3QUVA

Crystal structure of a trna-guanine-n1-methyltransferase from mycobacterium abscessus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
Knots found
sequence length
229
structure length
216
Chain Sequence
GSMKIDVVTIFPEYLQPVRQSLPGKAIDAGLVDVAVHDLRRWTHDVHKSVDDSPYGGGPGMVMKPTVWGDALDEICTSETLLVVPTPAGYPFTQETAWQWSTEDHLVIACGRYEGIDQRVADDAATRMRVREVSIGDYVLNGGEAAALVIIEAVLRLVPGVLGNASLLEGPSYTRPPSWRGMDVPPVLLSGDHAKIAAWRAEQSRQRTIERRPDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
total genus 56
structure length 216
sequence length 229
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.31: Transferred entry: 2.1.1.221 and 2.1.1.228.
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 3quvA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3quvA01
4YVHA 4CNEA 1X7PA 4MCCA 3BBEA 4YQ8A 4YQGA 1NXZA 1UAMA 4YQCA 4YQBA 4YVJA 1P9PA 3IEFA 2I6DA 2O3AA 2YY8A 5GM8A 1MXIA 3AI9X 4YQRA 4YQTA 4YQ4A 3E5YA 1GZ0A 1V2XA 4YVIA 4X3LA 1ZJRA 3BBHA 4YQQA 4IG6A 4YPXA 1X7OA 4YVGA 4YQ5A 1J85A 3L8UA 1VHYA 4L69A 4YPZA 3KY7A 4YQPA 4YQNA 1IPAA 5D9FA 3OIJA 2QWVA 3O7BA 3N4JA 3KNUA 3NK6A 3ILKA 3AXZA 4YQ2A 3ONPA 5CO4A 1UAKA 3GYQA 4XBOA 4E8BA 4YQ6A 3DCMX 4YQ7A 1VH0A 3OINA 3KTYA 4YQOA 5GMCA 4YQIA 4YQKA 4JALA 4YQ1A 3N4KA 4YQDA 4KGNA 4YQ9A 4YQAA 2V3KA 2Z0YA 1VHKA 3KW2A 2CX8A 3QUVA 1O6DA 4YQ3A 4YQLA 4CNFA 4JAKA 4YQJA 4YQ0A 5FAIA 4CNGA 1TO0A 4X3MA 1UAJA 4MCDA 4MCBA 3IC6A 4PZKA 1OY5A 3AIAA 1Z85A 4YVKA 4KDZA 2EGVA 4H3YA 5GMBA 4J3CA 1UALA 2V3JA 4YQSA 2QMMA 4YPYA 1V6ZA 4FAKA 4CNDA 3NK7A 1K3RA 4YPWA 2HA8A 3OIIA 3BBDA 4RG1A 1NS5A 4H3ZA 2EGWA
chains in the Genus database with same CATH superfamily
4YVHA 4CNEA 2XDIA 1X7PA 1CO0A 3KORA 4MCCA 3BBEA 4YQ8A 4YQGA 1NXZA 1UAMA 1RCSA 4YQCA 2OZ9R 4YQBA 4YVJA 1P9PA 3IEFA 2I6DA 2O3AA 2YY8A 5GM8A 1MXIA 3AI9X 4YQRA 1WRSR 4YQTA 4YQ4A 1ZT9A 3E5YA 1GZ0A 1V2XA 4YVIA 4X3LA 1ZJRA 3BBHA 4YQQA 4IG6A 4YPXA 1X7OA 4YVGA 4YQ5A 1J85A 3L8UA 3WRPA 1VHYA 4L69A 4YPZA 3KY7A 4YQPA 4YQNA 1IPAA 4JWHA 5D9FA 3OIJA 2QWVA 3O7BA 3N4JA 3KNUA 3NK6A 3ILKA 3AXZA 4YQ2A 3ONPA 5CO4A 1UAKA 3GYQA 4XBOA 4JWGA 4YQ6A 4E8BA 3DCMX 4JWFA 4YQ7A 1VH0A 3OINA 3KTYA 4YQOA 5GMCA 3G1CA 4YQIA 4YQKA 1WRPR 3FRWA 1TROA 4JALA 4YQ1A 3N4KA 4YQDA 4KGNA 1WRTR 4YQ9A 4YQAA 2V3KA 2Z0YA 1VHKA 3KW2A 2CX8A 1JHGA 3QUVA 1O6DA 4YQ3A 4YQLA 4CNFA 4JAKA 3SSWN 4YQJA 4YQ0A 5FAIA 4CNGA 1TO0A 4X3MA 1UAJA 4MCDA 4MCBA 3IC6A 4PZKA 1OY5A 3AIAA 4JWJA 4YVKA 1Z85A 4KDZA 2EGVA 4H3YA 5GMBA 3SSXN 4J3CA 1UALA 2V3JA 4YQSA 1MI7R 2QMMA 4YPYA 1TRRA 1V6ZA 4FAKA 4CNDA 3NK7A 1K3RA 4FMWA 4YPWA 2HA8A 3OIIA 3BBDA 4RG1A 1NS5A 4H3ZA 2EGWA
chains in the Genus database with same CATH topology
4YVHA 4CNEA 1X7PA 4MCCA 3BBEA 4YQ8A 4YQGA 1NXZA 1UAMA 4YQCA 4YQBA 4YVJA 1P9PA 3IEFA 2I6DA 2O3AA 2YY8A 5GM8A 1MXIA 3AI9X 4YQRA 4YQTA 4YQ4A 3E5YA 1GZ0A 1V2XA 4YVIA 4X3LA 1ZJRA 3BBHA 4YQQA 4IG6A 4YPXA 1X7OA 4YVGA 4YQ5A 1J85A 3L8UA 1VHYA 4L69A 4YPZA 3KY7A 4YQPA 4YQNA 1IPAA 4JWHA 5D9FA 3OIJA 2QWVA 3O7BA 3N4JA 3KNUA 3NK6A 3ILKA 3AXZA 4YQ2A 3ONPA 5CO4A 1UAKA 3GYQA 4XBOA 4JWGA 4YQ6A 4E8BA 3DCMX 4JWFA 4YQ7A 1VH0A 3OINA 3KTYA 4YQOA 5GMCA 4YQIA 4YQKA 4JALA 4YQ1A 3N4KA 4YQDA 4KGNA 4YQ9A 4YQAA 2V3KA 2Z0YA 1VHKA 3KW2A 2CX8A 3QUVA 1O6DA 4YQ3A 4YQLA 4CNFA 4JAKA 4YQJA 4YQ0A 5FAIA 4CNGA 1TO0A 4X3MA 1UAJA 4MCDA 4MCBA 3IC6A 4PZKA 1OY5A 3AIAA 4JWJA 1Z85A 4YVKA 4KDZA 2EGVA 4H3YA 5GMBA 4J3CA 1UALA 2V3JA 4YQSA 2QMMA 4YPYA 1V6ZA 4FAKA 4CNDA 3NK7A 1K3RA 4FMWA 4YPWA 2HA8A 3OIIA 3BBDA 4RG1A 1NS5A 4H3ZA 2EGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YVH A;  4CNE A;  1X7P A;  4MCC A;  3BBE A;  4YQ8 A;  4YQG A;  1NXZ A;  1UAM A;  4YQC A;  4YQB A;  4YVJ A;  1P9P A;  3IEF A;  2I6D A;  2O3A A;  2YY8 A;  5GM8 A;  1MXI A;  3AI9 X;  4YQR A;  4YQT A;  4YQ4 A;  3E5Y A;  1GZ0 A;  1V2X A;  4YVI A;  4X3L A;  1ZJR A;  3BBH A;  4YQQ A;  4IG6 A;  4YPX A;  1X7O A;  4YVG A;  4YQ5 A;  1J85 A;  3L8U A;  1VHY A;  4L69 A;  4YPZ A;  3KY7 A;  4YQP A;  4YQN A;  1IPA A;  5D9F A;  3OIJ A;  2QWV A;  3O7B A;  3N4J A;  3KNU A;  3NK6 A;  3ILK A;  3AXZ A;  4YQ2 A;  3ONP A;  5CO4 A;  1UAK A;  3GYQ A;  4XBO A;  4E8B A;  4YQ6 A;  3DCM X;  4YQ7 A;  1VH0 A;  3OIN A;  3KTY A;  4YQO A;  5GMC A;  4YQI A;  4YQK A;  4JAL A;  4YQ1 A;  3N4K A;  4YQD A;  4KGN A;  4YQ9 A;  4YQA A;  2V3K A;  2Z0Y A;  1VHK A;  3KW2 A;  2CX8 A;  3QUV A;  1O6D A;  4YQ3 A;  4YQL A;  4CNF A;  4JAK A;  4YQJ A;  4YQ0 A;  5FAI A;  4CNG A;  1TO0 A;  4X3M A;  1UAJ A;  4MCD A;  4MCB A;  3IC6 A;  4PZK A;  1OY5 A;  3AIA A;  1Z85 A;  4YVK A;  4KDZ A;  2EGV A;  4H3Y A;  5GMB A;  4J3C A;  1UAL A;  2V3J A;  4YQS A;  2QMM A;  4YPY A;  1V6Z A;  4FAK A;  4CND A;  3NK7 A;  1K3R A;  4YPW A;  2HA8 A;  3OII A;  3BBD A;  4RG1 A;  1NS5 A;  4H3Z A;  2EGW A; 
#chains in the Genus database with same CATH topology
 4YVH A;  4CNE A;  2XDI A;  1X7P A;  1CO0 A;  3KOR A;  4MCC A;  3BBE A;  4YQ8 A;  4YQG A;  1NXZ A;  1UAM A;  1RCS A;  4YQC A;  2OZ9 R;  4YQB A;  4YVJ A;  1P9P A;  3IEF A;  2I6D A;  2O3A A;  2YY8 A;  5GM8 A;  1MXI A;  3AI9 X;  4YQR A;  1WRS R;  4YQT A;  4YQ4 A;  1ZT9 A;  3E5Y A;  1GZ0 A;  1V2X A;  4YVI A;  4X3L A;  1ZJR A;  3BBH A;  4YQQ A;  4IG6 A;  4YPX A;  1X7O A;  4YVG A;  4YQ5 A;  1J85 A;  3L8U A;  3WRP A;  1VHY A;  4L69 A;  4YPZ A;  3KY7 A;  4YQP A;  4YQN A;  1IPA A;  4JWH A;  5D9F A;  3OIJ A;  2QWV A;  3O7B A;  3N4J A;  3KNU A;  3NK6 A;  3ILK A;  3AXZ A;  4YQ2 A;  3ONP A;  5CO4 A;  1UAK A;  3GYQ A;  4XBO A;  4JWG A;  4YQ6 A;  4E8B A;  3DCM X;  4JWF A;  4YQ7 A;  1VH0 A;  3OIN A;  3KTY A;  4YQO A;  5GMC A;  3G1C A;  4YQI A;  4YQK A;  1WRP R;  3FRW A;  1TRO A;  4JAL A;  4YQ1 A;  3N4K A;  4YQD A;  4KGN A;  1WRT R;  4YQ9 A;  4YQA A;  2V3K A;  2Z0Y A;  1VHK A;  3KW2 A;  2CX8 A;  1JHG A;  3QUV A;  1O6D A;  4YQ3 A;  4YQL A;  4CNF A;  4JAK A;  3SSW N;  4YQJ A;  4YQ0 A;  5FAI A;  4CNG A;  1TO0 A;  4X3M A;  1UAJ A;  4MCD A;  4MCB A;  3IC6 A;  4PZK A;  1OY5 A;  3AIA A;  4JWJ A;  4YVK A;  1Z85 A;  4KDZ A;  2EGV A;  4H3Y A;  5GMB A;  3SSX N;  4J3C A;  1UAL A;  2V3J A;  4YQS A;  1MI7 R;  2QMM A;  4YPY A;  1TRR A;  1V6Z A;  4FAK A;  4CND A;  3NK7 A;  1K3R A;  4FMW A;  4YPW A;  2HA8 A;  3OII A;  3BBD A;  4RG1 A;  1NS5 A;  4H3Z A;  2EGW A; 
#chains in the Genus database with same CATH homology
 4YVH A;  4CNE A;  1X7P A;  4MCC A;  3BBE A;  4YQ8 A;  4YQG A;  1NXZ A;  1UAM A;  4YQC A;  4YQB A;  4YVJ A;  1P9P A;  3IEF A;  2I6D A;  2O3A A;  2YY8 A;  5GM8 A;  1MXI A;  3AI9 X;  4YQR A;  4YQT A;  4YQ4 A;  3E5Y A;  1GZ0 A;  1V2X A;  4YVI A;  4X3L A;  1ZJR A;  3BBH A;  4YQQ A;  4IG6 A;  4YPX A;  1X7O A;  4YVG A;  4YQ5 A;  1J85 A;  3L8U A;  1VHY A;  4L69 A;  4YPZ A;  3KY7 A;  4YQP A;  4YQN A;  1IPA A;  4JWH A;  5D9F A;  3OIJ A;  2QWV A;  3O7B A;  3N4J A;  3KNU A;  3NK6 A;  3ILK A;  3AXZ A;  4YQ2 A;  3ONP A;  5CO4 A;  1UAK A;  3GYQ A;  4XBO A;  4JWG A;  4YQ6 A;  4E8B A;  3DCM X;  4JWF A;  4YQ7 A;  1VH0 A;  3OIN A;  3KTY A;  4YQO A;  5GMC A;  4YQI A;  4YQK A;  4JAL A;  4YQ1 A;  3N4K A;  4YQD A;  4KGN A;  4YQ9 A;  4YQA A;  2V3K A;  2Z0Y A;  1VHK A;  3KW2 A;  2CX8 A;  3QUV A;  1O6D A;  4YQ3 A;  4YQL A;  4CNF A;  4JAK A;  4YQJ A;  4YQ0 A;  5FAI A;  4CNG A;  1TO0 A;  4X3M A;  1UAJ A;  4MCD A;  4MCB A;  3IC6 A;  4PZK A;  1OY5 A;  3AIA A;  4JWJ A;  1Z85 A;  4YVK A;  4KDZ A;  2EGV A;  4H3Y A;  5GMB A;  4J3C A;  1UAL A;  2V3J A;  4YQS A;  2QMM A;  4YPY A;  1V6Z A;  4FAK A;  4CND A;  3NK7 A;  1K3R A;  4FMW A;  4YPW A;  2HA8 A;  3OII A;  3BBD A;  4RG1 A;  1NS5 A;  4H3Z A;  2EGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...