3QUQA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, an open cap conformation
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
225
structure length
225
Chain Sequence
HMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 83
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3quqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3quqA01
5AVYA 2JARA 1AQ6A 2D2VA 3UMBA 5AW4A 2GO7A 5AW1A 4YCNA 2NO5A 2HI0A 5AK3A 2C4NA 2IOFK 3PCTA 5AK6A 1K1EA 2RBKA 1Q92A 2I54A 3PGVA 5AI0A 1NF2A 3SD7A 4YH1A 4UU0A 2BDEA 3MN1A 3NALA 4EEKA 2C8KA 2ZBEA 3A3YA 3I1YA 2B30A 3FZQA 4H1WA 5AI5A 3ZTWA 1ZD5A 3OCYA 2MU1A 4OFZA 2JAWA 4YIHA 2G08A 3R09A 2P9JA 2AMYA 5ALIA 3NUQA 3L1UA 2WF8A 4BBJA 1Z5UA 2FDRA 4ZEWA 5AI6A 4NWIA 5ALJA 4EENA 2YN4A 3QU4A 3L0CA 1YJ5A 5ALMA 5AIAA 1L7PA 4E88A 3VAYA 2JAOA 4UATA 5ALOA 2JGAA 5AK4A 3W5DA 3DV9A 5AKGA 1CQZA 1ZD3A 1SU4A 1Z4JA 2YBDA 3ZWDA 5E0OA 3U7EB 1U02A 2ODAA 1SWVA 2YJ4A 3ZU6A 1L8LA 2HCFA 1RRCA 3KC2A 3E84A 2FEAA 3SKYA 5AW3A 3U7HB 2FPRA 3ZUPA 4NAVA 4QQFA 3UM9A 1YDFA 1SWWA 3ESQA 5ALRA 4PNHA 4GIBA 3SKXA 1U2SA 2IOFA 3QUBA 3W5BA 2G80A 5AI9A 1XP5A 1XVIA 2FUEA 3U19A 4BEWA 5IS2A 4MWOA 4KX5A 5AI4A 2GHQA 3L0BA 4BX0A 1RKUA 1L7NA 2YFYA 3N5KA 1EK2A 2G1AA 3AR2A 3OCUA 3IB6A 5A3QA 4UAUA 2X4DA 5AKZA 3KOOA 3PDWA 3A1CA 5AKYA 5ALKA 3L8GA 2B1RA 5AKLA 2DQSA 3QXGA 3U13A 4GXTA 5FP0A 4I9GA 5AW9A 3MMZA 2W43A 5T41A 3ET4A 3B9RA 3BWVA 3WGUA 2WF5A 1ZJJA 4F72A 3WKAA 3L7YA 1YV9A 5IT4A 5ALXA 1QQ5A 4FE3A 4BEVA 4HAIA 4L6AA 3OTQA 3QX7A 3ET5A 4NFLA 2I55A 2HF2A 5AI8A 3AR5A 4AS3A 4JDPA 4Y2XA 4CF5A 4AS2A 5AKXA 2FUCA 3HYCA 4YCMA 2FPSA 2OA0A 3QUCA 3QU5A 3UMGA 1QYIA 3WGVA 4UMFA 4EZEA 4HGQA 2C9MA 3M9LA 1Z4OA 4Y2PA 3BA6A 4NV0A 4B6JA 2WHEA 4DFDA 4UAVA 4KX3A 2R8XA 3MPOA 5AVRA 2FPWA 1Z5GA 1RLOA 1U7OA 1RLMA 3DAOA 5AKEA 3WK4A 2C8LA 1S8OA 4C4RA 3FPSA 2FPXA 5AK5A 4IG4A 3WKCA 1YMQA 2O2XA 3N07A 2ZBGA 5AKJA 5AW7A 2YMMA 3WK6A 3W5CA 3E58A 4OD0A 1J97A 5AM5A 3L5KA 1RDFA 1U7PA 2HF7A 1PW5A 1T5SA 2ZBDA 3AR4A 1RC8A 4L57A 3OCXA 3ED5A 2C88A 3B8EA 3P96A 1Z4QA 4O8CA 2MU2A 3J7TA 5AVXA 4XQ0A 5AM4A 3QLEA 1JUDA 1KYTA 5AKIA 3OPXA 1O08A 1TE2A 2WF9A 1ZD2P 3QNMA 3NAMA 3MC1A 5ALEA 3KBBA 3ZX4A 3NIWA 3UMCA 2I34A 2G0AA 1MH9A 3I6BA 4HYTA 3ONNA 4CNQA 4L6CA 3ZVNA 2YJ6A 3NRJA 3N8GA 3U26A 4BX2A 2G07A 1ZRMA 2RAVA 3AR3A 4BYGA 3OCVA 2GFHA 3AR6A 1T9ZA 2YY6A 3QU7A 3WK8A 1Z4MA 2B8EA 3FVVA 4BNDB 3ZW7A 3OCZA 3SHQA 5IT0A 5ALSA 5AVUA 4RETA 2IYEA 3HLTA 4NABA 2PQ0A 3KD3A 2YJ5A 5AVTA 3NASA 3R4CA 5AM1A 1ZOLA 2ZBFA 3FGOA 4BX3A 2ZXEA 4UMVA 3GYGA 1Z4PX 2P11A 1RPZA 2RARA 4DCCA 3S6JA 1RLTA 4YIKA 5AW2A 3WK9A 1WR8A 1Z88A 1NRWA 5JJBA 4UM5A 5ALGA 2BY4A 2HDOA 1T5TA 2I33A 3CZ4A 3N28A 5AHXA 3L8FA 2W11A 3N1UA 3SLRA 2O9JA 3L8HA 4FYPA 2B0CA 1Z4LA 1U2TA 4UASA 3AR8A 5AVVA 2YMQA 3EWIA 1RMQA 4Y2YA 1ZS9A 2PR7A 2MSNA 2VKQA 4EX6A 1TJ5A 1X42A 5AKKA 4QJBA 1TA0A 2RB5A 5ALWA 1ZRNA 4BKMA 2ZOSA 4FFDA 4XE5A 5ALZA 1QH9A 4KNVA 3L1VA 4OHFA 4YCLA 3M1YA 3ZVLA 3CNHA 1TJ4A 3W5AA 3A1DA 4ZEXA 3SMVA 3PGLA 4J2TA 5AW5A 2CFRA 2WM8A 2I7DA 2HSZA 1Z4IA 2HEGA 3FPBA 2HOQA 2ZG6A 4EX7A 5AICA 3SF0A 2I6XA 1N8NA 1TJ3A 5ALHA 3ZI4A 3ZVMA 3IJ5A 4Y2QA 5AVQA 4UU1A 4XOUA 4RESA 4C4SA 3K1ZA 4HGOA 5AM0A 5AW0A 4EELA 2WF7A 2WF6A 2CFSA 5ALPA 2QYHA 3WK5A 4F71A 3WKBA 2EATA 2IOHA 1YNSA 1RMYA 4DWOA 1J8DA 3DNPA 5AW6A 2R8ZA 1L7MA 2GMWA 5AKHA 2P69A 1Z4KA 4J03A 1L6RA 2EAUA 2HO4A 4Y2RA 2PKEA 5ALFA 4Y3UA 4KN8A 1O03A 4HGNA 5ALYA 1NNLA 4KNWA 1Q91A 2GHTA 3WKDA 4CF4A 2FPUA 3WK7A 4Y2UA 5ALTA 3QUTA 5AM3A 2G09A 5ALNA 3QYPA 3RF6A 3FM9A 1CR6A 3QU2A 1RKVA 1N9KA 5ALLA 5ALQA 2B1QA 2B8JA 5AVZA 2OBBA 1QQ7A 2R8YA 4XPZA 3QU9A 4C4TA 1L8OA 3KDPA 3D6JA 2Q5EA 2YJ3A 3AR9A 1VFPA 3ESRA 2OYCA 3EF1A 1IWOA 1FEZA 4UMEA 4MUMA 4Y2JA 4Y2TA 2HX1A 3KZXA 4CF3A 3EF0A 3NANA 3E8MA 3A1EA 5ALDA 2BDUA 2NO4A 3ZWKA 3QGMA 2CFTA 4KYTA 4UMDA 3ZX5A 3L0YA 3RFUA 3DDHA 4JB3A 4UM7A 3E81A 1VJ5A 1VJRA 3U7GA 3EPRA 5ALVA 1WZCA 2Q4RA 4Y2SA 4OCZA 4UW9A 1RKQA 2AH5A 2G06A 3OCWA 5ALUA 2YMPA 4CE6A 2OM6A 1F5SA 2Q4TA 1EK1A 2WFAA 3L8EA 3I76A 2HHLA 1LVHA 5A3SA 5AESA 4DW8A 3WKEA 1Z4NA 2QLTA 1XPJA 1WVIA 4G63A 3IRUA 1LTQA 3U7FB 2R8EA 3AR7A 3F9RA 3QUQA 2B82A 4Y2VA 2AUTA 2YMLA 4ZEVA 2W4MA 4HGPA 5AVWA 1RQNA 1RMTA 3R9KA 2FI1A 4G9BA 2P27A 5A3RA 4UARA 4BNDA 1ZD4A 2JAUA 2EARA 3I28A 2AGVA 4I9FA 1WPGA 3B9BA 1S2OA 2NYVA 4YGYA 1YS9A 5AM2A 5AVSA 5AW8A 1RQLA 1L7OA 2IA5A 3ZTYA 3TLMA 1Y8AA 4AP9A 2CN1A 5AIBA 1QQ6A 4HGRA 4IFTA
chains in the Genus database with same CATH superfamily
3WISA 4JXZA 1DOZA 1USIA 2WC1A 4N9QA 2ETXA 4G1VA 4LI3X 1O95C 1QH8B 4ECYA 3VNQA 1KQFA 1VPWA 2HI0A 1AB5A 3ECCA 2F55A 4H1HA 2NACA 2BHNA 4QUGA 1F8UA 3L04A 3RAQA 4X44A 4CN9A 4DLUA 4POOA 3BKWA 8ICZA 5AK6A 4L7QA 4AJJA 2XCPA 1ZETA 1LCIA 1WZNA 3PQ7A 4OLAA 1UT6A 2HKIA 4YH1A 1GSAA 3H17A 3DTYA 4YJKA 2WWWA 1HDIA 1H9AA 3P9RA 5IZCA 2HBLA 1KH3A 3H5AA 3NPMA 4S0XA 5JCPA 5FTJA 1CRPA 1V8DA 3K0CA 4JUDX 2I4LA 2J9YB 1ULZA 4GSKA 2FMKA 1L7VC 2O54A 2ZBPA 1PK9A 2CDAA 1A4IA 4Q0MA 4X85A 5DBEX 5EFOA 1S7CA 1ZD5A 4I5DA 3GP8A 1TM2A 2E6KA 2UUOA 5EP1A 5BVHA 3R5TA 1FW6A 3ZQUA 1XZKA 3EVGA 5BRJA 5IPFA 3NKFA 5EIBC 1QONA 2GS9A 1VMIA 3TARA 4EG6A 1ZQFA 2HA4A 2ZXHA 1SV4A 4W63A 3HXMA 4O4IA 1ZQBA 2K2WA 3FTNA 3Q9NA 1WCYA 5ENDA 1LNQA 2XPCA 3BUSA 3ETCA 3NM5A 3QVGB 5I9TA 4AU1A 1G5QA 2QPLA 2EIHA 3BXFA 4PQRA 1UA1A 2HU8A 3M5PA 3JALA 5C51B 3G17A 5EMHA 4QYIB 1XVAA 1FL9A 4E88A 2JAOA 5BT8A 4C4YA 2HHHB 2VZ9A 2X0IA 4Z4IA 1NJ2A 4G97A 4I50B 4ZHQF 3Q98A 3FNQA 1NVDA 4BV3A 5IT5A 5ICMA 4PW0A 3CUKA 3IPAA 1FFEA 1OZFA 3QHAA 1Z4JA 4X94A 3O3MB 5E0OA 5HKBA 1IBRA 1RHKA 1Z39A 1VGVA 2QN8A 3PD0A 4EMTA 4RJIA 4J75A 3NOQA 3UATA 2Q0ZX 2MIIA 3ADKA 2IE8A 4AB1A 5JZBA 1OCEA 5KYUA 3W5JA 2F8LA 2XBLA 1JNXX 2OFPA 4D98A 1RRCA 1OY1A 5J8YC 3GU3A 2ZYAA 3SJBA 2FEAA 3JXEA 1JJ7A 3ZC3A 4P6VF 3R7LA 5C5EA 4HATA 4NHOA 3A06A 4FLFA 2JFVA 1FYFA 5E7JA 4BJ3A 1NVVQ 2CFCA 3C6ZA 1MSWD 1T7PA 3EZFA 4FZ5A 1P5RA 3VH2A 4CM7A 4E11A 3AOEA 5J23A 3OSNA 1V4BA 2WNSA 1DGQA 2RP5A 1A5ZA 5KYXB 1JN3A 2DFVA 3OC0A 3PZRA 4R1SA 1GNVA 2RHHA 4GAEA 4RQ6A 2X5OA 3GVIA 1PJZA 2B5VA 2YXDA 3I05A 3I8OA 4IUYA 4JSRA 1XNSA 1MIHA 4ZPJA 1XFDA 3CB4A 3RG2A 2J5BA 4DMLA 3CNBA 1E7SA 1M5TA 4G0OA 2FRDC 2BQ3A 1RZ3A 3PDJA 2G1AA 1TNDA 4M9QA 3OZUA 1ZCFA 1VXRA 3KOOA 5AR1A 1PS9A 2JKVA 1RQRA 1W4LA 5EXXA 4FNMA 5C46F 3ZCSA 3EZ7A 3O3OB 2A9QA 3DEHA 1O8BA 3E23A 5K2MA 3CONA 4MUNA 4XQCA 4IQUA 5AJUA 5ITZA 5D4BA 3QXGA 4J0DA 1XKTA 2ESRA 3LWMA 1Z6XA 2A0KA 3N2LA 3S27A 1A5AB 4B3DA 3UJNA 2ZB4A 1E3WB 2VJOA 4RNOA 1YI1A 2QP3A 2JFPA 2R6GA 4D1YA 2QL6A 2OB1A 4DQQA 1DCMA 4RAQA 4BFYA 3Q5GA 3ET4A 5ISMA 3ORSA 3M1IA 5H4HA 4X6YA 2I2AA 3UXEA 4CIVA 2Q5HA 2NQ2C 4FYWA 3TI0A 1FU7A 1Z2OX 2V45A 2VQ3A 1ZMXA 2WJZB 4PCVA 3K0HA 1JDZA 1JFFB 3OD5A 3Q7TA 5A5EA 3VO8A 3SJCA 3PFWO 3EXHC 4RJLA 5HBRA 3UHOA 3B36A 4GQBA 4TSFA 4DT1A 3BDVA 4L6AA 5BORA 3CCBA 2G40A 4IJ5A 3VU8A 4WKPA 3IBFA 1Y4SA 3LZ6A 2W7OA 1BVYF 1CK4A 2CLMB 1LPNA 3QW4B 1KNQA 3R3XA 1PNOA 4G0YA 4MRAA 2FW8A 3FDZA 3GLHB 4BATA 2A14A 3ZU3A 3HZZA 4BO3A 2F1KA 3TEMA 3D5TA 2XUKA 1O77A 4G23A 5C34B 1FP7A 1UBRS 1U4BA 3ZYZA 4A91A 4ATNA 1NYTA 1KZ1A 4UBKA 1VMAA 5EL0A 4D0SA 4R9VA 1Z4OA 5L3ZA 2C96A 3UAWA 5BOMA 4BV8A 3LPNA 5TARA 4DEZA 1QIGA 1ZOOA 4I5FA 3GRCA 3IUPA 3B9PA 3RM3A 1DC3A 1OTYA 4WLOA 1JIKA 4YCXA 4ZTZB 4FD2A 4KLZA 4LOAA 3VC8A 2EZUA 1S2GA 2IU6A 2IDKA 4HWPA 4DWWA 1LJLA 1NR1A 1M1XB 2C2KA 2PV7A 3D6MA 1MA7A 5AKEA 4HXGA 3WK4A 3T41A 1DC6A 2ERCA 4G5HA 3QA9A 1S8OA 3VC3A 4G5XA 2VJ4A 2WFMA 3G13A 4I6JA 4DDTA 1EQAA 3ESBA 4RGYA 3KTFA 4YG2A 2NNWB 3WLRA 4KPYA 3BHMA 2XTAA 2ZM5A 4KI0A 4FZ3A 4JN6B 1YB4A 1JG1A 3P71T 5A9SA 4GMFA 3R5KA 2VQEB 1BGVA 5G0UA 4R5HA 4P0PB 1MB4A 2FSIA 3SR6A 2I6TA 2VJCA 2D59A 3H2ZA 3QOXA 3TR6A 3VMMA 3AUSA 1WDMA 2BR3A 4I46A 4UQPA 4G0MA 3FBWA 4R6WA 4L27A 2LYHA 4MW4A 5A2QA 2ZTUA 1K0UA 3AH8A 3RJ5A 4YRPA 5I01A 2JFUA 3WGZA 4O8CA 1VE7A 7ICOA 2D7CA 3J7TA 3OE7D 4IV8A 1QZUA 2B1IA 5F33A 1AGXA 3O26A 4AUNA 3DDWA 1XLWA 2A94A 5TJHA 1ZBQA 4FMDB 1KYTA 3MK31 1DC4A 1SVWA 2W55A 4PSDA 4ZALA 4IUDS 4I27A 1R9MA 4HBGA 2XVZA 4K9QA 3ZXXA 3FF1A 1SRQA 2E49A 1NXWA 4YP7A 1OZGA 1ZZEA 4FB4A 1JR6A 3LDUA 4DLZA 4EG8A 4KQKA 5ALEA 1ENPA 1Y8QA 1EH5A 1WWKA 3LVQE 4X61A 4QBKA 4TRNA 3BRQA 3D3KA 1SXEA 1MN6A 1WYGA 3EH1A 3I6BA 2XMDA 1DFGA 2ZJFA 1XRPA 4IWYA 4TSRA 5FWAA 5LOVB 3W1WA 1P2GA 1G0OA 4Q8EA 3EUB2 2BE7A 2EW8A 2GKSA 4RQ7A 4MQUA 1IV8A 5HCNA 4HTFB 2B98A 3RREA 3KSZO 4AYWA 1B6TA 4YP1A 1NPYA 1R6DA 5LMZA 3O0FA 5KFCA 1E66A 2ZSKA 3IAAA 3NRJA 4MO9A 4Q93A 1A7JA 3O2JA 4XIGS 4AWAA 4XQGA 4BYGA 5JMOA 1CJCA 2W6QA 4Q3KA 5JYCA 4HUQB 2GFHA 3IAM1 3JD2A 1PFGA 1T9ZA 4PC3A 1I8TA 2I8AA 3DV2A 4IZOA 1C7IA 1I2MA 3MJSA 3P9YA 5G2OA 4Z51A 5DZSA 2EBWA 2PUEA 2QDKA 1S5PA 1XHFA 1J56A 1WW3A 2A6PA 3V9PA 3ZW7A 4K87A 4KLUA 1YRHA 4FR5A 2RHDA 3V1LA 2FUNB 1G6KA 2O7SA 3BIXA 1EFKA 3A1VA 2VJBA 1KK2A 3WHIA 3G9ZA 1RWNA 1AHNA 3SFVA 1H5UA 5I7RA 4MEJA 4Z4HA 1K97A 2A1JB 4M2YA 2RONA 4R8MA 1SCNE 4NYJQ 5EPUA 2QRUA 4QWDA 3F5SA 4Q7KA 3DA8A 2IHJA 3VV3A 1ZOLA 4B87A 5JOQA 4KVAA 2QD4A 1VJTA 4Y2GA 4EBEA 2CSXA 3N3BC 1YZ6A 2I67A 2QI9F 3QMPA 3ZBPA 4EA7A 5C1PA 1JBQA 5L3SB 3LDFA 3OWXA 3OETA 3ICEA 1CPYA 3U3DA 2A4KA 4C6TA 3BK2A 3JQ8B 4ZIRA 4PXYA 3EFOA 1NI5A 3IUNA 4YRBA 2JD0A 4Y6GB 3FVQA 3V8QA 4NJ8A 4J3JA 3I9FA 3RIYA 1M2VB 3NTUA 2PBZA 2OQRA 4JYBA 4DNQA 3VR4A 5IYZB 3CU5A 1KO7A 1NDHA 1SL0A 4RJ2A 5T5QA 3KFXA 3TTVA 1S8FA 4UOEA 1DO2A 1LSJA 4CN8A 1RZRD 5HTKA 2WTFA 1KO4A 4D25A 1U7HA 2EWMA 4Q9KA 3TX6A 3WGTA 3R0JA 1OXTA 1ZC3A 4GXQA 3C3PA 3KXLA 5LZ9A 3EWIA 4JI5B 2HWXA 1A04A 3PHGA 1L4GA 4QT0A 1ZS9A 2ZVJA 4TQSA 1XZFA 5T4BA 4BQPA 4BKPA 4D8TA 5JMWA 1KLNA 4YK7A 5AHOA 3G2LA 1TA0A 2NAPA 4W7HA 4A82A 3DZKA 4EH1A 1T0UA 2C97A 1CY1A 2WYHA 2EJWA 2JCGA 3T3HA 5MN5A 3OZBA 3H9UA 5U4XA 2X19A 3IMFA 3Q87B 3WVNA 5LMNB 2Q1YA 2X4LA 3NWPA 3I2IA 5DB6A 2EU8A 2P5YA 3KZ1E 5HE9A 5J2UB 2IHUA 4NCXA 5F7XA 1F9EA 5IT9A 1Y33E 2HIMA 1RRKA 1IYZA 2IPOA 4YRZA 1AZWA 5JQGF 5LP6B 3DCJA 4YA6A 4ZV7A 2OK8A 1G7CA 1GQYA 4QLBA 1ZP6A 4F4WA 1IZ8A 1SXJE 2OXTA 3RJFA 1EA5A 2Y0CA 3IDWA 4WPGA 4R1QA 4PHDA 4Q82A 1A5BB 7REQA 1JMVA 1RXYA 4I1UA 5IM5A 1H4TA 3K2EA 3K0FA 3NXKA 2OCGA 4DM4A 5ITWA 2A1TR 3ZVMA 1Z2PX 1PWHA 3RVKA 3TL6A 5E4YA 3K09C 5HCUA 3S55A 3UYLA 4K3VA 3NRWA 5DDIP 1BPBA 3WIBA 1Q7EA 4JUIA 4YBZA 4ZQHA 1KQNA 5BW5A 1A2QA 2WTMA 2ONCA 4FT4A 2XDQB 4FHDA 2CE2X 3LY7A 2QYHA 5K8IA 4IDHA 3D4BA 3M7DA 2XMRA 3LL7A 3LVRE 1ZQVA 2BFCB 2IUUA 5JXJA 3K0EA 1J8DA 4MEYA 1JQLB 4OHRA 2GEDA 3TKYA 4WK6A 4JYCA 3KUCA 4I5EA 5ELXA 2Y1WA 3PNVA 4ZVMA 1RYUA 1L6RA 3L6OO 4DIUA 1AUXA 1U7XA 3PWTA 3JQGA 4JP1A 5CT9A 4EECA 2GAOA 4CKCA 1QHSA 4MHSA 1K6EA 1NNLA 1J5XA 3MMNA 3K1JA 1VL8A 1ZQPA 1RBYA 2BIFA 3FPKA 3ZR4B 4FE7A 1TCAA 4JU8A 2KHZA 5CA1F 1BFUA 2HHUA 3MR5A 1UJCA 2MSEB 2EKDA 2HIHA 2CYCA 4J7AA 4LJKA 3P94A 3VR2D 3U09A 2YY5A 4AD8A 1ZDMA 2OFWA 3BQMB 3KQHA 3IHTA 3ZV3A 4D92A 4N54A 3H5IA 1OT3A 1XCOA 4NAHA 1Y7IA 3HGQA 2PZKA 4LDPA 4YWHA 3PR3A 1RKVA 1NW5A 5KFEA 4BNFA 2JIOA 4MWSA 3V7UA 1UBJS 1G8KA 1JAYA 1PJCA 4RADA 1B22A 2OBBA 2AG0A 3WIDA 5J4HA 1HG0A 4QYTA 5IIIA 1L8OA 1SG6A 2H4JA 1TM5E 5B3AA 1D1QA 4D96A 2C3YA 3G88A 1SBNE 4TWJA 1UJ2A 3V6KA 3IQGX 3QW2A 4XFKA 4EFMA 3PW0A 1VIYA 5EVJA 9ICVA 3QA3E 4BMPB 2UVDA 2N75A 5EUBA 1B7GO 1KJQA 1I3OA 3KZCA 5EJAA 3WYDA 3I6MA 4LVUA 1LDYA 1F2TA 3D8NA 3EGEA 3EF1A 1YFKA 3KBOA 2OL4A 3HZHA 3NX4A 3O95A 4RDXA 4GKKB 4B32A 1Q0LA 1COZA 3TIXB 5DGXA 4Y2TA 1FPQA 3QX9A 2PSJA 3NANA 4CMGA 1WUIS 1CFJA 1HT1E 1U90A 1PJTA 4H7HA 4J0FA 5DDMA 1ODSA 2NPIA 1KR5A 4P4SA 1OPXA 2IS6A 1JPJA 1S4QA 3D2BA 1TGYA 4N5HX 1DKOA 4BBZA 3ZX5A 3HCCA 3T0GA 3V1MA 3D6FA 5EERA 1XA0A 1JHDA 1M2FA 2PPLA 2X77A 2Y93A 3CUVA 4A8JB 1U3TA 3AIMA 3MMSA 5CA1B 5JSZB 5FOUA 4F6CA 2IZ1A 3EPRA 5REQA 4RUCA 4JEHA 1QOQB 2H1FA 4FEYA 1YR1A 5KYNA 3GNTA 2ASJA 4E2XA 3BBPA 1ZM9A 4I9UA 5H3HA 1Q44A 3AHDA 2YB4A 1EJ6A 1T5OA 4RSGA 4TKUB 4CI0B 3IQEA 4ZGWA 2YZ2A 2PD4A 3UXMA 4TOIA 4IIFA 4BDPA 4B4DA 1BG6A 2O5VA 4EZIA 3DR5A 1YR8A 3O4FA 1PD0A 3H86A 3TTXA 2F9FA 1WXDA 1U3UA 3IRUA 1PZFA 5K45A 3C1ZA 1CNMA 1XVVA 2G63A 3JQ7B 4QWAA 1I2BA 1C30B 4AZ3A 3SHOA 3FPEA 3INRA 1OJLA 3OQHA 1ORTA 5CVCA 5AXDA 1VCMA 1WXEA 3PQFA 1GN9A 2CWWA 3F4LA 3ELUA 2XRZA 2VN8A 1QRDA 3T1QA 1Q6YA 3E18A 4PGFA 3GR6A 5KINB 3NBAA 5FCDA 1AIPA 1SC3A 1YRQA 1E2IA 2BWJA 5C8XA 4DO9A 1A8SA 4IIVA 4JKIA 4DARA 1IBMB 5DSTA 1AGYA 2AUNA 1ZQIA 2YKGA 4NMMA 4MLPA 4RF4A 1DZ3A 4QQRA 3LZCA 1YS9A 4P2HA 3PFFA 2IHMA 1H4VB 3FYSA 5J2TF 3T3PB 3VYVA 3HT3A 2FPOA 2OORC 5BMVA 3TPZA 3A3KA 1G8JA 1AGPA 1KJJA 1UFVA 2WMNB 3FI9A 1NQTA 5DHQA 2BGJA 3AJDA 4A0HA 4H3HB 3HRHA 4AJKA 4QGHA 3HM2A 5FYDA 2QR5A 4W1RA 4B3MB 2F64A 4J9KA 1NFRA 2YTZA 1CR0A 3MWLA 1AX9A 2KJQA 1OXJA 3T5HA 3EDOA 4QEZA 4QYMA 1E3QA 3MSCA 1N2XA 2NO5A 3ORYA 1A5TA 1I4OA 3K5WA 4TRJA 1ZU5A 2OH2A 4PN3A 4RKYA 2IOFK 4MQBA 2DTDA 2ZR9A 4LHXA 4L72A 4ZO8A 1UAGA 1ORDA 4E08A 4MQ6A 1NF2A 4FPXA 4XDYA 4AKEA 4EUKA 2OBXA 1T25A 2WJ4A 5FPQA 2VJKA 5HHHA 1PYGA 1V3VA 3AG6A 4EEKA 3NALA 4OHOA 3I09A 1UADA 2ZBEA 1E96A 2L19A 3DS8A 4NBTA 4HBZA 4OHYA 5JD6A 1CDZA 1UFQA 1E3LA 3AM5A 2ZWMA 1WP4A 2DR3A 2CNWD 1I80A 4X20B 4PX5A 3QG1A 2DZDA 8OHMA 3E0XA 4OFZA 1CUKA 1FYDA 1OUMA 1F8GA 1JDTA 3W2EA 1W88A 4TLAA 1HWYA 1B2RA 2Z2ZA 3O4RA 3UYKA 4DAOA 2ADOA 2IXBA 4YVFA 3OQIB 5CWRA 2CRXA 4MOWA 4L9WA 2IDJA 4NENB 1XO1A 3HKZC 2V97A 3BGWA 5JXWA 4YMTA 2ZWAA 3K4PA 4W5WA 5CM9C 4ZEWA 3BFKA 3FHOA 4OKSA 2NV0A 3BXPA 5F21A 1FNNA 1JX4A 4NY8A 1FMJA 5DLQC 3WGKA 1HDZA 1LFAA 2G1UA 4G65A 4EW2A 3T5CA 2ODPA 1R0RE 4YRGA 1VIVA 3SYKA 4WCDA 1RAIA 5AKGA 4ZYLA 3H1AA 4EFNA 4JYMA 2W03A 1KI1A 3JRNA 3O8OB 1GRVA 1N77A 2XMSA 3OKCA 3GAZA 3OC6A 1IVSA 2JIQA 2NT3A 3FYTA 4S2EA 2IU4A 1KZ9A 5HM6A 5JFGA 2P65A 3H0KA 4O2LA 1QCCA 4OXXA 3K5HA 5LQSA 3SHVA 2PKQP 1CUAA 3BHJA 4H4DA 4Y1RB 3ME5A 3E82A 5KO2A 1I5RA 1TVMA 5E7MA 3AERB 3EPIA 1QC5B 2AW5A 4WKOA 4JVMA 2FG6C 3S2SA 1PTJC 2KFZA 1SAYA 3DMNA 3ZUPA 2BFNA 4YN3A 4EB3A 4FYYA 1FP6A 8ICAA 4I4TF 4JZKA 3K6SA 1IUOA 5DG8A 1TLFA 1ZOIA 4HR7A 5A03A 3A6KA 2MA1A 3DC7A 4CLRA 2W8ZA 5K3OA 4YASA 3WMFA 1T9KA 3SKXA 3RUPA 2H3HA 1CY4A 3AV3A 3GT7A 3DXXA 3NTVA 5AI9A 3W5BA 2C22A 1EDDA 1R8QA 3N39C 4TL9A 1HLGA 2QARB 4LRQA 3SXPA 2AQ0A 3OQPA 3U19A 1J5EB 1N1GA 3RRFA 3KSUA 4KX5A 1BXRA 4BX0A 4XVCA 1XLUA 4N5NA 3TW4A 1D1TA 4HF7A 1QO9A 3PEEA 4PGMA 3IB6A 2C2HA 3DPIA 2WSMA 1CQXA 1E3IA 4KQ2A 4U7WA 4MNTA 4X65B 5AKYA 1E3SA 3SG0A 3L07A 5DT9A 5ALKA 2GM9A 1TKBA 3U3ZA 5JCOC 1N5OX 1SHJA 1U8ZA 4MR9B 4N7BA 2HA6A 4D8UA 4DUGD 1FOEB 1XIVA 4GXRA 2YUIA 5EVCA 4FMCF 1SXDA 1H9BA 4LBVA 4XAQA 1HTWA 1G291 3EQ6A 3MCAA 2SKDA 4PFSA 3B3JA 5DFAA 3HABA 4JXKA 2R18A 5DYTA 1TK5A 5CT6A 2OB2A 4MZXA 1ZD1A 4YR0A 2R8IA 5TS3A 2FPPB 2W83A 4LPSA 2QUZA 1HURA 2X40A 2ZS8A 2Y8EA 4R81A 3K1AB 4OUDA 4F2RA 2VT3A 3ZDEA 2O5RA 5DNAA 5JDCA 1T3LA 4QWEA 1W6UA 5KG6A 1DXYA 1BXGB 2QMQA 2YV4A 3D7RA 3JD4A 3P0EA 3QI2A 2JXJA 1K7XB 3OTQA 3FHTA 3I0ZA 4YPVA 3T7CA 1BXGA 1M10A 5K0CA 1MBZA 2VC2B 4I2NA 4NYMR 1YJBA 5CHYA 5TDHA 2WYOA 1ZQXA 1MB0A 3BG5A 2I3ZA 1S01A 2P3OA 1TZKA 4CMAA 4BECA 2C2EA 2Z57A 4YCMA 3RK1A 1VB5A 4OO1J 1XWFA 3CJRA 4OM7A 5FRDA 3T4PA 1ZW1A 3M81A 3BFVA 3SR4A 1PJAA 3MOGA 4UMFA 3ZLTA 4L0MA 4PLYA 4KR3A 3E35A 2WM2A 1S9HA 4G5RA 5TE9A 2KJ8A 4J43A 4EAQA 4KNYA 7ICSA 3UBMA 1YHNA 5BR1A 4YV1A 3B1VA 4IGKA 3RSCA 2PSDA 3F4BA 3ED1A 1P2FA 4LHYA 4MWBA 1ZWKA 3VU0A 1W6RA 4IMPA 5AWFC 3ORRA 5EQJB 2YIDA 3GAMA 4KN9S 2AJLI 5KFGA 4U2BA 4D0LB 3B1FA 5EUQB 3OGUA 4YT2A 2VWPA 1KN5A 3O1HB 5BOVA 5I7WA 5C18A 2ACWA 2C4KA 3HO8A 1OXUA 3GARA 1KEWA 1UK6A 4G4SP 3GGPA 4G4GA 4L16A 2HBMA 1BXRB 1PNQA 2DH6A 5F3RA 1TL7C 1D0VA 3KKAC 1E9BA 5D6NA 2G4CA 3RLFA 4LF8B 1T1SA 2FMQA 1YDWA 1YL7A 2NZXA 3ZNPA 1O3YA 4Q9NA 1POXA 1BEEA 2O7VA 4FKBA 4WKNA 2Y99A 5JD3A 5LCXA 1R4MA 2W3SA 3AWDA 4EW3A 5EXTA 1T3TA 4YRIA 3X1MA 3AF4A 4UPVA 1DG9A 1HUOA 1JEDA 2CUKA 3C0KA 1P91A 4F8EA 3ZI7A 1R0XA 2QU8A 2A86A 3GJQA 4YXFA 4DWJA 1NDQA 3MABA 3WG9A 1EFAA 4N0QA 1WSDA 3GEDA 5J0UA 1KK3A 3RJKA 3FB1A 3PF9A 5BN1A 5KC8A 1EQUA 4DL7A 4K88A 1U7PA 5JAOA 1AA9A 1PW5A 1MQ9A 5JVDA 2W2NA 2V7QD 3ZQ4A 2G5PA 1OC4A 4K9OA 4YJHA 3ZLUA 1Z4QA 4MFCA 1UJNA 5EYPB 1J7KA 3DVRX 5HMMA 3EHDA 4BVHA 5I9LA 3M5WA 3JQRA 1ZUIA 3IUYA 4D7AA 1GP2A 4B3XA 2X5XA 2WP8J 3W34A 2P2NA 1JUDA 5CVTA 3FOZA 1CUZA 1IB6A 1IY1A 2WD8A 3PD7A 4WIAA 5EIFA 3TW8A 7ABPA 4IQ0A 1VC2A 1YZLA 2C2WA 4DXHA 4K6HA 2B69A 3KZMA 4F93B 3NBZC 4LXIA 4E22A 4MJ3A 3KBBA 4UEJA 1QGUA 3KHUA 1RWQA 4IH1A 1DAKA 3VQTA 5CH3A 4DBVO 5AHKA 3UAVA 4QZ9A 5A5FA 4RZRA 2QTMA 3SHTA 5BQ3A 2DUUA 1MGOA 4L8YA 4HYTA 3PJRA 4IO0A 4LHEA 4EYHB 3SJUA 1ZQAA 2YV2A 2YOFA 3ISCA 1FS4A 5BWCA 2JR5A 1SXJD 4YDRA 3ZGXA 4DJEC 2GCOA 3D7KA 5DHFA 3D3WB 2QRVA 1A9PA 4GP9A 3U3KA 4OXRA 3IEPA 4HLQB 3CKKA 3HVKA 2J0EA 3NJ4A 2K8BB 2HRCA 5EGSA 4L4UA 4PSVA 5A2GA 4ZT5A 3TDKA 2Z2IA 1TAGA 3M6LA 3H2IA 4DJDC 1X9IA 2PFOA 1RAGA 4N5IX 3S2YA 2IT1A 3CRW1 2NU8B 5JWOA 5KNBD 4DR4B 2AQHA 4E14A 4U2KA 4RCVA 1XYYA 3HKEB 1RIIA 2A1AA 1VKHA 1KE1A 5IWCA 5JAZA 1BXZA 2QTHA 2ZWPA 4NABA 5DW3A 4ZCMA 1ULUA 2Y71A 1K5DA 1N2CE 3EGXB 2J87A 2V9WA 3DLAA 3GA7A 4OYLA 1VKJA 3GJ3A 2ZBFA 4P7BA 2WU1A 3ZLVA 1ISGA 1E79A 1TLTA 2C98A 2OWDA 2XCUA 4OH1A 1SB9A 1V2HE 3CZ5A 3IC5A 2EWWA 3DBHB 3H2KA 4G07A 3SSOA 3AKZA 2HW8A 2I7XA 4O9MA 2EFCB 1UBLS 3KB6A 1KDHA 1ZRHA 1M33A 2V5VA 2ODTX 4RPLA 5K3AA 3RSQA 4EWLA 1QTRA 3B6MA 5H16A 1JQ5A 3MMXA 2WYIA 3HSSA 3MWJA 2Q3MA 4UXIA 4WY2A 4DV2B 1GNRA 2C5BA 1E1LA 1MORA 1Y42X 3IQXA 2C4MA 2OAEA 4NS1A 3SZUA 4PS0A 1DRGA 1SCDA 2DUYA 3L1IA 5KEIA 3RBZA 2OUIA 2P1ZA 2R7KA 3P45A 3ABZA 3ISJA 4PAGA 4TXNA 1Z4LA 4C5BA 4UASA 5CD1A 2Z8YA 4W9RA 4O3RA 1YB1A 4GZLA 4IAOA 2XY4A 4XM2A 3ZS8A 5ESXA 1GGNA 5JUMA 1G16A 3I34X 1U5CA 4KFTA 4AYBF 1L5YA 2ZFUA 2V7VA 3HP7A 2CMFA 2JJQA 2N3ZA 4L95C 5KFOA 4KXWA 4QJBA 5EZYB 3DOOA 4DQUA 5GV7A 1OHHD 2C4WA 1YR9A 4BPRA 1A9OA 1L9XA 2OAGA 2PMDA 2FX5A 2Q2NA 1CB0A 2W2TA 3PYMA 3U3JA 1ECPA 1J90A 2AXTU 4QXQA 3GA0A 4BDTA 4M6WB 2A0WA 2HMWA 2H06A 1NFQA 2RB4A 5EWMA 5EJIA 5JROA 5KNDA 4RD6A 3LW8A 4GZ6A 1FFYA 3BQ0A 1GG2A 2J5XA 1E0AA 5B2FA 4CKEB 4AQ7A 4TZ6A 4FOOA 2JDID 2PYIA 3KELA 4NLKA 1NW6A 1SXJC 2HHSA 3E0QA 4QAQA 1HXHA 9ICGA 3NRZA 4ELUA 4RL4A 3U3XA 2HFJA 3G2HA 3OFKA 3ZE8A 4KN7A 1XKXA 2O14A 1XQWA 4RABA 4DSZA 4ZI5A 5CA0F 4HWGA 2IIPA 4QDZA 1AQIA 1O97D 2JAPA 3RVNA 3NGXA 9LDBA 1RYDA 3EXEB 4RD4A 4V0ME 1B6GA 3V7NA 3MCUA 1PZHA 3DOUA 1GUYA 3KKLA 4ENTA 4KO3S 5K3DA 4ETMA 1L8AA 2XMZA 1A8HA 3DHWC 1Y3AA 4HFJA 2FZKA 5BV8A 4BFSA 3L6UA 4DWOA 1ORIA 2HHQA 3MGVA 3IBYA 3HGTA 2BAGA 3GQBA 4GVXA 1DHRA 2OXIA 5ITVA 1ZQWA 4B48A 1U7TA 2NQ8A 4FGSA 3DVLA 4WESA 5KT6A 1RW4A 2QZJA 2XUHA 3LO5A 3CNLA 3T5JA 1LD3A 2PKEA 2J8ZA 4LC9A 5L3VA 3U1BA 2A78A 1LLQA 2FSFA 3RAXA 3F97A 2WW8A 3PEUA 2W37A 5THXA 2FP4A 5TT1A 3FVTA 3QWHA 2E48A 2ZS9A 4P82A 2VDQB 4CF4A 4XB1A 3T7DA 4ECEA 5IH7A 5JAUA 2C2MA 2OMEA 5ICEA 1WO8A 1P7WA 4J0EA 1OLSA 3GIKA 1AZLA 2LXNA 4QICA 4OKIA 4EP1A 1IL0A 2IKSA 3CF2A 4ZV4A 3NATA 4MQMA 1VJ0A 5FHRA 2JJ2A 1JV2B 2X86A 5HOEA 1OYOA 3D7MA 2A1TS 5CHEA 2PZJA 4Q1CA 4DQIA 4BQSA 2FR8C 3ZCTA 1X40A 3H4DA 4R0VA 2B1GA 2EKPA 3BDAA 3TLEA 3TLGA 3KHGA 1A72A 1JKXA 2CL5A 2UUPA 3NS7A 4QZIA 4DFJA 2H1SA 4FFLA 3ROQA 3UW1A 5FDFA 2Y77A 3DZHA 3FSGD 4HAYA 4BO2A 5JECA 5CJPA 4KR0A 4U8HA 2Q5EA 2A5JA 1XEWX 5FT9A 5DM4A 1SOAA 3KQKA 4R7ZA 4CMIB 3DEFA 3OT4A 5MFPA 3QFFA 2UUBB 4I8IA 1A0PA 1JX6A 1FTNA 2JFYA 1Q11A 4RM3A 4CRWB 1M74A 3NHFA 2XCTB 4Y2JA 1GPNA 1NC3A 3PFKA 3WL5A 1JIUA 1FRFS 4K4HA 4Z3DA 4RSMA 4G2NA 3CVJA 4NR0A 2W90A 2VK8A 2WTEA 3Q8LA 1GPUA 3G9XA 4M22A 4F2SA 4WEQA 1XEXA 3HJAA 1G38A 4OHXA 1WV1A 2YRWA 4BEBA 4IVPA 4ZRDA 3VPAA 4YMUA 3AUKA 2YTUA 3QKRA 5AJWA 1WHSA 5HK8A 3WLPA 5EMMA 1W8DA 3VZQA 3GJRA 5BYBA 4FYHA 4Y2SA 4XPIB 2WJWA 2ZP1A 3I9KA 1CUYA 1N9ZA 1KS9A 3DW1X 3F96A 3PJEA 4I2DA 2H3ZA 3RROA 4E1BA 5LU8A 2CEAA 5ER6A 5B5EU 1HYBA 3GJ5A 4HN9A 2WK1A 4J29A 2HHLA 3QPUA 3HCWA 4PF1A 3GBVA 3BJRA 3LLSA 5A3SA 3UHPA 1SFRA 1N5KA 1ZQMA 2PUDA 3IAFA 3OSZA 2W8BB 4QDUA 3T6KA 3NM4A 2A92A 2XA9A 5AUNB 6GPBA 2VAXA 4RAOA 4G63A 1NURA 5K9ZA 1QFXA 2HCJB 4GYJA 4QIHA 1MW8X 1O7JA 3KRTA 3MJFA 2WJVA 5JIBA 2ZR8A 4FCCA 2LW7A 4HHEA 5EJEA 5IXYA 4QJ5A 4DL3A 2Z8XA 3G5LA 4UUAA 1VE3A 1V39A 1JXEA 1CRZA 5CRXA 2XMPA 1I2DA 3AU9A 3K6KA 1U1DA 1TEZA 5L40A 4D3ZA 2B4QA 1AKVA 1MEEA 1NULA 2KBEA 4IDQA 3CEMA 3KU1A 3Q3IA 4KHZA 3RB8A 3T3GA 2G5TA 3NI2A 3TW0A 3UN1A 3UW3A 2GA9A 5TLSA 3MJEA 1C4OA 3IV9A 5HGXA 3IG5A 3EFOB 3OIYA 2HSGA 2KICA 4P93A 2BTEA 3EVEA 4H6PA 1IOWA 4EG1A 3PIIA 3VJMA 2GNPA 4IDAA 3RC2A 4JV1A 1WB5A 2ZCUA 3A6LA 3EY4A 1LK5A 2DPXA 2IWRA 3P2EA 3AM4A 4IUBS 1Z2DA 2P2DA 4JR0A 4QPCA 3C5HA 1UDBA 4OAOA 2VF7A 1QPZA 5KFYA 4ZAWA 2OENG 1KYIA 4F5PA 1K5PA 1NJ6A 2HZBA 3E9EA 3EHEA 1A8UA 2XGMA 1ZICA 1CB7A 3A1TA 4IDOA 4JITA 2R1ZA 3TQIA 4RE5A 1ABBA 3KEFA 1M8JA 2EP7A 3CJTA 3LCJA 2ESEA 1RYYA 1E2EA 1SCAA 5B4TA 2QZPA 1NYLA 2P6RA 3LSTA 5I7AA 5EPEA 2OV4A 3H8JA 3WICA 5KOIA 4I3GA 4NAUA 3PCTA 2PX5A 1JLHA 5CVVA 1J9ZA 3B0YA 1MGPA 2FNAA 3HE3A 2ZIVA 3LWLA 1K75A 4C43A 1U0SY 5BSEA 5DEIA 3R9WA 3MN1A 1LUAA 4P5DA 2HD4A 5HIIA 1QXSA 1F12A 5CIYA 3DZFA 4B33A 3DSRA 4OA5A 3G59A 4PYLA 4P4OA 1MRSA 2G9VA 4C29A 2KZ3A 1AKTA 1KOGA 5TS2A 1NUQA 3FWZA 2JFFA 4HN2A 1P18A 2R11A 2BMJA 2H7XA 2VUIB 4B2IA 3KQNA 1WMAA 1R4ZA 1E2HA 3H5OA 1OU4A 2R60A 3KJGA 3U44B 3OE5A 4RA6B 1RJEA 2FMPA 1SOUA 3WMEA 4NLZA 2WIBA 5EIWA 1NVMB 2Q28A 2WB1C 5BWOA 4OB8A 5AI6A 5GJBA 3S2FA 1PG0A 5B66U 4G5GA 4EENA 5K4GA 1SXIA 5KT3A 1NI4B 4AQYB 4GZ3A 3OPYB 3CPEA 5ALMA 2RC5A 1GY8A 1PU2A 4J4TA 4ELTA 2SBTA 1YZUA 3KPWA 1ZUNB 3PCRB 2PZGA 2EEZA 4KQXA 5KFPA 1XC7A 3RABA 1DOQA 8MHTA 5KFKA 1WEHA 4JBWA 1DAEA 4XD7D 3V34A 5FWNA 1IUKA 2XI9A 6ADHA 2JBAA 1BW9A 2VDWB 4IJUA 4NICA 2EG9A 5CDFA 2AMJA 1GU0A 5JMTA 1JVBA 1MAVA 3LPAA 1P7CA 2BC9A 3AW9A 4CG0A 4RYLA 2UUAB 3RVSA 9ICTA 3ANTA 2CFOA 4UBOA 1NBAA 1II9A 2BW0A 3GO4A 3K6JA 2GCOB 4TTQA 2G83A 2QG6A 3ZLJA 2PZFA 4Q05A 5FIUA 4BWMA 3GFSA 3H3XA 5HRAA 3WRYC 4ECZA 2PKWA 4TN5A 1SVLA 1T3SA 2GX6A 3HKBA 3TFRA 1TF7A 2ORIA 2K60A 1PSWA 3B8HA 4MYHA 3UFBA 4B2PA 1CVRA 1WX1A 1ONPA 4EPXA 1QZ3A 1L3TA 2A9JA 1XVIA 3PE6A 3GP3A 3WBJA 4BEWA 2O3RA 1QOPB 3F90A 2KYRA 3AZPA 2GARA 2W6PA 4O2BF 1AQUA 2W71A 3IT3A 4AWBA 5DG9A 4JOBA 1NQWA 1JTEA 3E7WA 3N5KA 4V2IA 4YDSA 3C39A 3UK2A 4EYOA 5AKZA 1TYBE 2VHYA 1NX6A 2GHRA 1D3AA 4LCJA 5DP1A 4B34A 4DF4A 1N61A 1TQ8A 1WSBA 1PK7A 1P81A 2DU8A 2QWXA 5AKLA 1E7RA 4XEUA 1IE3A 2MYPA 4N3BA 2Q1TA 3FCCA 3U62A 2UAGA 1FFAA 1Z5NA 6PFKA 1IN1A 3KQSA 3RJMA 3C3AA 4JL5A 2IHNA 3B3AA 4D6PA 2IYLD 3WL7A 3MEQA 5E6UA 2MSKA 1QC5A 3N2NA 4X8HA 3MVEA 2QG9A 1ZSNA 2VNKA 4N03A 1QLHA 2P67A 1E6WA 4CEJA 1W1WA 4A7PA 4BL5A 4F72A 3D0OA 4FOPA 2HQRA 5DEOA 4C7OA 1E94E 2IGTA 4MV1A 4DRZA 2C4UA 3CUEF 4TZTA 3S2ZA 1QRAA 2VCEA 4ZCTA 3TUZC 1TAHA 4MTCA 4G0WA 5CLJA 5EE9A 1R64A 3UJDA 1CJUC 4BEVA 4U3JB 4RD2A 2NXNA 3T7RA 2WI8A 3CH4B 3D3EA 3RV3A 3MT9A 3PDCA 4MVJE 3NAZA 4AKHA 2AZDA 2NU9B 1VG9B 3PC4A 3ENQA 4H4CA 3AR5A 4M1TA 2J7KA 3CG4A 1OTXA 3T7TA 2LR0A 1J1ZA 1DQSA 3OZXA 4PZZA 3QVMA 4OI2A 2NZYA 5CM2Z 1FK8A 4GR4A 1S2MA 8ICMA 1DEHA 4NENA 5C5DA 4JB8A 1OF1A 4UHEA 1O95D 3TGWA 1TVAA 5LP6A 4MVJG 1W88B 1UKCA 4KOAA 4ECTA 1KFCB 3H5TA 4IXTA 2EFEB 4YRJA 3THXA 4Z4EA 4KUHA 4BP8A 4DQKA 2MYUA 3MDAA 5IJ0B 5TQ2B 4HC4A 2R8XA 4ZJZA 3LK9A 2V8BA 1KSFX 2OO5C 5KIAA 2BCSA 2BSAA 5E7QA 4TMTA 4HRAA 2RGXA 4RKWA 1BEUB 1S02A 2JA2A 2UYOA 2PL3A 4GBMA 2DSTA 4I4IA 3VPGA 3ZG6A 3ZWOA 5A7HA 1E2PA 4USAA 1O1YA 4UAZA 1WMDA 3P2JA 4IDDA 4LJAA 3RF9A 1C80A 4UTOA 3D2SA 1C4KA 3ZXYA 3K1TA 3U3OA 5LQAA 1Y9AA 2C84A 4IX1A 4CG3A 4IP0A 3ZQ6A 1ZK2A 5HZKA 1TDJA 2ERXA 3HB4X 4PCAA 4F2DA 1J22A 1K1SA 2JFWA 2AFVA 3E22B 1DJQA 5GP1A 3AM1A 2XV1A 5JW6A 5FNVB 3W9UA 5A1TA 1P3JA 2GLXA 2MYTA 3AR4A 2Z04A 5T6MA 2QX6A 3JQBA 2PGXA 3VNRA 3IR5A 2GCGA 4EDFA 5BV0A 3H8SA 1GSOA 1BEZA 1PDOA 2JLSA 3DZDA 3OCXA 4L57A 5EIBD 1V7ZA 3EG9B 3P96A 3Q0EA 2I03A 3VSCA 5I7VA 3DT6A 4UEQA 1N5RA 2IYTA 3LT5A 4K9NA 1JEEA 5L1IA 3JD3A 1YAJA 3DL7A 3K9NA 4XQ0A 2YQEA 4C7YA 1V4NA 4J2OA 3SPXA 3CFYA 4EG0A 2BGTA 2J85A 1WJGA 3DFKA 4RIHA 2BCEA 5HGJA 4YJ2B 3RR7A 2QD1A 3AEUA 3DFFA 4GXIA 3B48A 2ZEJA 4NZNA 2WMYA 1NI4A 2DPGA 3O1JC 1FDOA 4R63A 2FB9A 1AH2A 3D8RA 3HJNA 2FLPA 2OD9A 4HY3A 1DMSA 1MJNA 5CUQA 1RM5A 2I6GA 3AMZA 5GGYA 1N2EA 2OXFA 1CUJA 1F17A 4S12A 1KYWA 1TQ4A 5JRJA 1K63A 3A9TA 1ISFA 4PICA 1L8QA 3SSNA 3A6GA 1H66A 4B9TA 4C7VA 4R9UC 2OHVA 2PVCA 5FUQA 4AI6A 4OHVA 2VHUA 1COWD 1YF3A 4Y0AA 5IDVA 1I7DA 5CBPA 1GGVA 1SG0A 1NY6A 2AZTA 1KF0A 3CG0A 2A5LA 3KOUA 4WZAE 2NXCA 2NPFA 5LQUA 2FZCA 4DWIA 1OFIA 3PNOA 4JVSB 4EMBA 3ELBA 1YL5A 2A0XA 2DEUA 1W5BA 1YE8A 3IPXA 5CLHA 1J4AA 1M6HA 4CV2A 3ZZNA 1IAQA 4EUHA 2CV1A 1Q7RA 1VLBA 3C2KA 2ZSFA 3SYNA 2JGJA 4DMHA 4HXEB 1G59A 5D3KA 3QH4A 1Z12A 1B74A 2X0RA 4OGLA 4Q7EA 4P4TA 3EYZA 1FDSA 2O0KA 3TOSA 5JS6A 3SC4A 5L53A 4UKDA 4G56A 3KE9A 3ZZ1A 3DTTA 4QL3A 5KB3A 2XF8A 5D2CA 4CT5A 8ICNA 2D8AA 3P4UA 3A7EA 4TL7A 3WWDA 2YY7A 3NASA 3JS5A 2J30A 4RQ1A 3H9BA 5LLDA 2B21A 5COAA 1X6IA 1O94A 2DHCA 4BX8A 4MF2A 3I0NA 3BMOA 3O75A 4LZLA 1DPFA 1V1RB 4Q7MB 4X5OA 6CHYA 4Z9BA 5JS7A 2H4WA 1IOVA 2W54A 1TM3E 1DBSA 3VKUA 4MA4A 2EAOA 2PK3A 4Z1OA 4RHFA 2OV1A 5HHTA 5K0FA 4RQ3A 5K6AA 3WYBA 4IL6U 1HEUA 3KAQA 1C9MA 5ECYA 5JWHA 1OPRA 4NE2A 3MJHA 2W11A 1R3DA 5F7JA 3N1UA 2UVUA 3X1ZA 3HPOA 2VJDA 4ELVA 2CL0X 2BCJQ 4O08A 3WAKA 3FTQA 1BFDA 2JI7A 3T7SA 5JJKA 3PEVA 4YAEA 2C2YA 1JSZA 1XEWY 4IHKA 3SXUA 4AF7A 2W4QA 4LYFA 1KGSA 5A3JA 1NQUA 3P32A 1L5FA 1G42A 1C1YA 1BDBA 1BVSA 1U9IC 2EZ4A 2Z3WA 2MSNA 5KFHA 2NYRA 1XQXA 2B7BA 2DBZA 4RK7A 2C5LA 4EBCA 1P1RA 4EVSA 1V9CA 2P0YA 2MDTA 2ECOA 2AU0A 1C50A 3BE8A 2CMGA 4NG5A 2BZ0A 4QBTA 4RQTA 4BFZA 3REGA 1TUBA 9ICEA 3VDRA 5H59A 1VLHA 3E3NA 5L3QA 4BTVA 2NVWA 1NMXA 3CV3A 1SA0B 2VK1A 3A25A 3L1VA 3O2NA 3SQLA 3T34A 1TJ4A 1B0XA 2IIQA 3H1FA 1KERA 5T6BA 2WIGA 1P44A 4FE4A 1V38A 2VLIA 4F4YA 1E1CA 2J0UB 4D9CA 3QE3A 2WD9A 4FBTA 1BDIA 3F6PA 1G21E 1Z4IA 2HEGA 1EX6A 1ICEA 2XH8A 4UFPA 3H2YA 2XDQA 3NYRA 4QFMA 4NIMA 4N6OA 4OGGA 2X8JA 1K8XB 1ACLA 2ZE8A 3IA7A 3IAS6 3L7CA 4C78A 4QODA 1X7GA 1NE7A 4RULA 4DEXA 4E5VA 1TZ2A 4CCAA 2HUPA 4Z49A 5DKWA 8ICVA 1N5DA 1WMBA 1XZPA 1Q3UA 2ZB8A 3E4DA 3LDHA 1PT6A 4PYKA 5J0RA 2JLCA 3UJ9A 3WTCA 4CR7A 1JFVA 4Z9XA 3W5IA 1YSCA 4O59O 3EZYA 4HI0E 3I39X 1Z17A 2ZANA 3IP8A 3OX4A 1ZL2A 4GQIA 2W9MA 2C2XA 1BKDR 2EATA 4LI0A 3IDFA 5IMBA 4CLOB 2M6LA 3MHTA 1JJIA 1B8VA 3JQCA 2IHVA 3A9SA 3JV7A 4L5AA 4R1TA 4YUZA 2O7QA 1F2DA 1JXAA 2QX8A 4K7JA 3V6MA 4QWWA 2WFZA 3EYWA 1HFEL 4EB6B 3LKVA 1DGSA 4ZVKA 4BNMA 1NLZA 3VYUB 1ZQ1A 1N6HA 1D1SA 3OJXA 3D8TA 1AE1A 1LFDB 3FZEA 5HBGA 1Y89A 2IHZA 4C0KA 1N78A 1OI3A 4DN6A 2GHTA 4U6SA 2DXIA 1L2TA 2FPUA 4K03A 4Y2UA 4NJMB 4WZBA 4BNKA 4FHEA 3UAXA 5BR8B 3ACBA 4RO0A 5A9TA 1GZHB 4KE6A 3FW1A 5LB4A 3PFNA 4J0QA 4CLOA 3L84A 5K99A 3GCGA 4Q18A 1H8HD 3L1KA 4RW0A 5JAIA 3OKPA 1T9GS 1Z0SA 5ALLA 3DBRB 2K4HA 3HEAA 2B1QA 1XVLA 3EDMA 3UJ6A 3W6PA 4MW6A 4MUHA 1JKMA 1M3SA 2KJ5A 2CKMA 2OBFA 3AUOA 3AUFA 1QQ7A 3I64A 3ZOZA 2DAPA 3RT9A 5K8UA 2HN9A 2AG5A 4NNOA 4GFDA 5LWHA 1BOFA 4R54A 1EBBA 3TPCA 2ZRCA 2IXTA 3UGTA 2XTNA 3GRRA 3FYDA 1XTJA 3D6JA 4CGZA 1NXPA 1RWWA 2R6ZA 4I55F 2OVBA 1JU9A 2GO1A 3IXQA 3M6UA 1SKYE 2DRIA 4YJ3B 2AMLA 2VPPA 5I4BA 2XNDD 1IZYA 1FFWA 3KCQA 3PC6A 1CQJB 3QX3A 4KI7A 3GBPA 1B23P 1N7GA 2QN6A 4UMEA 3RQIA 4B80A 4EO9A 4YJ3F 3LBFA 1U5AA 1EEXB 3ONDA 2EFGA 3KZXA 2PSHA 3U2QA 3EXEA 4BO1A 4YDQA 5JD5A 3A1EA 2WIAA 4Y9SA 1YB2A 3K73O 2Y1OA 2EWVA 1PGPA 4RLQA 2MSWA 1GDDA 1SXGA 2PS9A 3CF6R 1J2JA 2BGIA 4BLQA 4RCZA 4CEHB 3OTHA 3WQBA 2G71A 3R3UA 3LXUX 1EP3B 4TQUS 4W1SA 3D0KA 3AQ4A 3OF5A 4BFWA 4CL3A 4XVUA 5BUQA 3RYCA 2MSDB 3D3JA 3WU2U 5ALVA 4H60A 1OIVA 4FX2A 1UWKA 1G6HA 4UB4A 4KGDA 3TLAA 2W5UA 5KTPA 3GEBA 1I14A 2H31A 1WCNA 2EV9A 4NYMQ 5FBKA 4BUGA 2JKYA 2OM6A 3L01A 3FN4A 1EVJA 1KPHA 1XLTC 3NTRA 1XN4A 2Q0QA 3ZW9A 3R3SA 1XHLA 3RS8A 1LPMA 3GROA 4DXDA 4BWJA 4ECXA 3NNNA 1TK2A 3MF4A 2BZ1A 4Z6CA 1VHLA 4HDMA 1EHCA 3DPSA 2RCYA 3EYAA 1YBVA 4JLPA 1SIWA 1QVWA 1XPJA 2FZ4A 2E8PA 3ILSA 5EN4A 3RC9A 5DWVA 4KIJA 4YRLA 2VHEA 2M6KA 3U7FB 3BXHA 3U31A 4ZZIA 2R8EA 5ED4A 5LOVA 2J6HA 2JANA 1WMFA 1MB3A 1ZGCA 3HDQA 1SUFA 2II6A 4D0RA 4DL9A 1WW8A 1JEQB 1KORA 3OE4A 3MWGA 4US8A 4KDFA 3IE0A 4K5QA 2ZRIA 4NE9A 4PXAA 5EEGA 2WWRA 3EC7A 1AO3A 3FCEA 1EDOA 4ARIA 4G4JA 3JZAA 3H3JA 1YZVA 3NBUA 4ME6A 4QUAA 3IODA 4KWTA 4D9FA 4DA8A 1SD2A 4J6EA 2QP9X 3F5MA 3GFOA 3UUFA 2OVFA 4KQJA 3RLIA 4UTPA 1EVKA 1TV9A 3LOUA 4AVYA 5KKCA 1HDOA 2BN4A 3GPCA 4HLUC 5DBCA 1SCJA 2H1HA 1HE2A 1VHJA 3G9UA 5E9JA 2XXBA 4YONB 1UOQA 5DGIA 5J0TA 2W2KA 4AYBC 1S10A 4CR8A 1S2OA 1N8SA 1KFDA 2B1JA 4R8UB 3LUGA 3PRJA 5AM2A 9ICMA 4UTZA 1UR5A 3DD1A 4PNZA 2IA5A 1IMJA 1NZPA 5EJGA 3CH5A 4CQJA 1TEHA 4V39A 1F2VA 3HJTA 1UBTS 4I2FA 3RS5A 1GTSA 1DLIA 3HJFA 1QV9A 2WG0A 4E15A 4H27A 3FNHA 1QTQA 3ZY3A 1I2CA 5AIBA 4N1AA 4PRYA 1ZC4A 3GNQA 3PGXA 4F97A 3DLTA 1W30A 1NQVA 1JDSA 5AUPB 4HJRA 4QWMA 5KOHA 3HRKA 1I6LA 2AI1A 1UT5A 1JZQA 1K3UB 1W0KA 2C4NA 4LRWA 4EL0A 5KG7A 1C1DB 4BP1A 3KSAC 2AGOA 5C1BA 4BO4A 1CDOA 3BZBA 1V26A 5TV2A 4YUVA 4LC0A 1W49A 4P3PA 4ZYXA 1SC4A 1YI8A 1YBMA 2COKA 1QGED 4YJFB 1JJVA 1YDMA 3U4CA 2P9GA 1L7DA 5H80A 3U4GA 4I2GA 5CR0A 2VP9A 4NU8X 4WFIA 1AQLA 1VE5A 3FZQA 3M9WA 3PF8A 4PBTA 1Q0HA 5AI5A 1HNZB 4LJXA 1CUXA 1QX4A 2DPMA 3PGA1 1NFFA 1NUHA 4U39A 2IHYA 3C5CA 3P0IA 4JI3B 3VX3A 1WQ1R 2COEA 2UV8A 2PO5A 3WGHA 3RU9A 4U9UA 2REBA 1PNTA 4RHEA 1E9RA 1EX7A 3IEMA 2AYXA 1E2BA 5AUQA 1MT3A 2PY6A 2X2EA 3P9XA 4PNEA 2REXB 4M47A 2F1OA 5CW2A 4X00A 1HQYE 3EBOA 5KX5A 3T3NA 2BZFA 1D4AA 2PZEA 2Z2XA 4MX8A 3M9OB 1T6BY 4DIMA 4ZU1X 4CMIA 4EY7A 4ONEA 1J2YA 3IQZA 2JGRA 3L0DA 3LT1A 4IUCS 5DULA 4UHKA 3TQRA 1XLVA 1X7HA 2CVPA 2BF4A 2RHCA 3DV9A 4DCGA 4M4SA 2E87A 2AN1A 3VZCA 4E03A 2EQAA 4R2XA 3PP8A 1Y8RB 3QXCA 4TLMB 5FORA 5JV5A 1SZJG 2QPAA 1FFVA 2V3CC 2J45A 4I2AA 1JIJA 2QYSA 4YRKA 4PC2A 4WLUA 4H1TA 4FYMA 4M46A 1WCIB 4GNRA 4YP3A 8ICSA 1HKHA 2V6JA 1SVSA 4GECA 3KC2A 3VR0A 1SCIA 3OZVA 3I92A 4F38A 1BH2A 1R16A 2ZI7A 2O8EB 4M1KA 3WYGA 4KO2S 1QZTA 3TAHA 3SJZA 3HBMA 2YUTA 1Z5VA 2KVCA 2BR4A 4O2AB 4HGYA 2P5TB 4LGMA 3S4YA 3WL8A 2QTRA 1J23A 5C3UA 5FH9A 1PJBA 3ESQA 5MN4A 2XUDA 4ISBA 1C41A 3DBLA 3TRDA 4FW8A 2Y1GA 2IOFA 4ND4A 1PR4A 4UQGA 1EM8B 2WVHA 3OOEA 4N8EA 4QVKA 5ICCA 4RS3A 1N2ZA 1LSOA 4ED6A 4CUZA 4F1KA 2P1DA 4GLFA 4MWOA 1BCSB 3SFZA 4OQ4A 2XMBA 3ABSB 3W8FA 2PMWB 4Q01A 2I22A 5GJWC 1CEYA 2HL6A 4M04A 2JKZA 4FUTA 1L7NA 5HCIA 3V1YA 1GGJA 4BP3A 5JSHA 2Q9UA 1N57A 4HDCA 4C6TB 1O95A 3ZHYA 3OEED 3NM6B 4YRMA 5LL6P 5EWMB 2V1UA 1FX1A 4IH4A 2CXSA 2OC9A 4LTNA 3RAPR 4ZJPA 3R0ZA 2YZGA 2QX4A 2L69A 1J09A 1EUDB 4DOMA 2PRJA 3KLNA 4KC0A 5FTWA 4A73A 4BDSA 3MBYA 4M9NA 1HE3A 1Z75A 2V7QA 2XNCA 2ZRBA 1TQ6A 3FCXA 4FGJA 4EHFA 3PUZA 3WGUA 2H4XA 7AT1A 1ZJJA 1UBNA 2DETA 4RVUA 2XC9A 1C7EA 2WAOA 4EHDA 3WKAA 3D8BA 3L7YA 2RIPA 3C24A 1JDJA 3RUEA 1KY3A 3N75A 3NVZA 4DL4A 1HFKA 1MV8A 1JPNA 1KL7A 1D9ZA 2PR2A 3OUUA 4A8JC 4AKSA 1R0YA 1CCWA 1ZQJA 2EANA 1T8YA 2XGPA 3MQFA 5BSWA 1GQSA 2QSJA 4X1YA 3UAOA 4GZMA 4BOYA 3SZOA 2NZUG 1ZN8A 1T26A 3PDHA 4IXDA 5KJ1A 5AH0A 4DCTA 5HKKA 3CJQA 4ZAVA 4QIWF 1UZLA 9ICKA 1GPDG 1QHFA 2XWJI 2Z2YA 4GSYA 4WVFA 4AICA 1OWLA 1RS0A 1QCKA 1WNFA 2F00A 3DE2X 3JWPA 3OTOB 1JFSA 1ZM7A 3W4IA 3BXOA 4O4IB 1LKYA 1ZNQO 5FYQA 5CFNA 4B6RA 4X1IB 3JZMA 4DMMA 3OURA 2C5HA 3OLWA 4IINA 4KZKA 1H23A 4UHCA 4B3HA 1GUAA 1QU2A 1REQA 5JTIA 2DQYA 3FNBA 1SIOA 4FVTA 5FOSA 4CEIB 3UJHA 5CBKA 4R1PA 4JI7B 3WB9A 1J9GA 2WHEA 4B6QA 2H08A 4ZVPA 3JZFA 4B1FA 3PQ5A 2V98A 1M1YA 4KEAA 2VP4A 4WFKA 1OX4A 2O0LA 3F7OA 1R18A 4YXJA 3F3MA 3DF9A 3UFXA 2X0NA 2VA9A 2E55A 4BQIA 3R9XB 3LRXA 3M6FA 4FZVA 5J0PA 5FO1A 1TIPA 2XGOA 3FPSA 1J2MA 1GO3F 3C21A 4B9EA 1GV0A 2ONZA 3RUIA 4DMCA 3S1LA 2YMMA 3WK6A 3GGJA 4WLNA 4CMBA 4RNCA 4MDEA 3W5CA 1PK3A 5KG2A 3E58A 2PJUA 3BSSA 3E2EA 5I8PA 2I2FA 2EF0A 4DCJA 3A9WA 4P58A 1OXKB 3PDIA 4Q66C 4WRRA 3U7JA 1FLAA 1KFJB 3N74A 3NHSA 4Q43A 2ZJZA 2DFDA 5AM5A 3MUNA 2QF7A 2XOKD 4TXLA 2GTIA 1KJ8A 1PGNA 4F3CA 4Y1RA 5CD9A 1X7YB 5F2NA 3PD1A 1XZJA 1ECBA 1N4DA 1SJ9A 1Z38A 3GG2A 3T9CA 1G20A 4UD6A 3V1NA 4B5LA 3D81A 1WPXA 4MCIA 3P52A 5FAKA 3AEYA 2EX1A 1VKZA 2V6FA 2ZBQA 3QPAA 1SZCA 3ABRB 3QLEA 3V3KA 2Y0SC 1UA0A 2H9AA 5EGNA 1UBFA 1Y9EA 1ZQYA 1KO1A 1W4BA 5ERGB 2P79A 1XGKA 2EH9A 3TLKA 4EY3A 1HZZA 1NOMA 3ZHBA 1P1IA 1R9GA 2DBYA 1HE5A 9ICJA 4BC1A 2R6AA 4Q4DA 3JQPA 1PNRA 1KU0A 4XR4A 3X43A 1Z16A 1Z22A 1L4HA 3DG9A 3O8CA 1ECCA 3QFCA 3WLKX 2FUG6 1NUAA 2FRDA 3QIAA 4MYTA 3A6PC 2DFTA 3ETJA 3BMNA 4YFKA 2Y1JA 1XMJA 2HJWA 3FNRA 3WXBA 4FMPA 3U1TA 1K0FA 1K3FA 4ZCRA 1QGUB 1XPUA 3IE2A 3IIEA 5E79U 2A59A 1GCOA 1UPFA 4ARBA 3MJ4A 3U26A 1YIOA 3MILA 5CB1A 1K86A 3H2GA 3L1JA 4M8NE 3SEAA 3FI0A 5HZMA 4PHPA 4C1NA 1QU3A 2OSVA 4IRCA 1E32A 2ZB7A 4DF3A 6YASA 1YJ8A 2UYYA 2PZLA 2A7XA 2ZLBA 4G1FA 4TM7A 3VZPA 3SEFA 1GZDA 2G88A 2DKOA 2J31A 5FTLA 1TXGA 1U4OA 4L4ZA 2GSDA 4RV4A 3A27A 2B8EA 4XFJA 4KOEC 5T14A 2PI5A 4BC0A 3SHQA 1PI3A 2E37A 1OVMA 1YB6A 2ZI5A 3LPLA 4HH4A 4AMZA 5AVUA 4JUFA 5CAEB 2KOBA 1CZRA 4D42A 2A5YB 5LSAA 1QWOA 5EY5B 5H9WA 1BYIA 2ODQA 5GTDA 2V7GA 3RYFB 2VFAA 4KMSA 4CFSA 4HVLA 1OZ0A 2YL2A 2PL1A 1CI4A 1C2TA 2F77X 3C1UA 3H2HA 3NW9A 3MTQA 4HQ0A 3C5GA 3KWLA 3LOQA 1XRSB 2Y1IA 4I9NA 1I6WA 4KPEC 1Y88A 3AKDA 4JV0A 2IQIA 3D4LA 3HDYA 1D8BA 3MTJA 3R4CA 3T3EA 1BX0A 1NMSA 4BVEA 4IRKA 4CKXA 2XRFA 1ID1A 3W6UA 3B38A 4K6OA 1HNNA 1DKPA 2Y4NA 3WLAA 3FWYA 1X7ZB 2G1JA 4I4LA 4JJGA 2R00A 3S6JA 3ROPA 4GOJA 621PA 1CUDA 4DKXA 2ZYRA 1QG0A 1NRWA 2NWQA 2FN3A 1COOA 1J1IA 1KPGA 2R6HA 3U7IA 4DXAA 5D5HA 2I8LA 4CIDA 4HAUA 3ZY2A 5KPDA 2XR1A 1DAOA 2BZGA 4BTLA 5B37A 4FP9A 4M36A 2EGHA 1YXMA 1EAYA 1UK8A 2C29D 2CLCX 1QS0A 2OXRA 2WKWA 3C29A 1Z74A 4YUWA 4WCFC 4ABTA 3MCVA 3PI6A 5IH3A 2Q9BA 1E1RD 2FGJA 4TMFA 2W9CA 4WJ3B 1IXKA 2C7GA 3MAGA 3NVMB 2G04A 4X24A 4LECA 1DELA 5C37A 4N0MA 3NHPA 3MXTA 4LOJA 4ZVOA 1BD3A 2J3MA 13PKA 3OEEA 1GYPA 5LXTF 1PGQA 1P2DA 3L49A 4BYMA 1J33A 3PXUA 3SC6A 2X6RA 4FINA 2ASLA 5FJIA 3BRWA 2QVLA 2IZ5A 2ZRFA 4DKJA 2I91A 3M4XA 1XFAA 3QBVA 4M0AA 8ICXA 2EZ8A 3JARB 3SC3A 3ZBQA 5CIQA 4BKMA 5D87A 3GLFA 1C8VB 2Q3EA 4MW7A 1PNVA 2MMGA 1BDHA 3V48A 1SQSA 1LDGA 2ZBUA 4AG3A 2CVOA 3CNHA 5FPSA 5G1PA 3B85A 4IZHA 4KP7A 1QV7A 1I7NA 2C04A 3JPSA 3DQQA 3NNDA 4ZCPA 3WLMA 3SMVA 1NAIA 1T1RA 1WXXA 1JDPA 2CXQA 4W82A 3UG7A 1OH8A 1D5CA 2A57A 4RSHA 4F9FA 1UKYA 4O4HB 1VGRA 3NO4A 3SZGA 3EVZA 3V4VB 3KWFA 5NULA 4KFCA 2ZYUX 1L7XA 3BWYA 2MMCA 2AF3C 4KRFA 1XMPA 3JQBC 4WNYA 2O4UX 3T79A 3MR3A 2YVKA 3CUUA 4FFBB 5TQJA 5M2QA 3UPTA 3GIIA 4UHFA 4JLVA 1S5LU 3ZI4A 3D43A 3HUFA 3LHFA 2YXBA 2ZIZA 3FCUB 3FC4A 2H51A 2DTXA 2VF5X 5AW0A 2J3IA 1WXGA 3AB8A 4K26A 3FSGA 1KTVA 2F2AB 5ALPA 4EGQA 1E60A 1U8XX 1OREA 5FBQB 1ZQNA 3KFLA 4KR9A 5BVGB 4GDMA 1FSPA 4EI7A 1N1MA 5LU9A 4GBJA 3IBTA 4WLVA 3QLTA 1Z4KA 1R0WA 1BA2A 2Q1SA 4J03A 3JYQA 4MSUA 1VCIA 5AQ1A 2XIDA 4KTQA 1ISHA 1BOOA 1DAGA 1GNLA 1V3UA 2R8PA 1SK8A 2AKAB 4II3A 4JJZA 1XCJA 3H7AA 2RKOA 4Y6LA 2CLKB 2VANA 3EUFA 3KUXA 4DG5A 1Q91A 4YUYA 4OHBA 4JFRA 3UC9A 2QAGB 4KO1S 4IIHA 4H1UA 1HI9A 2LIVA 2AG8A 2W9XA 2G09A 3VU9A 1QM5A 3HI4A 2WPNA 2H54A 2IZ7A 2OZVA 4U4AA 4BQQA 1GL9B 3PEFA 2DUWA 1UKEA 2B7CA 2OWOA 2WDZA 4BCCA 4DL5A 3KQPA 1E9SA 4KLNA 5KFDA 5BPCA 4FZLA 1RLJA 1X15A 1J7JA 1A9ZA 1IHYA 3CE6A 2ONKA 3DFMA 3G6KA 3K4QA 4UXJA 2OQIA 1PT9A 2Q7XA 4JUZA 3TEJA 4UTNA 2I78A 1JAZA 4OQPA 4MGHA 3VDXA 1YBFA 3I72A 3QRWA 4E51A 4RU1A 2V74B 3CW8X 4TS1A 4L08A 2KHVA 2OHJA 2PHZA 5BWMA 2I5HA 1N5JA 4M1ZA 3WHKA 1D2HA 4IQGA 4BFXA 2H07A 2ZI9A 4GXJA 1PQUA 3WIVA 3KR1A 2WWFA 5M5BA 1JGTA 2J5RA 3RAEC 3B13B 1TO1E 3H97A 5THQA 1BTOA 2HQ1A 4M76B 1CZNA 3AQEA 4QUKA 2B2CA 1US8B 1KH2A 3TI9A 3ILHA 4KLHA 1H8ED 2WG2A 2NTYC 3EC1A 2NO4A 3TMYA 4B82A 4X95A 4MUAA 3IXMA 5DYGA 5J2TA 1F4VA 1T34A 3N0WA 3MTBA 1BS2A 3TQHA 2PE5A 3H18A 2DBQA 2JAXA 1T3GA 3WJ7A 4BAZA 1VYHA 1FFBA 2GEVA 1QTIA 2QE6A 3UG6A 3CNOA 3NONA 1TFUA 4BO0A 1P9OA 2HWYA 4WGFA 3F67A 1E0SA 2HTFA 1UFKA 2XNHA 4MVCA 4XM1A 3ZCXA 1CIJA 3N58A 3N7AA 4M21A 2DH5A 4M9CA 3RWMB 4CE6A 3GGOA 3OJWA 2NUTA 1NI3A 1EFTA 3EJ6A 4U7JA 5IAOA 2BR0A 2IEBA 3HI6A 3TBHA 4Q4CA 3JPQA 5JVDF 2VZ8A 3I76A 2D5AA 4MDHA 5TJ9A 4F4DA 3H04A 3AEKB 4S2UA 1ZYUA 1NN3A 1JILA 1P8JA 5IG2A 4UPDA 2XNSA 5BMVB 1ADCA 4JLKA 5GTIU 3WKEA 3G5MA 1YDGA 4M8KA 3PNCA 1AQNA 3BMNB 4ECSA 3BT7A 4MRMB 3I6QA 4GC6A 2Q3HA 2XJ9A 3NVWA 4NCJA 4PONA 4HZIA 4Y2VA 4O1IA 1THMA 3QVVA 2CF5A 1WUKS 1RLIA 2HMAA 1V1MA 4MF8A 2ZGVA 4JI4B 4QZGA 5D00A 4US0R 1ZK0A 3ICQB 1CQIB 9MHTA 3S7ZA 1OHHA 3MPUA 3H5WA 3NOVA 1QF9A 1CBUA 1TT7A 4Y0NA 3UK6A 1Z36A 3BD6A 4FMDF 4CHGA 5AVWA 2GTHA 2BJHA 3HCRA 2HTEA 3FSEA 4BMNA 4CL0A 1W35A 2EL7A 3G1TA 2D6FA 4EPVA 2Y9PB 1ENOA 1E61A 3E8XA 3OM1A 2FLWA 4HDSA 3C45A 1VA5A 2VJLA 2JAUA 1ZN7A 3FWHA 4PSKA 4UDXX 4ESHA 3B9BA 3MIIA 3MWEB 3LP8A 2H17A 3B1KA 4YGYA 1R0SA 4D0NA 2VPTA 2WUFA 2EKQA 3ND5A 3PITA 3QF4B 1PKXA 3A8TA 3EXFB 3KJZA 3OM8A 1PWXA 1Y8AA 4U6PA 4B2LA 3IFSA 4LGCA 1QKKA 4NBRA 4OBEA 4OUDB 3WOVA 4Y9TA 1JT2A 2WVJA 4ARCA 1TTTA 4QE3A 1AQ6A 1NLYA 3OQJA 1N60A 1XXLA 1Y4AE 2YIMA 3OOSA 4G5YA 4L9AA 3WDLA 5ICSA 4ED2A 2VDVE 4BNLA 2OHXA 4PQGA 2IZZA 4IICA 4TKZA 1DJNA 2KLHA 3FKSD 3IEKA 4V0SA 2YDXA 1FTWA 1E79D 5EWLB 1H1LB 3FIJA 4RV9A 3VHXB 3BA1A 1MFZA 2B9EA 2G6BA 2HLHA 2IXEA 3GF4A 4IHJA 4L8VA 4B43A 5AI0A 1IB0A 4V0OA 4YAJA 5KKAA 2OOSA 2PA0A 1XU7A 1A9SA 2W6IA 1GZ6A 2RJNA 4N5LA 3V4SA 3JRXA 3NTLA 1X7DA 1UK7A 4HX2A 2Q8PA 4LSWA 5KQRA 2WVAA 1ZK4A 1J06A 4QZEA 2IHBA 3BSWA 4KQIA 3SE7A 1HL7A 3RTAA 4P4SB 3PO5A 1HG1A 2KZMA 3I73A 5JH7F 2AI2A 3T7KA 2HGZA 3KT0A 3JPOA 1TYDE 1T24A 3AY3A 4ZI2A 4MPRA 1S3SA 3DULA 1KETA 2ZIUB 3EFEA 2EFYA 1PF7E 4HG2A 3GNLA 4MW1A 4BRWA 3GFPA 4BBJA 1XNJA 2C4HA 5FBZA 4Z7NB 4JH0A 1MABA 3VPHA 2YASA 4LRXA 4LSGA 1COWA 2X8AA 1UM9B 3W8EA 3J7AC 3QU4A 3TAQA 2GEBA 5CDSA 2CKDA 5AIAA 4NARA 1Z00A 4QBIA 3N9IA 4GPEA 2H1LA 5FX2A 5BSRA 3OF3A 4C7ZA 5E1OA 4R9SA 5HXAA 4HB4A 1C0EA 3KHRA 1ZCJA 4W5OA 3SV4A 3HMKA 2B3TA 5J1TB 5SZJA 4IO1A 1QSLA 3GH1A 5DHAA 4C89A 2PGIA 4WBNA 4PNPA 4CQNA 4F46A 2R0QC 3WYEA 5JNVA 3COJA 4P84A 2CK3A 4QBFA 2ODAA 3NBKA 8ADHA 1UXJA 5JZMA 1S8AA 3WYFA 3OCJA 4JCCA 4XQEA 1EBUA 4OXIA 2OZLB 4CLXA 2V8OA 1SOVA 1CZKA 3M1AA 3SKYA 3U9TA 5B2EA 4HX5A 2NUPB 1KVQA 3AB3A 4BVLA 1B8PA 5IKMA 2YWXA 3DEYX 4KGVA 3WBBA 2GRAA 3P0HA 5CK4A 2VG8A 1KSPA 3N7UA 3PX4A 3LAWA 1EGHA 1NRIA 2AC7A 4HRYA 2OZKA 3AP3A 3SS7X 4A27A 1J21A 1E8DA 4GRDA 1XYGA 3CLRD 1H65A 5IS2A 3GYBA 1OD6A 1KSHA 2MJLA 4RH3A 3CZRA 1M8PA 3VPFA 5AI4A 2XZDA 3VJKA 5KFJA 5L3RA 4CRXA 3NFYA 5JUWA 1EK2A 3OCUA 3ZXIA 1UP4A 3HQ4O 4XXHA 3MW8A 4PGHA 2R8GA 1FYEA 4QLOA 4MP3A 1W29A 4WW0A 2ZRDA 2P62A 3VPBA 2HBQA 3A1CA 2O07A 4ZXPA 5GOZA 2EZYA 1U28C 4QUEA 2OKCA 3QX8A 3FFAA 3UV6A 4GGMX 2QORA 1GTZA 2XF2A 4MVYA 2BFFB 5J2UA 1OH6A 4ZT4A 2A67A 4LMRA 1H38A 5FNZA 3SSMA 3TZLA 3RFTA 4O2BB 1CQWA 2WD7A 4NXMB 2JD1A 2P9QA 1OWOA 3FCYA 3L1HA 4RZXA 2FRVA 4TURA 3GEGA 5JAQA 5EHZA 4BNWA 2JZBA 1BE6A 4N7RA 3NMUF 3L79A 5CEHA 2Q3JA 2C03A 2WF5A 4WOKA 5ICGA 1DDIA 1K3TA 2QLBA 3GC6A 1ZG3A 4ZKEA 5C7IO 1T2EA 3I0MA 1OB5A 4YP5A 4BKRA 2OOKA 1NC1A 1CP2A 3LBNA 2LKYA 1ZNWA 1BJTA 1MD9A 2F3NA 5EIOA 1DBQA 1N5MA 2BBWA 3RTDA 3VKWA 3PXAA 4UNRA 3MJVA 1NQXA 3DMFA 4NFLA 5D7BA 2FMIA 2FW7A 2Y0PA 3GVXA 4Q4AB 4I14A 1YZQA 3IAS1 5F9NA 1EFLA 2VOJA 2GM3A 3IAHA 4Z54A 1R1DA 5EJFA 3AQFA 4CF5A 1DC8A 5LYYA 1ABEA 3D2NA 5KTMA 2FPLA 1ZOSA 1GA4A 1SCUA 1FBTA 4GC7A 2Q9AA 2GJAA 2FEKA 2REOA 3DMTA 4IBOA 4QYWA 3ZH9B 3QU5A 4ZAXA 3GB9A 1QYIA 2P2CA 4ZYZA 3FG9A 1C5KA 2O7RA 5E1DA 1FDIA 3HZOA 5D51S 3WX0A 5IULC 1ZIPA 5CCEA 3DZGA 1WNTA 1TJYA 3HACA 3NC1C 2ZTEA 4CJXA 5KHAA 7ICGA 1XE3A 2A3NA 2J9ZB 9ICOA 3B3FA 4IXWA 3LUHA 4DCSA 4ZI7B 2BFWA 2ES6A 4L50A 1ZUD1 4C4OA 2PM8A 5ILQA 1ZUHA 4QO7A 2JI8A 4WINA 4CCSA 4D8WA 1ISMA 4OA8A 4MKXA 5B2ZA 3SI7A 2VP0A 4JA0A 4AKGA 2B0JA 2BEUA 2JCBA 4IIYA 5I3CA 4TMYA 4OXNA 3AETB 2QRKA 4C4RA 2W9AA 1SD5A 1UPCA 2B3DA 2VSFA 4FZJA 3QZ8A 1JA9A 4DIOA 1KEPA 2FKNA 1JALA 1DWPA 1VQ1A 1WW2A 1YU6A 3ETEA 4D0GA 1Q1GA 5L3SA 3EEOA 1L4KA 1N0VC 2CUZA 3GUUA 1ZQEA 4R1MA 5D3MB 2VSQA 3GZJA 3OJSA 2EGGA 2XKJE 1T3ZA 3URKA 1E64A 3P9PA 2HMXA 1ZVMA 1RD4A 2R62A 2V0GA 1CLUA 4Q4JB 5JCJD 4LF4B 3DVQX 2VA8A 3FBGA 1E8MA 3H9QA 4JWKA 4RD1A 1J97A 3KTAB 3FDFA 1TU3A 1JAIA 4XZ3A 4WSOA 4CXMA 1B4FA 1T5SA 3TZBA 3EVDA 5FOWA 1IMOA 4B71A 3EB9A 5T64A 1B0PA 4F4XA 5CLFA 3GJ7A 4GX1A 1BHJA 4P3NA 4C0WA 4O4LF 2EBHX 2GN4A 4UD2A 4TUQA 2FW1A 1EGMB 3V8PA 4V0RA 3EVBA 5AM4A 4IIJF 4XYBA 2XOKA 1S9FA 4MV6A 5AKIA 3U4AA 1BHQ1 4J6FA 3THYA 1G8PA 1ZD2P 1P6QA 2W04A 3JALB 1PD1A 5DU2A 4MKGA 1C3EA 3VDMA 3DL0A 4RMHA 4A36A 1GZ7A 1ZITA 2BJWA 1CDEA 1XL1A 5BQFA 2AW3A 3G02A 4RPHA 3AEVA 2GILA 1CUIA 1JT9A 3EA0A 2E4YA 2RJ3A 4OO3A 3GRYA 1OIWA 1W0CA 1P7ZA 4WXPA 2Z4SA 3BRSA 3OJCA 2YHIA 3I6IA 3MLAA 1OR8A 3TWOA 2O2ZA 4QPDA 1E98A 1IZ0A 1RBQA 1Q5PA 2AEJA 2FG5A 5IDWA 1U5BB 1RI3A 3WL4A 3T3DA 2N42A 6Q21A 3ZV7A 2YV5A 1T8TA 3EXFA 3V7JA 2PU5A 5CYGA 4AKTA 1FFUA 2Z83A 3FDIA 4EGJA 2Y0EA 1X2BA 3T7IA 3W5HA 2ZJ7A 4MGZR 3VTZA 3IE1A 3M3DA 1NNUA 2EDAA 4IOKA 2QN9A 3R2JA 2XTZA 2ZXUA 3WJ2A 4D8XA 1XA3A 3LUPA 1O4WA 5HRCA 2PGOA 3IR6A 5LMUB 1FLNA 1CWUA