3QUQA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, an open cap conformation
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
225
structure length
225
Chain Sequence
HMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 83
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3quqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3quqA01
3ZU6A 3WK6A 2FUCA 5ALGA 2CN1A 2PQ0A 1RLTA 4Y2UA 2I34A 1Q91A 5T41A 4Y2XA 2PKEA 4UAUA 1Z4QA 1QQ6A 3A1CA 3WKAA 3W5AA 3U26A 2AGVA 3ZWKA 5ALUA 2NYVA 4UASA 2GFHA 3QXGA 3OCWA 2GHQA 1MH9A 1YNSA 5AW6A 3ET4A 2B8EA 3L8EA 1FEZA 2O9JA 3FPBA 1ZD5A 3BWVA 3QUCA 2NO4A 5ALFA 2WF9A 4HYTA 3I28A 1WPGA 3N8GA 5AM4A 4G63A 2WHEA 3ESRA 3UMBA 3ZW7A 3A3YA 3QUQA 3QU9A 5ALVA 1S2OA 3EPRA 2WFAA 5JJBA 3ZX4A 3EF1A 4UW9A 5AHXA 2YMMA 2IOHA 4CE6A 3U7EB 1SWVA 3WKDA 4UM5A 4BNDA 2Q4TA 3KOOA 2YJ6A 3AR7A 4UM7A 3FGOA 2FDRA 3AR5A 2ZBFA 3N28A 2WF8A 4NABA 2AMYA 5ALXA 1AQ6A 1TJ5A 3ZVNA 5AI6A 1Z4OA 2FUEA 1L7NA 3L1VA 4CF4A 4Y2PA 3L8FA 2D2VA 2JARA 1RMTA 1RDFA 3EWIA 5ALNA 5AM1A 3FPSA 4O8CA 5E0OA 4HGPA 3QUBA 1XVIA 1TA0A 3AR9A 4FYPA 3CZ4A 5AM2A 2MU2A 2YJ3A 3OCZA 5AIBA 4CF5A 5ALIA 1L6RA 3DNPA 2IOFA 5AK5A 1TJ4A 4DWOA 1O08A 5ALEA 4Y2QA 5AKJA 3ONNA 3QU2A 4XE5A 1RQNA 2R8EA 1RKUA 2FPRA 2ZBDA 1VFPA 1N8NA 1Z4JA 3U19A 3N1UA 2CFRA 2I33A 4QJBA 5AI8A 5ALLA 3RFUA 4BYGA 2IOFK 2YJ5A 2YY6A 4UAVA 4J2TA 1N9KA 2W43A 5AICA 1XP5A 4BX3A 5A3RA 5AW1A 4KNWA 4C4TA 1ZD2P 2YMPA 3R4CA 3WKEA 4JDPA 4NV0A 1L7MA 4UU1A 1S8OA 5ALPA 3ED5A 1SWWA 4UATA 5ALZA 2G06A 3L8HA 3PCTA 4UMEA 3SKYA 4BEVA 2ZG6A 4BEWA 1YJ5A 2G1AA 3HLTA 5ALJA 1WZCA 4Y2TA 2P69A 5ALWA 1NRWA 3FM9A 5AKYA 4YIHA 4OCZA 1KYTA 1K1EA 3PGVA 2PR7A 4C4SA 3HYCA 1ZOLA 4Y2SA 2G0AA 3QYPA 3WK5A 5AW5A 1RKVA 3KC2A 3M9LA 5AVQA 3E81A 2AUTA 2HOQA 2C8KA 2JAUA 3OCYA 5AI9A 1RQLA 2WF6A 5ALHA 2FI1A 5IT0A 3E58A 2W4MA 2JAOA 2B30A 3M1YA 2WF7A 3NRJA 3PGLA 4IFTA 2CFSA 3NUQA 3MMZA 1Z88A 4Y2RA 4B6JA 2B1QA 5ALRA 3KZXA 1RKQA 3ET5A 4DFDA 4YGYA 3E8MA 1Z4IA 4ZEVA 5AM3A 2FPXA 2HF7A 1LVHA 3I6BA 2G80A 1VJ5A 3UMGA 3QX7A 2O2XA 5ALSA 5ALQA 5ALTA 2VKQA 2QYHA 3MN1A 2C88A 4C4RA 5AM0A 4UARA 5AVSA 1ZRNA 3GYGA 4I9GA 1ZJJA 2C8LA 3B9RA 3UM9A 4I9FA 4F71A 3W5DA 3L8GA 4HGNA 2AH5A 5IT4A 3D6JA 2BY4A 2P9JA 3L1UA 5AI0A 2GHTA 3ZTYA 2G09A 4CF3A 4JB3A 1LTQA 1TE2A 3IJ5A 4OD0A 4BX2A 1WVIA 3CNHA 2WF5A 3NASA 3WGVA 5ALOA 3K1ZA 4UU0A 4EZEA 2YBDA 3MPOA 5AVZA 2JGAA 3AR3A 2MU1A 4KNVA 1RPZA 5AKLA 1CR6A 1J8DA 2IA5A 1T5SA 5FP0A 5A3QA 3U13A 4Y2JA 3L5KA 5AW3A 4MWOA 5ALDA 2I54A 3AR4A 2FEAA 4YCNA 5AI4A 2ZOSA 1O03A 2ZXEA 5AIAA 5AK4A 1Q92A 4L6AA 5AVXA 5AKZA 2ZBGA 3AR6A 4F72A 1EK1A 4E88A 3QU5A 3N07A 4OHFA 5AVVA 1EK2A 3S6JA 1SU4A 3OTQA 3MC1A 1ZRMA 1CQZA 3QUTA 4UMFA 1RLOA 3A1DA 3P96A 3R09A 4BNDB 4HGRA 2YFYA 4Y2YA 4NWIA 4XQ0A 2ODAA 5AW8A 4RESA 1Z5UA 2HHLA 1T9ZA 4G9BA 1RMQA 3SHQA 3SMVA 3ZWDA 4YH1A 3QNMA 1YDFA 4KX3A 2R8ZA 3WGUA 4BKMA 1RMYA 5AKHA 4EX7A 2YMLA 4DCCA 4KYTA 3WK7A 3DV9A 2HI0A 2OYCA 2P11A 3R9KA 2DQSA 2R8XA 3AR2A 2HSZA 3ZVMA 3ESQA 1RRCA 4EENA 3OCXA 3FZQA 3E84A 4OFZA 4H1WA 2EAUA 5AW2A 3WKBA 1X42A 5AK6A 2EATA 4QQFA 3L7YA 1QQ7A 2JAWA 4HGOA 4ZEXA 1U7OA 3OCVA 4NFLA 3SD7A 1QQ5A 2WM8A 3QLEA 4KN8A 1L7PA 1L8LA 4YIKA 1Y8AA 4CNQA 1J97A 3W5BA 3W5CA 3WK4A 1WR8A 1F5SA 2I7DA 3B9BA 4NAVA 3NAMA 4GXTA 3DAOA 3SF0A 2YMQA 3TLMA 2YN4A 1YS9A 3UMCA 5AW9A 2HF2A 1ZD4A 3U7FB 3DDHA 4PNHA 1VJRA 1ZS9A 4MUMA 2Q4RA 2RARA 4UMVA 1PW5A 2C4NA 2HX1A 4FFDA 2ZBEA 3U7HB 2X4DA 1U2SA 1YMQA 4EELA 2BDUA 1NNLA 3QU4A 3ZUPA 4AP9A 4EEKA 3SKXA 1Z4KA 5AVWA 2B1RA 2CFTA 2B82A 3WK9A 1Z5GA 1U2TA 4HAIA 4KX5A 5A3SA 4EX6A 4L57A 3U7GA 2OA0A 3BA6A 1L7OA 3L0CA 3ZI4A 1JUDA 2RB5A 3B8EA 1QYIA 1ZD3A 2RBKA 5AM5A 5AKEA 5AKKA 1XPJA 3OPXA 3WK8A 3F9RA 1YV9A 3ZX5A 2I6XA 5AW4A 2R8YA 5AK3A 4AS2A 2HDOA 2MSNA 2EARA 3AR8A 3NIWA 5ALMA 2C9MA 1Z4LA 2B0CA 4YCLA 1Z4NA 3WKCA 3IB6A 3L0BA 3N5KA 2RAVA 4YCMA 2QLTA 3IRUA 4IG4A 3NANA 5AVYA 4AS3A 2HO4A 2BDEA 4FE3A 4XOUA 3VAYA 3SLRA 5AI5A 1U7PA 1TJ3A 3FVVA 3I76A 2OM6A 2W11A 3OCUA 2B8JA 4Y2VA 1IWOA 5AVTA 3I1YA 5IS2A 4UMDA 1RC8A 4DW8A 2YJ4A 1QH9A 2FPSA 2NO5A 3QGMA 3PDWA 2I55A 1Z4MA 1RLMA 3L0YA 2HCFA 3NALA 5AKXA 3ZTWA 3ZVLA 5AW7A 2GO7A 4BX0A 5AW0A 2OBBA 4J03A 1NF2A 2P27A 5AKIA 3J7TA 5AVUA 4RETA 3A1EA 1L8OA 2FPWA 4XPZA 3KDPA 4HGQA 1T5TA 2Q5EA 2GMWA 4Y3UA 5AESA 2G07A 3KBBA 3RF6A 5AVRA 2FPUA 4GIBA 3EF0A 1Z4PX 4L6CA 4BBJA 2G08A 2HEGA 5ALYA 5ALKA 2IYEA 1U02A 5AKGA 3KD3A 4ZEWA 3QU7A
chains in the Genus database with same CATH superfamily
2NSYA 1M1UA 1BU5A 3A1CA 3VTZA 2OHOA 2JD0A 1Q3KA 2BR5A 2QX6A 4LYAA 3HKBB 5CX4A 2GHQA 1PLJA 4K88A 3A1VA 3MCUA 4KMUA 4XLLA 4V0SA 2B5VA 1D9FA 4O1MA 4D45A 4AY5A 4PXYA 1F4LA 5BXYA 2YINC 4QPJC 3KS9A 2UZ3A 5EIWA 1UKZA 1SG0A 4LRTB 1N32B 1ZX1A 1WNFA 1NVTA 1FJXA 4NBUA 4NABA 1O8CA 1C7YA 2BMWA 3D0RA 3GGCA 2J59A 2QSUA 2QVLA 1W0JA 1STOA 3ZIAD 4WJLA 3OLQA 5J0SA 3A8TA 4P8RA 4TTJA 1CY8A 4CM7A 4FGWA 1N1GA 1J33A 3C6KA 1MA0A 4EQ6B 2GCOA 5AM2A 2REQB 4X90A 3OQIA 4PLYA 3GFOA 4B9UA 3FWYA 1SGGA 4CF5A 2CCGA 2V3CC 1NVXQ 5E3JA 4B17A 2H16A 3VYSB 5E2AA 4D56A 3D6TB 4E5PA 4HUQA 1M2KA 2OXRA 5CXUA 2HHUA 1DC5A 4Y2GA 1UDAA 3ZBUA 3K0AA 1BZYA 2W6JA 3GUVA 3ZDRA 1WNTA 4JJ8A 5G1NA 1S2NA 1EGQA 4HFMA 2BFBB 2WWTA 3O26A 3QYPA 3FCEA 2RHLA 4KOAA 3Q5EA 1FXWF 2VZEA 4CHTA 4OJTA 1ZAKA 2UZIR 4DVJA 1XQVA 3WISA 5HKLA 4MVWA 1GADO 2E89A 4BJ1A 5J8YC 4P32A 2AV6A 3OX1A 4LDPA 1YL7A 4MO2A 4ALNA 1BH6A 4K9KA 3AK4A 2W6QA 3W8EA 3IJ5A 4ZYWA 3WSTA 5E1OA 1XZLA 2W3SA 5B36A 3JYLA 2ZUVA 5HQTA 3TQTA 2VSOA 5KFCA 1RABA 1WUYA 3DLIA 2ISQA 4Z0NA 3LZ6A 4U7HA 3H2GA 3QBTA 3RSSA 2LYHA 4Q4HA 3HCCA 4ENWA 1B6SA 3KSZO 1XKLA 1W19A 1Z5WA 4GI1A 4E2YA 1TYZA 3BZUA 1JQEA 5M04A 4NSNA 3SMVA 3O1LA 5CH5A 1FYXA 3ZZ1A 3ZHQA 4MVXA 1RMYA 1H3FA 3BQ7A 3ZJ4A 1M10A 1OUQA 1YKGA 4J49A 5EPUA 2WD7A 5EZYB 3B3AA 2B3DA 5CDFA 5HRAA 5I9LA 1NJYA 1NDHA 1XYVA 3VTKA 4XAQA 4ZCPA 1WLYA 2LNDA 5BRAA 2IDKA 4DR7B 4W82A 4QWWA 1QJ4A 2Y67A 4G9GA 3KOZA 2UAGA 1H94A 4TV9B 1NXSA 4IV8A 2PYIA 1F6BA 2IEBA 3AINA 2O3TA 3CF4A 2DFTA 3U7HB 1YUMA 3FJOA 9ICOA 1KKUA 4HN4B 2IKQA 2IXEA 2B4TO 4HWKA 3T5GA 3UO8B 1KS9A 3C3JA 4DLKA 1NVAA 3AIMA 1JR3D 4W4TA 4UUQA 1JAIA 3DVLA 1QZZA 3F3MA 1FX0A 1P4SA 3V4PB 4W5TA 4EG6A 2L69A 4YCMA 2RAVA 4JLBA 2EZ8A 2HO4A 3BIXA 2HQSA 2XCAA 3FFTA 3OM0A 5DRTA 4DMGA 5ICFA 1GRNA 1CUBA 1V7QA 4Y98A 1J2UA 4IQ4A 2HSEA 2QRVA 4QD3A 3IHQB 5K6TA 3HK2A 4QARA 3BHJA 2Y0PA 4GVXA 3RJ9A 1NPYA 2C8VA 4TV8A 2YVLA 4EBDA 5KFZA 4TZ6A 3O7WA 2VEDA 1BWSA 1TQ2A 3COZA 2CVZA 3VO8A 4UD2A 4YYZA 1PK1A 3JTEA 5GTIU 1QDLB 1BVHA 1KC1A 1SKYE 1PF7E 1FRQA 3AV0B 4PC7A 4DA7A 5C5EA 1VB5A 3CXRA 4M1MA 4AB1A 1TJNA 1TEVA 1QHNA 4OA5A 1TU3A 1HX7A 2Q7XA 2OV3A 3MFQA 4QZBA 4OHYA 4C0AC 1E3IA 1U0BB 4FSHA 5FBKA 4R0VA 1K08A 2KSQA 4BC0A 5KOJB 4L3VA 1LXCA 3MD0A 3ITDA 3DMDA 4UM5A 1IEXA 5J1TB 5IAOA 1SL2A 3USZA 1BX1A 4JCCA 2ZDQA 3GP5A 4QW8A 4PNZA 1T3SA 2E0IA 4A1FA 4GI7A 4JUDX 2YVUA 9ATCA 2Q3MA 1QAMA 1J90A 2CNLA 4UEKA 4YRKA 4TMFA 3WC4A 1QH1A 1Z2EA 2IZ7A 2HHAA 2GLUA 3MGVA 1M2FA 4CI9A 2FY8A 1S7GA 2H57A 1OFUX 4LXTA 4MV3A 2JI8A 3OF3A 4EHFA 3TZEA 4W6QA 5LDGA 3GQBB 4WVLA 2QUZA 3V7LA 1Z7BA 2JVJA 1GG9A 1G6HA 2A3VA 4K4HA 3OE4A 3PUVA 3ONFA 2GPSA 3KWLA 1R12A 3V4OA 1C4OA 3AHDA 4LJSA 1U49A 4RPGA 1EUQA 4KACA 4IH4A 5CHEA 4AZ3A 4OYHA 3BE5A 5IHXA 5A0TA 1L1QA 4OI2A 2Q9AA 4ID3A 1LWNA 1R1DA 1KJNA 2P2NA 3ID6C 2ZCUA 1W8IA 3UK6A 1UH5A 4X65B 2FUG1 3MN1A 3WXMA 3CVJA 4RMHA 5M34A 5HR6A 4S1WA 4CTJA 1T36A 2DPYA 1F2TB 2ZWIA 4RQUA 1YKSA 4NXZA 4QDZA 4JU8A 3GARA 2VR1A 4OOEA 1D8TA 3HXQA 2JLZA 4LKRA 1KTVA 2BCRA 1M5TA 3TQCA 2J7PD 4AN0A 2BGKA 2X5KO 4CGYA 3C3KA 5H4HA 5HDBB 2ZSHA 4Z0PA 5BRNA 5BV7A 5HHIA 1NF3A 1OREA 2B69A 2WLTA 1O2DA 2AFHB 1AF4A 4P4SA 4TV8F 3S1LA 4MQEA 4LPKA 1ZQNA 5AVXA 1JMVA 1H2RS 3RSGA 5FL7D 2HPZA 1MORA 2QVBA 3OMWA 1IG3A 4C22A 3D6UA 2W83A 1J8YF 4HNVA 3RHZA 3TQHA 3RAEC 4NE2A 3UOAB 1RWPA 3ZVMA 4HDSA 1HYBA 2W00A 3I6IA 3LGSA 4BUCA 4IDNA 2P4EA 3LIIA 1DGJA 2JAWA 2RGGA 2X86A 1EUCB 1KRXA 3EVGA 4C6SA 3LBIA 3RVPA 2VDWB 2PQMA 2WJIA 2YX8A 3A26A 5TEVA 4JBIA 3ZZTA 3KEQA 3EXFA 2ADMA 2YV5A 4FFBB 3IEKA 1QM5A 1MAHA 4RT3A 1TQHA 1M6VA 5JJ5A 1R18A 3W9SA 3BA6A 4PPQA 1O89A 2PUJA 3CIOA 3T4PA 4KR7A 1QFMA 3BMQA 2E8MA 1OTYA 1KQNA 5SZJA 4ZV9A 1OWMA 4YCLA 1Y9JA 2AC2A 2PT6A 4V0MA 4XDGA 5FLEX 2OSBA 5ECGC 3L6BA 2YN0A 4MUYA 2VCEA 4PO8A 4WUTA 1RRVA 2HNBA 1PD0A 1ARZA 1YAJA 1RYNA 2GVDC 2AG8A 5F78A 3E1GA 4XTCS 3V8QA 3GHHA 1SELA 1XZDA 3UQZA 1GRQA 3OFND 4YUAA 3I9FA 3L18A 1GSOA 4QUDA 4XIYA 3OZUA 4C0LA 4LXUA 3RAXA 3RABA 2JIQA 4KGDA 1QANA 3BWMA 2QKYA 3G5LA 3PC2A 5ALYA 4HSGA 3G6WA 3REQA 3MJCA 3PX7A 5G53C 1U7TA 1UF9A 5KAFU 2OT3B 5JNVA 1XTRA 3Q7QA 4M8SA 1FMFA 1RYUA 5KVCA 2P9EA 5KFUA 4D43A 1V43A 3ZWKA 4Q12A 1C7EA 1LI7A 2IXAA 3AQ4A 1PS8A 2EF1A 4D4HA 1ONBA 4Q9KA 1KJIA 2Y2VA 3H4BA 2ATXA 3K0KA 4QREA 1KTQA 1QTIA 3G5AA 4BJHB 4OGWA 1GNRA 1VIAA 1AA9A 2EIXA 1ZI9A 3ZGXA 4X7BA 4NR0A 3BK2A 4QLAA 1JPVA 2IPAB 5DGCA 2PX0A 3LKBA 4I1YA 2Y71A 4LIPD 4S1TA 1P1FA 5J47A 1RLIA 1UQUA 2CL0X 5M5BA 4P53A 5GGYA 4I9UA 4UU8A 1ZVQA 1NK7A 4NJ8A 4YCXA 1N6RA 3P45A 3JARB 2FKAA 3UK1A 2PSJA 5G3YA 2XNSA 2G70A 5HF8A 2ZUDA 2QW1A 4JR1A 1XP5A 4B4VA 2B4AA 1USWA 1WMFA 1BQEA 4HQOA 5IKOA 2RONA 521PA 3FXAA 2QMEA 3G88A 5AKYA 1AKNA 4OATA 3HJUA 4J91A 3NH6A 4MPPA 3TH5A 3ABSB 2D6FC 2BEJA 4NZZA 1IC6A 5F3WB 4M7PA 3ICPA 1QCDA 3EG5A 2F62A 4MB6A 1AUXA 4R6WA 4ZRNA 2XIDA 2WYVA 5BQFA 2N42A 4I2HA 3SIPA 4FDTA 5THQA 1X0XA 3WQHA 3D7MA 3FZGA 1NQWA 5DQHA 1YRQA 1Q6YA 4YJKA 1ICEA 5J2UF 1Y37A 3F6SA 4X9XA 1DLIA 3KXLA 5D3MB 1LTQA 5DB4A 3EVTA 4FE7A 1JR2A 3VUFA 2BPOA 3EC1A 1M7BA 1QJCA 3LUPA 3SAJA 4BN5A 5D46A 3GNQA 2FTKE 3LD9A 5ALDA 1LBHA 2VP9A 3RYFB 2CYAA 3D54D 3MS7A 2FFJA 5FWYA 5ILQA 1LNSA 2ZJ3A 1DT5A 5KAIU 3WA6A 4DSEA 1EXVA 1WCNA 3GZNB 3DBLA 4S0ZA 4M7WA 4JN6B 3FBGA 4PN7A 4DV2B 2ZAIA 3H97A 2ROQA 2Q5CA 1MEOA 1Y81A 5E0KB 1Q3TA 2Q2VA 3JWGA 3KL4A 4Y1GA 2I8AA 3UMYA 3NT5A 4EENA 3M6WA 1JDUA 3TLAA 3RFAA 4JK1A 5DWDA 3MINB 4RO0A 2CLIB 1IZ8A 1Q6ZA 4MYSA 1N36B 1GXSA 1CZNA 3MF4A 4B2LA 4Z9FA 3DC2A 3KFXA 4MVJM 5EGNA 1RD4A 1X1TA 3A0RB 3ZU4A 3QEAZ 2Q49A 1EQUA 4R64A 3AP3A 2NUAB 1VA4A 4JLVA 3JZIA 2ZSDA 3V5NA 1TEZA 3V6LA 2ZR9A 4RXMA 4QO7A 2YIJA 4GX0A 3DP7A 4ODIA 2ZFUA 2NQTA 2VP5A 3HA2A 4N7BA 4HBGA 1LZLA 2ACKA 3TWOA 1Z0JA 4U7CA 1ZLXA 5IXYA 3R1IA 3IPYA 2A35A 1B2LA 3OJWA 3WIDA 4FI3F 4ZOAA 1X7YA 5D5HA 4LY9A 4PG8A 2VDNB 2CE2X 3BF7A 1U8FO 2OR3A 3WP1B 4KYUA 1ZQMA 1PWYE 4QU9A 1E5DA 1RLMA 1RSZA 2FLVA 3ACDA 3KKQA 3AVTA 1FDVA 2IUEA 1LJLA 2XNCA 4DNQA 4JB0A 2B35A 4HQRA 1TYAE 4F46A 4KPEC 3JQPA 4DDVA 3RSQA 4MS3B 4GSKA 3BFXA 3O8BA 3L4KA 4OBXA 2EEPA 4JODA 3K0HA 1M1NB 3BSWA 4DBLC 4KMOA 1SXJE 1QRTA 4R8RA 3U26A 3BS7A 3C6QA 2IIBA 4ZC8A 4R41A 1FEZA 3PRJA 4KWIA 2CVFA 3P32A 2WSSA 2OCGA 2QSYA 3OBBA 4EUKA 4C89A 2FOLA 5B3KA 1HEKA 4FS2A 3LT1A 1HLDA 4PGQA 2I6TA 4IUBS 2H17A 3ZZMA 3AR7A 3B6IA 1P3Y1 3UNXA 1ECFA 3TAQA 3HRDD 1L7DA 1ZXBA 2QI9F 2Z04A 3AUYA 3GT7A 2C3OA 1JLMA 2W6PA 4V3BA 3KHRA 2RHHA 4AWBA 2WJ6A 4RA6B 3UHJA 4LHVA 5K0LA 1WXWA 2PPLA 2ECQA 2W6IA 4Q7EA 2JHGA 1WIWA 3Q3VA 2R8EA 5ITZB 4KQIA 3U19A 2ZSEA 1L4LA 1KOJA 3W05A 4BO8A 2PSFA 5I8ZA 4XVUA 1EZ1A 5AICA 5TV2A 3PR4A 2HIAA 4GXJA 4TYYA 5ALZA 2ACWA 1OU0A 4XB6B 3DL7A 1AZLA 1Z74A 4IEEA 3VDQA 5I9NA 4JJIA 2ORVA 1DEOA 3D43A 3E81A 5E1MA 1X1EA 3O91A 2OAEA 3PGLA 3I53A 3WLMA 3X1ZA 4GGOA 2GZSA 5K0CA 2JEZA 5EOZA 4IPTA 4GSLA 3PC7A 1V47A 1F8YA 2XEXA 1TX4B 3CEJA 4NCJA 4MLZA 4PAOA 5DIFA 1RPJA 2DHEA 2I8LA 3C5WP 3B9RA 3UM9A 1L0BA 2EF0A 1IJBA 3WU2U 1MC1A 2XGGA 2H3FA 4BNLA 3PENA 3TI0A 3I42A 2YC4C 4CXMA 3HGMA 1TK5A 5E6RA 4Z2YA 1FMJA 3L05A 1LLDA 2Z2JA 1PQWA 2JEYA 2KN7A 1F14A 2GDJA 1MABA 2JA2A 3CNNA 2J9YB 4G89A 1NUAA 5DXAA 1KVQA 4LQLA 4B3FX 3LUGA 4Q5IA 1YDWA 4EUEA 2VPYA 4AX8A 3NVDA 4JITA 3OO1A 3HL4A 1EFVB 4XSVA 1RM5A 4U9UA 2OVFA 2ZRDA 4L8FA 3WGUA 2X4GA 2D6FA 3NGMA 4R1PA 1IYZA 1QHHA 1P7DA 4DUGD 3FAKA 3OOYA 2V4RA 3GEMA 3T99A 3BCSA 2WWYA 3IEXA 2R9VA 2NTJA 4BQSA 2OXIA 1D6JA 1SVIA 2YWBA 4PBTA 3ZGOA 1LPMA 4DV7B 2QRGA 1E61A 3KHGA 1L5HA 1U8ZA 4QAJA 2YMQA 4COOA 3A9WA 3QVTA 2JAPA 2JD1A 1N5MA 2XCRB 2UUOA 4D9KA 1IV8A 5LCXA 1N6KA 3GCZA 4BV9A 3F7MA 4FZ3A 4DNOA 1EQ2A 1EDZA 3ZQUA 1S2IA 4AN1A 5TX7A 1UOEA 1WPQA 1CHDA 1B43A 4L57A 3FR8A 2QT0A 3QXCA 1UHUA 1W0KD 5AOCA 3C8ZA 3I0ZA 4BO7A 3H86A 4EVRA 5K3FB 5K0GA 3M9NB 3VAYA 3EZ7A 3CF6R 3WFZA 3NIDB 3RASA 5AVTA 5GZ1A 2PMZF 3HUDA 1XD2B 3B82A 5LSAA 2PD3A 5K6RA 2I3DA 4X6UA 5K45A 7ICKA 2IV7A 4M9GA 4G09A 3FY4A 3ANNA 4OHRA 3KDPA 4R1LA 1PX2A 2NT3A 1L9XA 4IRDA 1PTJA 1FRVA 4K6KA 2C2GA 2X76A 2EEZA 4X8MA 3BUSA 1OY1A 2PVCA 4IHKA 3T3GA 3ZGZA 1R9GA 4O2AA 4MYUA 3DYIA 2BZGA 3F5DA 5DDIP 3D6NB 2J4FA 4RGYA 5B4TA 3LHKA 4O08A 2VLBA 2XCTB 2OZEA 1XQ9A 4MQ6A 2NU7B 1EGMB 2H2WA 4AXBA 2RC5A 1PT9A 2VDMB 3ROKA 3VGJA 1T1JA 4ZVSA 1MC4A 1U5AA 7ABPA 4WCFA 2D5LA 5CPFA 2V7TA 4FINA 3AF1A 2VUHB 1T2NA 2D4AA 3PXDA 4XQCA 1CRXA 4H3VA 3G8YA 5EG5A 1RI2A 2TYSB 4IL6U 4LS3A 1LRLA 4CLRB 3PITA 2OP0A 8ICIA 3H1PA 4K9MA 2JHDA 1GUAA 4Z0HO 3DWGA 2QVXX 3H19A 3H5IA 4D4LA 1GPWB 1U4BA 4JWMA 3R9XA 2LKCA 2G76A 1OLXA 2WPNA 3KV3O 2KE7A 3T3NA 1H69A 2MU2A 2OWDA 2OBFA 4UB1A 4HNQA 1XAHA 4OP2A 2BKEA 3ADOA 3IULA 1AXEA 3KOWA 2YZMA 5DEIA 1ZUD1 5GVSA 2B92A 1JI3A 3QY9A 1WY7A 1CC1S 2ONCA 1TYDE 4H6VA 3CX3A 1SPXA 5ALJA 2HA0A 2P5TB 1T91A 1NSTA 3HZZA 3SYNA 3VYTB 1EM8B 4LKOA 2XT6A 1EXDA 1XCMA 3GFVA 4MI3A 2AZMA 16PKA 1ZJ4A 1GRCA 7AT1A 3IMFA 2YWJA 2ASDA 3KJGA 4YMOA 2VF8A 4IGIA 4YXWD 5EN4A 2L0XA 3PX3A 2I5PO 4B4KA 4G4SO 1IHXA 3NC4A 3RAJA 1K5DA 3SYTA 4F4KA 3H13A 2EKZA 5L4NA 4EBCA 3GJ4A 3TUIC 1WCXA 4H27A 3VVBA 1ST3A 4FEEA 1C3LA 1KJZA 5DFAA 4HR7A 4H31A 4ZOLA 5DBGA 3NHSA 4IJQA 4B9EA 4DL3A 3TL6A 3HCDA 4P34A 7ICEA 2ZVPX 1KFTA 2P5UA 5DU2A 1NJFA 2D3TA 2FF7A 1SY7A 1X7HA 4F9EA 3O8NA 5F51A 2DUUA 5BQXA 1S2MA 2LGJA 1RRKA 2FLWA 2LP4Y 4G2TA 4ZI5A 4HNUA 4MVCA 5KTMA 3DHWC 3MT8A 1PL8A 2E1FA 1P2FA 3DR5A 5F9FA 3SV3A 1NX9A 2JFNA 4YP7A 4IW3B 2A86A 1PVDA 2XWQA 3AXTA 3A1DA 1N57A 2WY2D 3W5HA 3H3JA 3V00A 2A94A 1XL0A 1PDOA 4KX3A 1L4BA 3IT1A 3IO3A 4HAZA 3HNPA 4O2AF 2C2HA 3F73A 3NFYA 3CWQA 4HYEA 2NP7A 1KC3A 3PY8A 3QVJA 3FCUB 1E2KA 1ONSA 4WGGA 3REFA 2FETA 2EBHX 2DVMA 3TSZA 2B3TA 3OZGA 4UJ5A 5EPEA 4J3FA 1LNQA 1Q11A 3AVPA 4BS9A 1RP7A 5TSDA 8ICFA 2FF5A 1IPEA 2YIMA 1Z06A 4LXGA 4NU6A 2RAFA 4BJ6A 1WWUA 3OZEA 4U8HA 5BWLA 2FPGB 4DUPA 1CXZA 1QZUA 4B3DA 5KYUA 4W7HA 5J0WA 2TMYA 5LJIA 4G0XA 4NOKA 5I4IA 2PEYA 5KFNA 2RB5A 3DXFA 3M70A 2RBKA 1SNYA 2Q99A 1PKEA 1NDQA 1PHPA 4M87A 5KWJA 2J9XB 2PUTA 3ON5A 1W87A 4GC6A 1QFXA 3JQFC 5J2IA 2IH2A 4FBUA 5EUCA 4OM7A 2OC4A 3I2FA 4ZVRA 3VR4A 3T9EA 5F77A 4HMPA 4AWAA 3GVPA 1KFBB 4MV9A 3SBDA 2P91A 2LUOA 2QP9X 1S3IA 3NS1A 1DXOA 2NO0A 2QDKA 3K5HA 3D6AA 2WP0A 2O2ZA 5DHTA 1KEZA 3W8NA 2C5BA 4HQ0A 3VNAA 2R1TB 3AOEC 2AFIA 4PTLA 1ORWA 1OXXK 5EIFA 4QGBA 5CVJA 5J59A 4UOZA 4KXYA 4UUOA 3BWEA 4DDUA 2K89A 4TT8A 2NU9B 1HE2A 3MMXA 3T7DA 1HQKA 3IKJA 1HOXA 3R5TA 1LB2B 2J30A 3SS9X 4JV0A 3E9ZA 2CN1A 4IR1A 4M9SA 2QM3A 4NMXB 4OP1A 4KDRA 2AMFA 3Q8PB 2GCEA 4BPRA 4TVSA 1WPXA 2GKOA 1XDSA 1ZUWA 1V7PC 3SAHA 4ZOLF 3TNFA 4YBRA 2ZBVA 4M55A 1L5QA 2YHUA 5C8YA 1K2VN 2YMMA 1WB4A 1O95D 2JLVA 3C74A 5EHIA 3WP0A 4BNGA 2ZPUA 4P7JA 3QXXA 3ZVNA 2IS4A 5AI6A 2FUEA 4WNCA 2J41A 1LUAA 5HR5A 4M6WB 1W6UA 1NJ2A 3MRSA 1P9LA 3DTVA 1FS6A 3EIEA 2Z5FA 3CLTC 2OHJA 1IBLB 5J0XA 4P22A 1PK7A 5HJ5A 3ONNA 5C0OE 4QUGA 2VTBA 1CY4A 4B7CA 3UF0A 3BZBA 2YY6A 1ZGGA 3T5TA 4PU0A 1J6UA 1PSDA 3I0MA 3CV3A 3WL7A 3E3AA 4A8TA 1V4VA 4MF8A 1GG5A 3N75A 3U0BA 2XB9A 1NVWQ 4UJ3A 1I2ZA 4XWAA 1R0BA 2J5BA 1BFUA 1S3FA 3TD6A 2FZWA 2R60A 2D8AA 1YIDA 9ICJA 1CZUA 4W5JA 3HU5A 4HB3A 4MWTA 1SIJA 1CS0B 1UQRA 4GM4A 3U4CA 4WKCA 5JO9A 1OYOA 3TIGA 4LJ9A 1E1QA 4YQFA 3I52A 2FPXA 5JPCA 1RE1A 2PKCA 1YGYA 3WQSB 5CHGA 4NDAA 4WOPA 1IQRA 3EBOA 4EI8A 2BVNA 4MQUA 3PMNA 9ICLA 4KLUA 1A9YA 1P45A 1ZXIA 3ND5A 2Q1UA 4WZZA 4LHSA 2EGGA 4K1LA 4AT1A 3OOJA 2GASA 1HBJA 3C97A 4RPJA 3WGTA 2E4YA 1S4MA 3M6LA 3JVUA 2G28A 1WG8A 3OIDA 3FTEA 5PNTA 4RGQA 1CQJB 4DLRA 4I28A 5DI9A 3N7TA 2FDXA 3FHOA 1QOPB 2D1SA 4EG3A 1DOZA 4BVEA 1M5RA 3UJBA 2E4XA 2OQRA 1HJPA 1QQTA 1I6KA 2WHRA 1A8UA 3H2BA 5J58A 5CUQA 2ODAA 1G9XA 2WWHA 1SJ9A 2R1VA 1RMQA 2AI3A 5JALA 4KXLA 4KLIA 1MOSA 4OGFA 5LDDC 1ZQZA 3M9MB 1P3JA 4HNAA 1SUAA 4ASUA 3EBPA 3TS1A 3L8CA 1EVZA 4U02A 1QQ7A 3I5MA 1JKMA 1OILA 4UZEA 4QLBA 3NKLA 2Q8QA 4B6EA 3EPGA 2E7ZA 1YMVA 3I23A 5TQ2A 4BGVA 1QVZA 5C46F 2YWEA 3GUUA 3QLUC 4EHHA 7ICGA 5DCYA 1YJXA 4NBKA 2BDUA 3IERA 4DLPA 1G8GA 3T94A 5J0OA 4W5NA 3K0SA 2HGSA 1AKQA 1ISJA 3GRKA 4PRYA 3NV9A 2DJ5A 3MABA 3HKEB 1M6YA 4OXYA 5F64A 2Y0DA 2RDIA 1C5KA 3JWJA 2O1XA 2N1MA 3SQWA 1RBQA 3FPLA 2DXIA 4URZR 3EE6A 2HUNA 2P2YA 1RRFA 5DYWA 5AVYA 3OLZA 3W4IA 3F1LA 5CD1A 1BMFA 3UUGA 4PZUA 4ALLA 3TAPA 1B2RA 4BCBA 2P30A 1KR5A 5ER6A 4UVHA 1SKYB 2VYVD 5HNKA 4EHLA 1IN5A 3WGQA 5JANA 2FQ1A 1POWA 1P1JA 4BFYA 1FB5A 3D2CA 1BX3A 4WNAB 3IMGA 1Z1BA 3AJEA 2D4HA 1EA7A 1EVLA 3I9KA 6CHYA 3BKXA 5BN3A 1JFVA 3SDZA 2FUCA 3OQJA 3K1TA 1VI5A 3JD3A 4KSCA 2PTHA 4I9NA 2D13A 3CR8A 2JIPA 1VRCA 4LOJA 1QIJA 2M6RA 3RKRA 2K2WA 2JJ1D 2WVJA 2HBQA 5SY4A 3K2IA 2WHQA 1C50A 2JIZD 3OC6A 3C5HA 1E2BA 4KIFA 3KZCA 4G8CA 2ZDHA 3B12A 1NIPA 1JWAB 1EEHA 4K28A 3DEKA 3UMJA 5DHPA 1Z33A 3LT2A 4PCUA 4LF7B 3C29A 1SRQA 2IP4A 1EJ2A 2A9KA 4YQZA 1M8PA 5B66U 4YEDA 1C1XA 2VBIA 1FTGA 1FFGA 3ZC3A 4Y2PA 5ECDA 1UJ6A 2BFOA 3EWIA 4IMJB 3F5AA 4FP9A 5L4LA 1N1EA 2DCMA 4ZT3A 3AR9A 5KYVA 3B70A 4FFSA 1HDXA 2AEMA 4QJFB 1DEHA 1XWWA 3HWSA 4ER5A 4MVJP 1N2ZA 1YZ7A 1L7XA 3WL6A 4IUDS 5A6SB 5K4HA 4NPAA 4Z5XA 1R8JA 2I6QA 1T8PA 4MW5A 4UMEA 4EA7A 1Q3VA 1IZ7A 2F3RA 1GAQA 1KYTA 4RQ8A 4DUZB 4KFTA 3DZCA 4PFQA 1KMQA 1ZOLA 3VR4H 3KC2A 2V5AA 1I36A 4UNIA 3OI7A 1KVTA 4LPSA 1DUVG 2M98A 3G79A 1SBIA 3GRZA 1UM8A 4ZYYA 1P72A 4BJ3A 1KETA 7MHTA 3L6DA 2XNKA 1A9XB 1TQ8A 4H1VA 4IRMA 2P3LA 3OE5A 2KHVA 4DCOA 5A9TA 1JIXA 2RCYA 2X9GA 3MERA 3Q41A 3FTQA 4I9FA 4BMCA 4B8YA 2BELA 2BY4A 2H5LA 2DPGA 3KPYA 2Q3JA 3BERA 3IPCA 4F96A 5DDMA 3ZWOA 1TK8A 2EAMA 4JLNA 2Y99A 2YFQA 1NZPA 4E14A 5JLAA 2FFHA 2JIBA 1FP7A 4DIKA 4C7YA 1Q15A 1EFKA 2FPPA 4ZP1A 3T15A 4QE3A 2CHEA 3P4UA 3VPCA 5J9FA 4CQLA 2ID4A 2DH6A 4P0QA 1JU9A 2Y66A 1JX6A 2VSXA 3SHVA 3CUYA 4OXKA 4OJPA 1CJSA 1RJ9B 4RHXA 5CVTA 1VHDA 1SOAA 2YFYA 1QOZA 3HQ4O 2AU0A 3TZBA 4A0HA 1JI0A 2XVYA 2GO1A 4HK4A 5BN5B 2CNKA 1U0EA 4WADA 3MOIA 1GOTA 1HE4A 5SY6A 3RC9A 1J97A 3HR7A 2W70A 3W5CA 3ZCUA 2ZM6B 4NAVA 3EIQA 3HYTA 3KUDA 1GPH1 3N8HA 4JT9A 3Q5GA 3JYPA 2PUDA 4DQVA 4CPDA 4K6FA 3T0IA 2BISA 4M1ZA 1RYMA 1ZGCA 3LF2A 1LDGA 1VLZA 4POAA 5DLYA 5E38A 1PL6A 3B1ZA 2QUKA 2HDWA 1PWXA 2XI9A 3IPRA 3RT7A 4J0QA 3TEJA 3EWNA 3E0FA 4IEFB 5J2DA 2DERA 2JGDB 1CIJA 3ZHTA 1I2AA 4MDHA 4IOKA 4J9VA 3VNQA 3C7DB 4YI3A 2OBXA 5A4KA 5FXMA 4DOAA 2GAOA 2QSJA 1X13A 5CX1A 4BWJA 1BEUB 2JDID 1BVUA 4EL5A 5IPFA 2FWBA 1QTRA 4YV0A 1OCEA 2DTDA 5IMSA 3LC7O 3KO8A 3QI7A 1SQ0A 5EP3A 3ZLTA 5CNMA 1YRWA 4NESA 2GJ4A 4RLSA 1I7LA 3D0KA 1G20E 1SR8A 4K8RB 4ECSA 4ZO8A 3SSNA 5BMVB 4FHZA 2EZTA 3SQLA 4PO9A 2ZYGA 3QLUA 3QVUA 4ZQBA 5BQPA 4UAUA 1ZGBA 1S89A 4QGFA 4QZ9A 5JFTA 5B7NA 1G7SA 4ONEA 2YCBA 1FYFA 2HHJA 1SIOA 3T41A 1XRPA 2X8JB 1J20A 3HU3A 1NRXA 5LMNB 2AXEA 1FSSA 3UV7A 4O5EA 3WWCA 2QMOA 4BWYA 3NG1A 4Z9AA 4KBFA 5L1MA 3RVRA 2QLFA 3A7DA 4M0KA 3PW5A 3QVKA 1JYEA 3LX6A 5FAXA 2DAPA 3DZDA 4Q3CA 3UCFA 1I5EA 2G71A 3WWPA 4RTNA 4R2HA 3QW4B 2EL7A 3BSFA 3MJ4A 3B78A 4IQWA 2ZUUA 4YMHA 2A0YA 1M7GA 4QULA 1F8XA 1JXQA 2V6FA 1L7QA 3HJAA 1CF2O 3WRWA 4LQ4A 3U1TA 2W2MA 4F0JA 3NLLA 3OZTA 2I6UA 4PQGA 4DQDA 3UUWA 3PSHA 1Y4AE 3OC0A 4XUGB 1CJTC 5LR6A 1EAYA 3ZV5A 3IJEB 1BMTA 3BSYA 1W9HA 3IIMA 221PA 4O3NA 4FHCA 4ZGWA 4HPXB 2CXSA 2KE5A 1ZQVA 4F5ZA 4XUSA 4PC6A 3I6YA 1WDKA 4OJOA 3TLYA 3ZNNA 1G55A 1U98A 4JR2A 4C08A 5BWNA 2NXNA 1SCJA 4WEQA 3U3XA 5CIYA 4YCCA 4E12A 3CPSA 4P3OA 4MR8B 2X0JA 2FWRA 2RD2A 2C88A 2F43A 3L93A 3C4QA 5G4KB 3L4SO 1UQVA 1U3GA 4CBVA 3HCNA 1NK0A 1TZCA 1QP8A 2HSWA 1O0SA 2ANCA 2ZSJA 2IWHA 3NATA 5DHSA 4X94A 5EJGA 2NZXA 3SX4A 2ZE7A 1B3BA 3P0JA 3WTCA 4JUZA 3V8NA 1T3HA 3GNTA 1AF7A 1GZUA 4RX1A 2HRBA 1EP1B 1OI4A 2JIMA 2W42A 2AZXA 1L1RA 3GL9A 1T24A 4C14A 4PSDA 1C3OB 3TJMA 4WBXC 4FMPA 1YI0A 2IU6A 4FI3C 1AY0A 1L5WA 1T5DX 1IXKA 4B3RB 3ETGA 2H11A 3X2SA 1QRAA 4M98A 5TMEA 2YYYA 4RQTA 4ECUA 5CT8A 2PGDA 1M83A 1PFUA 4PTZA 3GZ4A 4Q4AB 2N3ZA 2IH4A 2A1UB 4M9JA 2GBPA 4JBXA 2FCRA 4XEUA 2OV6A 2A1JB 3TMYA 3I72A 5AD1A 1GKUB 5JI3E 5KVSA 7ICLA 4HAIA 5TVKA 4K03A 2FRDA 1IXYA 1RQRA 4RNMA 2EX1A 3KBOA 3H5LA 2J45A 5KAMA 3I01M 4I08A 1PWZA 3DUFA 1JLLB 1RZRA 3D6MA 1WPRA 4U0JA 2HQBA 1GT91 4KAJA 4MUHA 3SEIA 1YZKA 5C37A 3GDFA 1W47A 2W11A 3GN1A 3AM5A 2OBLA 3AP1A 1JG3A 1TD1A 4MVJA 3E2EA 4WPGA 4YJGA 2DQKA 3S81A 1DAEA 2AXNA 3G02A 1X7GA 4ZTUB 2DE0X 3SYKA 3LDHA 2FEKA 4OHUA 1SXJB 3EIXA 1M2JA 4KN6A 5ENVA 8ADHA 2QN2A 1S5PA 2NUPA 2VQ3A 1G5PA 2PANA 2QI9C 5CA1A 3R24A 2DECA 1KI6B 2B61A 3ZXUB 3SKVA 2DHRA 5FTJA 5K99A 2OAQ1 3T0FA 3DFZA 1MN6A 3DBVO 2DPHA 2ZI4A 2IH5A 3S5JA 3PJDA 1Q1QA 3WK6A 3A14A 1GG2A 3JR7A 5KQMA 1MENA 1Y0BA 4AYBF 3QVLA 2UYCA 1Z56C 1M0WA 2BF7A 4G8BA 4ND7A 1YNSA 2HK6A 4TYWA 2RB4A 3BGIA 3GLUA 1FTNA 1BJKA 4X60A 5KJFA 4TQUS 1P2TA 1TADA 4FT2A 2IEIA 5CPBA 4P4MA 2JLCA 4Y6SA 3AJ9A 1ZNZA 2GD0A 2NZYA 2H3EA 3KYCB 2IYPA 1E7RA 3B36A 2CCKA 4GHWA 4BMPB 2ZJOA 1IQ0A 2PZMA 3CX6A 3UXOA 2R2GA 3IV9A 3KYBA 5DNEA 3SZRA 2J87A 3HC7A 3HZRA 1F44A 1SXDA 4NOLA 4GKKB 2YB1A 1IG0A 2QENA 3TSCA 3T1TA 4RZ2A 5LYJA 2FPIB 1YZUA 4LOIA 1ZN8A 3FCOA 4NNPA 3KOYA 3VPXA 3R7BA 3R4VA 2JZNA 3LQQA 1DI0A 3GB9A 3Q6NA 3KQLA 4ZANA 1SHKA 5FIUA 1W35A 3T0GA 5DG7A 4X3PA 2PRKA 3JQAB 5CG1A 1ZQUA 1NT2A 4LNHA 4Z49A 2WUDA 1MQ9A 5KG0A 1R0SA 3MS4A 1RHKA 3GV5B 3PC4A 1XDGA 5JXIA 1ESCA 2AZDA 1P2UA 5CURA 2LM4A 3C2KA 1BCRB 3ZEIA 4O59O 1TYBE 4OXXA 4O4JA 1QH0A 2UVWA 1XAGA 3O8LA 2G80A 5A1JA 1JHPA 4GI2A 1XMSA 4OYYA 5H2FU 2DWUA 4E32A 5C18A 4MV7A 5KPJA 8ICGA 2AX3A 4HSEA 3QOYA 4Z3OA 5KC9A 3ZD8A 2A6PA 4J94A 3UCEA 5TVGA 3TVYA 1BWQA 1JVBA 2GESA 4JELA 3PFWO 4UU0A 1KARA 3UHFA 2BMDA 3IIIA 3K71B 2J6CA 4UQGA 3LYHA 3MGBA 4N47A 2I1VB 3RB0A 1QX4A 3L84A 1J2JA 1PT5A 4LEIA 5JWHA 2PD4A 4NJEA 4F9GA 4NICA 1FU8A 1DC3A 1VE9A 3GUHA 3SXUA 2I4NA 4OBEA 3OESA 3VR2A 5CA1F 3MTDA 2BMVA 2JLSA 2ZQZA 3CNEA 3PX4A 2BPCA 4R1OA 3EFOA 1EP2B 4RTQA 2X0DA 5IF9A 1Q7RA 4D9GA 4P80A 5ICEA 2ONJA 1XF1A 2Q0SA 1O96B 2QLLA 3H40A 3QXJA 2DQSA 1YB6A 4MKZA 3X1XA 3V33A 3VYUB 2R8HA 5AW2A 1M6HA 4IS2A 4KLAA 2PMZC 1V97A 2ATVA 4JR0A 4PQFA 3KP1A 3I9NA 2P40A 1Z22A 3WK4A 2I76A 3HLYA 2C4KA 4HQLA 5CLJA 1KWKA 1ZN7A 3S29A 2W03A 1ZD1A 4BZQA 3VU1A 4IDQA 1I6LA 3WLJA 2CJXA 3D7LA 4DM7A 3QH4A 4WXPA 4ZYUA 1T3NA 5KU7A 5FB3A 3J81k 4U3JB 2PWPA 3VZPA 5HFAA 3MWYW 5AJUA 1EKXA 3HJGA 1H42A 2PJUA 2HHCA 1M66A 2EJCA 1GR0A 2P9TA 5IRCD 3BE8A 4IDBA 4KHZA 4RHEA 5LYJF 2FPMA 1CVRA 1AO3A 2J1LA 4QHTA 2XGOA 4KLMA 4JVLA 2C0CA 1PBNA 4YQEA 1AN9A 1QRUA 3L0OA 2W2OA 1M2OB 3I3SR 2EJUA 5KQGA 4CLOB 1VKHA 4BX0A 5G3ZA 4DLTA 3VSEA 2E6UX 2FLKA 1MVNA 2IU3A 1P33A 1OFHA 1GPYA 4HGQA 2A3NA 3OD1A 5GM1A 3PXGA 4Y3UA 3PEVA 2IHMA 4MA4A 4QECA 4GOOD 5CEEA 3OHSX 3UZUA 3WRXA 2R5NA 8ICHA 5KNCA 3FB4A 3QKTA 3TPCA 2ZB7A 3LC0A 3BMNB 2I1QA 1ZVKA 1N2CA 5IF3A 4EA6A 1WD7A 4O4JF 3ZU6A 1KYZA 2RAPA 5DCLA 1IM8A 4UB2A 2C7PA 4AJOA 3K8QA 2IHUA 4FFPA 2R65A 2NPOA 4U7WA 3FLAA 3BE6A 4O29A 4F3NA 2MINB 1QHFA 1GTL1 1WEKA 1UJCA 1NXWA 2V9PA 2F00A 3ZHZA 1NQ5A 1Y63A 3QUQA 5IJ9B 2EFJA 4G8DA 2W37A 3C2QA 3DAPA 2QARA 4DS4A 5HIJA 4I6EA 3LY9A 2CMKA 2B4RO 2BCEA 2J3MA 2OL4A 3DV2A 3SM9A 1SZDA 1MSWD 5L95A 1V6SA 2RIPA 1SQ5A 3ILXA 3NXSA 1BXZA 4FC6A 5F5XA 3TOVA 3MGIA 3MBOA 3BGSA 1ZD9A 4P0TA 1NP7A 4MR7B 4AF8A 5CB1A 1I94B 2DHDA 2YS7A 1N33B 2FZ4A 1RE0A 4J0GA 1XHEA 3VI4B 2VNAA 4DCGA 2IPOA 3GLHA 1P19A 1N5IA 3CZQA 1Y4ZA 3ADKA 1Q46A 5JY1A 3TDMA 1XR3A 4TTQA 1NXXA 2ZUCA 4NIMA 4OO3A 3W5IA 2O5RA 3TIVA 4ND3A 4A0RA 2AUTA 4NKRA 4MVJH 1V1MB 1RI5A 2P62A 3TLJA 1KYVA 1M34E 1PTJC 1N2JA 2C2EA 3WFIA 3KSDO 2V6GA 5DX8A 2QBYB 1NQAO 2E87A 2DBZA 3IAS1 5A9RA 4R6XA 1AQUA 4X84A 4E0DA 1X2EA 1CWUA 4LY0A 5AVSA 3NC0C 5AR1A 2OMKA 1GFIA 1G19A 1JALA 4P0PB 3A6FA 2JEJA 3CG0A 4PIPA 2GLTA 1L8QA 5FOVA 4MI9A 2BDTA 4S35A 1X94A 4RD4A 1Y4DE 2X7JA 3OKFA 2VK8A 1ML3A 5CAEA 1SPBS 3PGJA 1EB8A 1S0NA 4YAIA 2P9QA 4WCFC 3OAAA 3R5FA 4C6HA 2ODTX 3SOZA 5F2OA 1FZTA 2B34A 3BVPA 4J3JA 3ROTA 3U9TA 1E60A 1U0GA 1PQ4A 1SU4A 3GRRA 1M54A 3J81A 3JRWA 3WWDA 2Y77A 2IZ6A 1LLQA 2EKQA 1T3TA 1H6AA 4C30A 1Z13A 1GGMA 4EX7A 2P0EA 3U44B 4RUKA 4MVJI 4HAWA 4YRSA 3DV9A 2AR9A 2ZJAA 3PVXA 1ZQGA 2PSDA 8ICXA 1ZJZA 2NXWA 4YRNA 4C0XA 5BSKA 3L7YA 2K6GA 1U3TA 3GT0A 3JPWA 3QV2A 3DEIA 1PK9A 3ZZNA 4DT1B 2AWNA 5FNVA 3H7IA 2HF2A 4C7XA 4ZGGA 1KQPA 3HVIA 2YWHA 1B3RA 4H4DA 3PXCX 5D49A 2RARA 2VPPA 3PIIA 2C95A 3BIOA 3K30A 5ESRA 3AL0C 3RUCA 1XA3A 2HJ9A 3R5KA 1P0CA 1V16A 3GNLA 5DW0A 3R7SA 1PCXA 4WZAB 4WERA 5AHWA 4ZVPA 2FE4A 4ESEA 4P3XA 4JBLA 3L1JA 3ZHBA 3LPDA 3PB3A 3VYRB 1Z5PA 1IPHA 3FVVA 1F48A 4FM9A 2PUAA 3R77A 2W0SA 2AXPA 2JAXA 1KZ9A 2W4QA 3GPCA 3P0EA 1JAXA 1CF9A 4QA9A 5BOSA 2BJWA 4N6OA 4ZZIA 1WU7A 4N12A 1MVOA 3NOQA 2DTEA 3BHNA 4UHHA 3NRZA 3IL2A 2DFDA 4PPGA 2AWOA 3F97A 1E6WA 1RWKA 2X2EA 1M2WA 1ORIA 2IS1A 2HWXA 1BKSB 5LQUA 3JALB 1QIEA 2C84A 5DSXA 4ZAYA 2A5FA 1U1GA 5BWCA 2HSGA 1PL7A 5JT1A 1YZLA 4WKBA 4GD3Q 1LQTA 3F49S 2DR2A 2WG1A 1U5BB 2VC2B 3MWKA 5IJWA 2EKPA 3B53X 3FNBA 1DRWA 3F9CA 3S2YA 1B73A 2ZKLA 3IT3A 3HB0A 3LGXA 3R0IA 2PXIA 2P1RA 2H85A 4S05A 2AHRA 3DEFA 3WHKA 1TVMA 2WIBA 2ZPAA 3E0QA 4UFNA 3QF4A 4M9NA 1Z1VA 4XCXA 1QORA 4P4NA 2KG5A 2QUHA 2R5WA 2O2CA 1OXUA 4N4AA 1T5BA 3K6SA 4INZA 2NZUG 3QY0A 2VDVE 1GCUA 1CR2A 3PE4A 4FZVA 3WHIA 5DP2A 1X80A 3F98A 5C5JA 5A02A 3O8RA 2BR4A 3A6JA 3DZHA 3I2YX 1OKKD 3FFXA 3BDVA 3PW7A 4Z54A 4FQ8A 1T6NA 2Z8ZA 3JASB 2ODBA 1ZOIA 1UPHA 1O94D 7ICHA 3L02A 2YKGA 2FV8A 4IP0A 1IIRA 4OHOA 2QRQA 3AHJA 4IF4A 1EXWA 3AMVA 3DFMA 2EP5A 2HNAA 1E9RA 3VKFA 4M49A 5F9LA 4ZEMA 5FNVF 3UJCA 2QB0A 2G3YA 1U2GC 2WZCA 5IK2D 1LY1A 2E82A 3H5TA 3WWYA 3EEIA 3V8MA 3RSLA 2DFPA 3K6RA 1CEZA 3I6BA 1FS4A 2HVIA 1V7ZA 3QX8A 1HF3A 5BV2P 3QXHA 3G5TA 1T8UA 3B9QA 2H59A 3ZHVA 1N25A 5KNCH 3DEAA 5J2GA 2WI8A 1A88A 1WHTB 4WLOA 1ZH6A 1G5FA 1NC3A 3RIHA 5G02A 3TPFA 5JTTA 3GLGE 1QLNA 5HBRA 5EZ6B 3D2NA 3VKGA 2GTIA 1QE0A 4FYHA 2XX3A 1I1NA 1H1DA 1JX4A 4OP3A 2PXCA 2G8LA 2UYYA 2KP7A 2BGLA 5IDXA 1BOFA 2AZTA 4QJ3A 4F8YA 1EK2A 1NXOA 2J4DA 4H08A 3Q8SB 1BFDA 3TBHA 2R0QC 2ARKA 4XDHA 2KOBA 1GQFA 2Y9MB 4EBFA 4WFIA 3U49A 2FP3A 1QFYA 1EUDA 4UHCA 1IONA 3FUVA 1MOZA 3HJNA 1R3DA 1CG6A 3M9WA 3WR5A 2XZDA 2IEGA 2E8PA 5KQLA 2OKCA 4M1EA 1AGXA 4W6ZA 1A71A 4ZQEA 2CJWA 3NAGA 4FGUA 3O4GA 3FYSA 2O3RA 3D8HA 2W6ZA 2INGX 1KK2A 3W5BA 3H4DA 1SURA 3NAMA 4NEHB 2YN4A 4CCYA 2W8KA 3FMVA 3DDHA 4ED9A 2J85A 3HFJA 2C2WA 3OF2A 1JIJA 2AB0A 4GPTA 4EL0A 1E3WB 3K9CA 3EZ2A 3QG1A 1NGSA 4OM8A 3H1BA 3IAM6 4ZRDA 3NIBA 4LFCB 4YPVA 2REOA 4B84A 3OZIA 2Q1WA 2WD8A 3DAFA 1S1MA 3AILA 3E9MA 5B58C 4D9JA 3CRXA 4LYJA 3TACB 2QRKA 3GR6A 2GK6A 2I0FA 2VNJA 3QJ5A 3PEUA 4HEA6 1AM4D 4WA8A 1QIHA 1U9YA 4Q34A 3O3OB 3T34A 2MWMA 1K92A 2JGNA 4E70A 4EB0A 2AN4A 2QUBA 3ZK7A 5LP1A 3AM4A 5KWIA 1RXYA 1ED1A 2B98A 3O31A 3RUFA 3U81A 4HDKA 3J7TA 3ZV4A 2YL2A 1F38A 3P5BA 5AHOA 4L8VA 4XPZA 1T9HA 4M89A 4KYVA 1PKXA 4NFYA 4YRBA 3QENA 3KB1A 1H2XA 3E3LA 2FPUA 1U9ZA 3EXHA 4FPXA 5D4BA 3E2IA 3KZVA 3RFFA 4KQ1A 2P9BA 2YZKA 4DBVO 4CDGA 1UANA 1ND6A 5C2JB 4JV5B 4KUGA 1X1DA 3LP6A 3TI7A 2QIOA 2AKAB 2WINI 3G6YA 2F2AB 1MG0A 2GDZA 4U2KA 2ZSIA 2WUEA 3GP3A 2G9ZA 5GZ6A 3RLFA 1OI7A 4D8YA 4ALIA 3LYAA 2ADFA 4DKXA 1MN8A 1MO5A 2CLOB 1ZM2A 2Q1XA 5GZ3A 4O3OA 5E6UB 4L5JA 4P5DA 2YVAA 3F5EA 1F0PA 2QVGA 4EAQA 4J07A 5IXSA 2G1KA 4UDYX 3MWDA 3BA1A 2AXQA 2GD6A 2VXCA 2O3QA 4O4LB 2BPGA 3KQNA 4HXGA 5H4GA 4FS1A 1JEJA 3W77A 1ZJNA 3ITEA 3TM4A 3LXUX 3PVSA 4DC9A 3G3EA 2QW8A 5BV8A 3AUAA 1HE3A 2ONKA 3IPAA 4PG4A 4C05A 3DOJA 9ICPA 1DC4A 4WASA 3EXG2 4D4GA 3PL5A 3SR6A 4NBWA 1SMKA 3UGTA 3PTZA 4K86A 3QKRA 3NHWA 4UEWA 4C0KA 2CB9A 3WKEA 3LSTA 3UT5A 1ZU4A 3HCWA 3P19A 4GL2A 2XCOA 4ACAA 2X8LA 2Y9UA 2HLNA 4JEMA 1DXQA 3VJRA 3B6ZA 2XEDA 2VRBA 3LOUA 3A6DA 5AXBA 3UJ7A 1XMJA 1Q22A 1E1MA 5BW6B 1UMBA 1L4KA 5EYPA 2HBMA 1EFUA 1TT5A 3AF5A 1KRHA 2Z4SA 3H42B 3TINA 4GXKA 4X1KB 3KZXA 2ISCA 3N39C 4WCVA 4ENSA 4AFNA 4GOMD 3PG5A 3PQ8A 1C4KA 2XXAB 5IT4A 4JASB 2NSJA 1C7RA 3OLWA 4BKPA 3F7OA 5ILOA 5DGAA 4QUIA 1WUDA 2ZBRA 4JQSA 1QTMA 1K9VF 3N7PD 4NLGA 1D4ZA 2JFXA 5DASA 2NYUA 3FLBA 5JY6A 1VL8A 5EJ4A 1N75A 2F8KA 1T4CA 4OIFA 1CQIA 1C9EA 1ZPDA 3DKRA 2FUKA 4GBGA 1CUAA 2B21A 4JGBA 3TDKA 1CW2B 4WZAE 3RSFA 3C1OA 4Z1MD 1JB9A 3GGPA 4HZUA 2B6NA 3RJMA 2ZK7A 3ZGYA 4F2HA 5KYWB 1PYOA 2G1UA 2H9IA 1FK8A 1U2GA 4BMZA 5FWAA 4RM2A 5LLSA 3AR2A 3MGGA 2GI4A 2IXTA 5FI1B 1QO0D 2WHPB 4IC9A 1FOEB 2HF8A 3H1EA 4HGOA 4Q3KA 2PKRA 4BV8A 1U7XA 4CG0A 1MA3A 4PYKA 4CIYA 2QNBA 5LB2A 5KNBA 1UL1X 5AMXA 4CCHA 4WY5A 2ZLBA 2PXXA 4MX8A 4QYTA 4CETA 4QNLA 2P68A 1S5LU 2XI4A 2R00A 2ZRKA 1DKOA 1G60A 4D4KA 2XE4A 5FEMA 2I91A 4ENQA 2BGMA 3L9XA 4JJFA 4RZRA 4DLGA 4TGLA 1SXJD 3RS7A 1AK1A 2W2NA 2O2SA 2YXEA 3SP1A 3JATA 1TAHA 2H8GA 2ICAA 3OCUA 1WF3A 1GTMA 3D2BA 2QG9A 2ZRFA 3NAQA 1KFDA 4WN3A 3GJ3A 1H65A 1G20B 1LH0A 3VC2A 3LK9A 1DBSA 3HWX1 4GI5A 1X1QA 4OK6A 1LDEA 1XTKA 4W9NA 2IDZA 3BAZA 3TLEA 4ZI2A 1ZGAA 2SNIE 1CP3A 2FPWA 3SR3A 1B23P 2Q5EA 2KD1A 5KFIA 2MUTB 2V9CA 3RF6A 3B1FA 3TLGB 4PIMA 4FO6A 4ZXFA 4QZDA 2QUIA 1OT3A 4QLOA 3LRXA 2O5CA 2GGSA 3MR3A 1RJWA 1Y4SA 1DNPA 2ZJ8A 1VRVA 4D0NA 3VHXA 2XTAA 1UWCA 4HDAA 2DPMA 5CH3A 1QPBA 2JLQA 3EZFA 2XB6A 3PHHA 3VKWA 2XRMA 2XVZA 2AOXA 3QBJA 4XB2A 5F12A 2VANA 3ELUA 4XD7A 3SY8A 2EYUA 1QBGA 1YQGA 1JRLA 4WHMA 3UAWA 2XUDA 1SFRA 4PAGA 5CB8A 2MDTA 4CKEA 3DBHB 1DQZA 4XKJA 4RSGA 1VMKA 2SCUB 8ICQA 1J7JA 5EUBA 4DRYA 5CBPB 2C31A 4RHTA 2HRCA 4B6GA 1L5MA 2BKXA 3RCBA 1ZJYA 1S2DA 3JQAD 3P4XA 4U7PB 5FA5A 4ILEA 2PZKA 5DM60 4NZOA 2HCRA 1P7YA 4A5OA 1F6DA 1V1RA 4RKYA 3TAUA 2P2GA 2C7QA 5AW1A 1V2GA 1BNOA 3X1JA 2QY6A 1XEWX 2ETVA 2D1RA 2WTFA 2Z5VA 3I3OA 5BO5A 4HD8A 4Y2TA 3ECAA 4XYGA 1NRWA 1ZIPA 2OGSA 2PR7A 3V4LA 1R37A 1EVYA 3LK6A 1X7XA 1QHIA 3X1MA 1RKVA 2VZ8A 3NBYC 5LA6B 3K9LA 3RSZA 7GPBA 2C00A 4YMTA 2WV7A 3GVHA 2ZYAA 2DRIA 1HNZB 3FDFA 4HVLA 5DTEA 1N5DA 5EKUA 1TQ4A 4FZLA 4Q4CA 2VJAA 4LZOA 4OQXA 1ADCA 5KYNA 3IBSA 1LRKA 4HXEB 2SICE 5C8YF 1Q8KA 3MS2A 1P1BA 2C2KA 3SXJA 2GEBA 2W71A 1XROA 4F97A 1QIMA 4C8KA 1T9KA 2FW7A 1UK9A 1CUVA 1FDSA 3EFBA 3NHPA 4YD1A 2JGAA 1TM2A 1ZQLA 1O9HA 2HRDA 4BEBA 2F9MA 3VR0A 5EQJB 3E5NA 4DSNA 2XRZA 3G0IA 4KXXA 5LOVA 5KQSA 4NE7A 1UXIA 1UBNA 5A9SB 1KY2A 1LBQA 3PUXA 1PGNA 4YREA 3RUDA 5A5EA 3TZLA 4J9RA 5CYOA 3HVHA 3AEQB 4TX1A 3MSCA 3EZYA 3VOTA 4PHCA 4RK7A 2QWXA 1H3EA 3O2SB 2DBRA 3L6CA 5EMMA 4C3ZA 4IDAA 1T26A 4R2KA 2R6HA 1OV4A 3C24A 3OF5A 3OTOB 1QCYA 3DYBA 1NHWA 3LXXA 5TJ9A 2C9OA 3ZV3A 1K63A 3EMDA 4YMGA 3WLAA 2WUGA 3VU3A 3FOAA 4WACA 2Y1WA 4JIGA 3UFXA 4N8SA 2CB0A 3GEPA 3W7AA 3DF9A 4HAYA 2UVPB 2NU8B 3RE1A 3E9YA 4KLSA 5J0RA 1ISSA 1V3VA 3ER6A 2X4DA 2FWJA 2CXRA 4JKYA 1BEEA 1GZ7A 1QXSA 3WL3A 1M3SA 3JPPA 1HZZA 3GC6A 4ZD6A 4JUFA 3EOAI 3ZCTA 1T2EA 2A84A 1CY7A 2QGZA 2VYND 4AYBC 2LKDA 3B1KA 1PZFA 4C04A 3EJWA 3F8TA 5IBQA 4J29A 2RHDA 4N7RA 4CIXA 2X42A 5IC6A 1Z4NA 1GLGA 2E4VA 4IJUA 3IRUA 3IDFA 2ORWA 1DIAA 3V6KA 1XWIA 4E08A 1PBTA 1JPUA 1QRDA 4DCSA 3ER9A 1EWQA 3FYCA 4EKGA 4IIHA 3NV7A 4F06A 4NJMB 3ZG6A 2EFEB 3ZDZB 2BE7A 4KR3A 3TLKA 4EKYA 3JAKA 4J9MA 3W7BA 4U39A 1F12A 1Q2UA 1ECGA 4QWMA 1DFIA 4OMFG 5LM3A 1I7NA 3AT1A 4NEQA 3QNWA 3ZCQA 4WXRA 4YTEA 2Q0QA 4EGQA 3KR0A 3KVVA 3TO5A 3OTGA 2D74A 4IJWA 3LY5A 1ILWA 1T9BA 2WU1A 1CRLA 1VIYA 3BXFA 1K27A 2GBIA 2VAXA 4ZT5A 3ZE2B 2F1IA 4JJKA 1I3MA 4MA5A 5BYJA 3AONB 5JJKA 1B0UA 1XO0A 2XNDA 1HA3A 3ESRA 4XIIA 5C0YA 1KSGA 2X5NA 2HQRA 1FTWA 2WKRA 4TKMA 2WPDA 1VDZA 4BNDA 3T5CA 1UDBA 2H51A 3LZCA 4IXMA 3R3ZA 4E1AA 3BJZA 3GA7A 2GM9A 4GOND 3IKMB 3NQ41 3QPAA 5LOVF 1UKBA 4H7FA 1G1MA 2PWZA 1X9XA 4I2NA 3DMYA 2ZYTX 5KNBH 1CTQA 2FRDC 4NVRA 3SMQA 4BQRA 1C7ZA 5CFZA 1W4AA 4JROA 2OYSA 3L9WA 4BQIA 1VE7A 2IY9A 1NP6A 3UJPA 4B9SA 4J2TA 5EIHA 1N9KA 5SZKB 4UATA 5JVDA 5JPIA 3WXBA 2ZUBA 4QVGA 1FFYA 1P2BA 4U6QA 4MB2A 3M4YA 2BONA 4MH0R 4G1UC 4YAWA 4DR2B 3ZWBA 3RADC 1Q0RA 5HF6A 3ZGNA 4YR3A 3SZMA 4GGMX 4Q3LA 3DVAB 4UCXA 2C8KA 5EMHA 4ZCRA 4F4HA 2GT1A 5DNDA 1S0UA 3FLEA 4O8ZA 3ICVA 1T8EA 3K94A 4H7JA 3U1VA 5UKDA 1Y5IA 3Q4GA 4X3CA 1DPFA 4ZCSA 4NBVA 2IXFA 5U9CA 4P54A 3MTEA 2G6TA 2HLDA 3RRBA 2Q5FA 3EDQA 4OQMA 2E4WA 4JLPA 2R4QA 2KZ3A 1RPLA 3BFVA 4C78A 1Q1NA 1HQYE 1UMDB 1N9GB 1XTVA 1H8EA 2JEOA 4RH0A 3HBJA 4CMJA 2CXOA 9ICRA 3H5RA 3NYIA 2GVNA 1UBOS 1KU0A 3CVXA 1J8DA 4B9NA 4R81A 4GNRA 5FP0A 5EINA 1GTG1 1I9CA 1MRSA 1EVEA 5JEDA 2ALZA 2VH5R 2ZREA 4UHFA 5DQGA 3D1LA 1CY1A 3ILHA 1T1GA 3M49A 2R47A 2XYRA 1W36B 4QPDA 5LZ7A 3VR3D 3HI6A 1SBYA 4W7SA 1Q0LA 3EXIB 5L3SB 3D3JA 3M9OB 4JVNA 1ID1A 4FNAA 5EIAA 1CIVA 3B2EA 2FG6C 4DLWA 2DPXA 3HYSA 3GN2A 3NTXA 3RDPA 4YI5A 1M2EA 1CHNA 3A3PA 3KZOA 1KQGA 3NWOA 4JXZA 4J1NA 4GGPA 3DE5X 1RI1A 3ONDA 3HDYA 1WMDA 3M6FA 4KG7A 5DXFA 5KPDA 1ZGHA 3TMKA 1G8SA 1JEYB 4KJZA 4J6FA 4PNHA 4Y6PA 1ZS9A 4K40A 3EG9B 4YUVA 5CEJA 5JZSA 1Q7GA 1U2SA 1JDJA 5TARA 1S7CA 1R5OA 1IE3A 3M81A 4HGYA 4DQ0A 1NTOA 2NU6A 3L0CA 1I3LA 1OBOA 2RGUA 4F5EA 3PX6A 1I9GA 2FGJA 5H8WA 3JPRA 4G5OA 2GEFA 1MJNA 2IUSA 3PS9A 3BOSA 4NZMA 1U3DA 4B9MA 4MICA 2R1UA 4ERNA 3LQ4A 4YMVA 1TCCA 1KK0A 2V6IA 4QUBA 3BD9A 2YIVX 3JQEA 1Z6QA 4DWJA 3LBAA 5AW0A 5JVDF 2DBYA 4MK4A 1AU9A 3UKDA 4J0DA 2P67A 3TKLA 5ICMA 2VF4X 3F6YA 3OTWA 4DLSA 3DZIA 1PN3A 3G68A 4XUEA 1H5UA 4MF2A 2AYXA 1DK3A 4GT1A 1TK3A 1TUIA 4CM5A 5ALKA 4TYPA 3E53A 2TMDA 1AT1A 3V46A 9GPBA 5DNUA 1D2AA 4QJIA 5FUBA 4YN4A 4R54A 2HYIC 2MOKA 3T61A 3SC3A 1PJSA 1O6BA 2ZIXB 4GOJA 1H9AA 1XVLA 3LK7A 4PBSA 1UT8A 3OBIA 3EMVA 3O8QB 5BN4B 1Q16A 5JC8A 3LT5A 1OF1A 1U0FA 3TN7A 1G16A 2BW0A 2F8MA 3HWWA 1K7YA 4PGAA 5D5QA 2UUPA 1X40A 1W5BA 4FEAA 5K05A 1NMXA 1BJRE 4BXOB 3R7WB 2IDJA 1O0CA 1F17A 121PA 1E7MA 9ICXA 2HXSA 4KAFA 4Z1OA 3HSKA 2WFLB 1A9PA 4TRMA 1GCIA 1J39A 1TAQA 3N87A 2BHRA 4HC4A 4DCMA 3RVJA 1GNPA 2Y6VA 4KQ9A 4HXYA 3KDAA 1QS0A 5JH7B 2CKDA 2H7VA 2Z2ZA 4BY9E 2YHBA 2GH1A 4ZAZA 2RHFA 3FW1A 3P9YA 2F64A 2O4CA 4BYGA 5DN6D 1JEOA 1J0EA 2NG1A 2DH5A 3DZJA 1M34B 2XMRA 5U4XA 4CKWA 4F4IA 1OWOA 3CINA 2ESRA 2NZVG 4H77A 5ARCA 4OLJA 4M54A 3E15A 4F5OA 2AYZA 3DJFA 5CCBA 3IP3A 3T3MB 1KORA 4LY6A 5A4AA 4PZOA 3WRXC 4B48A 4IYJA 3RBAA 4KV9A 2VUTA 5I3ZA 3HYNA 1ZHOA 5FQNA 3C1YA 4C4RA 2JHPA 2XGSA 3OZFA 4CF6A 3OHBA 3IBGA 3GAMA 4JAVC 3RHFA 3QEMA 2P4QA 3ND6A 3AESB 1K7CA 1ZIOA 4YJ3B 2PKXA 2C9CA 1QUEA 3KLOA 5C53B 4E4TA 2Q2NA 2ZYDA 4WN9A 1ULHA 3PDIB 3WL5A 4WBNA 1MT0A 2ZE6A 5B57C 3VSDA 1RRMA 3DMHA 3DT8A 1W5TA 3BFKA 2F76X 4KWTA 3IQFA 4ESVA 2DY1A 4Z4GA 3S8YA 5HZHA 5IANA 1RWNA 3KIPA 1C9MA 1V5WA 3KQWA 4J2OA 3EUB2 2IVFA 2P3OA 4H3SA 4LK2A 1HMYA 3Q8XB 1KI2A 2JFUA 2OGZA 3AWIA 4HWSA 1RQGA 2Y05A 2VHWA 2TMGA 5DYGA 3A7EA 5KTQA 1IJFA 4A23A 2WAXA 3M4JA 1XG5A 3AETA 1MJ5A 2J09A 3WYAA 5AK6A 2C54A 3VAZA 1L7EA 4IQTA 3C2LA 3KR1A 1F0KA 3GA5A 5J0PA 1L3SA 2I80A 1WUJS 2PT7A 4OSOA 4P5PA 1H2EA 1O1YA 3VH2A 2XGMA 2HX1A 3RJFA 5JYCA 3P4YA 2OHVA 2CFTA 3ZWVA 5B4UA 4CVNA 4PC3A 4OV6B 2A7XA 1GSIA 2ESEA 4DSFA 2ET6A 1TEXA 2ZZMA 2EFCB 4MLCA 2XV1A 1RFGE 1ZUNA 3KXKA 2GK3A 5JMPA 4KXFB 2FQXA 4F5PA 1LK5A 3K35A 1YS1X 1DS6A 1Z36A 3OUUA 2WV9A 2QRUA 2ZCVA 4XOIA 4RZHA 3D3WA 1EMDA 4GP9A 1R6VA 3TIXB 1U65A 5AW7A 3EHDA 5KG7A 1GQQA 3DDNA 3EW9A 4ZCMA 2XNJA 1Z00A 3GJQA 3DFKA 3FPFA 2XY6A 2QR2A 3DXZA 2EW2A 2HM7A 3BXEA 1Q91A 1IMOA 4DLBA 2OCPA 2R6ZA 4YDSA 2G40A 5K9ZA 5KNIA 3K5WA 5F2NA 2JZBA 2O9JA 1HE1C 4B87A 4QT4A 3Q2KA 1PG0A 1QYXA 3BHMA 1Y6RA 1NV9A 4RVUA 2C2OA 3RYCB 3E3OA 2GR9A 1NLUA 4GVPA 2OCDA 1U3VA 2XCIA 1SWVA 2A9VA 3SHWA 4WBNF 3GLFB 2CVHA 2W9AA 1UDRA 4XQEA 4Z6DA 1XVAA 2XDQA 3LM8A 4CLXA 3ED1A 4BB6A 4IDPA 5CEHA 4D3XA 5K3BA 4MVJF 5D85A 1U2ZA 3G1WA 1AA6A 4G97A 1ESZA 3EVZA 3GFGA 1D0VA 2YN2A 3IC5A 1X2BA 1CZLA 1KJ9A 4XFDA 1I4LD 3AY0A 4C4TA 4X91A 5BNFA 1LDYA 1OLSA 3PSTA 1OLOA 4K05A 5K4AA 4QELA 1L4MA 1JSCA 4CUJA 1VMIA 1JDTA 3UWPA 4N5MA 2IUFA 2ENWA 5DVZA 3UQ2A 4PXAA 4W9RA 4AVYA 5C3UA 4M1TA 1OIVA 3EIOA 3EH1A 1Z0UA 1KI9A 1L7VC 4JMLA 1JS1X 1FYEA 5I9TA 3GLGB 1TYCA 2IUYA 2XVXA 4BX9A 2PUFA 2VXBA 5ES3A 1UDCA 2AN5A 1NVDA 3CU5A 3PXEA 3X1KA 3KTQA 1UMKA 4OKIA 4M4SA 1YRBA 3MGHA 4IO0A 4CL8A 2BEWB 2G09A 5ULLA 4ZH4A 2WLSA 2LD4A 1K98A 1GKKA 4RMIA 4DL7A 4P36A 4P1ZA 1K5HA 3AR3A 2GD1O 1Q77A 2KLHA 1J0XO 3GZTB 1PGOA 1N3YA 1IEWA 2AZ4A 2ZS8A 2UYHA 3VR5D 3WL8A 3QVGB 5DGIA 5DBIA 2D2FA 3A4IA 5KG2A 4LXXA 4KFSA 5CLGA 4N6NA 4ED2A 5HG0A 3UQYS 2GARA 4BWMA 1SUCA 4WCDA 1QIGA 5F7JA 4AO8A 3N7SC 4UTVA 3O93A 3JQGB 3H8SA 4YRTA 4YPOA 2X3YA 4Q9HA 3QEKA 3FNEA 3H17A 4D4JA 5KYXB 2OPBA 3ILYA 1E3LA 2PKWA 4O5KA 1C14A 2HA3A 1GCGA 2WTBA 5CR0A 3FGZA 1L8LA 4HG2A 5JQGA 2R25B 1DFHA 1E2UA 3ANYB 2VDLB 4QXQA 4UVEA 1AZWA 3KKLA 1L6NA 4ZJZA 1NZBA 3W1EA 4UB3A 5IUKC 1TVKA 2GBCA 3PTAA 2Q2QA 5J0TA 4FN4A 4OTZA 1ZOPA 4EYGA 2VWHA 4GX1A 1Z4KA 3ELYA 4MKGA 4NG5A 4NYMR 1Q5PA 1CUXA 3ICEA 1VSVA 2ZWAA 3WG9A 1I10A 3LLVA 2Z5LA 4D5GA 4Q82A 1EFRD 3VKUA 3SWWA 3N6VA 1NBIA 2GYWA 4Y2HA 3U2QA 3W90A 2PX4A 1XRSB 3JZDA 5MF6A 4V0LA 3SLRA 1A5AB 1U7PA 4R1NA 2M9MA 2MYTA 5G0TA 1XYGA 3NP9A 4M9ZA 2QTLA 3ECSA 5CMLA 1WXEA 2BMAA 3CRQA 4UAZA 2WIFA 2CVQA 2N1RA 1F4PA 4ZAXA 3V8RA 2DGDA 2W6CX 3BRSA 3A1SA 1G6KA 4R9NA 2GK7A 1QYRA 4GQAA 1EE1A 1T9CA 3DQQA 3GLTA 4HTFB 1WYGA 1J0BA 1G3RA 2PV0A 5AO9A 1A97A 1N7GA 5IDWA 1XFDA 3IX7A 3HE3A 1S10A 2VJ4A 5FFFA 4Z7OB 1G8JA 4ELTA 3KLNA 1IEVA 4L1KA 2XY5A 1TCAA 4NXMB 1XCPA 2XAUA 5I7RA 1HUOA 4OHBA 1JQ5A 3G8CA 1NXVA 4DEXA 3F6CA 2FMQA 3ET4A 2LV8A 1JLHA 2XOXA 3E8SA 3EDMA 3E27A 5B2EA 1X92A 3CUTA 3LCJA 1CDEA 1VBMA 2D7CA 3NVZA 2JG3A 2FX2A 1D8YA 4UTNA 1PYGA 1COZA 4Y7CA 1CRQA 4TKUA 4B2IA 3B0XA 3URKA 4CMHA 3THYB 1EDBA 3O94A 4I1VA 3RR2A 5BNTA 4B3SB 5EKDA 3NCTA 3DA8A 4LZGA 3PDJA 2Z2XA 3W3AD 2MMGA 4D96A 1ZQTA 2HMSA 2QE7D 4B9LA 3ABOB 5YASA 3TG8A 3OKAA 2MHCA 5IAJA 2BFDA 1A2BA 5KNDD 1W25A 1VFPA 1IWPB 4D8WA 4KO1S 4UBNA 1MMFB 1E64A 5CCEA 4DO9A 2NQ2C 1SG6A 1II8B 3MSXA 3L8HA 4BEVA 4JBYA 5T4EA 4F4ZA 2I3AA 4INJA 3E23A 4PZCA 3WIOA 1T34A 1M1YE 3G2JA 2DKNA 1EWRA 3WLRA 4GPAA 1RFLA 3H6KA 5JQGF 1EGHA 2ZTCA 3PEFA 7ICJA 2X5XA 4C0JA 1BW9B 1ONNA 4RTPA 4X7RA 1GQSA 2QD3A 4B3MB 2D5IA 2RK4A 5BUZA 4GYWA 4TYQA 2XYPA 4EJSB 4X1IB 3NBAA 4H17A 3EXHC 3PI6A 1C2TA 1J42A 5BSFA 4ER0A 2IYLD 3NBMA 5NLLA 2I2DA 1U4SA 3RH6A 5FF9A 5IASA 5L40A 2ENUA 5ELLA 4Y67A 2NUTB 3INNA 3IUMA 1V11A 5DK6A 5CFLA 2RIRA 3ICWA 5K7SA 3WGVA 4JD5A 4OFBA 3D4OA 4JWNA 4FYIA 4RZIA 3C28A 2BZFA 2AQ4A 1M72A 3W06A 4DQKA 2WNSA 2NVUB 4RTKA 3GBPA 2VZ9A 3ICCA 4RD6A 4E0BA 4J1TA 2I54A 4BMNA 2PBLA 3VTAA 3GDOA 2CL6X 2XUQA 2BZ0A 2EBUA 3BMCB 3PZBA 4CV3A 1YZYA 5EWLA 3IVAA 5EFZA 5T8KC 4BUZA 4RJJA 4EA8A 2V54A 1WULS 4JHLA 4ATNA 4D6XA 5KUTA 2WKQA 2O19A 1B7GO 4N18A 4C8LA 3BZKA 2DULA 4YLGA 4INOA 4WSOA 1H9CA 3MB8A 3BJYA 2AGOA 1NVBA 4XR9A 3ZDDA 4OA8A 1COKA 1QVVA 3M2PA 1JEAA 2IYOA 2KNJA 4JYZA 2SKEA 4R7ZA 3G2NA 4DQPA 4HWTA 4MP8A 2L42A 3NBQA 5EXPA 3ZDFA 1NLZA 4RAOA 4JBHA 4MLPA 3JPTA 5FQOA 3WB0A 2QPTA 4AM8A 4KQCA 1AS0A 3LF1A 8ICKA 1RAEA 1XXHA 5JNTA 3TRHA 2HO5A 2J9RA 3G85A 3PPIA 1MGPA 3O1HB 1XLWA 1X86B 4HX9A 3R76A 1JE1A 1QP4A 4X8OA 3GOQA 4WLVA 3PC6A 4RW0A 5JHGB 2NTVA 1WUKS 4Y2VA 5D2CA 1GTJ1 4YJ2A 2FZEA 3UPDA 4CCSA 4CHGA 3CISA 4BQQA 3GLFE 3L0PA 5KHAA 3L0YA 2DR3A 5F1YA 2ZTVA 4PSUA 4X5VA 4G4SP 1SCNE 2C1ZA 4BGEA 1QFZA 4EEZA 4IOMA 1ZQKA 4YJHB 4YRMA 2GMWA 2CF5A 3LCVB 4GXQA 1UK8A 2BEVA 3SX0A 4YS6A 3C3AA 4A26A 1A9QA 2NV3A 2O8CB 4LZAA 4O3FA 2P77A 1KH3A 1N3BA 3OT4A 1CQPA 3ND9A 1YVDA 4RDIA 4JP2A 2XUKA 5J2CA 4O4IA 2YTZA 4QDXA 5DM70 4ARCA 4EY7A 2AGVA 1IL0A 2GWSA 3W2GA 2O8DA 3U3OA 2QRPA 8ICMA 3NT4A 4LW8A 2TECE 4J4HA 5JSHA 3GV7B 1L3BA 4G81A 2ZAOA 3UT0A 4TLMB 5D7NA 3VOBA 3GJ0A 2ZRBA 1XBTA 3HPQA 4MGEA 2EJTA 4TTIA 2ZTDA 4X1YB 2QL9A 4AZ0A 1C1YA 3H83A 3FGNA 5L3ZA 1XTPA 2ILTA 3OEEA 5HOQA 4RPZA 5IT5A 5I6DA 3L8FA 1U1IA 4EF6A 3KJXA 2AI1A 2R00C 3THOA 1Z2PX 3LRTA 2L5YA 1IATA 1SKRA 2AE1A 3LQ1A 1YZQA 3ZHCA 4PHPA 2JI7A 2R97A 3EYZA 3DNPA 1ZETA 4K0KB 3UTDA 2CK3A 2VIIA 1Y1RA 2HBJA 3QKIA 4AZWA 2X3UA 2PFQA 4B3BA 4NMMA 2ZUFA 1PT6A 1AG9A 1KPIA 3FSRA 3MAAC 3CWCA 3OOSA 1JXEA 1YASA 5B1DA 1PR0A 1QGUA 1Q20A 9ICCA 1ISIA 1Y33E 3AKCA 3Q12A 3U31A 2MSCB 2ODPA 3SSMA 3B1WA 1P7PA 2IYTA 4W9NC 2HBZA 3TSYA 1DKQA 2XTMA 2AI2A 5CGQB 4I1SA 4XJVA 1GFWA 1YHNA 5DE3A 3I9OA 1UAAA 3D8UA 1YULA 2JK1A 4FC7A 4NI5A 1XTZA 1AIPA 1A4XA 3CLSD 1E0SA 2EZYA 1N34B 4W1SA 4DPMA 3IXMA 1ZU5A 4EHBA 3FHJA 3PR5B 3M9XA 3OFJA 1TE2A 4B3CA 3D8RA 3V4SA 3VSCA 1W36D 2QV7A 1TMOA 1CUIA 1QSGA 1GPMA 3SJBA 2PFOA 9ICVA 4YJ2F 1EYZA 2F3QA 3U13A 1S9HA 4UTPA 4KTVE 2QORA 4QYWA 4BX8A 5JCJA 2JKYA 4Y9UA 1F1BA 3OOEA 1SHJA 4DJ5X 4E88A 2J6BA 2NZ2A 2FH5B 4EKDA 1C4XA 1LBTA 4B83A 4CCWA 1O97C 4AG6A 3RB4A 4K1XA 2P6MA 4C43A 5K8TA 4RXUA 4EZIA 2BM9A 4LY3A 4O4IF 4IX9A 4CQMA 4RWZA 3L3BA 2PZBA 3F2IA 1GYRA 1P3DA 2O4UX 3LLMA 4QQFA 1Y8RB 1I7DA 2WWGA 5K0EA 4ZHSA 1JDPA 4C76A 2C77A 3C6YA 4IINA 1WR8A