 2BGUA 1EJ6A 1GIAA 3A7EA 2DHDA 2WFLA 1OZ0A 1W1IA 1SKWA 3X1YA 3SIRA 4IQWA 3LUFA 4OAQA 5T67A 4W5TA 1Q1EA 2Q3HA 3CKYA 5L3VA 3RAEC 1S4MA 5B3AA 4QPJC 1P1FA 3N2EA 7ICLA 1YR1A 3VNQA 2XE8A 4TM8A 3WJ7A 1Q95A 3MTGA 3IVCA 2O2CA 3DL2A 1CD5A 3M4NA 4EPVA 4JT2A 2IKSA 1GZ4A 2BEVA 3B5EA 3TUZC 3EWAA 3B1XA 1VL5A 3E81A 4Q9DA 4C01A 1BPBA 3GJ4A 3WR5A 5CA1F 1G55A 8ICCA 1DOQA 3LBNA 1GA1A 3CR3C 5HJ5A 2GASA 5GINE 1F0YA 2PT5A 2KP7A 3GV5B 2XMDA 3M9WA 1R5OA 4HVAA 3AI7A 1E2UA 5I3CA 3ASYA 5FPYA 5P21A 1M2EA 2XYRA 1N6HA 4JBNA 4GUDA 4FGUA 4QWBA 3V55A 3N8IA 1YJXA 4QUEA 1JG2A 1BPEA 4HQFA 4JEUA 1XVIA 1PW5A 3PNSA 1HF3A 4DSOA 3EY4A 4EEZA 4PQRA 4DLPA 4Y2JA 4KLRA 1JXQA 2ACEA 2W6ZA 3VSDA 4ZKEA 3ROGA 2VRCA 5K6TA 3NALA 1M1NA 3R24A 4K9OA 2P5YA 3Q3HA 2I2CA 4M89A 3EVGA 3EASA 4XGRA 1DUIA 5C8YA 3QA3E 2G09A 3ZLUA 3ZZMA 4P36A 5DTQA 4PAQA 3WBFA 2OV8A 4L5BA 1L8XA 2LM4A 3GI1A 1JB9A 3E9QA 2UUPA 3N39C 4WIAA 3ITEA 2XMSA 1SOUA 4K6CA 3H75A 4YAKA 4GU5A 4B5LA 3LM8A 3DP7A 3R41A 1ORTA 4ZD6A 4CFSA 1KFCB 2ZSFA 4IDQA 4X1OA 1OF1A 1RPNA 3IDWA 2IUUA 2JA2A 3BZWA 4KGZA 1KJ8A 4JOCA 4X97A 2QTAA 3HR4A 4WACA 5K8VA 3ABSB 1YI8A 3OI7A 1RQXA 5K99A 1KY5A 1CE8B 2NXWA 4DRYA 3Q9LA 3V4OA 2Y1FA 1XRMA 3OZFA 2JFWA 3RJHA 5J40A 2WYIA 2WA2A 1KAEA 3HWTA 2LBPA 4P4SB 4BX9C 2CLDX 4JUBA 3L5KA 1YFKA 4GWKA 5FUMA 4ZAXA 4FMCF 2QTMA 2ZE6A 3DT9A 3VDRA 4AJEA 2IDJA 1C0KA 3C39A 1EGVB 3PP8A 4KMUA 4GSLA 1K7EB 4DDVA 3U4QB 3QKRB 3VBCA 3AWIA 1FRQA 2QK4A 4OIFA 3GV0A 3RREA 2DFKB 2L17A 4EO4A 1RHMA 2XJ4A 2GZMA 2BQRA 1ZQXA 2QARA 1ZXIA 1JLSA 5CLHA 5DB8A 1YJAA 4DR2B 2XGQA 2HHCA 5HZHA 5H3LA 1ZGAA 4KPYA 1ZW1A 5BOSA 3CPHA 3JZFA 1K7SN 2B92A 3ISBA 1V5WA 4OHXA 1D1QA 2O8EA 4MEXA 5K0LA 4DA7A 2RK4A 3KV3O 1J8QA 1QQAA 2X2PA 3L05A 3ZIAD 3QUTA 3PPWA 2LYAA 4CIXA 5EIAA 2O14A 4DTIA 3E03A 4DDTA 4O08A 1QLNA 2Q9AA 5JQGA 2ESRA 1E1LA 5FV4A 4PRLA 3MNFA 3W5CA 3DEFA 2D7JA