3QUQA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, an open cap conformation
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
225
structure length
225
Chain Sequence
HMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 83
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3quqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3quqA01
4EX6A 1RDFA 3ZTYA 4Y2RA 4NWIA 4BYGA 1TJ4A 1RC8A 2WF6A 4CF3A 2ZBDA 3MC1A 4F71A 5AI9A 1Z5GA 5AM4A 1QQ5A 1NF2A 5AW3A 4KX3A 1LVHA 4Y2JA 2DQSA 2HF2A 3OCXA 4JB3A 1T9ZA 1RMTA 4UATA 2D2VA 3MN1A 2G1AA 2MSNA 2OBBA 3AR4A 2R8XA 4YGYA 5IS2A 3L8GA 4FYPA 3DNPA 2NYVA 3L8EA 4IG4A 3W5CA 1VJ5A 3L0CA 1Z4PX 3MPOA 2HX1A 4BX0A 2QLTA 3U7GA 5AKXA 1YS9A 3UMCA 4HGNA 2FI1A 3FGOA 2OYCA 2WM8A 4C4TA 2EARA 2W11A 5AVYA 2O2XA 4UAUA 3R4CA 3ED5A 3U7FB 3OPXA 2C8LA 2C8KA 2FUEA 3B9BA 3FPBA 3KBBA 2YMPA 1ZJJA 2RAVA 3QXGA 3HLTA 4Y2QA 1RKVA 5AVQA 5AW6A 3AR3A 4YIKA 2R8YA 3NIWA 4XE5A 4E88A 1Z4OA 1KYTA 5AKLA 3W5BA 1Z4KA 3ZWKA 3ET4A 5E0OA 2Q4TA 4BX3A 4EEKA 3ZVMA 5AM5A 2FPRA 4GIBA 1VFPA 2B8JA 3L8FA 3S6JA 4YCLA 2ODAA 3SHQA 2CFTA 5AVZA 4XQ0A 2IYEA 1SWWA 3ZVNA 3E58A 1YMQA 2MU1A 1Y8AA 2JARA 4NABA 4QQFA 3L0YA 3ONNA 4ZEVA 1MH9A 2HDOA 2B30A 5AW7A 1Z4NA 3E84A 1YV9A 1J97A 2HF7A 3WK9A 1XPJA 3QU2A 4DW8A 3FM9A 4UMFA 3U13A 4DCCA 3RF6A 1RRCA 3R9KA 1LTQA 5AVTA 3QNMA 4H1WA 4UMEA 4I9GA 3FZQA 4OD0A 2ZXEA 2PKEA 5ALUA 2GHTA 3U26A 3DAOA 4L6CA 5ALRA 4MUMA 3SMVA 2HOQA 1J8DA 3WK7A 1XVIA 3EF1A 3ZWDA 4UARA 5AK5A 3TLMA 5AVSA 1EK2A 3QLEA 1RPZA 4EX7A 2AH5A 3QGMA 2HSZA 3FPSA 2CFRA 4GXTA 4Y2SA 2YJ4A 2YJ5A 4CNQA 5JJBA 4NAVA 3U19A 4QJBA 3BWVA 4O8CA 1L7NA 4UW9A 4JDPA 3WK4A 2GMWA 5ALVA 4BEWA 4UM7A 3B8EA 4BEVA 3A3YA 2NO5A 3NRJA 4KYTA 4HGPA 2EAUA 3AR5A 3WGUA 3ZX5A 1L7MA 2G09A 5AW0A 3QU7A 2FPXA 3QYPA 4Y3UA 4YCNA 2AUTA 1U2TA 4NFLA 2EATA 1Z4MA 2WHEA 3WKDA 4PNHA 5AK6A 5ALMA 3NALA 4NV0A 5ALJA 1L8LA 2AGVA 2YMLA 3W5DA 3EWIA 3OCYA 3KOOA 2I6XA 4UAVA 5AW9A 1QQ6A 3WKAA 3KDPA 4Y2TA 1T5TA 1RKUA 4ZEXA 2G06A 2IA5A 3QX7A 4OCZA 2W4MA 1K1EA 3F9RA 3ZX4A 3OTQA 5A3QA 3NUQA 5AKIA 1WPGA 4YH1A 2YY6A 1NRWA 3FVVA 5T41A 4BKMA 2HHLA 3QU9A 3WKBA 3NANA 4EENA 1WR8A 3DV9A 4HGOA 2RBKA 3WK6A 3RFUA 5ALDA 5AHXA 5AW1A 3PGVA 3SLRA 4UM5A 3KZXA 3ZUPA 3I76A 5ALZA 5ALXA 1ZD5A 1SU4A 1WZCA 4KN8A 4G63A 3N28A 4L57A 2P69A 5IT0A 1TE2A 5AM2A 5ALQA 2RB5A 2NO4A 5AM3A 3AR8A 1IWOA 3WK5A 2FDRA 4CF4A 2OM6A 3OCUA 1RQLA 1ZRNA 5AVWA 3L1UA 1RKQA 1Z4LA 3L0BA 5IT4A 2GO7A 5ALOA 1YDFA 2Q4RA 5AESA 2I34A 3QU5A 2JAOA 4AP9A 1Z5UA 2I54A 4L6AA 5AM1A 5ALWA 3UM9A 1RLOA 3B9RA 3AR2A 1TA0A 3I1YA 4HAIA 2JGAA 4RETA 1TJ3A 1YNSA 3A1DA 4B6JA 3QU4A 5AICA 5AK4A 3L1VA 1RLTA 2CFSA 3QUCA 5AK3A 5AKZA 1ZD4A 1CR6A 2BDEA 2IOFK 4G9BA 1RLMA 4YCMA 3J7TA 1QYIA 5ALSA 1N9KA 3KC2A 1X42A 1U2SA 2YJ3A 1F5SA 2G07A 1Z4JA 3E81A 2C4NA 2CN1A 2C9MA 4OFZA 2PQ0A 4KNVA 3I28A 2BDUA 4KNWA 3D6JA 3W5AA 2O9JA 3M9LA 1JUDA 3WK8A 5FP0A 2RARA 2HCFA 3ESRA 3QUQA 3GYGA 3SKXA 4UMVA 4BNDA 3WGVA 5AKEA 3P96A 4FFDA 3AR6A 3EF0A 4XPZA 4EZEA 3KD3A 2GHQA 4XOUA 5A3SA 3U7HB 2BY4A 5AW8A 1S8OA 4MWOA 2B1RA 2HO4A 2WF5A 3N07A 3N1UA 3QUBA 4AS2A 5ALYA 1FEZA 3CZ4A 3N5KA 5AI0A 2ZBEA 2FPWA 4J03A 4BNDB 1U7PA 5AVVA 3NAMA 5AVUA 4Y2YA 4HGRA 4EELA 3QUTA 3WKEA 2P9JA 2R8ZA 4YIHA 5ALFA 2JAWA 4OHFA 1Q91A 4CE6A 3IB6A 2FPSA 3E8MA 3BA6A 5AIAA 4BBJA 2P27A 2HI0A 5AKHA 1L8OA 3L7YA 3ET5A 5ALEA 3UMBA 5AW5A 2B82A 1T5SA 3I6BA 1RQNA 2JAUA 2WF7A 4UU0A 1S2OA 4HGQA 1Z88A 5ALTA 1U7OA 4HYTA 1ZRMA 2Q5EA 4C4RA 1CQZA 1O03A 5ALGA 3L8HA 1WVIA 4UMDA 3NASA 3K1ZA 2VKQA 2FUCA 2X4DA 1VJRA 3ZW7A 2MU2A 1U02A 1RMQA 2YFYA 3M1YA 3SD7A 1ZD2P 4FE3A 3ZTWA 2FPUA 3HYCA 5AW2A 5AKGA 2B0CA 4C4SA 3L5KA 5AI8A 2B8EA 3SF0A 4BX2A 3IRUA 4AS3A 1EK1A 2B1QA 5ALKA 4F72A 2ZBGA 5AVXA 3DDHA 5AI5A 3IJ5A 3CNHA 1QQ7A 5ALIA 1YJ5A 2YN4A 2P11A 3UMGA 2AMYA 2C88A 2HEGA 4J2TA 3SKYA 5AKYA 1ZD3A 5AM0A 1L7OA 4IFTA 3U7EB 3PGLA 1L6RA 5AVRA 1Z4QA 4UASA 2YMMA 3AR9A 1L7PA 4RESA 1SWVA 5ALHA 4Y2VA 1TJ5A 2IOHA 3OCWA 3ZI4A 2PR7A 2R8EA 2FEAA 5ALLA 5AI4A 1Q92A 5A3RA 2YJ6A 3OCZA 2WF9A 2YBDA 3ESQA 4UU1A 2YMQA 1QH9A 4Y2UA 3R09A 3A1CA 5ALPA 5AIBA 1N8NA 1RMYA 2WF8A 2QYHA 3N8GA 1AQ6A 3AR7A 2G0AA 1ZS9A 3EPRA 2G08A 2ZBFA 3PCTA 4CF5A 4Y2XA 2ZOSA 5AKJA 1PW5A 2ZG6A 2WFAA 2OA0A 3ZVLA 5AKKA 2I55A 4DWOA 2W43A 4KX5A 4ZEWA 3VAYA 3PDWA 3MMZA 4Y2PA 1XP5A 2IOFA 5AI6A 5ALNA 1NNLA 5AW4A 2GFHA 3A1EA 1ZOLA 2G80A 1Z4IA 1O08A 3WKCA 4DFDA 2I33A 4I9FA 3OCVA 3ZU6A 2I7DA
chains in the Genus database with same CATH superfamily
1E5TA 2Z5LA 1X92A 4WCFC 4QKQA 1MDFA 2VF4X 1P74A 7REQA 3IAHA 1LKYB 2IEIA 1NIPA 2MSWA 1MX3A 1W87A 3WYFA 4P38A 3QQPA 1VCOA 3GN1A 3CRVA 1YGYA 3X1WA 4HUQA 4R0VA 4CXMA 2PWAA 2OV1A 5LCXA 4TLCA 1LTKA 5IIMA 3Q3VA 4IOJA 1KL7A 1MB2A 1NF2A 4RHXA 4WK6A 5JW6A 2GPBA 4S1PA 5MGBA 4UREA 1FTYA 3GQBB 2Q9CA 1YH3A 5ELXA 3QITA 2WINI 4FGKA 5L4SA 2FH5B 1NF8A 3HXQA 1MOPA 5LZ8A 2O2CA 2G36A 3D8UA 4PZUA 2DXIA 3H0MB 2ZCVA 5JG7A 1R8QA 2JGDB 3DNPA 1RCTE 2YL2A 2ZAMA 3NPAA 1H5NA 2FWMX 2JI6A 2ZSDA 3PT5A 4B43A 4CM6A 3I1FA 3MPOA 2XT6A 5TEVA 1Y6FA 1VIVA 2OWEA 4OQ4A 2IZ1A 3ZBQA 3U7GA 5AKXA 7ICUA 5GJWC 2C1ZA 5IAKA 4H7JA 4HAOA 1P1JA 2FPPA 3ZXUB 3CIOA 4MJ3A 2I1WA 4E2WA 2GJKA 4ICAA 3BJRA 1T1JA 1ZM2A 3EJ6A 2IHKA 1PQPA 4JXZA 3L77A 4MS3A 1QWSA 2ZJFA 2F9LA 2JFNA 4BY9E 4KODA 5DHTA 1RPAA 1Y1QA 2C5EA 3FPCA 3OTWA 1T5IA 4L22A 5C18A 1V6CA 3U61B 1MRNA 4LWQA 5AUQA 1Q1GA 2WAMA 4DVGA 3QP9A 2XD9A 3STXA 3KBBA 1YRYE 4D9CA 3D5QA 1ZMOA 4EG6A 1Y8QA 1N9GA 2J31A 3QKRB 1JIKA 3TIXB 5CT4A 2QLJA 1TM4E 3O8OA 4CDGA 3OKCA 4A8JC 4DA7A 4RVDA 3U4GA 4WASA 2OUKA 5I4KA 2ZIFA 1RQGA 1E1MA 4KSCA 4RPYA 3L06A 3QOXA 4X1IB 4Z2AA 1UKZA 2W2KB 5JZSA 4NJEB 4HCJA 3ZZNA 4V02A 3KX2A 5ILGA 4OSEA 4LXQA 4BX3A 1FNSA 2C77A 2NN3C 2JW5A 2QE7A 2VRBA 1CY6A 3AOEC 3Q7TA 5DF1A 5ENVA 3FJOA 3P8ZA 1P6UA 4RMHA 2H2HA 4Z3DA 2PJZA 1BS1A 2Q0SA 2WVJA 1FXUA 5IJ9B 4EHJA 2KSOA 4QZBA 4NHEA 4RMJA 1Z6AA 2BR3A 2ZR0A 3P9KA 5DWQA 5AVZA 1YE5A 3SQNA 1JMKC 2X1MA 1I6WA 2JARA 1XK7A 3RUPA 2C2XA 4X7BA 4G1MB 3IA2A 3II6X 1LS1A 1A96A 4N40A 3AIKA 4PFKA 3LD9A 4BLSA 1DG9A 5KX5A 4CEHB 3NEAA 3IDOA 4YRJA 1G5HA 2PZAA 3THWB 2Y1IA 1F8YA 4KXLA 2AXNA 3D02A 4KQFA 3SR4A 1MB9A 4M0FA 2XNCA 3NBZC 3SOZA 4AZ0A 2Y66A 5BMOA 1EE9A 4O3QA 3KB8A 4Q45A 4NCNA 3COSA 3HBNA 3CVOA 1TCCA 1M5TA 2BFCB 2DP4E 2IYFA 1ABBA 3V6MA 1OIXA 2FPMA 1Z45A 3BL6A 1ZR2A 1XYGA 4M9LA 3ZD8A 4AN0A 4Q3NA 5AVTA 2XOXA 4RUAA 1NE7A 3R40A 4M0MA 1I5OA 4RD2A 3ZH2A 3EFEA 4JELA 4HXGA 1FS5A 1P3Y1 2CXHA 1M1XB 2A92A 2HGZA 2XWQA 1PBNA 3QXSA 4UTXA 4ZZ1A 3GGPA 4LOLA 2DM6A 3NBFA 3E5NA 1UMBB 2PX8A 3IQDB 4LVNA 4LDJA 4CQMA 1F38A 3F74A 2I71A 3E9EA 5BNZA 5JYDA 4G0UA 3R3SA 4BFXA 5CX1A 3WGNA 3SMVA 4DGSA 3NTVA 3RNOA 1J8DA 1RXIA 1N5XA 3RB0A 2C8JA 2P9HA 2IWHA 3ZU5A 3MGGA 2QTRA 3WHIA 1BDBA 4ND7A 4DCOA 1D2MA 3UKOA 2DX7A 2WSSD 3JQCA 4NICA 2H0RA 3SR6A 1OAOA 4UCWA 2VAWA 4XKJA 5DO9A 4BAGA 4ZJPA 1V9PA 4DOBA 2IELA 3MUFA 3REOA 2XZOA 4EHDA 4LOJA 4N0DA 1T1GA 2C9OA 4BNTA 4EPXA 3IT1A 2OXCA 5LVAA 2XVYA 2NRZA 2IYRA 4V1CI 5J2DA 1N33B 2GWHA 1SV0A 2PBZA 4Q3OA 1BWSA 1WZNA 2J0VA 2WTAA 4UCQA 2GX6A 4I5FA 5ALVA 4C7ZA 3A14A 4HXEB 3HKZF 3V7KA 3ZZTA 2ZSKA 3R0VA 3OM1A 1Y7IA 4G85A 2NUPB 3RHFA 1AKRA 1LJUA 1X6VA 4OJTA 2I66A 4WTOA 5E6SA 2GBGA 2JLSA 3HR7A 4YREA 1DKNA 2GZ1A 2H3HA 4QZDA 1CZKA 4EF5A 2QGFA 1ABFA 2QU7A 3UQ2A 4XWOA 3VDNB 4ZCPA 4ZMBA 1SC4A 2ZRNA 4HNAB 3OHSX 3O26A 4LOHA 4I2IA 3GJTA 2G82A 2OCIA 2HADA 2HDNB 3WKDA 3RG2A 4D7AA 1DARA 3GUVA 5AK6A 1QDLB 3L4EA 4M86A 2AXEA 2O50A 4ND1A 4XWYA 5DM60 1NJ8A 1XDGA 4KMSA 4BB9A 4PG8A 1H1TA 4IS3A 1ATIA 4NBRA 5E79U 2Q27A 4L73A 3C21A 4E4TA 4PANA 2Y05A 1DKUA 1UC5B 1Y88A 3AV3A 3KDPA 4BP9A 1P81A 1X9MA 4OA8A 1QIJA 1I7NA 2OOKA 2PMWB 2J3LA 1U80A 3EEYA 5F73A 2G06A 4LHZA 3VKVA 1I7LA 2BEVA 4Y1EA 1ZQVA 3ITDA 4DSAA 3STUA 2ZDHA 1XSNA 5THKA 3T9CA 4CG1A 3NUQA 3CLTD 5HS6A 1E9AA 2OESA 3ONDA 4BO6A 3CXRA 2KBFA 3COVA 1IN1A 5LR6A 4K9LA 1P62B 2HMWA 1JEAA 2IP4A 4FMDF 4V0QA 4YR9A 1WCWA 2XA9A 3F73A 2J3MA 1RWPA 4RPIA 1WRBA 4B4WA 1BEEA 1L5VA 5EERA 3KG2A 5DGAA 2CRXA 3GV7B 4NCHA 4WKBA 5FYQA 2XUZA 4AKGA 3DMTA 4JBLA 4A03A 4P0QB 2YIMA 3C4QA 4RZUA 1NQUA 4MCHA 4ZREA 1BXGA 4YQWA 2G6BA 3PX3A 2DKOA 2E89A 3ELDA 3L4SO 4HTAA 4KWHA 1KTVA 1ADJA 1XZ8A 2N0SA 4RY0A 4EATA 2JJMA 5LQJA 3QH4A 2HSGA 3ML1A 2QTLA 2ZXHA 1LPMA 4TUYA 4YCSA 3VVLA 1SIOA 4WFJA 4Z54A 5ETJA 3HUTA 1K8ZB 1ZPDA 3ND6A 1OXMA 1NL3A 4QRIA 1KEPA 5TGTA 3V1NA 1ZC3A 2CJWB 5KFPA 3BN3A 3QENA 5B3KA 1U4OA 4L3VA 1UHUA 1E7WA 1IAQA 3VU3A 3QVGB 1UM9B 1T2NA 1ENYA 4PYKA 3SM3A 5MF6A 3T5AA 5J2AA 1RVDA 1HETA 2NW6A 4E3WA 7ICEA 1ECCA 2AQHA 1AF7A 2YNMC 4DVJA 4CIBA 3H1GA 5ALOA 2HF8A 1A76A 3P2JA 5CWRA 1URPA 2O8FA 3PQ8A 3EX7C 4JLVA 1E66A 1GPH1 2JAOA 1J0AA 2ZQZA 5TXGA 1AKVA 4BRUA 3UH0A 4ENQA 4Q4AA 1UKEA 1UR5A 3INRA 3O93A 4PWZA 4RL6A 3UFXB 4CL0A 4BQFA 4IDEA 2Q1YA 3B9RA 1D9FA 4B5LA 4MP6A 3R3YA 4RETA 2C82A 1TJ3A 1Z62A 3FN4A 1FE8A 3FPEA 1FNDA 2FMPA 1P5HA 4NJ8A 3MOIA 1AUXA 4LISA 4OXXA 3OKPA 4WJ3B 2HCTA 3PD0A 4HYYA 2QRNA 3DWIA 4DRYA 2LM1A 1TK2A 4F3YA 1IOVA 5DKWA 2UVPA 1ZIDA 3BIOA 4IOMA 2QD3A 4LF7B 3G7SA 3OPYB 1K1SA 3NGDA 2QOEA 5L53A 2YDXA 2W4QA 1H1LA 2ODEA 3KEMA 2QX9A 3LO8A 5D8DA 3CX7A 2OILA 5KOIA 2BTQA 4A0FA 3IAXA 4EYKA 5KQLA 1FTQA 1LQTA 1PZXA 2H1WA 3D5EA 3FLBA 4OGKA 1XE3A 4WZAE 1KDHA 4D8XA 2DC1A 4B9TA 3ECCA 4I1OA 1XD8A 1MD9A 4UBCA 7GPBA 1HDGO 1B76A 4Q3LA 2QRHA 1O0BA 1N62A 1DT3A 5CVEA 5TQJA 3ZI7A 4CIVA 5BV8A 1AXGA 4W9NC 2W83A 2PZBA 4TKVB 3PC3A 4DQSA 3F5MA 3FYUC 1BYUA 1ISHA 3IR6A 4TYMA 5BSRA 3KM0A 2IYWA 2JHPA 3RTCA 1PYDA 5CM9C 2B8NA 1Y8ZA 1RFGE 2C3PA 3I6MA 3H18A 5FA5A 1KYQA 4KAJA 3VR4H 4AJ2A 1O54A 4W5TA 4MP8A 5FP0A 3P9RA 1ML3A 3ZVKA 1GA4A 2ET6A 1H93A 3MYRA 1AJEA 3E8XA 1E6MA 3TIFA 4XD7A 4RENA 1ISFA 3V8MA 2ZVPX 2QDXA 5EXPA 3ZV4A 5KOJA 2JRZA 1N6LA 2B4AA 4ZU6X 2D6FC 1V1JA 1QH1B 4UBKA 3P96A 4UZSA 4YMNA 1T91A 2VI5A 4TWJA 1XS9D 5HKAA 4XOUA 4ESHA 1IN5A 4DSLA 4UFPA 2FN3A 2A5LA 3KPYA 2KIVA 3E1SA 3JALB 3AUTA 4MH0R 3G85A 3UMSA 2PKWA 1B16A 1JDSA 2W3SA 2C94A 4B9LA 4DSKA 3V3KA 5C1BA 2VG8A 4WH0A 4DDMA 1KJWA 2JJ8A 2WT4A 4ZO6A 1U2EA 2O8DA 2DECA 2VSQA 3R5JA 5EJ4A 2VPTA 2W8LA 3O4RA 1C41A 2JKVA 1NKEA 3BDPA 3BVPA 2GBLC 3B9PA 4LRXA 2YH2A 4N5LA 3WYCA 1TQ6A 5FBVB 1P0CA 3PL1A 4FB4A 3LIPA 2OZKA 1O5OA 2ONKA 5EKDA 5EP4A 4YUXA 4W9MC 4L5IA 3BGIA 3R8XA 3LYAA 1BJRE 4NENA 4TYYA 1KI8A 4GUAA 2QN1A 5KVCA 5LSAA 4PX3A 2J5KA 3WGLA 2FF7A 3PA8A 2V4UA 5HXAA 1P29A 3OZGA 2X41A 4Z4CA 3WADA 5TRTA 1X1SA 4MF8A 4KLLA 3TX2A 4AKIA 2LMRA 3KQLA 2BEWA 3I8OA 5T6BA 1V4NA 2XMZA 3DEIA 2PD4A 1QFSA 2JK0A 2FY8A 5FWYA 1XDZA 1ZOPA 1G20A 1PQ4A 3GRPA 5JXHA 4CFSA 2XOKD 3GLHA 2I6UA 4FLMA 1Y63A 4IEIA 3C45A 3FFXA 9ICHA 4RANA 4EQZA 1IPHA 4FVTA 5A4MS 3IV7A 1GXSA 4QYTA 4CI9A 1JR3A 1KVQA 1RRMA 5EXDA 4CKZA 2OC4A 3K8ZA 3EEIA 1Z38A 2ZIWA 4DA0A 2CZGA 1ZQKA 3K9QO 3N6XA 3U80A 1GTMA 1KAGA 4GBGA 5F5NA 1JVSA 1O03A 3AM4A 4EFMA 4QATA 5BN4B 4FS2A 1PR4A 4YN4A 3ABRB 1Z2PX 1QFJA 1E0KA 1Y8CA 2W2OA 3OOHA 1WB4A 3D6AA 1H2ZA 3K5HA 4M98A 1KE2A 2FUCA 2I22A 3UJ9A 3K0KA 1VLQA 2WWWA 2HEIA 1HOTA 2QRKA 4G5YA 4H1HA 1KI7A 1ZNQO 2NVBA 4PAWA 2CVFA 4ZAZA 3OAAA 1B6GA 1RWNA 4AW9A 2JIPA 4JBHA 5JROA 1K92A 1B74A 1GITA 3GFGA 3OPQA 4AJ1A 2XRZA 2VJMA 4PFQA 3HYCA 1I4OA 3GLGA 1PJRA 4CR8A 4BIMA 2BMJA 4QRHA 3RTVA 3ORHA 1ZIYA 2QZ4A 4M2YA 5ERGB 4EITA 1W5FA 3TWOA 4AKEA 5CFMA 4Q8EA 2BD0A 1YONA 2DR0A 1P1IA 3EY4A 1H2RS 4TV9F 1U5BB 2GZSA 3SJUA 3KJQA 1XO1A 2YV5A 5K7SA 1XUOA 4YR2A 1Y5NA 5C1DA 2ZBGA 4HB0A 4QULA 1DOAA 3PQ6A 4XLTA 3DW1X 1L5KA 4RKYA 3CUTA 5G41A 1W75A 1VB5A 2A7QA 3FWZA 4UE6A 3L4BA 2P11A 3EXFB 2PX4A 1ZETA 3PCRB 3I04M 3L7JA 4MIKA 4NOLA 4ZOLF 5BSEA 4YR0A 9ICGA 4MV5A 4Z99A 2KE5A 3T35A 5L1MA 2D3TA 2DT8A 3IV9A 4Q4JA 2JAQA 3AONB 3OT1A 4KWCA 4X44A 1C20A 5DN9A 1S3GA 1ZQZA 2DPJA 5KU7A 2DSNA 3CLTC 1V8FA 5H4HA 3W05A 2PX6A 1GXSB 4R2HA 3TXAA 2LDBA 1IZ0A 2W7TA 3LU1A 4F6RB 3QSGA 2AOXA 1MO2A 1I3OA 2QPAA 1GZUA 4J0CA 3DFKA 4P93A 4IDGA 5EJGA 3Q7EA 2ADOA 4BGEA 4BNZA 4F5NA 2FUG6 5CW1A 2XQFA 3UB3A 1BXRB 3CEHA 4YT2A 9LDTA 5ALLA 4YHHB 4C5BA 6CHYA 2W70A 3QW4B 1HV8A 1TUIA 1WDMA 4UU1A 1QH9A 2YMQA 3R09A 4B47A 1Q6YA 3HPOA 1QAOA 1RMYA 1W9HA 2A1UA 2FZKA 2PKQO 4OGFA 2G0AA 1NXWA 2A9FA 3EVAA 5G4LA 1SUBA 4ZIRB 3UANA 4H7PA 3VVMA 4FFWA 1P45A 4D5GA 4KTTE 1AURA 1XHEA 2WFAA 3PX6A 2PBRA 1VCMA 1HF3A 2Q99A 1K7EB 1TQDA 2Q7XA 4QXOA 4ZEWA 3U7QB 4BNMA 2HU8A 2O8NA 2Q0QA 1I2MA 3LYHA 4Q4HB 4XTRA 1Y33E 3AJ9A 4NBTA 4RPJA 4TKUA 3WL7A 1RPJA 1BE6A 5AI6A 1E6KA 1RIFA 2I4RA 3LCRA 3NM5A 4JZKA 5FIUA 3ZDFA 1ZQSA 5LFAA 9ICAA 3O4GA 4Q19A 4KFUA 2HD4A 1ZOLA 2G80A 2XI4A 4PYNA 5A4IS 5K45A 2NSYA 1Z4IA 2EZYA 3Q0IA 4K3VA 1SXJC 1VYVA 4G5RA 4CEIA 5C4IA 1UPAA 4TKMA 1DTSA 3B6MA 2XOEA 1R6AA 5AVJA 4YAOA 2BUCA 3LWBA 4N7MA 1M0SA 4YJ2B 4CQLB 4CR7A 3N86A 1A7AA 3MD9A 4KITB 2OOSA 4Y30A 2HREA 1KQFA 1AF4A 1SCBA 3QVTA 1AS3A 5HCUA 6YASA 2JASA 3TB4A 5L9AA 4XLLA 3RRMA 4KNYA 1MG5A 5CPFA 3UJDA 1SQGA 2IUTA 4BXOA 2JGKA 2GSWA 2QQ0A 4X71A 5DXAA 2QQEA 3ETDA 1XEFA 1WXEA 2QJTA 3FNQA 1UBGA 4L5JA 1G3QA 2B4RO 1V6AA 3Q7IA 1SUPA 1U7TA 3WWEA 3AU6A 2I6GA 1IHYA 4TLBA 3WJ1A 1PR0A 3WRYA 3PQ3A 1P0MA 4DCMA 4G0MA 5A5FA 4RVOA 1NKVA 4YMLA 2SNIE 2BEKA 4FUQA 3TI0A 1JFFA 5E3JA 1U7WA 5KYGA 2N47A 2NM0A 4KPEC 4V2UA 2QP4A 1EEHA 1UK7A 1PUJA 1R5JA 1KJNA 1SHKA 2OO5C 2ZTHA 2CVOA 4KMMA 3RPEA 5C35A 3OJUA 5L40A 2YWJA 4FZVA 2IVZA 2O2ZA 3LBYA 2V4RA 5FFFA 1Q19A 4TSKA 4YROA 2IIBA 1Q3TA 3MGCA 4JX8A 5ICFA 4C6HA 1QVZA 5HK9A 3UB2A 1D0VA 3I09A 4N5MA 4CEJA 1VCNA 3QUAA 4RHFA 3Q4GA 4OM7A 1WW3A 4ZK6A 1E2BA 4DABA 1ZUIA 3D0KA 4FE7A 1T1SA 4F5PA 4DPMA 3QF7A 3ZQKA 5DEIA 4Z9FA 4IHJB 3N7RC 2I4IA 1QAQA 4J0HA 3DTYA 4YO8A 1P5FA 4IIVA 4R81A 2FLVA 1US8B 3VH2A 1YE3A 2NZYA 3RRGA 2YZNA 5HS4A 1J2MA 2K89A 4PPGA 4KK3A 1UKBA 4D3SA 4UBNA 4P4GA 2K4HA 3V42A 1YFJA 2NMVA 1Z4OA 2ASDA 2FX3A 3EK2A 2IGTA 3D6UA 4MR9B 3PSAA 1T9BA 1WWUA 2VZ8A 1Z4KA 3M81A 3ANSA 4IG9A 4Q47A 5TGDA 4P0PB 1XU4A 4BDPA 3K53A 3BD6A 1IUKA 1JSCA 1YB1A 4AZTA 3G5MA 4C78A 2IS4A 1E94E 1IJFA 3F5QA 4HX2A 3S40A 1RPLA 2TMDA 4O3RA 2GETA 2ODAA 1S97A 5FTKA 1P39A 2IUSA 1VLJA 2QL6A 4TXHA 4B7AA 4R71A 4A0HA 4I3HA 4EB6B 4RQNA 2MU1A 1S76D 3PXAA 1NXTA 2JR5A 1W85B 1XCGB 3B2EA 4MUAA 4PCVA 5K3DA 3OBBA 3V7FA 4BV8A 1NSFA 1T2FA 2FRDC 4XJSA 4E5VA 2ZCJA 1BJTA 3GGOA 4OFWA 1U9JA 5HVNA 4QOEA 4M9ZA 4MQFB 5AOCA 5ESXA 3SFTA 2RHRA 2HDOA 1KDVA 3B9JA 3PWKA 1SBQA 4WZZA 4QZ9A 3I73A 2OZVA 1KZ7B 3C41J 4D8TA 4UNRA 4AJHA 3BJZA 3M5WA 2AGOA 2BZGA 2XGSA 3H8WA 4OKSA 1W85A 3JD3A 5EY5B 3W5SA 2UVDA 3BPSA 4TTJA 2PD3A 3O8LA 1QCDA 3QZUA 4IKPA 4J9UE 1Z9BA 5BYJA 3F3MA 3R9KA 1A4XA 1LFAA 3GMDA 3PPWA 4JGGA 4KPUA 1IBRA 4JWMA 2JEIA 4YWJA 4I9GA 4WCDA 5HFNA 4CMKA 2P35A 1P2VA 1Q11A 2A0UA 2VWGA 1AIPA 3AVQA 3BB3A 3CWQA 2EFDB 3QXHA 3DNFA 1YR7A 4PO1A 2HCBA 3GLIE 4QZGA 1RD4A 3PEFA 5C2JB 1IBKB 4CW7A 2REQB 4RZXA 1QAMA 1JQEA 3A6LA 4G26A 5DM1A 1TMGE 1VKJA 1QQAA 3TQIA 2J0UA 2M6RA 3QOFA 2ZYUX 3QSYA 3V1KA 3IUPA 1DGQA 1HUZA 1W29A 1ZXBA 4KAAA 4YXJA 3OLXA 4OI0A 4UNIA 3GN2A 1NKTA 3IQEA 4EHLA 1HE4A 5LKRA 1QGED 1J06A 4OQXA 1WSBA 3NXKA 4K8OA 1E7QA 2W6QA 3C24A 1GFWA 4BB6A 5B7PA 2FUNB 4N6OA 3PXXA 4QJBA 2YWGA 4O8CA 4RFLA 4RLQA 7ICLA 4B45A 2FNAA 3HBAA 4ELTA 2CNDA 2CZQA 3PD1A 4TLAA 5KAPA 1TW2A 4P7KA 3SHOA 2JH1A 2DH5A 4GE3A 1VSVA 3JQAB 2EAUA 4M6WB 4JCCA 3SHTA 4E08A 3HZOA 7MHTA 5AW0A 1KMCA 3L1KA 2X6TA 2ZE8A 2DUNA 1ABEA 4W5OA 1PK9A 1Z3IX 1I3MA 2C4KA 2PL5A 3EC1A 1UFKA 1K8XB 4TXLA 4DM7A 5TJ9A 1D2EA 2ZKLA 2FFAA 3WWYA 4B3DA 3FKJA 1EG2A 3KKLA 3PNMA 4BQOA 3PZPA 1YFLA 3TANA 2H2WA 4JLOA 3DBLA 1FJXA 4U2DA 3S4YA 3ZDDA 4I7EA 1MR3F 4LPKA 2PMZF 3OJFA 2CEKA 3H0KA 3ICVA 5ECWA 2HJGA 1Z0ZA 2VJAA 3DTNA 3SICE 5HWSA 3EEOA 2ZUBA 2QTZA 1LI5A 4F4KA 4I1PA 3ZKAA 1OXTA 1UPCA 4DG5A 1YZHA 4I55A 4EJ6A 5B2FA 5DSXA 1UMBA 3USZA 4R1QA 3CO0S 1JRPA 3GGSA 4WCFB 5EE9A 1RXVA 2B83A 2I8AA 2KD1A 5LLSA 1Y6GA 5EIWA 3ZE7A 2EHDA 4PLCA 5AT1A 5G4KB 4PIVA 3DKVA 3WAGA 4G1UC 3DMFA 1JH8A 4NPCA 5JHGB 2C97A 2IE0A 1H8EA 1KU6A 1S5PA 4B31A 1J0CA 2QT0A 2RD2A 2KIWA 4JJZA 5D1HA 3REQB 1JDBB 1O6ZA 2QRLA 2YV3A 4FEGA 4ENSA 1YIOA 2VHVA 4DNFA 4ZFNA 3F98A 1CQJB 4IDCA 3V97A 4DS3A 5DB8A 3DV9A 2DOKA 2X8JB 4B3SB 1BH6A 1XR3A 3OI7A 4FE4A 2JI7A 4N0PA 4NECA 2C7PA 4LYGA 4M49A 2UYYA 1EFDN 3R74A 4F8YA 2IHMA 3I2JA 4URXR 4IX1A 8ICMA 4CMEC 1N1DA 4G4SO 4I8DA 3I76A 1II9A 3I9MA 4GI1A 2WYVA 4H35A 5DXJA 3G0BA 4B5KA 3LRPA 2JEFA 3H65A 2RHJA 1KGSA 1CP3A 3S2FA 4QZEA 1TE2A 4FT4A 3C6QA 3IOBA 3ZGLA 1F4PA 4D4GA 1IAVA 5M7EA 2AD5A 8ICRA 4IDNA 2E0IA 3ONVA 5T4HA 2KTQA 1JG3A 3HU3A 4PAOA 4P80A 3SZRA 4EQ6A 4LJ6A 3J80A 1K08A 3QFSA 5ES3A 2EGGA 2BMFA 3ZJUA 2VTBA 1XCBA 5ESDA 2G5IB 4F1JA 4LI0A 4CT5A 1Y42X 1NP3A 5B66U 4J7UA 3AFHA 3OH8A 1NMQA 1RHJA 3ENNA 2IHYA 4ISBA 1A9SA 3QU5A 2VPIA 3WMGA 5BWNA 3TBKA 5HRUA 4DV4B 4LTDA 2G1PA 2RI1A 4D56A 1NU8A 4S3MA 1X39A 1YBHA 4P31A 3WX0A 5K0CA 1Z74A 4BQSA 1CUBA 2AJLI 3HXPA 4YD1A 1GADO 1W25A 1YUNA 3PGKA 4U9HS 5FNVA 4BAZA 2JGAA 3O8OB 3NRZA 2VDOB 3RIXA 3HP1A 1LFDB 4IINA 4FFPA 1QHHB 4FEYA 3KEFA 5FBWB 4CT4B 3SX4A 5FX2A 5CNJA 2H4WA 2IKQA 2OQIA 5CVVA 1E1NA 1TYZA 2VT3A 2WE8A 4I2AA 1N48A 1DKRA 3NS7A 3ZGYA 4DZRA 7ICHA 4YRLA 1GL7A 2PUWA 3X0DA 3T1HB 3QWAA 3RROA 2HNAA 2V9WA 1IZ8A 2IOFK 2PXAA 1R64A 2F3PA 1CT9A 2JD1A 2OECA 2PX3A 4M1YA 1L3CA 5IDQA 3OFJA 2CHFA 2ZIZA 2MSDB 5DTMA 1T9DA 3WMWA 2BFDA 2GT1A 4TZTA 3UVEA 1RAAA 3FWHA 1ACLA 2OBNA 4NEGA 4E09A 2VZ0A 2V7TA 1JKJB 2EZ8A 1N60A 2A9OA 2CXXA 2I29A 2H4FA 4IRKA 3G2QA 4IIDA 2IXAA 4KNVA 1I0ZA 3LDFA 3JRXA 5GJBA 1M2VA 3FIUA 3R6GA 4GOMD 4WBXC 1JDJA 1SXHA 2PFGA 4ZVLA 5CB4A 5JAUA 3SHFA 2ISQA 2QP9X 5EJ7A 3UXOA 5F51A 1DC6A 1EP2B 1H0KA 5KFLA 2PIDA 4NK5A 4WECA 4L51A 5L3QB 4F91B 3RFAA 1GKUB 1YQDA 4U2CA 1ZM7A 3RW9A 1CY4A 1IDOA 1Z0JA 2JPDA 2QQGA 3FMPB 1A8SA 4C0KA 3U44B 2VIIA 2E3TA 1XL0A 4DEXA 3AUOA 5FB3A 3TTXA 3AETB 5DVZA 1TMOA 4FOPA 4HLCA 3WSTA 2HJ9A 1YNOA 2VZEA 1KO5A 5JC1A 2IYYA 5K0GA 4Q37A 1YR2A 2XEXA 2BM9A 5KWVA 2BFBB 2VUSA 2ZSIA 4J0DA 1VIYA 2WIBA 4UFOA 3RS5A 3TSOA 4DC9A 3KELA 4JA2A 3F7NA 4JKOA 3K6SA 1G1AA 2AEEA 3NAQA 4YT4A 2WU1A 1GFZA 4NCXA 4NYMQ 2C96A 4CTMA 3SSAA 4UXIA 2B7LA 2VPQA 3DVLA 3AKDA 2WV9A 4EJSC 3SV4A 2A67A 5AVUA 4HGRA 1JEQA 2OD7A 5I5GA 2VNSA 2MINA 1Z22A 5B58T 1LBSA 1OKKD 1M74A 2R6JA 3AW8A 5F3RA 1J9GA 1GSIA 3NPMA 1B93A 3VI4B 2ACEA 3I5XA 4MHTA 5KFSA 4UHKA 1W8DA 1U0NA 3CT6A 3FTEA 1NHGA 2Z0MA 3OJSA 3BQ2A 2JFPA 4RQ2A 3EG9A 3TL2A 3HWX1 4R9UC 4DMFA 3KXPA 4EGQA 2VHJA 3SX2A 3PDUA 1FDRA 1WF6A 1OREA 2H06A 1XMQB 3MGHA 5BVGB 3BWXA 1FDOA 3F0TA 4TUSA 2I1LA 4WY2A 3BSYA 2OXRA 4URZR 1QC5A 3U31A 4BLRA 1NP7A 2LYAA 2QRVA 3NDPA 1KVTA 3PJDA 2A0XA 1PYOA 3QPBA 4BVHA 3MF4A 1O6GA 4QODA 4ICIA 1DK3A 2R6CA 4IH1A 4C05A 5BMVA 1YI8A 2D2EA 2QF7A 1EG7A 4DLSA 2QUZA 1JR3E 1RLJA 1DGSA 1VE3A 2P2ZA 1ULBA 4LMBA 5DBFA 5FR1A 3T5PA 5ALTA 1U7OA 3VSEA 4DQLA 3ZIAA 4MARA 1BMQA 2HQBA 2GKSA 4QOJA 4YASA 4EEZA 3CWCA 1C0PA 2OP0A 3AM3A 3EW7A 3QFTA 3EISA 3KV1A 3X1JA 5H3HA 1I2DA 4AG3A 4XGKA 1TK0A 3EH1A 5L9XA 4G8DA 3KFUF 1P2BA 1U02A 1PK1A 3MDAA 2ZIEA 3A0UA 3HEMA 2O2JA 2WSYB 3X2SA 1RM4A 2CCKA 2W8BB 3LWDA 3NP9A 2PS1A 4IHKA 4QXAA 3QVLA 4CL2A 4N03A 3SYMA 4BFSA 4TSRA 3WGYA 3SR3A 4B6GA 1AQYA 2P66A 5EPEA 1WVGA 1QSSA 1F0YA 1CKEA 3NORA 1EFHA 2R60A 4LEIA 3KWLA 1GPLA 4HZUB 2IUYA 3INGA 5JXJA 3FAKA 2VSYA 5BW4A 5E3IA 2L69A 4JVSB 2WFLB 2I3AA 1M10A 2BBWA 5EIBD 1R6TA 3BWBA 2O5EA 2WAQC 3QVSA 4DG9A 1BD3A 1PG2A 4QOGA 2VDVE 2J1LA 1NKCA 5DQGA 4UD2A 5JLJA 1R9NA 1F9EA 1GG5A 4C76A 2WJAA 1KVUA 3ABSB 3NRCA 1NJ5A 4PYOA 3FOEC 3Q8PB 1J39A 2LCFA 2OCDA 2BRUC 3A26A 3AYXB 5L51A 1H42A 1J0BA 2AMYA 4KKXB 2Q3HA 4PBRA 5CA1A 8LDHA 2Z2YA 1X94A 1NPTO 2Q0XA 1FX1A 3MTBA 4DR1B 2I6QA 3ETGA 1XQ1A 1E1CA 4QU8A 1T2VA 2FMFA 3UJPA 4D74A 4JXJA 1QO7A 3LK6A 1UBOS 1I9CA 2YMMA 4LIPD 1Q5PA 4PHAA 3UFXA 3GPLA 3V33A 2HDHA 3NHYA 1R4ZA 4BQEA 3BRQA 2GR9A 2VLIA 3C1AA 4JC8A 3ZQ6A 4D82A 2C2OA 4II7A 2Z6VA 1I5RA 2E87A 4MIEA 4JUZA 1SVMA 2PRSA 3C3MA 4A82A 5FLYA 1W19A 1CZUA 4MS1B 3MTQA 4UJ5A 3OETA 2VT2A 1HRKA 2CHGA 2V6FA 3HCAA 3LZ6A 5B6PA 2NZ8A 7ADHA 2CK3D 4R6WA 3K9LA 2VHQA 1ZH4A 4RQ4A 2L42A 2HYIC 3C1UA 2WF8A 5D46A 3OBIA 4K6FA 2J6UA 4IL6U 4UVIA 2PFOA 2W54A 1EH5A 3ZH9B 1VMKA 1W1UA 2E1EA 4RQBA 3F9CA 5C51B 1T8PA 3HUUA 1CB7A 1K0FA 2C7OA 3LUFA 2ZG6A 4D9KA 3PQDA 2OA0A 1L5WA 1X2IA 4ECYA 2I55A 1XEAA 2E6UX 3ZVLA 2W43A 2AEJA 4CT0A 1FFDA 3RASA 2QORA 4D43A 1U1CA 3LK7A 2WKSA 4QX6A 1X1QA 1NOIA 2IA6A 3JR7A 4Y0AA 2Q4BA 3V6LA 3I64A 4F9FA 2Z4TA 2QVGA 3NONA 4P0QA 2ZULA 5MHTA 1NUQA 4AJOA 1GP2A 4FFOA 4NZYA 1P60A 4F5ZA 2VHZA 4LYFA 4QASA 4EHFA 5JC8A 1E1RA 1CUJA 3WKCA 3I45A 4KLNA 3EGWA 4O4IF 3FVTA 1VGVA 3FLAA 4FQ7A 2HHXA 1D0IA 1O9BA 3LA8A 4UC0A 4OUKX 3LLUA 3K8YA 1YWGO 1GG8A 1V5EA 2G17A 4TLDA 3ALRA 3MEQA 1QZUA 4KQXA 4RPZA 1XTRA 1QTNA 2V98A 4GVPA 3FPLA 4JC4A 1GQRA 2FW1A 3CUYA 1UEIA 4F7WA 1Z5NA 2WYIA 4QDUA 4Z7JA 5JAHA 5JYBA 3TSCA 1WBBA 1R3UA 2A4MA 2ZRJA 1DMRA 3GFPA 3A6GA 3HFJA 4DCJA 4KR7A 3HH8A 3F8SA 3PE3A 5CLHA 3NB0A 4BVKA 1IRIA 3EF3A 4Q1DA 3TAXA 4GI7A 5DNVA 1KAEA 4HL6A 5HMLA 3CWZA 2YWFA 4N3NA 2X22A 4MVJE 5A05A 4JB3A 1T9ZA 4UHJA 5J2UF 1M1NB 2GBLA 3ZD9A 1DJNA 3GGCA 1GAEO 4TMVA 1ODKA 3QX9A 2HIHA 1C50A 1C80A 2V4ZA 1K7XB 4FYPA 4D4KA 2D4AA 2XGQA 1THGA 1KPGA 3MQ2A 2VRCA 3IQWA 3V6JA 3OX2A 5FLXA 5CHGA 3BHMA 2XVXA 3AKEA 4QD3A 3TIGA 1CETA 5GY7A 2I4NA 4MI3A 1SBHA 1Z4PX 2X19A 3V2HA 1UMCB 4ECXA 2VJKA 3W06A 1JGTA 1PG0A 4MQ5A 1VIMA 3EQ2A 3V8NA 4FB5A 2B94A 2R8RA 3DC7A 4IF4A 1YS9A 1M1NA 2H85A 4FHDA 3HO6A 3TL6A 2D1RA 1IG6A 5CBKA 4G5OA 1APBA 3PWTA 1SURA 4DADA 4WQMA 1RSZA 4XASA 1YD7A 4D3FA 4UPDA 4HWOA 5AR1A 3A27A 5FUBA 2GERA 4M38A 4M99A 4KBFA 4OXQA 2W11A 3IBCA 1VG0B 5ENZA 2AJQA 3PI6A 2DF4B 5G3ZA 4NFHA 1RYNA 3RI3A 4B3JA 4MRMA 4KE8A 3QFCA 2P6OA 3VV3A 2EQAA 5JUMA 1GCAA 1KY2A 3R6WA 4K40A 1RYSA 4N5IX 1I3KA 3MS4A 3P19A 4G1CA 5BRAA 5LWHA 4RH1A 2ZAYA 4ND6A 3U81A 4P86A 1MQSA 2GZAA 1E4OA 4NOMA 4A5SA 2NRWA 3QVVA 1RKVA 1Z0SA 2GLUA 4D0LB 2I0FA 3Q8KA 1XMIA 2RKOA 2WSIA 1ZISA 3YASA 1XFAA 2KKPA 3BXOA 4R9RA 4ZCMA 1THMA 5IK2D 1E6UA 4XCXA 4TVKA 3W5BA 1BKDR 3MCAA 2CDRA 1K75A 2EWWA 3RWOA 5JS6A 1VGQA 5E8RA 4RDXA 4RULA 5KAIU 4C4YA 1L6NA 4JT8A 4UEWA 4DSNA 2R1UA 4K5QA 2IZZA 1O0SA 2BFFB 1MN6A 1JLMA 1Z2OX 3D2SA 1N1GA 2W2QA 3FUCA 4QNNA 4IFIA 4NOKA 4Y1RB 3WS7A 3EZ6A 4CNBA 3LO5A 1Q1AA 4DXHA 3ENWA 4LCJA 1YVRA 1A72A 2FKAA 4DGQA 3IALA 2IP2A 2NZVG 2Q1XA 3FCOA 2CMFA 4DR4B 1YMQA 9ICNA 1PR1A 2PS3A 5IVHA 2XRMA 1QGUA 2LP4Y 1I01A 4L6IA 4BLPA 3KD2A 1GM5A 2OZPA 3E05A 3LX8A 1RZRA 1S8NA 5I9BA 2A9KA 3VSAA 4MS1A 1PNQA 2NUTB 2DGDA 4JLKA 2JK1A 4AG5A 2GA9A 3CVWA 5KTOA 4TUQA 1OGJA 4MGIR 5DB4A 3BK1A 1JHVA 1ZC4A 5DNUA 5JQGA 1FFWA 3OQNA 5JS1A 3GWGA 6AT1A 2FDXA 2WOOA 4MVJH 1KI1A 4CIDA 2RGAA 2JJYA 3L0IB 3IEVA 1WQ1R 5J2BA 1EVJA 4NDZA 1PV4A 3QLJA 4LJXA 1ZH0A 4B32A 3E84A 4OP3A 2H2IA 4BCBA 1SIJA 3PPYA 4Q12A 4B9MA 2FMKA 3ISBA 3IAM6 3NU1A 4KYVA 4UZFA 4B44A 3QU2A 1E1CB 2EZ4A 5F77A 1LEHA 1IG3A 1R15A 3VZCA 3CH6A 1AHNA 2DUMA 2WPDA 3P9XA 2C07A 3M9NB 2KSOB 2MTBA 1T8WA 4UAGA 4OI1A 5IWAB 5FF9A 4EW2A 4TUYF 4DUPA 1T1IA 3C7TA 3JALA 3BBPA 1KJ8A 2VNKA 1QP7A 1SVWA 3U39A 3IR7A 2YFQA 1ZYQA 2I7TA 3QWBA 4HLUC 4L6CA 2O5VA 1Z0UA 3AL3A 5CTJA 1GUBA 1R0WA 1CRWG 1KRPA 1BJKA 4QWBA 1PHPA 1XVIA 4OXKA 3W7VA 4RJTA 1QHEA 2A5JA 1EDOA 2ZWIA 4ZP1A 4RTNA 3F5SA 4XFKA 4F3TA 3ZNOA 2PRYA 4HQLA 1I0LA 3SLGA 2CUTA 4UM9B 2K60A 3AJEA 4POOA 3CT4A 4A27A 1ZA1A 4W8HA 2E8MA 4DA8A 1AU9A 1KBQA 1U1FA 4BMZA 4E14A 1UXIA 1WS6A 4NV3A 2XW6A 2ZIVB 1E9SA 3SXUB 3U40A 2YJ5A 3H4DA 2XR1A 3BBLA 3MOGA 4NULA 4XD2A 1L5QA 4CV1A 1DGJA 1D09A 1YS6A 3JPNA 2C57A 2G83A 4XJTA 4YQFA 5SZIA 2A59A 4GZ5A 5EHNA 1L7NA 4RK0A 5J0XA 4QVIA 2H5JA 1DOHA 2IITA 3HHPA 4YP7A 3VZQA 1M2OA 7YASA 3KYDA 5LWQA 4I4IA 4B2YA 1QPBA 2VDUE 1EE2A 3E7FA 3U44A 3BE6A 3KQYA 2XIQA 3D3JA 3JYLA 4HGPA 4TQGA 3BE4A 3WGUA 3ZWPA 5LZ4A 2HK6A 2UUCB 2WWGA 4YR3A 1CEYA 1QIMA 4RPKA 3QYPA 4PHFA 5BMVB 4YCNA 1FMFA 2V9ZA 3RC7A 1SJ9A 1UT5A 3P9QA 2AGPA 4JODA 4Z7QB 4A2CA 1R0SA 2K7ZA 3W34A 1AV7A 1AKTA 3GJSA 4IDAA 1XZGA 3E22B 4NARA 4PNHA 2JGIA 2EVWX 3D5TA 1PWEA 4DSJA 3U3DA 1ULHA 1Y1RA 4IUDS 3VU8A 4YXMA 1V16B 3DEJA 4K6OA 1L8LA 2AGVA 2F6RA 5BN3A 4XR4A 2JHCA 4IZOA 4PPYA 4V0ME 1NJ1A 4Q34A 3N3AC 3GJ8A 5CB0A 1N3BA 2J5BA 4YCDA 1INLA 2NVUB 3LIIA 2HBQA 3PCXA 2C42A 5FL7D 4HZIA 3ANMA 1N0UA 1EE1A 2Q45A 4Y2TA 5JFGA 5SICE 5EWGA 2WJPA 1LSUA 1OUQA 1Q95A 2RJNA 3K92A 1SRQA 1HDRA 2CNOA 4OCZA 3B52X 4M0LA 1G3RA 2W4MA 1HURA 2ZB8A 4R2LA 4YJKA 3I2YX 4A0SA 4AS1A 2GNPA 2MINB 2O05A 3F9RA 4J2OA 3TQTA 3M89A 3HL4A 2ERXA 3ZKWB 4UULA 2DG2A 4A8PA 2P0EA 4YRSA 2F1OA 4GGOA 2IZ6A 4K6GA 1Y6JA 4GXQA 5F3DA 5FOUA 3F2IA 2CNWA 3O1HB 1D2GA 4EENA 2EF0A 2XE7A 1AN0A 3K73O 1L5OA 4KIJA 4ZALA 3K0EA 2QL9A 3P5BA 1WMDA 4FN5A 3L40A 4EIWA 5HKKD 1O77A 4AXBA 5ALDA 4F4WA 1G7RA 3PW5A 3GG9A 2VTDA 3NCTA 3M6AA 3HDHA 4LJ9A 5F76A 3KTDA 4YWHA 2LW7A 1CXZA 1HZZC 3B3FA 2OE2A 2FZLA 3TN7A 3A70A 5A3JA 5A0LA 1GZHB 1D2RA 4BO9A 2XUHA 5JYEA 4NE2A 4M04A 3PQ4A 3IBGA 4P4PA 1ZLXA 2ZTMA 4XDZA 2M9NA 3HMKA 3OA0A 1K66A 3K32A 3Q7QA 3K9HA 5D84A 3UXYA 5A0VA 2W2LA 3RUAA 4R7ZA 3GT4A 2GAJA 1Z68A 5LQSA 1AZWA 4GZ6A 3VC1A 1AK9A 1ZVJA 1JXQA 3WNZA 4U6QA 2IXDA 4L16A 1OFUA 1ODSA 2SCUA 1QH8A 3Q6IA 4S1TA 1JFRA 1T1RA 3NGMA 4YCCA 4O4JB 2R84A 5AP9A 1LXCA 4A9AA 4PLWA 4UHBA 4AU1A 1X1RA 3IERA 2PFNA 1X9IA 1VIAA 1KP2A 8ICIA 1KGDA 3I9V1 5KREA 3HWWA 2VDNB 1BGXT 1DFIA 3UT5A 1DIBA 1JG4A 3HWSA 4KO3S 5BV1A 4S1WA 1QU2A 4HAIA 4N9WA 5LA6B 2GA8A 4H6PA 3IP1A 2FSPA 3JQGA 1ZUWA 5EKSA 5EJ9A 3I5UA 1ND5A 4V0RA 1H4VB 3HDJA 3HEAA 3N59A 4U0KA 1UWVA 5EJFA 2WJIA 2ZS7A 4UNSA 7ICVA 4J0QA 5EUBA 3ZLBA 4EGCB 3G88A 5DTQA 3L1VA 1KNQA 1QORA 4JJFA 1SOVA 4W7SA 3Q3IA 2WG1A 1PAUA 4FZRA 1TNDA 5IVIA 4ED9A 4L0CA 4O5KA 4B76A 4OQZA 3RCBA 1EESA 1H2WA 1NLYA 2NQ2C 3RQIA 3A9VA 3VI3B 5AFSA 5KUTA 4BO2A 2ZW9A 5KFRA 3TAPA 2C28A 3AEUB 1W96A 3DHNA 4U8GA 4BAUA 1BMTA 2A5FA 3B36A 2YWCA 1TYEB 4DRZA 2Z9DA 4TMZA 5FI5A 2Q41A 3JYNA 2E8NA 4MCAA 3GBSA 4MYDA 2REOA 4YRMA 1MVNA 1SN7A 2DY0A 8ICSA 3DBLB 2KHZA 2GN1A 5FI3A 4X41A 3UW1A 4CG2A 2GPSA 3TE6A 3L1IA 4EG4A 1VG1A 3AF3A 1GTSA 4RPXA 1Z6ZA 5KFOA 3KQMA 4K9SA 2XEDA 1EVZA 3D6JA 4C8LA 2OHVA 1KI2A 2H54A 1N7IA 3IT2A 2NU7A 3G2JA 2HHCA 2JIZD 5K99A 5LM3A 5LL6P 2OXEA 2O2IA 3M9LA 3H99A 5BOVA 5C7IO 3S7ZA 2RARA 5DBGA 1NY5A 4AJJA 4CM7A 4EHNA 2OT3B 3ORYA 3T1NA 1PDOA 4JJAA 4HMQA 4MVJF 3UMRA 1K6MA 4O1IA 2FP4B 4M54A 3NBMA 5KOHA 3DKPA 2RCYA 2ZR7A 1ECLA 4QO7A 4BNDA 3L7MA 2NV6A 3X1DA 5GJVC 4PR3A 2QJOA 5IC4A 1OC4A 4F93B 1L7RA 1NSYA 4QZFA 2AOUB 5I9SA 1UJMA 5ITWA 3V6HA 1E79A 3STHA 1XXHE 5BW6B 2RGDA 1V47A 2TYSB 3TFQA 4NQRA 4O0IA 3TVDA 5FOQA 1SQSA 4BZQA 1ZOSA 4HH3C 3DPSA 2GCNA 3DE7X 2H9AA 2BDPA 3PQ7A 3T5LA 5GZ1A 1OA0A 3OZWA 3HO1A 2HRQA 1F1BA 5F98A 2PQMA 4IKEA 4C7VA 2WHRA 4AM8A 3KXIA 1D03A 2REQA 2X6QA 1ZMBA 4L5YA 4RD0A 3TQCA 5A03A 5LOVF 3VX3A 2BGGA 1WHTA 1NWHA 4X5VA 3HB7A 2JAWA 2P3SA 1FP4B 4ZA2A 1RWOA 4CE6A 2PWBA 2HRBA 1N8SA 3O0DA 2QZPA 3E8MA 3DSRA 4DLYA 1EUCB 1GR1A 3AEKB 1J8QA 1TIBA 3PXDA 3FDZB 3WLLA 2GLTA 2BCGY 2YX8A 2ZU0C 4U2KA 4BMVA 3UOGA 1RWMA 5J23A 2HI0A 1SG9A 2ODTX 3Q7PA 2C9ZA 2BJWA 2PUVA 2D00A 3BHNA 4GOXA 5HBRA 3FBGA 1ZGAA 1OWNA 4WEQA 5HCNA 2MUTA 3JWEA 1NXOA 5CLJA 4MRNA 1DX4A 2CNBA 5KKNB 3JV7A 4MUBA 3E8SA 1NG1A 4GEGA 4QGHA 2JFQA 4HDNB 4EI9A 4ER0A 3KXKA 3L8CA 1WY5A 2A9QA 3VTKA 4AFNA 4CUKA 1XVAA 2QAJA 3KJXA 5KKCA 2GK3A 3QFRA 3M6XA 3MRVA 3JARA 2IODA 3IHTA 3FRIA 1WPQA 4H3SA 3JQAA 4YDHB 4YPVA 3REGA 1FTWA 2O3SA 4BCDA 5B4TA 4I28A 5TE9A 4AZ3A 2ONYA 3MRXA 4R5HA 5FBZA 2CLEB 3AXSA 2BE7A 4UUNA 2P9GA 4ALMA 3ADCA 1H2BA 3NASA 5GOTA 5JJKA 1P2DA 5IN4A 1KXJA 1T9AA 3DE6X 4C01A 3CF4A 1EXWA 2H7VA 1Y5MA 4FWTA 3OP4A 3RSCA 2NU8A 1K5PA 1OFIA 1Y81A 4ZI7B 4DJTA 1DC3A 2BUBA 4TV9B 1VHJA 3K9WA 4M7OA 4LGCA 4HNGA 3IULA 2CNLA 2OR3A 1IHUA 3F6YA 2H59A 1T6NA 1XLWA 3AJ8A 1UBMS 4G1EB 4IWXA 5KYXB 2F8SA 2CV2A 4S35A 1KEWA 4NS4A 5FPQA 1ORIA 2QRMA 3A7DA 3C3XA 3DO6A 3GPIA 3OCCA 5C8ZA 4LMRA 4MV1A 3DV2A 1A97A 1NNUA 3JQ9C 4RADA 3ETLA 3KSRA 3SZLA 4BQRA 5I7SA 1AH2A 4CMBA 3VHXA 3HJEA 3I2GA 1C9KA 2LPMA 3G17A 4KU4A 4K7JA 2FR8C 4CMIB 4O0LA 4KO2S 3RFVA 4IMPA 5TNXA 5E7MA 5AVXA 2JEYA 3M0EA 3EFHA 2ASJA 3H1TA 3OZUA 1Q84A 1N2OA 3LNTA 2JS7A 1SH7A 3PK0A 3U17A 3WDKA 3WLKX 4TROA 4OLAA 2LVBA 4J1NA 3GRFA 4KZKA 1E2GA 4O3FA 2EKDA 2BQRA 5FORA 2JLCA 2VNHA 4RE5A 2V65A 3QF4B 2EFCB 3KSMA 5IDXA 4FQ5A 4KXVA 3PGLA 4JVOA 4LZJA 3NWEA 5K4GA 1WL8A 2KYRA 3CVVA 2G1KA 3GJ0A 3U4AA 2HQ1A 4CDNA 3THXA 2AFIA 1U47A 1FP6A 3H8VA 3N8KA 4ZGBA 3IMGA 2J8ZA 1PV1A 1JPUA 1FS4A 2YVUA 2EBHX 3NBXX 2UYGA 5J0OA 3A58B 3GFBA 4HZGA 1MT3A 2QMQA 3KBOA 3W2HA 3N2KA 4I36A 1ID8A 3VR2D 3COJA 4H4EA 1L8AA 2ZJ6A 3CLSD 2XMPA 5T4EA 2BGTA 1VG8A 2YBDA 3ESQA 3HM2A 4KIFA 3WXMA 5ALPA 5AIBA 3N8GA 1X3LA 1DO8A 1N0WA 4DJDC 5LDDC 2YXNA 5BWOA 3V8QA 2WA1A 2A94A 2X5KO 1X15A 3IP8A 1E3WA 2BCRA 1C4KA 2PTGA 3W9BA 4Q82A 3PCTA 4QNRA 4CF5A 2GTIA 3L0ZA 3D7SA 3NX4A 3ZU3A 3GP8A 2A19A 2YJGA 3R0XA 3S3TA 3Q6NA 4F4IA 1II8B 4UCFA 1PWZA 3DFZA 3AEZA 2YQZA 1DVRA 2Q07A 3B38A 2ENWA 5M3BA 3TOSA 4KX5A 1WUYA 5H9WA 8ICAA 2OO3A 3H3FA 4JA0A 2GEBA 2ZRQA 1W4BA 5IIKA 1VLBA 2ZYWX 3A6KA 4FMPA 1GUZA 1DMSA 3WIDA 2CDBA 1JZQA 3CR8A 4WWHA 2IC5A 1GQYA 4BTLA 1SXQA 4IIJF 3D4BA 1K63A 3D2LA 4HHEA 5JIBA 4DM4A 2WIGA 4X00A 1V2HE 5D86A 4IPTA 3IEMA 1M0EA 2OV2A 4PXAA 1ZHOA 1J90A 3DXYA 1IVNA 1MV5A 5EQFA 3ADPA 1V3UA 4R8VA 1XVVA 1CY8A 2ZIUB 4I2VA 5JDIA 2PUDA 4JBXA 5YASA 1ZNWA 3IUYA 3VPSA 3PUJA 4P9NA 4QQ8A 5ECYA 2QAIA 3PA6A 4C1NA 4XWKA 1RC8A 2QR3A 4I50A 5KNIA 5IW8A 1ADYA 1PIWA 2C2WA 1TW3A 2ZBDA 4KSBA 5T4BA 3RVOA 2GCOB 3PHIA 4RK6A 2AT1A 4O1HA 3NHFA 4C9BA 2RHOA 3K2EA 2R5WA 2WNSA 1T2AA 3OZAA 4I66A 5FBKA 1K6JA 3EW9A 1AHIA 3I92A 5DN6D 2A5YB 3EVFA 2KNJA 3OCXA 4AQDA 1EIWA 2RHHA 1NY6A 3NDIA 8ICBA 4PSVA 4QPPA 5EI5A 4J8PA 4MWTA 5FHRA 4E5UA 1CNFA 2GF0A 1GKIA 4ABYA 3A6EA 2LWIA 4FD3A 4IMIB 4K9QA 1G4HA 1JI7A 2E2WA 3Q3HA 1JSLA 5CR0A 1OXUA 2P2GA 2I87A 1QX3A 2NYVA 2WWHA 3IXQA 1GY8A 2FVXA 1E9EA 4KYIB 1GNTA 4XGIA 4BLTA 3OMXA 4MDHA 2VSNA 4D0NA 4GOLD 1IVSA 1FLNA 1LBQA 2PGIA 2G5CA 5K51A 2IBSA 3U5TA 1D8BA 4UOEA 5CR9A 2XWSA 1G5IA 1NFRA 1SL2A 1RLUA 4D42A 2I62A 3IQIX 1OLUB 3R6TA 1DCFA 1ADBA 3CBGA 4R9VA 3RDPA 3KQQA 3KSBC 4RTJA 2DQZA 1V5WA 5D6NA 4DKXA 3D6FA 7ICOA 1DKMA 4R8SA 4BXOB 2FV8A 1UFOA 2Q8NA 3LE8A 3MJSA 3ZHBA 3PW0A 3N4MB 2O2XA 1M9NA 3FW1A 1UBCA 3I4CA 3MVEA 1TVAA 4URHA 3OPXA 3GPBA 5AXCA 3AL2A 4OHMA 4BGUA 3AP2A 3U7FB 2C8LA 3B9BA 3I2IA 4UB1A 5J2JA 1K88A 2IEBA 3RYIB 1ZQUA 3PT9A 4PYRA 3BE8A 3HZZA 3N8HA 5E2IA 2OWOA 2RAVA 2VJ5A 2X14A 3GLFE 1Z5ZA 3QXGA 1WABA 3RVSA 3K9FC 1MJGA 1U5BA 4GH5A 4GKBA 4HLQB 2D0PB 4ZMSA 4CF7A 3JATB 3KUKA 5E6UB 4YAIA 4GX2A 4CHTA 1A82A 4ZEMA 3FGZA 1B43A 1JX4A 3FETA 1WZEA 3K09C 3VKUA 2ZSHA 5IM4F 2JRCA 3I5YA 1FQWA 4TKUB 2XMDA 4O25A 4NG4A 5CCXA 1U48A 4Z5XA 5K6RA 2H52A 2APJA 2A1AA 4PHEA 2P6UA 4MR8B 2R1VA 1W88A 1N63A 3I9OA 5E1MA 5EQJB 4KQJA 2P9BA 5CXQA 3EFBA 5CM8B 2P9CA 2BFOA 4O2BB 2J3IA 4AP6A 1MC4A 5F23A 9MHTA 1DBWA 1TO1E 2VPYA 2PH5A 1P3DA 2IYEA 2ZRAA 3ZVNA 1IRXA 3VH4A 3I1JA 3CLRD 1ZVVA 3CURA 5DX8A 4XYMA 4Y6LA 3UJAA 1GARA 3GV0A 1AGXA 3AJRA 2HMTA 3AUFA 1TM1E 1N4DA 3W3AH 1AG9A 4AUKA 4DL3A 1H85A 1EQAA 1UKVY 2X8LA 2O7SA 1OASA 2YJNA 2RMKA 1G5TA 3N7TA 4EG8A 4G0WA 3KQWA 4U8HA 1QF7A 4FR2A 4I2BA 1ZX1A 1N9ZA 2FG6C 3V1UA 8ABPA 2O7VA 4MWGA 4DIUA 4ZN6A 3DPIA 5HQJA 5SY6A 3U1BA 4BJ3A 2UXCB 3Q5DA 1Q17A 1Y3IA 1OI3A 4LZNA 3IURA 4TTIA 4M22A 1DI0A 3VNSA 1G42A 1KKLA 4UMFA 1D9DA 5J4VA 5CVUA 3OC6A 1X1BA 1E63A 4NZNA 4K81B 2IPNA 1QR2A 5L6LB 4JQZA 2O0LA 3FNEA 4OD0A 1AB5A 3PVSA 4IS2A 1YVDA 2H5IA 1C9MA 3QVJA 1V7ZA 1PZHA 2NTNA 3EA0A 4M0UA 3RUDA 1XQ9A 1WB6A 4KYUA 4C0LA 3PUIA 5BN5B 2OMKA 3FZEA 4KFTA 3RVPA 2EIHA 2CJYA 1NAIA 4JV0A 1SCKA 1M2HA 2QW0X 2VATA 3C5HA 2NXJA 1NX6A 3GIJA 5K0BA 4XAQA 3FAHA 4CU5A 3BTOA 4V0LA 3ZYZA 1EPUA 4N6GA 3JASB 2EW1A 1Z2AA 2BEJA 4CLEA 1Z0IA 4QXMA 4CODB 5LXTA 4FDLA 1R0KA 2IDKA 4LC1A 9ICCA 3ZHCA 1NJWA 4ZGWA 1M8GA 2EJWA 4L2IB 4PLYA 3IIJA 3TM4A 4H15A 3KU4A 8ICLA 1LD3A 2FVYA 2YV2A 4TVSA 4BWGA 1ZM3A 4KTQA 1P44A 3GPDG 4YMGA 4X20B 4W5QA 3U19A 1ZI6A 3C3KA 3ER9A 2YWRA 1K0UA 1T3TA 3ITEA 3PWSA 4ZVKA 3UHPA 3UGKA 4WADA 3G0GA 1P4SA 3LT5A 4GP7A 1DSSG 2XUFA 4QIHA 4X3PA 1OFVA 4XUSA 4BEVA 1ISMA 4A8JB 1RZTA 5LQMA 5LP6A 2XQGA 3DLTA 3HKCA 1KJ9A 4MR7A 1LJ8A 5KQPA 4IQ0A 1GLNA 2PSHA 4P6VF 5GV8A 2Z8YM 4JR2A 3SF8A 3WBFA 4PE5B 4GX1A 2IH2A 1P77A 1VP9A 4RHTA 3E15A 1E0SA 2C5GA 1MFPA 3GA7A 1A9RA 3GZTB 3KTAB 3KOWA 1O8CA 2H08A 4ZQGA 4F2GA 2QBYB 5JJ5A 5K3OA 1UBRS 5LD2B 4LS3A 4G8BA 3S1SA 5KPDA 2Y2VA 1GTL1 3T7KA 1M2NA 1G20B 3OTIA 5DTRA 1PVQA 2KFNA 3EZYA 1ZU4A 1JG2A 3IAM1 2C04A 2FOXA 2A0KA 2QX7A 2YHUA 3RUIA 2BEWB 4F2PA 4X65B 2E37A 2GDJA 1D8TA 2N1MA 1T4CB 2VDJA 2DWOA 4IAOA 3KQSA 4L8GA 4LVUA 1YL6A 4N3GA 4Z0PA 3RFFA 2WNHA 4HH0A 4QDTA 3TO5A 1CUYA 4YRIA 5KCZA 1VA5A 5E6RA 2AFRA 3DBVO 3CX8A 3D81A 3DAGA 4RXTA 4DA6A 4TLMB 4WEOA 4BIIA 4ITRC 1BRTA 2C4VA 2JHFA 1GYPA 2YWDA 4X0EA 2MCFA 1UOPA 1ODLA 2J08A 2JA2A 3ABIA 2GXQA 2PKQP 1ZN8A 5E4YA 4XTCS 1LRKA 3X1KA 4QYMA 4I2FA 4ZJZA 5CH8A 4K6CA 3ZHOA 2KM1A 3CZPA 2KK0A 3VC7A 5DSTA 2O8DB 1OBOA 3BS7A 4WLVA 2OFWA 3U5ZB 5IF9A 4QTXA 1KOGA 3RSFA 1IIPA 3HDYA 3P4XA 1S01A 4JHLA 3CNEA 2FEWB 4WBNB 4HNTA 5I7UA 1TFUA 3WKBA 2R8KA 4UQGA 3B1VA 2HQSA 2PO7A 4B9AA 1D4AA 3GDHA 3JQ7B 2G25A 1EDBA 2R5FA 1NV8A 2Z04A 2RJ3A 1K27A 2PL9A 3AFNA 4JV2A 1JEJA 3GDGA 4HGOA 1B6TA 5THQA 1A9OA 1JI0A 3PGVA 2M0NA 1I0IA 2ZVJA 3BZUA 1KU0A 1QH1A 2GLEA 2IKSA 3P9CA 4IXTA 5K0SA 4LDPA 4ABTA 4MB2A 1FIUA 1P9LA 4E5MA 1PYGA 3Q1LA 5AJXA 4L57A 3AMZA 4BWYA 4Y18A 4Z0NA 5EVCA 1OKKA 3WMEA 5I45A 2QNRA 2ZBVA 1P1FA 3L9XA 4B73A 3NWPA 4QUGA 3EFOB 2X1LA 1VL0A 4KTVE 4EBCA 3KYBA 1K7SN 4CRXA 3LWNA 3B1FA 3VRHA 4C88A 2RHBA 3DTVD 2JZBA 2GBCA 1O89A 4HAXA 1TB4A 5IVDA 4FMCB 3TDNA 4AO8A 2QRUA 3E9MA 4IDOA 4A92A 3GCXA 4KQ9A 1SUFA 3ZQ4A 4CM9D 3S68A 2IF2A 2P5SA 2QTTA 1ONOA 1MA7A 3IG5A 3T4PA 3WYAA 3F1KA 4TT3D 2V0NA 1KDOA 2Q4DA 3AY7A 2F8MA 1M8JA 5EC8A 3KTAA 4QDKA 4D3DA 1TZJA 5T7BA 2O07A 1T34A 2UZAA 4LTMA 4II3A 5F52A 3ANXA 1Q3UA 5KQGA 4MFAA 2H2FA 2ID8A 1W73A 3ZS9A 3VNRA 4TN1A 2I67A 3O38A 3VBCA 4LY9A 1V11A 5DDIP 1TKCA 4PLGA 1C3OB 3ZIDA 2WI8A 5K03A 4ZI5A 3WYBA 3FUWA 3QUCA 2UVUA 3H75A 2F9MA 3AWDA 2XHEA 2XGMA 3A4MA 2YWHA 3PC2A 4XWGA 4BUZA 3GQVA 2E4UA 1XNQB 3HR4A 5U1PA 1W44A 3EGVA 3TTSA 4MLCA 5JMWA 5EE0A 2OZLA 4X95A 3W6OA 1WZ2A 1XTKA 3H2ZA 4H60A 5I9LA 3NTXA 2UZIR 1IEWA 4IBOA 2IH5A 1JDVA 1N5JA 2A14A 2YJZA 4R1TA 4WT7A 3RFXA 2OKGA 1AKMA 1F3OA 2PD6A 4PIMA 5CHEA 3M3DA 1GKLA 3C48A 2XBMA 4MA0A 5CFLA 4LHXA 1HTWA 2GXAA 4YRFA 1XV5A 3NHJA 1UZNA 2WQ6A 4KQ2A 1KPIA 4I9HA 1FBNA 4KNWA 3RRNA 2JBHA 3GFOA 2OB1A 4TWAA 1SU7A 4AIIA 1HJPA 2DSTA 2I7VA 4JNCA 3ZCPA 2V6BA 1G9XA 8ICNA 3AZPA 2H7CA 2IYZA 1O97D 2G0TA 4HDCA 4LJ8A 4ZPXA 2HCFA 3PSTA 2NO7A 3MFYA 3UYKA 4B3GA 2G4LA 3D4LA 4A2QA 5IG2A 3OQOA 3PKZA 3E4CA 1EP3B 2VOJA 3JD4A 5CFNA 1UMKA 1PD1A 4EKGA 3F4LA 3GU3A 1TX4B 1KJIA 3TG2A 1XU7A 4XPZA 4FFDA 3DWGA 3EF0A 5HUHA 4DSOA 1B6RA 1YCDA 2ZCUA 4HNQA 3K1JA 4DQKA 2ILVA 1NXSA 1UZAA 2O1EA 3KEOA 1UJ2A 1K7YA 5J47A 3URMA 3L4JA 4FSDA 4QZIA 2B1RA 1IL0A 2HO4A 4R2XA 3TCXB 4FBTA 3SQIA 2FPLA 3N1UA 1E1RD 1DO0A 1EI9A 1GGHA 2GN8A 4GLLA 2PX5A 2VJLA 4QW8A 4UUBA 2X3UA 2ZRPA 1Q74A 4ARZA 2ZM6B 5CIWA 4ND8A 4HNSA 5D5HA 1P72A 3C3PA 3OEEA 2FF5A 3RS0A 3C3BA 2JIQA 5PNTA 4EUNA 4BRSA 5LU8A 2WU0A 1RJDA 5DB6A 3A3KA 4XDGA 3MR6A 3JQBA 3OQPA 2DEUA 3UF0A 4ZT7A 1T8UA 2QK4A 4O4LF 4YXFA 3OM8A 5KFKA 2PUFA 3M6FA 4KREA 3A1UA 3GEMA 3IVXA 2ZIXA 3LYLA 1ZWKA 3QYFA 3GNSA 3AL0B 4IQTA 1K86A 1ZOIA 2RK3A 4Y1FA 5E7JA 2XO7A 1IXYA 2PT9A 3ORQA 4MR8A 3NM4A 1VRVA 2P27A 1JJFA 1GAJA 3ESCA 5EZQA 1A8UA 2VSFA 4FGJA 1ZI8A 2GYVA 3T7EA 1QBKC 5U4XA 3FHJA 3C3CA 1OU0A 2WTFA 3B6KA 3BIJA 4DXDA 5DHQA 1NX9A 3KQVA 2HW8A 4P35A 1XAGA 4EPVA 2B82A 3JATA 2JC3A 5H83A 3P9IA 1RQNA 2MHCA 4ZRNA 5C81A 2CPRA 3KR2A 2WF7A 2FN4A 5C1PA 4YR7A 3TBHA 4RVFA 4FW8A 1NONA 1GGMA 1JLSA 3RWMB 3TOZA 2CMHA 2K2WA 3BGVA 3FHLA 5B1EA 1E3MA 3PO4A 2Y27A 1DBPA 3ROKA 3RYIA 3O91A 1MGPA 5TT1A 4KLGA 4HYQA 4GLFA 5LDGA 1KQPA 4A23A 1CR2A 4UDNA 5FYDA 2Q21A 3CUEF 4UQPA 4KV9A 1L3TA 5T3YA 4ETWA 5D7BA 3TJRA 4AJPA 3K5WA 4IZHA 5IJ9A 1G2OA 3MW8A 2HK7A 4OXNA 2AHOB 4RVHA 4TTVA 2VKQA 4UAYA 1VKRA 2C4TA 1NI3A 1OT3A 2JFWA 1Y6ZA 5FPKA 3OFKA 2HBLA 3K1RB 3CW2A 1YKSA 2WYOA 3GUCA 3OJCA 1ULUA 2B7BA 3MWEA 1LRJA 5K4HA 1T24A 4FFLA 4PGFA 3VJMA 3JSXA 3VKWA 1MNQA 4X1IA 3A4VA 4KJXA 5EMLA 5K0EA 3I2FA 4NYIR 2GDZA 1H0RA 4JI3B 1H94A 3CB4A 5JAOA 3CTMA 1XPRA 1W94A 2J9FB 5CX1B 2FJ0A 2WTXA 3OD5A 1AXEA 1N25A 1ZQOA 1G5QA 2I3ZA 3DDNA 5J3JA 1FVXA 5ALKA 2HBKA 3LJKA 3RH6A 1R88A 4QLOA 4F72A 5CNKA 4B9SA 3UGTA 4CKEB 1YS1X 2P67A 2ZS9A 3T95A 5CXUA 5D2CA 4PSDA 4UUOA 1SUIA 4EG7A 1DBVO 1MIHA 4REQB 4WX2B 3GYBA 4I2HA 2OAQ1 3TLGA 1P1CA 4XM0A 3AINA 1S4MA 2HHSA 2R7LA 1KN5A 1KIAA 2YHIA 3LFHA 2BSQA 5B6JA 4G65A 4F1KA 1POXA 1QFMA 3U4MA 4KLAA 1H22A 1Z4QA 1KYWA 3LP6A 2BFAA 5I5EA 4AY6A 5KINB 4COOA 3P94A 1J56A 2Q3EA 4DMCA 5ALHA 4HDAA 3O8BA 4EW1A 4A0RA 3ZCQA 1GAQA 3ZI4A 1PG5A 1O94D 1ZO8A 2CLKB 4LI3X 3FB1A 4BFTA 5L4LA 1NFQA 1D6MA 1YC2A 3OHAA 5BUZA 1GN9A 1GUYA 3I0ZA 4EJ2A 2WF9A 5JPDA 1DZIA 2BZSA 4RIHA 4W4TA 4DJJA 5BYAA 3VZBA 4EA7A 3IIEA 4LBYA 2QYHA 4DWWA 5IJ0A 1Q3VA 3GAZA 1J20A 4KQIA 3MSXA 5CPBA 4MVJA 3MCWA 3CF0A 4A7PA 5CEEA 1QIFA 1V3QE 4YBRA 1KOJA 2XAAA 4HUQB 1AV6A 1T5BA 3G8BA 1MAVA 2C0QA 4L8VA 3H0EA 1I30A 1M34B 1P75A 4I2NA 5IKXA 3L84A 3VAYA 1CRQA 1N7HA 2W0MA 2XLBA 3E70C 1LV8A 7REQB 1YULA 1Z8FA 3E2PA 1L7VC 5E3HA 1K2WA 4S04A 5A0TA 4JMPA 4QNLA 3EYZA 1PJLA 2IK8A 3E9ZA 3MHPA 2PAAA 3BGSA 2WJHA 4GD3Q 4B3RB 4M8LA 2D5CA 4K9MA 3OD1A 1CY0A 2LR0A 3IQGX 4LK3A 5C8YB 3FNGA 1TF5A 4M1SA 1R0LA 3AFOA 2VSOA 4C1BA 3PQ2A 3RADC 1NI4B 3QVUA 1KSFX 1RXCA 5HOQA 2WILA 3TLBA 2F62A 1RRKA 3HJHA 4H7HA 3MCVA 3SYKA 1XQ6A 1Z33A 3QVWA 3RIGA 3PE4A 4RH3A 1TZ2A 4RIGA 3RNLA 3T38A 3VU0A 2Q5OA 3QPCA 4LNUA 1IV8A 1T9CA 1CPYA 4FU0A 1P1HA 2BGMA 4MKRA 4WLEA 3UNXA 2BFNA 4C08A 3MN1A 4US8A 1WX1A 1J22A 2MSNA 3C8ZA 2ATCA 4NTZA 4OMDA 5CAEA 1KSJA 4ED2A 1LW6E 3CTPA 2NU9B 3EBLA 1MZPA 3BQ1A 1IZYA 4CMCA 5EAIA 4BO7A 2QWXA 2CCGA 3BCSA 3G2OA 2IYAA 4RLFA 1UOEA 5A7GA 3RS3A 4OYRA 1NMYA 4CVNA 1NVVR 1NBAA 4NONA 3SHVA 3W04A 1C7JA 1T3ZA 1J4AA 3C43A 3OEWA 5DJ5A 4BATA 1PFVA 1ZH8A 3V80A 4EKIA 1X7WA 3MSCA 2EKZA 4YUAA 2IFTA 1L4FA 1EMDA 1BU8A 2F90A 2WM8A 2GRAA 4KE6A 3HBLA 1Q12A 4B0PA 3JYHA 3V1TC 1M2OB 1FSFA 4M88A 5EP3A 4AZ3B 3ZJVA 1ZQXA 1AKUA 1QIIA 1E2JA 4BMSA 4FDAA 5H7XA 3HSKA 1UDBA 1FMLA 4G3IA 4TM7A 5HF6A 1QV6A 2HV9A 4IICA 2YWEA 3IP4B 2JLAA 4YJHA 1AQUA 4JQOA 3HLTA 3O1IC 1WSAA 2E4XA 5T5QA 1EFVB 3M1AA 5BN1A 4I1RA 3IIKA 1XNSA 3PRKE 4QOSA 1NUTA 3ABZA 4D3XA 2ZUDA 1KO1A 1Y4ZA 3CS3A 3FFWA 3E18A 1JTFA 1I7SB 2A9JA 1DS6A 1EZ1A 4J9PA 1DK2A 1FDSA 4DL5A 3I4FA 4IRMA 4KW7A 4LOKA 3UWDA 3VU9B 1XPUA 4GKJB 2Q9BA 3H5WA 4FUTA 1M1YA 3ICXA 1JXEA 5ICMA 3E3OA 2G9VA 3GXOA 4RK1A 4GXRA 5LZ9A 4ODIA 4ER6A 2NPOA 1CYEA 4OJMX 2B8JA 4JSYA 5GM1A 4PCUA 5JYCA 4C6RA 3BZWA 1CF9A 3DXFA 4U02A 3DMDA 4BLUA 1KFCB 2OUIA 1E4YA 4YV7A 1IM2A 3OEHA 3OIVA 3QOYA 1FFSA 5KJCA 1WW8A 1ULTA 2EC5A 1FQOA 1PFUA 3AOGA 1P61B 5DM2A 4QQFA 5E9JA 4C7MA 2OORC 2YNMA 4NU6A 1II0A 3PD7A 2KEYA 2W58A 3PITA 2RHGB 1VXOA 2C7VA 3EG5A 1NVAA 2C9DA 2N46A 2E1PA 3GT0A 4TRMA 4Y67A 4M2LA 4QXQA 4D5EA 1M6EX 1MW9X 1V7CA 1YIDA 2NYRA 5AJYA 5DP1A 4AJLA 5AW7A 1W49A 1XXHA 3C70A 4OHVA 4OH7A 5BUQA 5IZCC 4KMRA 3VPBA 1LBEA 3DBHA 2UYHA 1J97A 3VNBA 2ZIAA 3K1AA 4LJRA 5JASA 4QELA 4QJIA 2QB0B 1IJEA 1JQDA 4PRYA 3N7UA 5D7NA 4AXXA 2DFKB 4ZT6A 3RBZA 4K0RA 1N6NA 3PX0A 1KZ6A 1HYEA 1JYSA 4XB2A 3O47A 3RRYA 2EX0A 5LJLA 5DRTA 2J4DA 2MJLA 4MW9A 1ZK1A 2ZR9A 3HP4A 3KKPA 3OTGA 4JITA 2YICA 5H81A 1Z29A 4RV9A 1PJCA 1V39A 5JTIA 4WZ6A 1NW3A 2GGSA 3AY0A 4MVJP 1TVCA 2NXNA 4RGBA 3RIYA 3TMAA 3ASUA 4EFLA 5J2EA 3E2MA 5HNKA 1SPXA 4HGZA 1A5ZA 3W2EA 2XC9A 3AU8A 1I33A 4KK4A 2GWRA 3SZGA 2Q3FA 2E4AA 1AO0A 3RRZA 4NE7A 3N3BC 3TLMA 2XYVA 1KC3A 2CHUA 3S5JA 1RACA 4OBXA 3NDRA 4NAHA 4GFJA 5FBQB 5H9VA 2C2MA 4Q3BA 1QLJA 2BMEA 1MPXA 4NU8X 3X2EA 4AMZA 4QJFB 1L4YA 3GJ5A 1KYIA 3RVKA 3KQUA 2R4UA 2VDKB 3KZNA 1VE5A 1KH2A 2Z30A 5DYTA 1WJGA 2GBIA 1EFLA 2R1TB 4O4HF 3AEUA 1HDZA 3NHKA 4IGFA 2DFDA 4M9SA 3SDZA 3DP9A 2FZCA 4RWZA 3CFYA 4MRMB 4TL8A 4B80A 4A73A 5GTIU 3NDJA 4R01A 4DR3B 2ENUA 1HE1C 1RS0A 3LNCA 4CKWA 4V03A 1WTAA 3E61A 2C5LA 3B8EA 5DBCA 1M73E 3OHPA 4Q4LA 1GPNA 1RTKA 3VM6A 4QGSA 1I36A 2JLWA 2C31A 3TL3A 3OUTA 1JDBC 5AVYA 3CO5A 4ERXA 3OTHA 4RHEA 5LYJA 4BCCA 2HCRA 4MITA 5J2HA 1ST3A 1Z07A 2NTVA 3M9WA 2W9AA 1J2TA 5MDHA 2I1QA 4BVEA 1SPBS 2JVIA 4F4DA 1W35A 2AOTB 4XARA 4KXYA 3AUYA 1OFTA 3B0YA 3EWNA 5KTQA 2DH6A 1CJSA 4GWLA 1RBZA 3TTTA 1SGWA 1M0WA 5DBBA 1NMSA 3R5KA 3VYWA 1BKYA 4MLDA 4J07A 4P4UA 4YONB 5I01A 5HF8A 4J3FA 2ZPUA 1NNEA 4QYIB 1RJFA 4A2WA 1W30A 5LQRA 4RPGA 4R8UB 2B3DA 2BTEA 4E46A 4F2DA 1XD2B 1T5TA 2ZRDA 4L0MA 3LX4A 4XRHA 1V8PA 1WQ4A 4U2BA 5JCZA 5KFNA 1TCUA 1O96B 1K1EA 1I2ZA 3EH2A 1I8TA 1YZYA 3ZX4A 2WTMA 2UXDB 2P1RA 3MBKA 1XG5A 1U2PA 4FFVA 1SU6A 3OEED 1ZJNA 4N0MA 1JSZA 2ES6A 5F5LA 2BDTA 3DE2X 4IV0A