3QURA

Crystal structure of fosfomycin resistance kinase foma from streptomyces wedmorensis complexed with mgadp and fosfomycin monophosphate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
271
structure length
249
Chain Sequence
SGLVPRGSHMTPDFLAIKVGGSLFSRKDEPGSLDDDAVTRFARNFARLAETYRGRMVLISGGGAAFSLAGLTEATFEVKKRWAEKLRGIGVDAFPLQLAAMCTLRNGIPQLRSEVLRDVLDHGALPVLAGDALFDEHGKLWAFSSDRVPEVLLPMVEGRLRVVTLTDVDGIVTDDTILPEVDARSPEQAYAALWGSSGAMHTKLDALVTCARRGAECFIMRGDPGSDLEFLTAPFSSWPAHVRSTRITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical insights into the mechanism of fosfomycin phosphorylation by fosfomycin resistance kinase FomA.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Transferase
molecule keywords FomA protein
total genus 79
structure length 249
sequence length 271
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3qurA00
3TVIA 4F6TA 2J0WA 3QVFA 3AB2A 2JJXA 2CDQA 2J4LA 1YBDA 3WWNA 2J4KA 2BUFA 2A1FA 4A7XA 2J0XA 4NDOB 2J4JA 2R98A 3D2MA 3K56A 3C20A 3AB4A 3LKKA 1OHBA 2JI5A 2V5HA 3D2PA 3AAWA 3NWYA 2BTYA 3ZZIA 3QUOA 3B8GA 2WE5A 3ZZGA 4KZTA 2R8VA 4I49A 2BNFA 2HMFA 3ZZFA 3D40A 1OH9A 2BNEA 2E9YA 1OHAA 2WE4A 2BNDA 2IJ9A 3KZFA 4NDPA 4A7WA 4JZ8A 3C1MA 2J5TA 3D41A 3ZZHA 3WWMA 4USJA 1GS5A 2OGXB 3S6HA 2BMUA 2J5VA 1E19A 4JZ7A 4NDQA 3S6KA 4NDRA 4F6TB 2W21A 2JJ4A 3EK6A 3LL9A 4OLCA 3QVHA 4JZ9A 2AKOA 2V4YA 3EK5A 3K52A 3L86A 3LL5A 3K4OA 2RD5A 2BRXA 2WXBA 1B7BA 4NDRB 2X2WA 3QUNA 2VA1A 2AP9A 4NDPB 4AB7A 3T7BA 1GSJA 3QURA 3C1NA 2OGXA 3S6GA 1Z9DA 3L76A 4NDQB 3U6UA 4NDOA 4AXSA 3K4YA 4Q1TA 2BRIA
chains in the Genus database with same CATH superfamily
3TVIA 4F6TA 2J0WA 3QVFA 3AB2A 2JJXA 2CDQA 2J4LA 1YBDA 3WWNA 2J4KA 2BUFA 2A1FA 4A7XA 2J0XA 4NDOB 2J4JA 2R98A 3D2MA 3K56A 3C20A 3AB4A 3LKKA 1OHBA 2JI5A 2V5HA 3D2PA 3AAWA 3NWYA 2BTYA 3ZZIA 3QUOA 3B8GA 2WE5A 3ZZGA 4KZTA 2R8VA 4I49A 2BNFA 2HMFA 3ZZFA 3D40A 1OH9A 2BNEA 2E9YA 1OHAA 2WE4A 2BNDA 2IJ9A 3KZFA 4NDPA 4A7WA 4JZ8A 3C1MA 2J5TA 3D41A 3ZZHA 3WWMA 4USJA 1GS5A 2OGXB 3S6HA 2BMUA 2J5VA 1E19A 4JZ7A 4NDQA 3S6KA 4NDRA 4F6TB 2W21A 2JJ4A 3EK6A 3LL9A 4OLCA 3QVHA 4JZ9A 2AKOA 2V4YA 3EK5A 3K52A 3L86A 3LL5A 3K4OA 2RD5A 2BRXA 2WXBA 1B7BA 4NDRB 2X2WA 3QUNA 2VA1A 2AP9A 4NDPB 4AB7A 3T7BA 1GSJA 3QURA 3C1NA 2OGXA 3S6GA 1Z9DA 3L76A 4NDQB 3U6UA 4NDOA 4AXSA 3K4YA 4Q1TA 2BRIA
chains in the Genus database with same CATH topology
3TVIA 4F6TA 2J0WA 3QVFA 3AB2A 2JJXA 2CDQA 2J4LA 1YBDA 3WWNA 2J4KA 2BUFA 2A1FA 4A7XA 2J0XA 4NDOB 2J4JA 2R98A 3D2MA 3K56A 3C20A 3AB4A 3LKKA 1OHBA 2JI5A 2V5HA 3D2PA 3AAWA 3NWYA 2BTYA 3ZZIA 3QUOA 3B8GA 2WE5A 3ZZGA 4KZTA 2R8VA 4I49A 2BNFA 2HMFA 3ZZFA 3D40A 1OH9A 2BNEA 2E9YA 1OHAA 2WE4A 2BNDA 2IJ9A 3KZFA 4NDPA 4A7WA 4JZ8A 3C1MA 2J5TA 3D41A 3ZZHA 3WWMA 4USJA 1GS5A 2OGXB 3S6HA 2BMUA 2J5VA 1E19A 4JZ7A 4NDQA 3S6KA 4NDRA 4F6TB 2W21A 2JJ4A 3EK6A 3LL9A 4OLCA 3QVHA 4JZ9A 2AKOA 2V4YA 3EK5A 3K52A 3L86A 3LL5A 3K4OA 2RD5A 2BRXA 2WXBA 1B7BA 4NDRB 2X2WA 3QUNA 2VA1A 2AP9A 4NDPB 4AB7A 3T7BA 1GSJA 3QURA 3C1NA 2OGXA 3S6GA 1Z9DA 3L76A 4NDQB 3U6UA 4NDOA 4AXSA 3K4YA 4Q1TA 2BRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TVI A;  4F6T A;  2J0W A;  3QVF A;  3AB2 A;  2JJX A;  2CDQ A;  2J4L A;  1YBD A;  3WWN A;  2J4K A;  2BUF A;  2A1F A;  4A7X A;  2J0X A;  4NDO B;  2J4J A;  2R98 A;  3D2M A;  3K56 A;  3C20 A;  3AB4 A;  3LKK A;  1OHB A;  2JI5 A;  2V5H A;  3D2P A;  3AAW A;  3NWY A;  2BTY A;  3ZZI A;  3QUO A;  3B8G A;  2WE5 A;  3ZZG A;  4KZT A;  2R8V A;  4I49 A;  2BNF A;  2HMF A;  3ZZF A;  3D40 A;  1OH9 A;  2BNE A;  2E9Y A;  1OHA A;  2WE4 A;  2BND A;  2IJ9 A;  3KZF A;  4NDP A;  4A7W A;  4JZ8 A;  3C1M A;  2J5T A;  3D41 A;  3ZZH A;  3WWM A;  4USJ A;  1GS5 A;  2OGX B;  3S6H A;  2BMU A;  2J5V A;  1E19 A;  4JZ7 A;  4NDQ A;  3S6K A;  4NDR A;  4F6T B;  2W21 A;  2JJ4 A;  3EK6 A;  3LL9 A;  4OLC A;  3QVH A;  4JZ9 A;  2AKO A;  2V4Y A;  3EK5 A;  3K52 A;  3L86 A;  3LL5 A;  3K4O A;  2RD5 A;  2BRX A;  2WXB A;  1B7B A;  4NDR B;  2X2W A;  3QUN A;  2VA1 A;  2AP9 A;  4NDP B;  4AB7 A;  3T7B A;  1GSJ A;  3QUR A;  3C1N A;  2OGX A;  3S6G A;  1Z9D A;  3L76 A;  4NDQ B;  3U6U A;  4NDO A;  4AXS A;  3K4Y A;  4Q1T A;  2BRI A; 
#chains in the Genus database with same CATH topology
 3TVI A;  4F6T A;  2J0W A;  3QVF A;  3AB2 A;  2JJX A;  2CDQ A;  2J4L A;  1YBD A;  3WWN A;  2J4K A;  2BUF A;  2A1F A;  4A7X A;  2J0X A;  4NDO B;  2J4J A;  2R98 A;  3D2M A;  3K56 A;  3C20 A;  3AB4 A;  3LKK A;  1OHB A;  2JI5 A;  2V5H A;  3D2P A;  3AAW A;  3NWY A;  2BTY A;  3ZZI A;  3QUO A;  3B8G A;  2WE5 A;  3ZZG A;  4KZT A;  2R8V A;  4I49 A;  2BNF A;  2HMF A;  3ZZF A;  3D40 A;  1OH9 A;  2BNE A;  2E9Y A;  1OHA A;  2WE4 A;  2BND A;  2IJ9 A;  3KZF A;  4NDP A;  4A7W A;  4JZ8 A;  3C1M A;  2J5T A;  3D41 A;  3ZZH A;  3WWM A;  4USJ A;  1GS5 A;  2OGX B;  3S6H A;  2BMU A;  2J5V A;  1E19 A;  4JZ7 A;  4NDQ A;  3S6K A;  4NDR A;  4F6T B;  2W21 A;  2JJ4 A;  3EK6 A;  3LL9 A;  4OLC A;  3QVH A;  4JZ9 A;  2AKO A;  2V4Y A;  3EK5 A;  3K52 A;  3L86 A;  3LL5 A;  3K4O A;  2RD5 A;  2BRX A;  2WXB A;  1B7B A;  4NDR B;  2X2W A;  3QUN A;  2VA1 A;  2AP9 A;  4NDP B;  4AB7 A;  3T7B A;  1GSJ A;  3QUR A;  3C1N A;  2OGX A;  3S6G A;  1Z9D A;  3L76 A;  4NDQ B;  3U6U A;  4NDO A;  4AXS A;  3K4Y A;  4Q1T A;  2BRI A; 
#chains in the Genus database with same CATH homology
 3TVI A;  4F6T A;  2J0W A;  3QVF A;  3AB2 A;  2JJX A;  2CDQ A;  2J4L A;  1YBD A;  3WWN A;  2J4K A;  2BUF A;  2A1F A;  4A7X A;  2J0X A;  4NDO B;  2J4J A;  2R98 A;  3D2M A;  3K56 A;  3C20 A;  3AB4 A;  3LKK A;  1OHB A;  2JI5 A;  2V5H A;  3D2P A;  3AAW A;  3NWY A;  2BTY A;  3ZZI A;  3QUO A;  3B8G A;  2WE5 A;  3ZZG A;  4KZT A;  2R8V A;  4I49 A;  2BNF A;  2HMF A;  3ZZF A;  3D40 A;  1OH9 A;  2BNE A;  2E9Y A;  1OHA A;  2WE4 A;  2BND A;  2IJ9 A;  3KZF A;  4NDP A;  4A7W A;  4JZ8 A;  3C1M A;  2J5T A;  3D41 A;  3ZZH A;  3WWM A;  4USJ A;  1GS5 A;  2OGX B;  3S6H A;  2BMU A;  2J5V A;  1E19 A;  4JZ7 A;  4NDQ A;  3S6K A;  4NDR A;  4F6T B;  2W21 A;  2JJ4 A;  3EK6 A;  3LL9 A;  4OLC A;  3QVH A;  4JZ9 A;  2AKO A;  2V4Y A;  3EK5 A;  3K52 A;  3L86 A;  3LL5 A;  3K4O A;  2RD5 A;  2BRX A;  2WXB A;  1B7B A;  4NDR B;  2X2W A;  3QUN A;  2VA1 A;  2AP9 A;  4NDP B;  4AB7 A;  3T7B A;  1GSJ A;  3QUR A;  3C1N A;  2OGX A;  3S6G A;  1Z9D A;  3L76 A;  4NDQ B;  3U6U A;  4NDO A;  4AXS A;  3K4Y A;  4Q1T A;  2BRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...