3QURA

Crystal structure of fosfomycin resistance kinase foma from streptomyces wedmorensis complexed with mgadp and fosfomycin monophosphate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
271
structure length
249
Chain Sequence
SGLVPRGSHMTPDFLAIKVGGSLFSRKDEPGSLDDDAVTRFARNFARLAETYRGRMVLISGGGAAFSLAGLTEATFEVKKRWAEKLRGIGVDAFPLQLAAMCTLRNGIPQLRSEVLRDVLDHGALPVLAGDALFDEHGKLWAFSSDRVPEVLLPMVEGRLRVVTLTDVDGIVTDDTILPEVDARSPEQAYAALWGSSGAMHTKLDALVTCARRGAECFIMRGDPGSDLEFLTAPFSSWPAHVRSTRITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FomA protein
publication title Structural and biochemical insights into the mechanism of fosfomycin phosphorylation by fosfomycin resistance kinase FomA.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Transferase
total genus 79
structure length 249
sequence length 271
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3qurA00
3D2PA 2J4KA 2J0WA 4A7WA 3K4OA 1OHBA 3U6UA 4AXSA 4NDQB 3LL5A 1GS5A 2J5TA 4JZ9A 3K4YA 2CDQA 2HMFA 4AB7A 3C1MA 3S6KA 2BRXA 3C20A 2V4YA 3QUOA 4F6TA 3D40A 3QURA 3AB4A 4NDPB 2JJXA 3L76A 4I49A 3B8GA 4KZTA 2AP9A 2A1FA 2OGXA 3AAWA 3D2MA 2R8VA 2J5VA 2IJ9A 3TVIA 4NDRB 4Q1TA 3ZZHA 3AB2A 2X2WA 3K52A 3S6HA 2J4LA 4NDOA 4USJA 2V5HA 3KZFA 2BUFA 2WE4A 2WXBA 2BNDA 2BNEA 2BMUA 2JJ4A 1YBDA 2RD5A 3T7BA 2JI5A 3ZZIA 3L86A 2VA1A 4F6TB 4NDQA 3K56A 1B7BA 2AKOA 1GSJA 3ZZGA 2BRIA 2WE5A 1OHAA 3QVFA 2J4JA 4OLCA 3WWNA 2BTYA 4A7XA 3EK5A 2J0XA 4NDPA 2BNFA 3S6GA 4NDOB 3D41A 3QUNA 3LL9A 3C1NA 3WWMA 4JZ8A 2R98A 3LKKA 1E19A 2E9YA 3NWYA 4NDRA 1OH9A 3ZZFA 4JZ7A 2W21A 3EK6A 2OGXB 1Z9DA 3QVHA
chains in the Genus database with same CATH superfamily
3D2PA 2J4KA 2J0WA 4A7WA 3K4OA 1OHBA 3U6UA 4AXSA 4NDQB 3LL5A 1GS5A 2J5TA 4JZ9A 3K4YA 2CDQA 2HMFA 4AB7A 3C1MA 3S6KA 2BRXA 3C20A 2V4YA 3QUOA 4F6TA 3D40A 3QURA 3AB4A 4NDPB 2JJXA 3L76A 4I49A 3B8GA 4KZTA 2AP9A 2A1FA 2OGXA 3AAWA 3D2MA 2R8VA 2J5VA 2IJ9A 3TVIA 4NDRB 4Q1TA 3ZZHA 3AB2A 2X2WA 3K52A 3S6HA 2J4LA 4NDOA 4USJA 2V5HA 3KZFA 2BUFA 2WE4A 2WXBA 2BNDA 2BNEA 2BMUA 2JJ4A 1YBDA 2RD5A 3T7BA 2JI5A 3ZZIA 3L86A 2VA1A 4F6TB 4NDQA 3K56A 1B7BA 2AKOA 1GSJA 3ZZGA 2BRIA 2WE5A 1OHAA 3QVFA 2J4JA 4OLCA 3WWNA 2BTYA 4A7XA 3EK5A 2J0XA 4NDPA 2BNFA 3S6GA 4NDOB 3D41A 3QUNA 3LL9A 3C1NA 3WWMA 4JZ8A 2R98A 3LKKA 1E19A 2E9YA 3NWYA 4NDRA 1OH9A 3ZZFA 4JZ7A 2W21A 3EK6A 2OGXB 1Z9DA 3QVHA
chains in the Genus database with same CATH topology
3D2PA 2J4KA 2J0WA 4A7WA 3K4OA 1OHBA 3U6UA 4AXSA 4NDQB 3LL5A 1GS5A 2J5TA 4JZ9A 3K4YA 2CDQA 2HMFA 4AB7A 3C1MA 3S6KA 2BRXA 3C20A 2V4YA 3QUOA 4F6TA 3D40A 3QURA 3AB4A 4NDPB 2JJXA 3L76A 4I49A 3B8GA 4KZTA 2AP9A 2A1FA 2OGXA 3AAWA 3D2MA 2R8VA 2J5VA 2IJ9A 3TVIA 4NDRB 4Q1TA 3ZZHA 3AB2A 2X2WA 3K52A 3S6HA 2J4LA 4NDOA 4USJA 2V5HA 3KZFA 2BUFA 2WE4A 2WXBA 2BNDA 2BNEA 2BMUA 2JJ4A 1YBDA 2RD5A 3T7BA 2JI5A 3ZZIA 3L86A 2VA1A 4F6TB 4NDQA 3K56A 1B7BA 2AKOA 1GSJA 3ZZGA 2BRIA 2WE5A 1OHAA 3QVFA 2J4JA 4OLCA 3WWNA 2BTYA 4A7XA 3EK5A 2J0XA 4NDPA 2BNFA 3S6GA 4NDOB 3D41A 3QUNA 3LL9A 3C1NA 3WWMA 4JZ8A 2R98A 3LKKA 1E19A 2E9YA 3NWYA 4NDRA 1OH9A 3ZZFA 4JZ7A 2W21A 3EK6A 2OGXB 1Z9DA 3QVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2P A;  2J4K A;  2J0W A;  4A7W A;  3K4O A;  1OHB A;  3U6U A;  4AXS A;  4NDQ B;  3LL5 A;  1GS5 A;  2J5T A;  4JZ9 A;  3K4Y A;  2CDQ A;  2HMF A;  4AB7 A;  3C1M A;  3S6K A;  2BRX A;  3C20 A;  2V4Y A;  3QUO A;  4F6T A;  3D40 A;  3QUR A;  3AB4 A;  4NDP B;  2JJX A;  3L76 A;  4I49 A;  3B8G A;  4KZT A;  2AP9 A;  2A1F A;  2OGX A;  3AAW A;  3D2M A;  2R8V A;  2J5V A;  2IJ9 A;  3TVI A;  4NDR B;  4Q1T A;  3ZZH A;  3AB2 A;  2X2W A;  3K52 A;  3S6H A;  2J4L A;  4NDO A;  4USJ A;  2V5H A;  3KZF A;  2BUF A;  2WE4 A;  2WXB A;  2BND A;  2BNE A;  2BMU A;  2JJ4 A;  1YBD A;  2RD5 A;  3T7B A;  2JI5 A;  3ZZI A;  3L86 A;  2VA1 A;  4F6T B;  4NDQ A;  3K56 A;  1B7B A;  2AKO A;  1GSJ A;  3ZZG A;  2BRI A;  2WE5 A;  1OHA A;  3QVF A;  2J4J A;  4OLC A;  3WWN A;  2BTY A;  4A7X A;  3EK5 A;  2J0X A;  4NDP A;  2BNF A;  3S6G A;  4NDO B;  3D41 A;  3QUN A;  3LL9 A;  3C1N A;  3WWM A;  4JZ8 A;  2R98 A;  3LKK A;  1E19 A;  2E9Y A;  3NWY A;  4NDR A;  1OH9 A;  3ZZF A;  4JZ7 A;  2W21 A;  3EK6 A;  2OGX B;  1Z9D A;  3QVH A; 
#chains in the Genus database with same CATH topology
 3D2P A;  2J4K A;  2J0W A;  4A7W A;  3K4O A;  1OHB A;  3U6U A;  4AXS A;  4NDQ B;  3LL5 A;  1GS5 A;  2J5T A;  4JZ9 A;  3K4Y A;  2CDQ A;  2HMF A;  4AB7 A;  3C1M A;  3S6K A;  2BRX A;  3C20 A;  2V4Y A;  3QUO A;  4F6T A;  3D40 A;  3QUR A;  3AB4 A;  4NDP B;  2JJX A;  3L76 A;  4I49 A;  3B8G A;  4KZT A;  2AP9 A;  2A1F A;  2OGX A;  3AAW A;  3D2M A;  2R8V A;  2J5V A;  2IJ9 A;  3TVI A;  4NDR B;  4Q1T A;  3ZZH A;  3AB2 A;  2X2W A;  3K52 A;  3S6H A;  2J4L A;  4NDO A;  4USJ A;  2V5H A;  3KZF A;  2BUF A;  2WE4 A;  2WXB A;  2BND A;  2BNE A;  2BMU A;  2JJ4 A;  1YBD A;  2RD5 A;  3T7B A;  2JI5 A;  3ZZI A;  3L86 A;  2VA1 A;  4F6T B;  4NDQ A;  3K56 A;  1B7B A;  2AKO A;  1GSJ A;  3ZZG A;  2BRI A;  2WE5 A;  1OHA A;  3QVF A;  2J4J A;  4OLC A;  3WWN A;  2BTY A;  4A7X A;  3EK5 A;  2J0X A;  4NDP A;  2BNF A;  3S6G A;  4NDO B;  3D41 A;  3QUN A;  3LL9 A;  3C1N A;  3WWM A;  4JZ8 A;  2R98 A;  3LKK A;  1E19 A;  2E9Y A;  3NWY A;  4NDR A;  1OH9 A;  3ZZF A;  4JZ7 A;  2W21 A;  3EK6 A;  2OGX B;  1Z9D A;  3QVH A; 
#chains in the Genus database with same CATH homology
 3D2P A;  2J4K A;  2J0W A;  4A7W A;  3K4O A;  1OHB A;  3U6U A;  4AXS A;  4NDQ B;  3LL5 A;  1GS5 A;  2J5T A;  4JZ9 A;  3K4Y A;  2CDQ A;  2HMF A;  4AB7 A;  3C1M A;  3S6K A;  2BRX A;  3C20 A;  2V4Y A;  3QUO A;  4F6T A;  3D40 A;  3QUR A;  3AB4 A;  4NDP B;  2JJX A;  3L76 A;  4I49 A;  3B8G A;  4KZT A;  2AP9 A;  2A1F A;  2OGX A;  3AAW A;  3D2M A;  2R8V A;  2J5V A;  2IJ9 A;  3TVI A;  4NDR B;  4Q1T A;  3ZZH A;  3AB2 A;  2X2W A;  3K52 A;  3S6H A;  2J4L A;  4NDO A;  4USJ A;  2V5H A;  3KZF A;  2BUF A;  2WE4 A;  2WXB A;  2BND A;  2BNE A;  2BMU A;  2JJ4 A;  1YBD A;  2RD5 A;  3T7B A;  2JI5 A;  3ZZI A;  3L86 A;  2VA1 A;  4F6T B;  4NDQ A;  3K56 A;  1B7B A;  2AKO A;  1GSJ A;  3ZZG A;  2BRI A;  2WE5 A;  1OHA A;  3QVF A;  2J4J A;  4OLC A;  3WWN A;  2BTY A;  4A7X A;  3EK5 A;  2J0X A;  4NDP A;  2BNF A;  3S6G A;  4NDO B;  3D41 A;  3QUN A;  3LL9 A;  3C1N A;  3WWM A;  4JZ8 A;  2R98 A;  3LKK A;  1E19 A;  2E9Y A;  3NWY A;  4NDR A;  1OH9 A;  3ZZF A;  4JZ7 A;  2W21 A;  3EK6 A;  2OGX B;  1Z9D A;  3QVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...