3QURA

Crystal structure of fosfomycin resistance kinase foma from streptomyces wedmorensis complexed with mgadp and fosfomycin monophosphate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
271
structure length
249
Chain Sequence
b'SGLVPRGSHMTPDFLAIKVGGSLFSRKDEPGSLDDDAVTRFARNFARLAETYRGRMVLISGGGAAFSLAGLTEATFEVKKRWAEKLRGIGVDAFPLQLAAMCTLRNGIPQLRSEVLRDVLDHGALPVLAGDALFDEHGKLWAFSSDRVPEVLLPMVEGRLRVVTLTDVDGIVTDDTILPEVDARSPEQAYAALWGSSGAMHTKLDALVTCARRGAECFIMRGDPGSDLEFLTAPFSSWPAHVRSTRITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FomA protein
publication title Structural and biochemical insights into the mechanism of fosfomycin phosphorylation by fosfomycin resistance kinase FomA.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Transferase
total genus 79
structure length 249
sequence length 271
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3qurA00
2JJXA 3K4YA 4NDRB 3ZZGA 3EK5A 2AKOA 2W21A 2X2WA 4JZ7A 4NDRA 3C20A 4NDPB 4OLCA 2BNDA 3QVFA 3QVHA 3WWMA 3S6KA 3S6HA 2JJ4A 4NDOA 2E9YA 3U6UA 2WXBA 2BNFA 2BNEA 3D41A 2V5HA 3C1NA 2JI5A 3LL9A 3AAWA 3ZZIA 2J4LA 2J4KA 4NDQB 3LL5A 2HMFA 1E19A 1GSJA 4NDQA 3S6GA 1GS5A 3QURA 1B7BA 4AB7A 4NDPA 3AB4A 3QUOA 1Z9DA 3D2PA 3K52A 1OH9A 3LKKA 3L76A 4JZ8A 3K56A 4A7WA 2V4YA 4I49A 2VA1A 2BUFA 2WE4A 2BMUA 2BTYA 2A1FA 3NWYA 3C1MA 2J0XA 3K4OA 2RD5A 3ZZHA 4KZTA 3L86A 4Q1TA 3ZZFA 2BRIA 3T7BA 3KZFA 1YBDA 4F6TB 2J4JA 2J5VA 3D2MA 2R98A 4F6TA 2BRXA 2J5TA 2J0WA 2CDQA 2OGXB 3TVIA 3B8GA 1OHBA 3WWNA 4JZ9A 4AXSA 2OGXA 2AP9A 4NDOB 3QUNA 2R8VA 2IJ9A 3D40A 4USJA 1OHAA 3AB2A 2WE5A 4A7XA 3EK6A
chains in the Genus database with same CATH superfamily
2JJXA 3K4YA 4NDRB 3ZZGA 3EK5A 2AKOA 2W21A 2X2WA 4JZ7A 4NDRA 3C20A 4NDPB 4OLCA 2BNDA 3QVFA 3QVHA 3WWMA 3S6KA 3S6HA 2JJ4A 4NDOA 2E9YA 3U6UA 2WXBA 2BNFA 2BNEA 3D41A 2V5HA 3C1NA 2JI5A 3LL9A 3AAWA 3ZZIA 2J4LA 2J4KA 4NDQB 3LL5A 2HMFA 1E19A 1GSJA 4NDQA 3S6GA 1GS5A 3QURA 1B7BA 4AB7A 4NDPA 3AB4A 3QUOA 1Z9DA 3D2PA 3K52A 1OH9A 3LKKA 3L76A 4JZ8A 3K56A 4A7WA 2V4YA 4I49A 2VA1A 2BUFA 2WE4A 2BMUA 2BTYA 2A1FA 3NWYA 3C1MA 2J0XA 3K4OA 2RD5A 3ZZHA 4KZTA 3L86A 4Q1TA 3ZZFA 2BRIA 3T7BA 3KZFA 1YBDA 4F6TB 2J4JA 2J5VA 3D2MA 2R98A 4F6TA 2BRXA 2J5TA 2J0WA 2CDQA 2OGXB 3TVIA 3B8GA 1OHBA 3WWNA 4JZ9A 4AXSA 2OGXA 2AP9A 4NDOB 3QUNA 2R8VA 2IJ9A 3D40A 4USJA 1OHAA 3AB2A 2WE5A 4A7XA 3EK6A
chains in the Genus database with same CATH topology
2JJXA 3K4YA 4NDRB 3ZZGA 3EK5A 2AKOA 2W21A 2X2WA 4JZ7A 4NDRA 3C20A 4NDPB 4OLCA 2BNDA 3QVFA 3QVHA 3WWMA 3S6KA 3S6HA 2JJ4A 4NDOA 2E9YA 3U6UA 2WXBA 2BNFA 2BNEA 3D41A 2V5HA 3C1NA 2JI5A 3LL9A 3AAWA 3ZZIA 2J4LA 2J4KA 4NDQB 3LL5A 2HMFA 1E19A 1GSJA 4NDQA 3S6GA 1GS5A 3QURA 1B7BA 4AB7A 4NDPA 3AB4A 3QUOA 1Z9DA 3D2PA 3K52A 1OH9A 3LKKA 3L76A 4JZ8A 3K56A 4A7WA 2V4YA 4I49A 2VA1A 2BUFA 2WE4A 2BMUA 2BTYA 2A1FA 3NWYA 3C1MA 2J0XA 3K4OA 2RD5A 3ZZHA 4KZTA 3L86A 4Q1TA 3ZZFA 2BRIA 3T7BA 3KZFA 1YBDA 4F6TB 2J4JA 2J5VA 3D2MA 2R98A 4F6TA 2BRXA 2J5TA 2J0WA 2CDQA 2OGXB 3TVIA 3B8GA 1OHBA 3WWNA 4JZ9A 4AXSA 2OGXA 2AP9A 4NDOB 3QUNA 2R8VA 2IJ9A 3D40A 4USJA 1OHAA 3AB2A 2WE5A 4A7XA 3EK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJX A;  3K4Y A;  4NDR B;  3ZZG A;  3EK5 A;  2AKO A;  2W21 A;  2X2W A;  4JZ7 A;  4NDR A;  3C20 A;  4NDP B;  4OLC A;  2BND A;  3QVF A;  3QVH A;  3WWM A;  3S6K A;  3S6H A;  2JJ4 A;  4NDO A;  2E9Y A;  3U6U A;  2WXB A;  2BNF A;  2BNE A;  3D41 A;  2V5H A;  3C1N A;  2JI5 A;  3LL9 A;  3AAW A;  3ZZI A;  2J4L A;  2J4K A;  4NDQ B;  3LL5 A;  2HMF A;  1E19 A;  1GSJ A;  4NDQ A;  3S6G A;  1GS5 A;  3QUR A;  1B7B A;  4AB7 A;  4NDP A;  3AB4 A;  3QUO A;  1Z9D A;  3D2P A;  3K52 A;  1OH9 A;  3LKK A;  3L76 A;  4JZ8 A;  3K56 A;  4A7W A;  2V4Y A;  4I49 A;  2VA1 A;  2BUF A;  2WE4 A;  2BMU A;  2BTY A;  2A1F A;  3NWY A;  3C1M A;  2J0X A;  3K4O A;  2RD5 A;  3ZZH A;  4KZT A;  3L86 A;  4Q1T A;  3ZZF A;  2BRI A;  3T7B A;  3KZF A;  1YBD A;  4F6T B;  2J4J A;  2J5V A;  3D2M A;  2R98 A;  4F6T A;  2BRX A;  2J5T A;  2J0W A;  2CDQ A;  2OGX B;  3TVI A;  3B8G A;  1OHB A;  3WWN A;  4JZ9 A;  4AXS A;  2OGX A;  2AP9 A;  4NDO B;  3QUN A;  2R8V A;  2IJ9 A;  3D40 A;  4USJ A;  1OHA A;  3AB2 A;  2WE5 A;  4A7X A;  3EK6 A; 
#chains in the Genus database with same CATH topology
 2JJX A;  3K4Y A;  4NDR B;  3ZZG A;  3EK5 A;  2AKO A;  2W21 A;  2X2W A;  4JZ7 A;  4NDR A;  3C20 A;  4NDP B;  4OLC A;  2BND A;  3QVF A;  3QVH A;  3WWM A;  3S6K A;  3S6H A;  2JJ4 A;  4NDO A;  2E9Y A;  3U6U A;  2WXB A;  2BNF A;  2BNE A;  3D41 A;  2V5H A;  3C1N A;  2JI5 A;  3LL9 A;  3AAW A;  3ZZI A;  2J4L A;  2J4K A;  4NDQ B;  3LL5 A;  2HMF A;  1E19 A;  1GSJ A;  4NDQ A;  3S6G A;  1GS5 A;  3QUR A;  1B7B A;  4AB7 A;  4NDP A;  3AB4 A;  3QUO A;  1Z9D A;  3D2P A;  3K52 A;  1OH9 A;  3LKK A;  3L76 A;  4JZ8 A;  3K56 A;  4A7W A;  2V4Y A;  4I49 A;  2VA1 A;  2BUF A;  2WE4 A;  2BMU A;  2BTY A;  2A1F A;  3NWY A;  3C1M A;  2J0X A;  3K4O A;  2RD5 A;  3ZZH A;  4KZT A;  3L86 A;  4Q1T A;  3ZZF A;  2BRI A;  3T7B A;  3KZF A;  1YBD A;  4F6T B;  2J4J A;  2J5V A;  3D2M A;  2R98 A;  4F6T A;  2BRX A;  2J5T A;  2J0W A;  2CDQ A;  2OGX B;  3TVI A;  3B8G A;  1OHB A;  3WWN A;  4JZ9 A;  4AXS A;  2OGX A;  2AP9 A;  4NDO B;  3QUN A;  2R8V A;  2IJ9 A;  3D40 A;  4USJ A;  1OHA A;  3AB2 A;  2WE5 A;  4A7X A;  3EK6 A; 
#chains in the Genus database with same CATH homology
 2JJX A;  3K4Y A;  4NDR B;  3ZZG A;  3EK5 A;  2AKO A;  2W21 A;  2X2W A;  4JZ7 A;  4NDR A;  3C20 A;  4NDP B;  4OLC A;  2BND A;  3QVF A;  3QVH A;  3WWM A;  3S6K A;  3S6H A;  2JJ4 A;  4NDO A;  2E9Y A;  3U6U A;  2WXB A;  2BNF A;  2BNE A;  3D41 A;  2V5H A;  3C1N A;  2JI5 A;  3LL9 A;  3AAW A;  3ZZI A;  2J4L A;  2J4K A;  4NDQ B;  3LL5 A;  2HMF A;  1E19 A;  1GSJ A;  4NDQ A;  3S6G A;  1GS5 A;  3QUR A;  1B7B A;  4AB7 A;  4NDP A;  3AB4 A;  3QUO A;  1Z9D A;  3D2P A;  3K52 A;  1OH9 A;  3LKK A;  3L76 A;  4JZ8 A;  3K56 A;  4A7W A;  2V4Y A;  4I49 A;  2VA1 A;  2BUF A;  2WE4 A;  2BMU A;  2BTY A;  2A1F A;  3NWY A;  3C1M A;  2J0X A;  3K4O A;  2RD5 A;  3ZZH A;  4KZT A;  3L86 A;  4Q1T A;  3ZZF A;  2BRI A;  3T7B A;  3KZF A;  1YBD A;  4F6T B;  2J4J A;  2J5V A;  3D2M A;  2R98 A;  4F6T A;  2BRX A;  2J5T A;  2J0W A;  2CDQ A;  2OGX B;  3TVI A;  3B8G A;  1OHB A;  3WWN A;  4JZ9 A;  4AXS A;  2OGX A;  2AP9 A;  4NDO B;  3QUN A;  2R8V A;  2IJ9 A;  3D40 A;  4USJ A;  1OHA A;  3AB2 A;  2WE5 A;  4A7X A;  3EK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...