3QUYD

Structure of the mouse cd1d-bnnh-gsl-1'-inkt tcr complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 66
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quyD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quyD02
1DUYA 1DVFB 2J7LA 2UYLA 5JQ6L 3PWPA 4NC2B 3RWDB 3BIAX 3U4EB 4JG1H 5FV1L 2AJ3A 5CJBA 4PJDA 3P0YH 1CXKA 3FQTB 2NY6B 5J1TC 2FGWH 2XWBB 4NJ9H 4JFED 3H3KA 3UAJC 4KHTL 4TUJA 3QPXH 4LASL 4J4PA 3D39A 1BF2A 4UIMB 2J8OA 1A4JA 1YNKL 4MDIA 5TDPB 5EU3A 1IBGH 1GOHA 2OQJA 4WW1A 1T20B 3CH8A 1BFOA 3QO1A 3G08B 5CEXB 4ELME 4OLYL 2YWZA 3OKMA 1KIRA 1NC4B 4G6KL 5IFHH 3O2DL 5E1AA 4OCLC 3ZYIA 2EICA 1TPXB 1H5BC 3QYCA 2ED9A 4PJAB 5ICZB 2NY4C 3BP6A 2O5XL 5DD3H 4HGKC 3U7AA 1QLRB 1P7QA 2R1XB 2IFFH 4F58H 4HKJA 4M6NL 1FRGH 3AREC 5I8KL 5C9JA 3BQUB 2C1PA 3NTCL 2EDYA 4ODBD 5HHMD 3QWRA 2B1HH 5I8EA 1DANU 3STLB 4G8GA 4WWID 3Q6GL 1DBJH 2Y6SC 3QDJA 4XPHL 4Q0XL 5D7IF 2MCG1 3QQNA 3DUHA 4U1HA 3BMWA 1T21B 2VRAA 4W6YB 3LKRB 5C92A 1CLZH 4NO0A 5FEBA 2HFEB 4LLVA 2ZG3A 5D7SH 3RWGA 2HMIC 2C5DC 4WHDA 4JLRA 2P5WE 3QCUL 4XC3H 1G1YA 2AXFA 5J56B 5H8DA 2JLLA 3WL9A 3HZMA 3RZWA 4EXKA 1MFNA 5DA4A 3ZKSD 2FX9L 3NFPA 2IBBA 4N0FA 4CW1A 1L6XA 4NO5A 3Q6FB 4O2EB 1FAKT 3HG1A 1CE6A 1WT5C 3NCCB 3V8OA 5D7JB 3AY4A 1YEIH 4YX2L 4I13B 4QRRE 4H88L 4Z0XA 1KLGB 43CAB 1TCRB 2XQYK 1V3MA 5GQBA 2APFA 2EEDA 3ZYZA 4BSVA 5FUOH 1EV2E 4HWNA 4LDLB 3VI4F 1DUZB 1GJIA 1H9VA 5I8CB 3QFJA 3C60B 3MYJB 1LO0H 5E8DL 4I9WD 3QUML 3T0WA 4TSCH 5B38G 4ODXA 1WSST 1YEHH 2UY7A 2CLZB 1OPGL 5KSAA 3VXTB 1ITBB 1H15A 5TFSH 5CP3H 2W92A 4P46B 4L8CA 5IJVA 5GRXG 2GY7B 3M8OL 3EHBC 1QYGL 4HIXH 5GGVY 3GI8H 4ZS6C 3K8KA 4YDLC 2ZWLT 3RTQC 4BQCA 1E4XI 3ULUH 2YD6A 3U9UA 4X9BA 3C09C 3UBXA 2VXUH 5T1KB 3QWOA 3EYVA 3UC0L 5DWUL 2BC4B 1ZT7B 3HE6A 4M48L 5D7KD 5E08H 2ZKHH 1NEZG 1LO4L 4PBXA 2QBWA 3QCVL 3WIIH 5T1LD 3KPMB 4BFGA 3F7YB 3X17A 4MNHA 5FHAH 3CCHB 4HV8A 5CLTA 4P59L 1KTDA 4ELKB 1FP5A 1PX4A 3FCTA 4LU5H 4OF8A 4MZ2A 5LWYL 1E4XH 1BQUA 5D70H 2EO9A 4KKCC 3CPLA 1JGEA 3WUZA 4P9ML 2OL3A 5EO1B 2GT9B 5J1AB 1P4BL 5KSUB 3GMRA 3MLTB 4P4KA 3TNNB 2ZCKL 4D0CA 5DJ8B 2RR3A 3MLSH 3MBXL 4KK6C 5DMGD 3OX8B 1WZKA 1RJZB 1PJ9A 1T83C 5C7XH 5GZOC 3SO5A 3DIFB 1LO2H 4WUKL 4PY7B 1CFNB 2EDNA 1T0NB 5B3JF 1DBAL 1DLHB 2BERA 2PW1A 2HWZL 4OQTA 5D6DA 3JUZA 4MZ3A 5IWLC 2BHZA 3QDMA 5C0CE 3L3OA 3M17B 5BRZA 1IMHC 1UWGL 1U8HA 3DGGB 1ZLSH 3LQMA 3MLWH 2H41A 4NGHL 1MRFL 1QQDA 3NZHL 1YMMB 3FKUS 1HK6A 1VACB 1N2RB 3EJYD 3QQ3B 1PZ5B 2BVOA 1ZVHA 4U6XA 1KCLA 4GS7B 4WTXA 3K8LA 4U7SA 5I71B 4NZUL 2H9GB 4Y4HA 2CDFB 1AFVL 5F9OH 4MNQD 3TM6A 2BNRE 2E8ZA 4EOWL 4H8WC 4ISVB 1ZGLP 2BJML 1ZLUH 4PJGB 5C0GB 1DR9A 1V3JA 2R2EA 4X5XB 1GGBL 4U3HA 1CZ8L 3L5XL 1UADC 3EYSL 4BELD 3OKLA 4B7IA 1KXVC 2A38A 2UZXB 3KYAA 4MQSB 5IB5A 1L0YA 3IJSB 4JRXB 5B38B 1Z0MA 1U8JB 5FYJD 4NPYA 1M05B 5D1XA 4PRHD 4MCYB 1G0DA 2NPLX 4UT6L 1FYTD 5EPMA 1A6ZA 3RDTA 3JTTA 3TNMB 1OAKH 5HYFA 3RWCB 5T5FL 5CFHA 4N0UE 1G9NL 4E9LA 2WBKA 4KKBD 3JWOH 4MWFA 1J1OH 2H3NB 4NOBA 4GAYB 1NH6A 4HUMB 3AMLA 4S0SD 2VWEC 4Z7QE 1WAAF 4MVBC 5IB3A 2QHLA 4D9RD 1MCQA 1ERNA 1ADQA 2Q3ZA 3V52H 3UO1H 3D3VD 1NBZB 1EAPB 2OLDA 3QCTH 3HC4L 5GPRA 2FB4H 1DL7L 3FT4B 1MHEA 2IPUK 3THMH 4YHKH 2BSRB 1RUAH 5ITBL 3NZ8B 2P49B 2AV7A 2BSSA 3BW9A 4NRZB 1NDGB 4XAWL 5IMMB 3SJVE 1NEZB 5CCKL 3DROA 4NQDD 3KPLA 1S7VA 3WE6B 5F7FA 1C5CH 1OAQL 5DLMH 2FWOA 1LP9B 5E5MA 1A6VL 5HGDB 3VRIB 1NMCC 2EE9A 4U6HB 1A9BA 5TF1L 5FKPA 2IH1B 2ZCHL 4Z7OE 2AV1B 3C5SA 4ZXBC 4XBEL 5MEOA 2DIBA 3Q2CA 4WDIB 1JK8A 4QRTA 2X5PA 3DSFL 1UGNA 4Y4KB 4HCRL 4QHUB 4RFEA 2XPGB 2BOCB 5EU5B 4FQQA 5EOTB 2CO7B 4UINL 2DLFL 5DQJB 1CXLA 4I0PA 5IP4A 1I3RB 1QA9A 1JPFB 4U7KA 3S88H 1S9WB 3I3DA 1QO3A 3VG9B 2R9HC 4BA8A 3NIGF 2X09A 4YPGB 4ZYKB 4NWTL 1CFTA 2VE6A 2HJKA 4HFUH 1AP2A 5E6IB 5C0ND 3HNSL 3IDYB 5DJDB 3BWAA 3TIEB 1PGRB 1U0QA 3T4YA 1VERA 4I2XB 4K3JH 4Z7WE 5ERWB 4HWZB 3UTTD 2NR6C 1EVUA 1MWAL 3ARFB 4JY4A 3EYFB 4CKVX 1JCKA 4R97C 4JHAH 3PQYE 4DEPB 4BFIB 2VQ1A 4LPCA 4PJ7F 3TH4T 5CHNB 5DJAB 5I30H 1T1XB 1NC2B 1ZVSB 4OI7A 2FATH 5HPMB 5HGAB 5EO9B 3KYOA 3ULSA 1I7ZB 3QRGL 4GKOA 3BVNB 4JM2A 1HWGB 4DFHA 1WVZA 4U6YA 2AI0H 3D25B 5DQ9A 3U46B 1HH9B 4ONOA 4IBLT 2MNUA 1JNLL 4RGMC 1Z5LB 3M07A 3MNWB 5JR1H 2EDTA 1DQQB 4GBXD 4OZ4A 4KJQC 3SCMD 4HFWB 2NY7L 5DJXA 4LQ1A 4XHQA 3DTXA 5BW7C 2XWJA 4QOKB 1U2HA 1KCVL 4WO4D 2RHEA 5SWZD 1YEGH 2ICWB 3QG6B 1WT5A 3HE7B 2VLKD 5I76B 4M8VA 4PJDF 4OGYL 3OAZH 1QSZA 5TE7L 5C70A 4LKCA 4GFTB 5I1JL 5FM8A 2BVUA 4WIQA 3L7FA 1AQKL 3FO1A 3ARDD 4V1DD 3I6GB 2ZUQC 1QFWH 3OKEB 4JQXA 4LKXA 5DDHA 1OP9A 1GHFL 2WZPD 1T1YA 4PJEE 3P9LA 4Q2ZB 3FQNA 5AYQA 5GGVL 5CJQH 3IXTB 4K7FB 1EFXB 4FQIH 3MLYH 4X6FA 5IW6B 5HSFA 2NXYB 4TVSa 2ADFL 5C07E 5B39G 1HYSC 4AL8L 5BCAA 4W6WB 3KDMA 5JZ7C 1FFOB 5ECJE 1ZS8B 5DRZA 3EYUH 4ZOAA 4U0RC 5CKAA 4KMTH 4NHCH 4HWEH 3PDOA 4OFYD 3U2SA 1XGTB 1G7IA 5E8OA 3O6KL 3CUPA 1U58A 1CXHA 4QHLB 4LRIC 3MROB 3BKMH 2FHCA 4KK8C 4L9LA 5IFAH 1UFUA 1I4FA 1HNGA 4LLMB 1IKFL 1SVCP 1JTPA 3BKCH 4Z95H 5F3BB 1BAFH 4UQ3A 2HVJB 3HZYB 1LD9A 4HK0A 2Y36L 5EN2A 3OR7A 4M00A 3HCVB 2OXHA 4BKLB 2D2OA 2CUHA 5J3HC 1ZA6B 5FYLD 3C6SA 4ZFZB 3V6ZA 4WU7B 1S9XA 4F9LC 2F54D 2R1WB 5JUEL 2BY0A 3E2HC 1UYWL 5BMFL 4GLRH 1S5HA 2PF6A 2PXYD 1QSFE 2Q7YA 1IGCH 1FZJB 4S1SL 2EEAA 5F7YC 3TV3L 2Y72A 4HWBA 3GRWA 1XF4A 2YPKB 5F9WB 1SYSB 4NUGL 1DVFC 2P7TB 4CVXA 3P4MB 5TGBA 3S4SB 1ZTXH 1IC5L 4OCSH 4RCAA 5IWLA 3CC5B 1BQHA 1ZKAA 3TBSA 3C9NB 3T0ED 3QIBB 4GG6B 5HHQB 1N7MH 4I3SL 4PP2B 3VG0L 3ZL4L 3SDDD 4N0YL 1WISA 4QYOA 2NZ9C 4U33A 4YBQD 4NC0B 4RAUB 4QHKI 2B39A 2PKDA 4FG6D 4N9GB 1VCAA 3M1BA 3VWKC 3UZQA 1HDMA 3BZEB 4ORZC 1JZ8A 1ZEAH 5EOQH 4QRSA 3T0XA 5FECB 3DVFA 4K8RC 4FNLH 4X7CC 4JFYA 5IB4B 3KWWB 1KPVB 3MSPA 4M6AA 4PD4K 4XP1L 1F4YH 4LVHC 1TPXC 3PDDA 1CIDA 4Z18A 3UYPA 3BEWA 1DQTA 2GJ6D 4MJ4A 4NKOA 2ZOKA 5F9AC 4UNVA 1NCNA 1QSEA 5K93A 1NCAH 4XCCL 4NQCB 4G8FB 1A3LL 1S9YA 4OM1L 1X7QB 3GO1H 3PWNB 5GS0L 4DZBA 5LBSH 5B39B 3MLPA 1X5XA 2PNDA 4OV5A 1RHFA 5C09E 2Z31D 3G5YB 4F2MA 3O6FB 1E6OH 5J8OA 4WJ5B 1FC2D 3GMOA 1UM4H 4N5UA 3MZGB 5EU6B 3T4AA 1FAIL 1CR9L 5C08B 3OKOB 3PWPD 4KUCF 3DETD 1BD2B 2VDLH 1NGYB 4EIZC 3Q5TA 2K9UA 1HXYB 1HHKB 2I60L 5JHDE 4D0DA 2VDOL 1RZKC 1FBIH 3LEYL 4J4PD 3D39D 5C0DA 4G8EB 5J9PA 2IQAA 3BKYL 3K2UH 4ZUSA 4G7VL 1MEXL 3VDAA 2ZNXA 3QR2A 3RAJL 1GYAA 1A4KB 2EKSB 2NY5L 3F58H 2HTLD 5F93C 2Z9TA 1DSFL 3FL7A 4XHJC 1QD0A 5FGSA 1TZHB 5DJZA 1IEBA 2GSGA 3HC3L 4UILH 3O3UN 3KHQA 3MRFB 1AD0B 4BZ2L 1VGKB 5CLWA 3S9DB 3MV7E 1QFWM 1K4DA 4R4FL 3O41B 5DEFB 1P7QD 5JORB 2F53B 2D0HA 3HRZA 4LSPL 3X11A 2BSTA 5FOBB 1IGIH 3O6MH 1MUJA 1MPAL 3M45A 1E4KC 3HPLA 2APWA 4FABL 3AS2A 1UEYA 3QWRD 4R0LA 3VFRA 4HJJL 1G6RA 3MRJA 1YEKH 4LAQH 4P46C 3BHBB 1NCDL 3GJEA 4JDVB 2J8UA 3B9EA 1Y6NR 4PLJC 1Y0LB 4UDUB 4X6EA 1GZQA 4JANB 5C0BE 4NO0D 5IMOA 2X41A 35C8L 4XVUC 3BRFA 4M1CC 3PV6B 3FQWB 1A6AA 4YWGL 2VXVH 2IBGA 1ONQA 3QHZL 3QG7L 4J3WA 4OZIB 3E6HA 2UZIL 4OD1L 4QHNA 5ADPH 2UWEB 5J6GA 3VXMD 1RJCA 3HG1D 1IGYA 3DX7A 3CFBB 4WI6A 5HVGB 3VGAB 5D2LB 3X3GH 4NZRH 4Y2DC 2VNCA 1NJ9A 1JMXA 1FV1A 1XGUB 4D9LH 2WQRA 1HXMB 3E3QE 3VJ6B 5DZOA 1JZ3A 5L2JA 2MHAA 1HZHH 2JJSC 3QA3B 1E27B 5BW7A 3LS4L 3QFJD 4NO3B 5C8JA 5EBMA 1LDPL 1AY1L 2CR3A 3O8XD 4P2CG 5L7XH 3TBVB 4G42A 4M3KB 1JGVL 4TN9A 5BJTA 4J3VA 1LK3H 5KSAD 3TCLB 3N9GL 1DDHB 1CFQB 1ZLWH 1A2YA 4F9PC 4Z7UB 5J6HB 1CQKA 3E6FA 5JXAH 3LN4B 3MBED 1QVOA 2KZWA 2Z92A 3WS3B 4F8QA 1LNUB 2NNAB 3I2CL 3ARGA 4HJ0C 4LSTL 3D69B 5AAWA 1F4WH 4MDJB 1Z9SA 1U92B 1JWMB 2VJXA 2HT2C 4KZDL 1HKLL 1PSKL 1KIPB 4YHOH 2GTZB 5CD5C 1QBLH 5BV7H 1I7RB 3G6JE 3MLUH 2X4UB 4XPGL 5I71C 4FFVD 3HE6D 2CLVB 2LE9A 5EA0L 3MLZH 5IB1A 2V9QA 5HYSA 2PR4H 3SO3B 4BZ1L 5EBGA 3MUGA 1INEH 3P0YL 4P57A 3G6DL 4UB0H 2FGWL 4M93C 3LH2H 1WTLA 2ZUUA 1I9IH 5GGQH 4JFDB 1KIQB 3L3JA 3PJSB 1RIHH 1UCBH 1QG3A 4KUCD 2W60B 2IG2H 5ACLA 4S1DC 5F3HB 2H1PH 3EOBA 1WWCA 4P2QA 1IL1A 1QBBA 2VISB 2FO4B 1BFTA 4XRCB 4XPFH 5IHUH 3SDXA 4PLKD 3TH2T 5J11C 4P4KD 3IDIB 1PAMA 2FJHB 4ZDHA 4XXCA 5IFHL 1YYLL 4HULB 4JM2F 4Q9RH 2WINA 3D0LA 5JPNB 1BVLB 1NSNL 4JPWL 3GIVA 4DTGL 1QNZL 4ZO9A 3S3SA 1S7TA 5CSZB 3CFKA 1JL8A 1NGXA 4KFZC 1OGAE 3TN0C 1N0XH 1EJOH 2R39A 4NBYB 1N4XL 4F9LA 2AK4A 3QDMD 4JFFE 3BH8A 4M7LT 1CVRA 3CSYA 5HYJE 2B7DT 4NKMB 3ARUA 4PGEB 4GXVH 4M62H 3EO1A 2D03H 3V5HB 4OIAA 4JCLA 2B1HL 2FZ3A 4J3UA 4YLQT 4Y4HD 3T2NH 1B3JA 5D72H 5I1AB 4PJ5E 1NCCL 5INCB 1AGDB 4R7DA 4XVTH 5DJYA 2YBRA 2CD0A 1BFSA 1QLEH 1J1XL 2EXWC 2VQUA 3KS0H 2KH2B 1ORQA 2BZDA 4H5SA 1FJ1B 5DZLA 2OTWA 1ZLUK 5FKAA 2LV4A 3DARA 3AVEA 5IVOA 3VWKA 5SX5H 1U95A 5SWSB 4YXKH 1PZUB 3RIAF 3P30H 2D31A 1MI5E 2BK8A 5D1XD 3HAEA 5I2IA 2QADB 3Q0HA 3RDTD 1YEIL 3GSWB 4MA1B 1G9MC 1MNUL 1S9KC 1AQDB 3OHXB 1HWHB 4OZGB 2ZOLB 4WTZG 1BVKA 5FUOL 1CXFA 3F12B 5JMRA 3MV9B 3MX0A 3KXFB 1N5AA 4M61B 4JDTL 5K9JL 5DVNA 1NUFA 2JF1A 5E6IC 2KKQA 4E42A 1PQZA 4ZPVA 3IDYC 4P9HC 2F5BH 3RU8H 4LIQE 1IGJA 1YEHL 3QUXA 3VXRE 2BNUB 1U91B 2DWDB 3T3PE 1F3RB 1JMZA 2FIKB 2R4SH 3PWUB 4I18B 4AIXA 3RZCC 4OKDA 3UTSE 1KPRA 1EVTC 2FO1A 1ZHKB 3QNZA 4JCMA 1QFPA 1H8NA 4JAMB 1YY8A 3EJZC 4M7ZB 1MH5A 3UAJD 4X99A 4WTWA 5FUCC 3O2VH 3NBNA 2IADA 3BGMB 5ESAB 5DHVH 2CUIA 2VXUL 1BM3L 3QIWC 4UQ2B 2BNQB 4RA3A 3V0WH 3A6BL 1ZSDB 4OFPA 5F1NA 5E2TH 1KJVB 5TQ2L 4GAFB 1NCWH 2E5EA 1S8DB 5I6XB 4HS3B 5ILTH 5FYJU 2GFBA 5FHAL 5HDOA 4M4PA 4Y0GA 4KWUA 2JCCE 2GUOA 2R2HB 3CXHK 1SEBB 4P2RE 1LO5A 2JIXA 3Q1SH 1WIUA 4WGWB 4WFEE 1F2QA 43C9A 2NY4D 3HKFA 1FZOB 3UX9B 3OAUH 1PLGL 1RMFH 3TYFB 3JV5A 4DK3A 4A6YA 2JKXA 1D6EA 1WFOA 2H6PA 4MSWA 3ARED 3ZDYF 2WIIB 4PJHB 5J89A 1CDUA 4KTEL 4GRWE 5DEGA 4UT9H 2NXYC 3RWHA 1D5ZA 4PG2C 1FVCB 2Y6SD 4CNIB 2MPAH 1ODAA 1LO2L 3B5GA 1OAYH 1H3UA 2G2RA 2VZ3A 2A6DA 5KVGL 5KW9L 4NZJA 1OL0A 4FXLA 1S7WA 2OTUB 3CDYA 3IJHB 4L3EA 5FYJH 1XIWA 4WUUA 1IM9D 3MLWL 1Z2KA 3PE9A 1KELL 5HHOE 3U36A 4LIQL 1TQCC 3HPJB 2HMID 2X2YA 4XNZC 4EN3B 1XR9A 2X4TA 1FNEA 1ZV5A 4ZOEA 3RVUC 1RU9H 3BOVA 1G0XA 2FHFA 3SGEH 4LLDA 2Z93B 4WWKA 1TTUA 1I8MB 3WJLC 4Y2DA 3KPSA 1EEZB 4JQVC 2NX5D 2O5YH 2G5BB 1BQLL 3EFFA 3GSQA 5JIIA 5AEAA 2C26A 2A9ML 4QY8A 5CAYB 3OAZK 5ALCH 2JJSA 5A3IC 3U4BL 4TNVF 3T77B 5F7WC 1YNTB 4NQED 3HLAB 4OJFH 2XTJB 2HVKA 3O0RL 3UTOA 4CMMA 4I48B 1UENA 2I25N 4MX7A 4XZUB 1J1PH 4ZUUA 3QSKB 5IQ7H 1OAKL 2WWMC 3H9SB 3QEUA 4F9PA 3RPKA 3ULVC 3KJ6H 1D5IL 4NCC2 3FONA 1MF2H 1MFBL 5E8NB 2WMPA 3EHBD 1EHAA 1INQB 5E6YA 4NM8L 4RDQF 1B2WH 4ZS6D 1J9CT 1U9KA 3RTQD 3QIBC 3V52L 3UO1L 4FRWA 1KJ2H 1EEYA 3VXUA 4RMTA 3RVTC 3MUJA 4YHKL 3KGRA 1EDQA 3QUYA 5T1MA 1RUAL 1UJTA 4TSAH 1I8KB 3UPCA 5D2NE 5FDWB 2VXQH 1BIIA 1V7MH 1QRKA 3EOTH 3MJ7B 2GAZA 3RGVC 5DLML 1T1WA 4JKWA 4YHIA 2AJVL 4PY8I 3BH9B 1AO7D 1D3CA 4CADA 2J8UF 2VB5A 3VMPA 4U1SB 4G6JL 3D2UB 3NPZB 1A0QL 2E6PA 2AK1L 2Q8BH 3F5WA 4MHHI 1KACB 3I9GL 4YIQA 1FIGH 4KKCD 5H94A 1T04B 4JM4H 3KR3H 4XWGL 4R96A 2YKLL 2ZSVA 3G04A 2A0LC 1U3YA 3ZT6A 1FZMA 4D94A 4YAQA 2B2XL 4KK6D 4LLWA 1KCSL 1OARH 2YPLA 5GZOD 4G9FE 2P8PA 4JRYD 3VD3A 4XXDA 2OMNA 5AUMB 2ATKA 2DD8H 3L5WB 3TN0A 1QR4A 1A1OA 4NT6A 3QT2A 2YWYA 4QXUH 2W91A 2D0FA 1VFAB 5HVHC 3RL1A 4ODUA 4DGVH 4K3JL 4HQQL 1CK0L 2OJEB 3Q3GA 4GAGL 4NFDA 4RQQA 4MJIE 3VDBA 3BT2H 3QXDB 1IFHH 5I1LA 3P73A 4Z7VA 4AH2A 1KYOK 3LKQA 3R0NA 3DXAB 4YK4B 5TDOA 5L8LB 2IANE 4ZFOA 3DBXA 3KYMB 4PYGA 2AI0L 5IMLA 3O3EB 2ARJB 3IGAB 3HA0A 2CJUH 1U8IB 2QR0A 4P4RA 4XVSH 1X5HA 2A74A 3IVKB 1BZ7A 5GGSA 3N85H 1FL3B 5DR5H 4JHWH 5A2FA 2Y5TB 2WBJC 4I3RH 2LU4A 5JDSA 1T7XA 5BQ7A 1J0JA 3O9WC 1MJ8L 2B4CC 4HGWA 4PG9A 4PTUB 3BP5B 3ZT5A 4UOW0 5EWIL 4LCWA 1W72L 4JRWA 3RUGB 5EZLB 4NWUH 5HYEA 1LWRA 5LCVH 2GSIB 4MVBD 3NGBB 3JSSA 3MJ8B 3N1GC 4QF1A 4U1MB 2IALA 1G7JB 5A1AA 5KS9B 1QFWL 3SDXF 4ERSL 5DUBA 2W1NA 3U0TA 5MERB 3JXAA 2X1QA 1G7QA 3LN5A 3VE0A 5F7DB 6FABH 5DRWA 3MLYL 4QCIB 3RZCA 1CT8B 2HAZA 3MRDA 3O3BB 4R3SA 2YUVA 5FYLH 1YC7A 4U1JA 1HH6B 3EGSB 3CZFB 1RVFL 2FHBA 2PTTB 3KPRE 4KMTL 1JPTH 3G5XB 3CDCA 4ZXBD 3CDGA 4I0CC 2FBJH 1JRHL 3PWJB 4MB3A 1F97A 3QIWA 3G5VB 2AJUH 4WEUD 4YO0B 4KKNA 1OCWH 4J6RL 9CGTA 5IHZB 1G7HA 3WIFA 4L29B 4P23B 1KT2B 1FGNL 3V8CA 2P8LA 5EBWA 3VXOB 3EYOA 4F7PB 1IKNC 1BAFL 3TBTA 2R9HD 5DRNA 2EYTB 1FL6B 3EOAA 3GBNH 3F7PC 1BZQK 3E8UH 4Y1AB 5D7LE 3MV8E 1N59A 4PGCB 5FYKD 3VRLE 1YDPA 4PRIB 3GMNA 2AEWA 3SGDH 3GSVA 5IMKB 3K1DA 4Z9KB 3GI9L 4HKZA 4OTXH 2VAAB 5CZKA 3PGDA 5I1CH 2NR6D 4POYA 1GCFA 4I8DA 3IDJA 2DQCH 2VQTA 4JPIB 1ROWA 3ALWA 3QO0A 2ESVB 2RBLA 4A2MA 5F8RC 4OCSL 4QNPE 1V3LA 5HVFB 3SO3C 3O4LB 1T3FA 4OD2B 1J8HB 1RZJH 1MHCB 4WHTB 4DKAA 4P5TA 3MLVH 1N7ML 1FO0A 2XG5A 4HIJB 2C4FT 1RJYA 4XP4H 4PRNB 4LGSB 4KJQD 3X13B 2F8VA 4AK1A 4QXTA 4U3XA 4KZEH 5IIEB 1D5XA 5FA3A 5DJ2A 5EOQL 4X98B 2VMFA 2IH3A 2X42A 4UZGA 3NN8B 5JOFB 4JQVA 3CH1A 2FIRT 1AR1C 4Y88A 5IG7B 5K9OA 4JDZA 2CIKB 4W6XB 2KUTA 2RQ8A 4PS4H 5IF0A 2B5IC 1DQJB 2E9JA 1ZLWK 5JPMB 2DMKA 1E6JL 1AJ7L 3GBMH 1D7FA 1LEIA 1K2DB 5LGJA 2P5EB 3FB8B 2DLEA 1MFCH 1A47A 4JZJA 3DSNA 4KK9C 5MENB 1UKTA 5LBSL 4TVPD 1HYSD 2V5RA 4H1LA 2VLJB 2VXTL 1UM4L 3D18B 4WV1B 5L2KA 1XF2A 1G7MA 5HDBF 5JZ7D 3D6GA 4F37K 3WV0A 3H7BA 5JOPE 5IBTL 5E9DD 2FECL 3O11B 4DKEH 3MR9B 3KAAA 4FXGA 1RIUH 3BSZL 5ANMB 5GGTA 1FBIL 2CLRB 2HG5B 2PYED 4GKNA 1F11A 4H25A 1RURL 4KK8D 5IB2A 3DO7A 4P2QD 4LHQB 3I84A 4JFEB 1BECA 4XWOC 5EU4B 3F58L 3RGVA 5IHBA 3VFVA 5D8JH 2MSPA 3QJFB 3MA7B 5DJCB 1OD9A 2QKIB 4XNQB 4RZCA 4U1NA 3WHXB 2AJSL 4UILL 5JO5A 1EA9C 4ZFGH 3MRKA 3CD4A 2BOBB 4EEEA 5J3HD 5GGUA 3WXWH 3LB6C 2AK4D 5E2JA 3N0PB 5BV7B 2NTFA 4MAUH 2WBWB 5IVZB 5E24E 4OZHA 3LKNA 5IESL 1IGIL 4M6OH 3GSRA 4ONFL 4JFZH 3R8QA 3MODL 1KOAA 1O7VA 2VLLB 5ADOL 4MJ5B 4FXKA 1DP0A 4MAYA 3UTZB 4OB5H 2DYPA 1DVFD 1PKQA 4I18C 1YEKL 4LAQL 2V2TB 3GUTB 2CKBL 3PL6B 1NBYB 3FRUB 2E9IA 3GK8H 3UBXI 3T2PA 3RHWK 4M7ZC 4LVNB 1L0XA 4PYHA 1GC1H 2NZ9D 2YEZB 1TVHA 1NBVL 1VHPA 2EDLA 5HHME 1G7PB 4N1EA 1DBKL 5ESQB 1MLCA 2VXVL 2V2XB 3VWKD 1S3KH 4YDVA 5ADPL 2DL2A 1A7RH 3LD8C 4DN3L 1AIFB 5T1DH 5SX5K 3TVMB 4L9DA 1HHGA 4W4OC 3S96A 4K8RD 3BDXA 5K33A 4NZRL 4QRPA 1N0LA 2A6IB 3SGKC 3OZ9L 1H3WM 4FOMA 3QEGH 4D9LL 3QFDB 4UT7L 5H35A 4OLUH 2FJFB 4J1UB 4E0RB 3MUHL 1UB5B 4Q7DA 1KULA 1R3JA 3W9DB 2R2BA 2WBJA 3ZZ1A 2OTPA 1GGCH 2GI7A 3RJQB 1T5WA 2XG4A 1KEML 3LRSA 5IEKA 1VADA 1HINH 3O9WA 1CD1B 1CGWA 5GHWH 3QULA 3IJYA 4G3YH 1UXSA 5I1DA 3P9MA 1LK3L 3MCKA 4ZO8A 4JFXA 1PEZA 4PB0L 3R1GH 3IFOA 4YFLF 3DVNA 3BRDA 3GRWL 3W11C 3P11L 4XP9L 3WDHA 1KIUA 3WO3B 1FNSH 2ICEA 1TZIB 4ZD3H 2M8XA 3HZVB 2CDGA 1S9VB 2VITA 5LGHH 5SV3A 2OL3H 5I66B 1UT9A 1YPZA 3U6RB 2MCPH 2PUQT 4JFHD 1F4WL 2X4RB 1AD9B 2EDXA 5HGGS 3D85A 2E7CA 1PX3A 5DA0B 3HC0A 5I9QB 1HSAA 3MNZA 4EN3C 3RX7A 4NRXB 4YBLC 4F57H 3MLUL 3H8NA 4ZSOE 1H3TA 2EDKA 4LARL 5C6WH 3KPQA 5L0QC 4R8WH 1YEEH 4MQXC 3OG6B 5TPWL 4QHKJ 3EFDH 4XHJD 5E2UH 5AZ2H 3D5OF 1ZGLA 2D7MA 1INEL 4UB0L 5K59F 4WI9A 3LH2L 2K7PA 3BESR 5C07B 1FG2A 1K3IA 2XNAA 1UCBL 1CDHA 5T1LB 1HHHB 2IG2L 3OKNB 4HKBB 4GW5B 3EYQC 4HS6A 5DMIH 4LCUB 3MRLA 2G60H 5IROC 3TCXA 5I19L 1GGUA 1YZZA 4NYLA 2XTJC 4Z7VF 4MA3A 4Z0BH 4MJ6B 3BO8A 3AAZB 4J3XA 4Q9RL 3WLWC 1KLUB 1EJ6A 4JVUA 3RPIB 4LSQH 4YBHA 2EIDA 1HCVA 2XFXA 3JWNC 4P46D 5AG8A 4YGVA 5CZVL 5IEHA 1LEKB 3MOAL 3GGWA 1EJOL 3DUSB 2VDNL 4PLJD 2V7HB 5I1HH 3MA9H 4FQJH 2D9CA 1IAKA 4WUUD 4AJ0A 2J4WH 3ES6B 3S7GA 4L8BA 4Y5YC 4XVUD 1EGJA 3OKDA 3LSOA 5CWSA 5FCUL 3FO2A 4UIKH 4M1CD 5CJXC 2D03L 3TIDB 1KN4L 2OZ4H 1GRWA 4AIZB 2EECA 4NN5B 3UJIL 3C2SA 1AGFB 3T2NL 5D72L 1D9KC 1GGTA 1UJ3B 4QHMA 4XVTL 2DQJL 5CD3A 4MNGA 4Y2DD 4WGVB 1JWSA 3KPSD 5IFJA 3L3IA 4OIBA 2BVPB 4NNYA 4YR6A 2CK0H 4FQ2H 3OXRB 2DQTH 5ETUA 4GSDH 4RBPH 4HF5H 4PGDB 5FGBA 1KB5A 3TZVC 4XBPA 5C71A 4MNQE 2JELL 4OKVA 1UH3A 2JB5H 1HILB 5D7IB 4HBCH 1SJVA 3C5JB 1N6VA 4H0GA 1U3HA 5TJWK 1G6RL 3MUY1 1KFAL 4MHHG 4D2NA 1CICA 4FQHA 1H3PH 4NFBA 4L8SC 2EYRA 2UUDH 1WZLA 1Q9KA 1FYTB 3VFSB 2N1KA 3CU7A 3CLFH 1QRNE 1QEWA 4HJ0D 4Q6IA 4JFQB 2X44D 5J12C 1NUDA 4PRHE 3WFHB 3CVHL 3WFCH 1RUPH 2HT2D 1AHWC 4TRPL 3GB7B 5ABDE 1YMMD 5CD5D 3VXUD 4X6BA 4XPAH 4ALAH 4Y4FA 3OKKB 3GSNA 2R4SL 4G80B 3D3VB 3N06B 4H0HB 2L7UA 3GJFK 5ISZA 2FL5B 4Q6YA 3B6SB 3KLDA 3GMQA 3NIDF 4JN1H 3T0VA 1NL0L 1J05A 2YHGA 1CGYA 4RNRA 3IDUA 1G9EA 1AC6A 1NAMH 3A6CH 4OZFA 1E4WL 2J5LB 1S7UA 2XICA 5DGQA 4RAVA 1SQ2N 3VA2C 2A6JB 3PGFH 2AJZA 1JN6B 3VH8A 4S1DD 2IMNA 1SJHB 5ACZB 5GRYA 2BVQB 3IDNB 4NQDE 5E2TL 1AE6L 4IS6A 1HHIB 3LMJH 3PHOA 1NCWL 3N50A 1IGTA 5BS0A 2GITA 4MD0B 1XF3A 4ODVH 5ILTL 5FGCB 2KL6A 4Z8FH 3P4OB 2WLZA 2YPLD 4PV8B 1B0RB 4HH9A 1DFBH 2X4QA 4EUPH 4LL9A 3TN0D 3PDGA 5FIEA 4O51B 1KJ2B 3VGHA 1FVDB 1FC1A 3OAUL 3NGBC 5GGRA 1EPFA 4KVCH 2ZCLH 4I4WA 3N1PC 5C6TH 2AJXH 4GG8A 3AM8A 2P46B 2FSEA 1M6OB 2ZNWA 4UTBH 4RWHA 5BVJB 2XTLA 5KJRH 1ZHBA 2HJLB 4O9HH 5CUSH 5DK0B 4P3CH 3VXSA 2MPAL 3UCRA 3DVGB 5EIIB 5DJ0B 1JNNH 2D9QB 3UTTB 1AXTH 2Z91B 5C0AA 4NKQB 1MCBA 2EXWD 5KVFH 5HHXH 4WW2A 4AQOA 1TJIH 5JHLH 1R24B 4ENEC 2OP4H 7FABH 4IEFB 4JO3L 1CDIA 3OF6D 5BXFB 3LKOB 3IAQA 5IJKC 1WV7T 1U36A 3PIQB 2HFGL 4W4OA 3OWEA 3DYOA 2Q86A 2BCKB 5DFVC 1CFSB 3T65B 3SCMB 1HQ4A 4IMKA 4WU5A 3LZFL 2O5YL 1LHZA 4N5EC 4WO4B 1FN4B 4YGAB 3NCBB 3U82B 3P2TA 4D8PB 3MFFA 1EHLL 4IOIB 5E6ID 5SWZE 4X5WB 5INDA 4L8DA 4PTTA 2VLKE 1RK1A 1R3LB 3KS0J 1SYVB 3U83A 2VZTA 5IQ7L 2A2QT 2DQFA 4V1DB 1RULH 1HOCA 5E94B 1A9EB 2CGRH 3KJ6L 3RZCD 1RUKH 3P77A 5IW1A 3PNWB 1NC2D 4OBRA 2YXMA 4RGOL 5DSCB 1B2WL 3EJZD 3TA3C 3ZDZF 4L4TA 1M7IB 4JPKL 4OZHF 3DRQA 1NANI 1MHHA 1BBJB 4F15B 4XPTL 1H8SA 3QIWD 4CMHC 3UZVB 1IM3B 1A22B 1BLNA 4F33A 3CK0L 3U7YL 3ORJA 4HWBH 3MGTB 4DW2L 3HZKA 4OLXH 3NPSC 1ES0B 2PCPB 1ZANH 1MVFA 1P7HL 2V5SA 1PY9A 2XA8H 3CFDA 4LHUB 4NN7B 4Q74A 3VI3F 2I9TB 3IS0X 5EUOA 5I74B 4U49A 1Q94B 1SEQH 4L4VA 4D9QD 3FB5A 3GFUA 3O3AA 2APBA 2YA2A 1NANH 1JVKA 2FX8L 3ARBB 1OOAA 3O2DA 4H8WH 4U6VH 4FQCH 4PV9A 1F4HA 4PJCE 4UV4H 5EB9A 1BX2B 1EFXD 4RGNE 1AR2A 5TH2A 2RFXB 1BHGA 4OM0H 1WWBX 2NLJA 1NAKL 2NXYD 1PKOA 2P8MA 4R4BA 2WM0A 2IAMA 2JJTC 5C0EB 3FFCE 2VABB 2ADGB 2YRZA 4NQSB 4Y8AA 2F54E 3BP4B 5MEQA 1SBSL 1RK0B 3ARSA 1QLFB 4Y5YA 5IVXA 1HKFA 5CJXA 1K5NB 3RVUD 4FQ1H 1QSVA 1XEDA 4XCYB 3IKCA 2DJUA 4HC1H 3T0EB 3BT2L 4JFFB 3QUZA 1D9KA 3UTQB 2DQEH 1KTRL 2R8SH 3UJJH 4FTVB 4LK4A 2R4RH 3I3EA 3K2MC 1B0GA 5DVKA 2XWTB 3MMEB 1YPZF 4DK6A 1VFMA 4L1HA 5GRWA 2DMBA 5LKNA 4XVSL 3TO4B 5A3ID 3PGCA 4ZS7H 3EDFA 2NXZC 3N85L 3TZVA 5DR5L 4JHWL 1P4LB 2JJUA 3HNVL 3ARXA 1UKQA 4OCYH 2GK2A 1IZKA 4QGTA 3IDXH 4FZEL 1BOGA 2UWEF 2P1YA 2FJGA 5FYKU 4PJ7B 5E6ZA 1TJHH 1W8OA 2AABL 1H0DA 2X70B 3W9EB 2WWMD 3ULVD 4KTDL 1OP5H 3WNPA 5JDJA 3FB6A 4L8SA 2GJ6E 1PYWB 4NWUL 2ZJSH 1T0MB 1S5IH 3BJ91 5L2KD 1NGWB 2IFGA 3B2VH 1FNGA 3TT1L 3QUMA 2GCYA 3UTPD 3OJVC 3HR5A 4XMPL 3R06B 3UJTH 4ELMA 3PL6C 4PRDA 3I50H 2BRQA 1WBXB 2Z31B 2HKHH 4XBGA 3QIBD 1G7HB 1N8ZA 1AHWA 4HIHB 1X5IA 3RL2B 1DUYB 2UYLB 4APQA 3PWPB 4RIRA 1I75A 1IEAA 3RVTD 1CD8A 2AJ3B 4PJDB 5C0IA 5I17A 6FABL 5TQ0H 4ZFFA 4J8RA 2GKIA 4N1HB 4M02A 2JK5A 4TUJB 5T3ZL 2W9DL 3RGVD 3D39B 4XB7A 1FSKC 1A4JB 1FNHA 3TVMC 4MDIB 3UBXG 4K3EH 3LHPL 4GXUN 4KK5C 5EU3B 1YMHA 2OQJB 3IDMA 4WW1B 1CF8L 1BFOB 3QO1B 5KSVA 4GMSL 5FXCH 1GXEA 3OKMB 2PO6C 1KIRB 5E1AB 1OCWL 3U79A 3U0WH 4M1DH 4NQCD 5C3LD 1M4KA 2OS7A 3K80A 2A0LD 3F6IA 2M1KA 2V2WA 4BUGA 3BP6B 2EZ0C 3RFZC 1JHLH 4OLEA 3WUWG 1P7QB 4OLWH 2P5WA 1QPXA 3SDCC 4HKJB 2G5RA 3WHE1 4DQOL 3GBNL 3GM8A 5C9JB 4JY5H 4EXPX 4JO4H 4NP4H 4F7MA 5J57B 5D5ME 5HDQH 2C1PB 5AAMA 3BGAA 1YEFH 1YNLL 3LY6A 5I8EB 3GKWL 2ZUTA 4R4NC 1CDCA 3W5NA 4G8GB 5KVEL 3RWJA 3MRHA 4QRRA 2R0LL 3AU1A 3QDJB 4OTXL 5DUPL 4E41A 5I1CL 2C3HA 2EE3A 4J3OC 2IPTL 3UEZA 3VFMA 4U1HB 2UY6A 3IFLL 5A2LH 1I9RH 1U2CA 4NO0B 5GSVA 4F7TA 4LLVB 3HI6H 3RWGB 4NM4L 1AXSA 2ITDA 3QHFH 5GS2D 2KZ1B 4JLRB 1A6TA 2AXFB 3WL9B 3QH3A 3HZMB 1YECL 3SKOA 3MLVL 3NFPB 4N0FB 4CW1B 1HHJA 4NO5B 4QWWC 4PY8J 4TVPH 3HG1B 1CE6B 1CD0A 1IAIL 4D0BA 4UAOC 2WBJD 1BJ1J 4LPUA 25C8H 3VXME 5I16A 5IJKA 2XXCB 5TE6H 1WIPA 4Z0XB 1QR1A 2PTVA 3O9WD 5K9KA 4PGZA 4F7CB 4BSVB 5DO2C 3H9YA 3VWJC 2R29H 3QFJB 3TYGH 1TITA 3ZTJH 1Q0YL 4PS4L 4ODXB 5KSAB 4CAGA 2GIYA 4AZ8A 3QXVA 4MA7H 1H15B 5GS0C 1ORSA 4QT5A 2NY3B 5E8EA 1MQKL 1YQVH 5DVLA 2AEPL 4L8CB 5GJSH 5F7UA 3MBEB 3RIFK 5IJVB 2XY2A 3O2WL 4Y5VC 4O5LL 1X5YA 3F65A 4NN5C 1BEYH 3UDWA 4IRSA 3BKJH 1VENA 1CLCA 3U9UB 3UBXB 4NQVA 1YUHA 3TA3A 1UJ3C 4MD4A 2QQNH 3QWOB 4TUKL 3EYVB 4C54A 1IRAY 3FFDA 3V4UH 4O58L 4JFPA 3HE6B 4PJXA 1TENA 5L6YH 2W65A 1KB9J 2IQ9H 1DE4A 2NY5C 1PG7L 4MNHB 3VFOA 1I1AC 2A73A 4HV8B 1EUTA 1KTDB 4QEGA 3FCTB 3X14A 2DBLH 1RJZA 5C0CA 4JO2H 1I7UA 4LMQI 3ZSTA 4YNYA 5EZOL 4LEXL 1YN7A 3L9RA 4QTHA 1UB6A 1XCTA 2X05A 1K4CA 2XI9A 3CPLB 4EVNA 1JGEB 4HCRA 1HN1A 2OL3B 4OGZA 4B50A 3SDYH 1OQXA 3GMRB 4XNMA 4P4KB 2FD6L 5KBNC 1PG7X 4D0CB 3AC0A 3WXWL 2R0KL 2BNRA 4OD3H 1A1NA 4XPBL 3QEQE 1SJEA 2Q8AL 4K8RH 3L3HA 2SEBA 2AGJL 2PW1B 5ID1A 3QDMB 2JJTA 3L3OB 5BRZB 1G7LA 3VFTA 1U8HB 1T03L 4NNXA 5ESVA 1QQDB 4X5XA 4YDKH 1MJ7H 4ORGA 2BVOB 4KQ3H 4GJTB 4U6XB 4YXLL 4PJIE 3F8UB 3GK8L 1MWAA 2OR7A 1HEZA 3MRQA 3VD4A 4Y4HB 4N0UA 2J5LC 1CLYH 3W0WE 3GDBA 4XVJH 3EAKA 1B0WA 2ADJA 1S3KL 2AP2A 3B2UC 4LF3A 3OQ3B 2BDNL 2HFFA 4RBPK 3OGCA 2X6MA 1MCWW 2R2EB 2YD8A 5T1DL 4YHLH 1AR1D 3NOIA 4ODSH 4Z77A 1RZKH 3OKLB 5IB5B 5I1IL 3QEGL 4NPYB 5D1XB 1B4JH 1SY6L 3SJVA 4AG4L 3FN0H 1Z3GH 3U48A 2DRUA 5EPMB 1A6ZB 3KPTA 5E70A 3V6OE 3RDTB 3JTTB 2UUDK 2Q76A 5IBLC 3AB0B 1HINL 2J88H 4MWFB 4KROC 5IBUG 1N26A 1OWWA 4KK9D 5LQBH 4OFIA 4DGIH 4M43H 5IB3B 5F9DC 3R1GL 1F42A 5EUOF 1JGUH 2NQCA 3FOLA 2BY1A 1V7NH 3ALXA 4JREB 5ISZD 2LTQB 3VFUA 3MLXL 1L7IH 4OQ1A 1MHEB 5E00A 2XRAH 1F8TH 4ZD3L 3CFCL 2LAAA 2VLRE 4A6YH 3BW9B 2AV7B 2BSSB 3INUH 2O61A 1IC7H 1OAXH 4PREA 4LGRB 1P69B 3DROB 3KPLB 1S7VB 5F44A 2FWOB 3IRZA 2EC9T 5FM5M 5E5MB 3BEVA 4FFWC 5JQHC 5E5UB 4HSQA 1A9BB 4PRPE 5SWSD 5FKPB 4XWOD 2X4NA 3C5SB 5MEOB 1II4E 1R0AH 1TVBB 3BJLA 1GPOH 1VKXA 3MRRA 3QB7C 5EU7E 5C86A 1JK8B 4QRTB 3EFDL 5E2UL 3ZE0E 4Z7WA 1I3GH 5BS0D 3B9VA 3IDGA 2ORBH 2QEJA 3IU4H 4YQXL 4RFEB 2DDQL 4HGMA 1YEJH 5IVXF 2X10A 3GZKA 1BJ8A 4FQQB 2HA1A 3PQYA 3NFNA 2PO6A 5JLZA 1OHQA 3MV9D 4OF6A 4I0PB 5FM5O 3KXFD 3LB6D 1QA9B 2EDJA 1QO3B 2NY4B 5L88H 1CFTB 2VE6B 2HJKB 4N90D 4Z0BL 1AP2B 3SDCA 3W2DH 3L3DA 1KN2H 1M7DA 1VSCA 4WFGE 2NY2C 1YA5A 2W0FA 2WUBL 3BWAB 3T4YB 1UXWA 3VXSD 3G5ZA 1N5YH 4K55A 1OT1A 5I8OH 4JY4B 1ZWIA 3ARRA 5I1HL 1EO7A 4IIQC 5GGTL 3CX2A 4R2GC 5AWNH 2VQ1B 3UP1A 3WEXA 4FFYH 2E7LC 1KJ3H 3KYKH 2VXSL 3RGHA 4F15C 4UIKL 5JA9A 4WFFD 2BNQD 3JZ7A 2BFVL 2OZ4L 3KYOB 3ULSB 3WS6C 4JM2B 1BQHG 3ESUF 4U6YB 4TTGA 4NC1E 5DQ9B 3MRBA 2QHRH 4YFLI 5AYUH 1YQ2A 1CYGA 3RIAK 4PJEA 3K4ZA 2NW2A 3KPNA 3QIUC 4ELMF 4OZ4B 1DBBH 2C3VA 4NJAH 3JV6A 5DJXB 1EUUA 4KVNL 5F1OB 3DTXB 1NMBH 1RSFA 2XWJB 5I74C 3FT3A 5C0RL 4HT1H 2MQCA 2CK0L 4FQ2L 4M6MH 5KANI 3IXTA 1T5XA 2F58L 4TULH 3MRGA 4YUEH 5LG1A 5IBUB 4C56D 3ARBC 3BIKA 3LV3A 2VH5H 3U9PH 1HI6A 4LKCB 5HXMA 5DVOA 2NX5E 3VWJA 4KHXH 1PFCA 2V17H 2G9HA 4FQPA 3L7FB 4FQXA 4XP6L 3W11D 3FO1B 3RX8A 3U4AA 3KNBA 1GIGL 1U8OA 1K6QH 3F62A 4LKXB 5DDHB 4M7KH 1T1YB 5CIPA 3P9LB 3FQNB 3VW3H 1P5VA 3CLFL 4NQEE 4X6FB 3EIFA 4XGZA 4YFEA 3FAXA 4HPYH 4L4TD 3WBDA 2A83A 1R5VA 4A2LA 3KDMB 4JN2A 1L9NA 1MIEH 5DRZB 4Y5VA 3REWA 4XPAL 2DQGH 4EN3D 5DK3A 4LRNL 3LPWA 4ZUWA 1KG0A 3MXWH 3GNMH 3PDOB 3U2SB 3VXPA 1G7IB 1JJUA 3RWIA 5E8OB 1T7VA 4MQXD 3B5HA 3CUPB 3HI1A 3LRHA 3WMSA 1U58B 5FM4A 5F97E 4OFVA 3U1SL 4M1GH 2CRZA 4L9LB 1QSFA 3VDCA 3A6CL 5ENWA 4IDJH 1I4FB 4UDTA 4L4VD 1R5IA 2IPKA 3PGFL 3TO4C 3MNVA 3S37L 1I1AA 4AIOA 3EYQD 1JYVA 1PVHA 4H20L 4UQ3B 2C4FU 3BD4A 1LD9B 4HK0B 2XTJD 5EN2B 3OR7B 1AO7E 4YC2C 5LAXA 4P3DA 4IRZH 4P2OA 5DD0H 3C6SB 3V6ZB 4RDQG 3WLWD 3EDDA 5EBLA 4Z8FL 3H9SD 2W59A 1S9XB 2GEEA 4XNYH 1DFBL 5E1HB 4RISL 5KSBE 3RA7H 1JGLL 1U6AL 1S5HB 1NMAL 1EX0A 3S37X 1WZ1L 4XX1E 2XN9E 2YMXH 2Q7YB 4TOYH 2ARJQ 4LGPB 3L3KA 2MKLC 2DM3A 4Y19A 3SQOH 5E2VH 1JHTA 4KVCL 4ZTPH 1I1FA 1ZA3A 1XF4B 5BOZG 3HUJE 4PJBE 4CVXB 4LQFH 1FORH 4IOSD 1G9MH 2VO5A 5TGBB 1BQHB 3TBSB 4JRYE 1AGEA 5EOCJ 1CGTA 3BPNB 3MZTA 4O9HL 4P3CL 4U3CA 5CGYC 1D9KD 3MCLH 4QYOB 1Q9OA 4X7TA 1AXTL 1K8IA 1KCRL 4P9HH 4GQ9L 2A77H 4G5ZL 3M1BB 3H42L 2QQQA 5HHXL 5C09A 5KVFL 1HDMB 1AC0A 5FO7A 4LLQB 5CEZE 2R2CA 1TJIL 4QRSB 5MEPA 2OP4L 7FABL 2OSLA 3TZVD 1FHGA 2ICWI 1TETH 4JFYB 1A3RH 3NABH 3O6LH 5HGBA 5JHDA 5MHSD 5CBAA 3BEWB 4NKOB 2ZOKB 1I8IA 2NY0B 5FO8A 4F8TA 1QSEB 1UZ6E 1Z9LA 4XB8A 1T22A 3UYOD 4XCNA 4NRYA 5B8CA 3QDGE 1OP5K 4DZBB 1JPSL 2KQNA 3QBTB 4OV5B 3QPQC 4F2MB 3GMOB 5KTEL 3T4AB 4K23L 3ROOA 2I5YH 3L7EA 3RWEA 5FHBL 4LPYA 3MV7A 4P3WA 1RULL 4D0DB 5C3TA 1RUKL 4UUJA 5I1GL 5C0DB 2W0PA 3ETBF 4N8CH 5CKGA 3TFKC 3VFPA 5J9PB 2IQAB 1VFBA 4ZUSB 3DXAD 5GRJL 3QHTC 4XNXH 2DI7A 4QLRA 5I0ZA 2OX5A 3GSUA 4PIRF 5HYSG 1KLFA 3LCYA 5LJYH 3JWDL 3AY4C 2LU7A 4M4RA 4PUBL 4OLXL 5DJZB 1IEBB 1ZANL 1NQBA 2GSGB 2W9EL 2XA8L 5DI8A 4LPVA 3MACH 5C0BA 3ZTJG 2ZUVA 1U8KA 2C4XA 4CN4A 2AKRA 1EHNA 1K4DB 2VOTA 5DHYA 3RVVC 1CBVL 1IJ9A 1FO0H 3SY0A 1P1ZA 5D1ZC 3HRZB 1MFAH 3QQ4A 3X11B 5CEZL 2BSTB 2NMSA 3UPRA 1MUJB 3FZUC 1KJMA 3HPLB 4U1LA 4OBSA 4N8PA 4Z7QF 5AZEH 4R0LB 3VFRB 1MJUH 2XT1B 4PJFE 1BZ9A 5T33H 5GZNC 1G6RB 3MRJB 2Q1EA 1P53A 2NY3C 3CXDH 4U6VL 4YFDB 4ODTH 5IUSA 2VDMH 4FQCL 4MXWL 2D4DA 1J86A 3RVWC 1X4ZA 3EOYG 3GJEB 4I5BA 2HTKC 2J8UB 1TZGH 3P0GB 4NHUA 4X6EB 4K3HA 1GZQB 1JYXA 5IVNA 3MYZA 5IMOB 3BN3B 4MXQC 3BIBX 1A6AB 4IIQA 4H0IA 1ONQB 2X1WL 3TO2A 4BZYA 3E6HB 5B4MC 4QHNB 3V5KA 5J6GB 2E7LA 1G1CA 3H9HA 4FP8H 4LSRH 1KEGH 4ENED 1DZBA 3S35L 4MQ7A 1I8LC 1IGYB 3DX7B 3ULVH 1XGRA 4PRAA 4ZAKC 4H1LH 1EEQA 1NJ9B 4HC1L 3VXNA 5F96H 1JBJA 2VC2L 4RMUA 1FV1B 4X6DE 3ZDXE 1TXKA 3L1OL 1IT9L 1F00I 1BFVH 1OQOA 3UJJL 5DFVD 3QIUA 5L2JB 2MHAB 3R4DA 5D9SA 1IQWL 4N5ED 5C8JB 5EBMB 1FPTH 3G6JA 1JZ7A 3PG2A 4G42B 3V0AC 5D2NC 5BJTB 3S35X 3HAEG 5EULV 4PRID 1CS6A 1FGVL 3MRCA 1A2YB 3SGJA 3IB4A 3C2AH 3E6FB 1QVOB 3ARTA 4HXBH 2Z92B 3CMOH 4Z7WF 4DUXA 5CSBA 2YZ1A 3ARGB 5DQDH 2OI9C 4F7EA 5L9DH 2YRLA 2HRPH 3LEXA 3KLAB 2ZJSL 2ESVD 3B2VL 4MA8H 1UZ8A 4PJ8C 4BQBA 3UJTL 2R23A 3TA3D 1HQRA 3I50L 3O4LD 5FB8A 3RI5K 3WFEH 4Q9QL 1IC4L 4ETQA 2AJYH 4S1RL 5IGXL 1AI1L 4TVPE 5HYSB 5FFLA 1MCOL 5IB1B 4OLVH 3MUGB 4P57B 4TUOA 1OGAA 3GHEH 4FS0A 4KRLB 4YJZL 1I3VA 4JEGB 5C0CD 3SE4C 3L3JB 4JY6A 2Z35A 5HYJA 3MFGB 5E9DE 1J0HA 4QXGH 1L7TH 3EOBB 4LSSL 4P2QB 4X6CE 1IL1B 2PYEE 5DUMH 3SDXB 3CX5J 4NZTH 2YOCA 3WCYA 4PJ5A 4EBQH 4ZDHB 2X1OA 4FFZH 5JW3H 1LE9A 1TTGA 4B41A 2WINB 3D0LB 1P6AB 4M1DL 5B22A 3GIVB 3AB0C 5GS2H 1D6VL 4LLUA 1P9MC 1S7TB 5HHPA 3CFKB 4PJEF 1NGXB 1NFDE 1JHLL 1VGEL 2DM2A 1N64L 2AK4B 3RNQA 5DC4B 3BH8B 1K3ZA 3E2HB 2VLJD 3K1KC 3CSYB 5CJOH 4JREC 2LTQC 1MI5A 3EO1B 3A67H 4JZOA 4CDGC 2K1MA 2B4CH 4AEIH 2RAMA 5D96C 2FZ3B 3QNYA 5J1SC 3NA9H 2YUZA 4R7DB 5DJYB 3GHBH 2YBRB 2Q3AA 1IVLA 2DKMA 4TPRH 1HIML 4JKPH 2DQHL 1ORQB 4H5SB 1WC7A 2OTWB 3ZKQD 5BZWA 2WK2A 5FKAB 1RJLA 1J5OH 3VXRA 3MRPA 3VWKB 1U95B 5EORL 2MKWA 1A7PH 2VERN 1VPOL 1KENL 3IXAA 3T04D 2D31B 3SJVD 1U8PA 3OB0H 1C5BH 3HAEB 5I2IB 5D6CA 2NXZD 3UTSA 1IGML 1DLFL 1NGQH 4I0PC 3ILPA 3IETA 5IR1A 4LVHB 4GO6B 2DTML 1BVKB 4CJ1A 2UVFA 5CEYA 1N5AB 4ODHL 2R29L 2WLYA 3EKCA 4PJAE 4E42B 1PQZB 4LSUH 4ZPVB 1OAZH 1IGJB 3QUXB 4XH2A 1JF1A 2X1XR 4O4YL 4X80H 3S5LA 4DN4H 3PL6D 1TIUA 1FVEA 4JG0H 4CDHA 4G7YL 5J13C 3G6AA 1A6WH 2JCCA 1F6LL 1BWMA 1VFUA 3MJ9L 1TMCB 4P2RA 1KPRB 5GJSL 3QNZB 3KVQA 4KC3B 4XNUH 4JO1H 1WK0A 1YY8B 2YD9A 2B0SH 1F90H 2J1KA 1MH5B 4X99B 4JM2C 3DVIA 3TWCH 3VMNA 1MY5A 2IADB 3TVMD 1Q0XL 4KAQH 2X40A 4KK5D 1RHHA 5ITFA 2QQNL 3C8KA 2WQ8A 4JFHE 4UV7L 5F1NB 2EDEA 1UWXH 3V4UL 2R69H 1EGJH 1T1ZA 4Z76A 5B3NA 2Y1VA 12E8H 4KDTA 5L6YL 4WI4A 3C08H 2IQ9L 2PO6D 5LGKA 2VAJA 2GFBB 3STZA 2EIEA 5DURD 1C1EH 4BYHA 1Y18A 2GUOB 2C9AA 1A7QH 2XYCA 1RZFL 4PR5A 1LO5B 2JIXB 43C9B 4E41E 5HHOA 2EZ0D 2A1WH 1LMKA 4JPVH 2DMCA 3SDCD 1JGDA 5D1ZA 4JGMA 4O02L 1FFQA 5HDBE 2BRRL 3ZE1E 4A6YB 4OIIH 2D7TH 4YHML 1D6EB 2H6PB 2VUOA 4MSWB 5KANG 4BH7A 1S7XA 4JQXC 1JIBA 3SDYL 1BQSA 1V3KA 4OUOA 4ZNEE 4R4ND 5DEGB 3WNMA 3RWHB 3DV4A 1D5ZB 2HKFL 2F8XC 1UQSA 2G2RB 3EZJB 2A6DB 5HI4C 3AUVA 2YK1H 4MQTB 1Y6KR 1S7WB 4L3EB 2WIMA 1MREL 1XIWB 4WUUB 4RX4A 2DKUA 3Q48A 2H8PA 3U36B 2ERJC 3WFBH 5I73C 1MHPH 3WIHH 4RFNB 3LQZA 1XR9B 2X4TB 1FNEB 1RZGA 1WFUA 4GRMA 4DZ8A 4L9LC 3PWVA 3WXVH 1NLBL 5ELIA 4QWWD 5C07D 4HKXA 3WSQH 3SPVA 5F7EH 1I8LA 1EAJA 3QEHA 4LLDB 1CLYL 3BI9X 4X4ZA 4WWKB 3I85A 1HYRC 4ZAKA 2IC2A 3EDJA 4G6FD 3AROA 4R6UA 3GSNH 3BPLB 4Y2DB 3KPSB 1CXEA 3EFFB 1G6VK 4OCRL 2ZZUT 3GSQB 1B6UA 3QXWA 4XAKD 4EQ3A 2FX7H 1TQBB 1YC8A 2DQUH 3OTTA 5DO2D 1W0VA 2C7UA 1YN6A 4QY8B 2W07A 1IC1A 4YHLL 3VWJD 2XZCH 4OZFH 2WANA 4LCCA 1RZKL 1WFNA 2O5ZH 1RZ7H 5D2NA 5DZNA 2HVKB 1Z3GL 4CMMB 3DHJA 4MX7B 4ONGH 2OYPA 1CE1H 4OT1H 4ZUUB 5EUKA 5GS0D 2XIDA 2OJZH 3QEUB 5ACMA 4PJXE 4LBEA 3HTLX 1W72A 2J88L 4BK4A 3FONB 3WYRA 4K3DH 2FEEI 5LQBL 1NGPH 2PN5A 2OK0H 2F19H 3NACH 4HPOL 3PHQA 4WEBL 3FT2A 4CUCA 4OV6F 2Y4SA 3BPNC 4ZOCA 1T7WA 1V7NL 1X5KA 1EEYB 4PJ8A 4LCIH 3VXUB 1JZ5A 2ZUWA 1J10A 2XRAL 1F8TL 3QUYB 5T1MB 1QSFD 3INUL 1BIIB 2EDDA 1YMME 4G9FA 2GAZB 4LNVA 1A5FL 1T1WB 4YHIB 4NKIL 1I1AD 4M93B 4CADB 5KVDL 5DF0A 1X5LA 2DB8A 5D1QC 3SE4A 1CU4L 2Z0BA 3F5WB 4CL7A 2YR3A 5E8PA 5FA4A 3S3JA 4LNRA 4YIQB 4AM0A 5H94B 2AS5M 2NY0C 3OB8A 4PJGE 5T3XD 3TJHC 1CGSH 2RCSH 4MJIA 4R96B 5DMYA 1CFVH 5J11B 2ZSVB 3G04B 1FZMB 3L95A 4YAQB 4WI2A 4LLWB 3L3GA 4JRXE 2R56H 5CINH 2YPLB 3VD5A 2EH8H 5C0JA 2P8PB 1CLOH 3HNTH 2IANA 4XXDB 1P9MA 2EDHA 1FZKA 2ATKB 3TN0B 2GK0A 1XGYH 5ALBH 1A1OB 1MAJA 4HZLA 4M7JL 4NT6B 2RIKA 2ZSWA 3G6JF 3BWUC 2CDEA 2EDFA 1UWEH 4GAJH 3RL1B 4MD5A 4ODUB 4N0CC 5EH1A 5FV2A 1QP1A 3Q3GB 4RQQB 4RSVA 4KPHH 2F15A 2F5AH 2HN7A 5AWNL 5C09D 1WFTA 5I1LB 4FFYL 3P73B 4Z7VB 4AT6A 3KYKL 2H2SC 2FLBT 2LU3A 4AH2B 1F45A 5HY9A 3NCJH 3LKQB 5FF6A 1MRDL 1J0ZA 4CU6A 5TDOB 3PUCA 3B2UD 1A8JH 2VLMD 3TT3H 4ZFOB 3DBXB 4ZTOL 1XGPA 5JW5A 2E7BA 5IMLB 2QHRL 1LP9E 2B8OT 2MJWA 2QR0B 1VEOA 4P4RB 2A74B 1DEEA 1BZ7B 5GGSB 2GJZA 5HD8C 3DI2B 4AEFA 1ACYH 5JDSB 1NMBL 1OSZA 5BQ7B 1RUML 5JQ6H 3VCLB 4EI6A 4HGWB 4M6ML 2V5YA 4PG9B 3CVIL 3PXJA 3GMLA 4LCWB 4TULL 5IBLD 1OWRM 1DBML 4R0LC 4KHTH 3KPRA 4KROD 3T1FA 4LASH 2VH5L 3U9PL 3FO0H 5GXBB 1YNKH 3OJDA 2V17L 3MV7D 3S36L 4QF1B 3REVA 2IALB 4N68A 4TQEL 1K6QL 5DUBB 3U0TB 2R1YA 1G7QB 4OLYH 3LN5B 3VW3L 3VE0B 5DRWB 5IOPA 4G6KH 3C5ZA 5D93B 5DMKA 3VGFA 4KKLC 3RZCB 1TCMA 3MRDB 4UU9A 4H1LG 4QXWA 3H7LA 4R3SB 5I15L 3DX8A 1SVZA 4U1JB 3LKPA 2O5XH 2DQGL 4FFWD 3BYTA 2NCMA 3S4SG 5D7LA 3S36X 3MV8A 2BVYA 3CDGB 2HJFA 3FJTA 4L3CA 4M6NH 4OCXL 1EO8L 4RFOH 1F4XL 3QIWB 5ICXA 4X4XA 4M1GL 4HAGA 5FUCE 3HR6A 3TJEH 1WQVT 3WLBA 4G8IA 4XPHH 3CU1A 3WIFB 4Q0XH 1BGXL 3MREA 2P8LB 5EBWB 4WFHE 4XTRC 3EYOB 1OLZA 4QOKE 3QNXA 3TBTB 5DRNB 3EOAB 2DI8A 3QCUH 1WF5A 1N59B 5DD0L 4BQ6A 1SMOA 1YDPB 4Y5XC 3GMNB 1J8HA 3SOBL 3GSVB 4N8VA 1S7QA 4NDMA 2NY2D 5F1IA 2FX9H 3T3PF 3ARGC 2XQBL 3QUKA 4HKZB 4K07A 3DGCR 1C7TA 4ZO6A 3PGDB 2QSVA 4QTIL 2P43B 4TOYL 5I1EL 3A6OA 3IDJB 3SQOL 4H88H 4M8QA 2VDRL 4O2FA 4R2GD 5E2VL 5GS1A 4HIEA 4YE4L 3QO0B 3CAFA 4HJGA 4LQFL 1FORL 1G9ML 1QBAA 3DOSA 3EUUA 1T3FB 2AEQL 2CKBA 5E8DH 4P5TB 1T4KA 3NAAL 3QUMH 4FMKA 4HHAA 1TQCB 3BD3A 1FO0B 4KGJA 4LHUD 4XNZB 1U8LA 1RJYB 1VA9A 1GSMA 3QIUD 4P9HL 4QXTB 3HMWL 1CL7I 1KGCE 2FYYA 1QBMH 2JCCF 1D5XB 5FA3B 5DJ2B 1GZPA 1R3HA 1MCWM 2IH3B 4U31A 1DCLA 2HP4A 3CH1B 1F5WA 1TETL 5K9OB 4JDZB 4XXCC 3ARBD 3RJDA 1Q72L 5IF0B 1FLRL 5AD0A 1ZVYA 3MPCA 3IFPA 2WW8A 3UC0H 5F6IC 1LEIB 5DWUH 5LGJB 4GRWF 4M48H 4GW4A 2EIZA 1CL7H 5IT2H 1LO4H 3WO4C 1R5WB 1OGTA 4JZJB 5BVPH 1P7KA 1AGBA 3ARWA 4P59H 2WSKA 4H1LB 5L2KB 1XF2B 2Z8SA 1G7MB 1EERB 4QRUA 1F3DH 5LWYH 1C5DA 3BZDA 2VL5A 3ULVE 1C7SA 3H7BB 1AXIB 1BOYA 1A1MA 4OF3A 4QO1A 1U93A 4JFFD 4FXGB 1P4BH 3HI5H 4GKNB 2BOBA 4EDWL 1F11B 4FTVD 4H25B 5C2BL 5HYJD 3MBXH 4NKDA 3CFEA 4GG6E 1H3VA 5IB2B 3DO7B 3RQ3A 4KY1L 4GKZA 1RIVH 3K74B 1CDYA 4KRMB 3RGVB 3VFVB 3MLRL 1DBAH 3TO4D 2HWZH 4JZNA 4PJ5D 1UKSA 2JE8A 3S34L 4Y19E 2VLLA 5D1QA 1UWGH 4RZCB 4U1NB 2YUWA 4NGHH 1MRFH 5JO5B 3MRKB 3MACL 5GGUB 4EJ1C 5F88A 5HTSA 2CRYA 2NTFB 4NZUH 1CVSC 5L8KB 2Z8RA 4OZHB 3LKNB 1AFVH 3ZKXC 1FNAA 3MOBH 3MRIA 1KTLA 1X5ZA 3GSRB 4EOWH 3ZDZE 3B9KC 3QUXC 2BJMH 5IK3A 2BHYA 4NQCE 4R90L 5DXWA 1KBGH 4FXKB 4M5ZL 5FAAA 4MAYB 5T33L 4RWYH 2DYPB 5E0QA 1PKQB 4GRLC 4WRLA 4X7SL 3CXDL 3O45A 4ODTL 2VDML 1DN0A 1CZ8H 3L5XH 1DN2A 3JV4A 4O2CA 5EU6E 5HVHB 2VIRA 5C08E 4HK3N 5CGYD 2A9NL 3HS0A 4JB9L 5F89A 1UM5L 1BD2E 1TVHB 1H3XA 1Z0NA 2FLRT 3WN5A 1MLCB 2J6EL 3VXRD 4YDVB 5F1KC 1J11A 3U7WL 1YJDL 4GW1B 4P5KA 2FDBP 5KN5A 3ULVL 2KPNA 1HHGB 3S96B 3UTSD 3CZJA 4QRPB 4Z7NE 5F96L 1NKRA 2FR4A 4ZNCD 4DAGL 2EC9U 3AXLA 2MWCA 3HC4H 5H35B 4HZAA 3TPUA 1DL7H 4GH7B 2COQA 3OG4B 1NEUA 1R3JB 2DQIL 3FTGA 2R2BB 2WBJB 3B3IA 5ITBH 1T5WB 3LRSB 5IEKB 2LVCA 1VADB 5CMAA 3O9WB 5CCKH 1K9TA 1P2CA 3QULB 4ZSOA 1FE8H 3IJYB 1BBDL 5DRXA 1UXSB 2AVGA 3NH7L 3P9MB 1OAQH 5I1DB 3MCKB 3I02A 4JFXB 4NNPH 3QPQD 2P42B 1JTTA 2F53E 3IFOB 5TF1H 3DVNB 5HHNA 4HH8A 3WDJA 3KJ4C 4I3GA 4G8GD 3C2AL 4D3CH 1OP3H 1MLBA 3QDJD 3OV6A 3DSFH 4P2RD 3K8MA 3SKJL 4BM7A 4K2UL 3I6LE 3V95A 4HDIA 1QZ1A 2ICEB 3MCG1 2OBGA 2CDGB 2VITB 5HBBA 1YPZB 5GRUL 4YHPA 1QKZH 1XIWC 2Y07L 2QQKL 1QHPA 3CVHA 1BMGA 4UINH 3TFKD 2ENYA 3D85B 3HC0B 1HSAB 3MNZB 4RFNC 4HBQA 3DJ9A 3L5HA 3WFEL 1IQDA 1MRCL 4RGNC 1CTNA 1ZT4A 3KPQB 1J12A 4I77H 4K9EC 4IHOA 4NWTH 1MFEL 2F8OA 5HJ3A 1ZGLB 4WWKC 4OZIE 1UWXK 4OFKA 3CSBA 4EZMA 3BPLC 3GHEL 5C9KA 2ZPKL 4JQIH 1UC6A 1IAOA 1VEPA 2HRLA 2OR9L 1MJJB 1FG2B 4OZFG 1TQBC 2XNAB 5D2LE 1BWWA 2ICWJ 3CNKA 3K4AA 3TBYA 5HHOD 5DHVA 4QXGL 3RVVD 3LIZL 1L7TL 3PF2A 3VH8G 4U2ZA 5D1ZD 4HS6B 4XI5C 3MRLB 3VGDA 2Q20A 4DOHB 4NYLB 3FZUD 5MI0B 4NZTL 4MA3B 1T2QH 4EBQL 3BO8B 1FNFA 3QRGH 3HB3C 5GZND 2NY3D 5EO0A 2XFXB 1IGFL 4BH8A 4YGVB 5IEHB 1IILE 3RVWD 3X3FL 1J0YA 4XP5H 4Y5XA 2HTKD 4L5FL 3GGWB 4Z7UE 4KQ4L 4H26A 1IAKB 1KCVH 4JFOA 3MV01 4RX4D 4L8BB 2V7NA 4MXQD 1A7OH 4MNQA 1DTUA 4OCMC 3OKDB 3LSOB 5T5NF 5CWSB 3FO2B 5JNYA 1I1YA 1EBPA 3QUYC 2B4CL 4Y16C 5B4MD 2P24A 4KUZL 3NCYS 1LK2A 4Z5RA 3NA9L 4JG1L 1KCUH 4QHMB 2ATPA 4ZAKD 3PHSA 1XF5A 4ZPTA 5CD3B 4MNGB 1JWSB 1QRNA 3QZWA 5IFJB 4NJ9L 4JHZA 3H6JA 3L3IB 4NNYB 4PRHA 3QPXL 4YR6B 5ETUB 4LSDA 5GGVH 1J5OL 4ZG1A 1KB5B 3OKYA 2ADFH 4KV5E 1IBGL 3MRMA 4XBPB 1A7PL 4AL8H 2RJMA 4JFDE 4YZFE 3D0VA 2CXGA 4OKVB 5FUZH 1C5BL 5DD6A 3GM0A 5CGMA 5CBEA 1B6DA 5ID0A 1U3HB 2F74A 2YN3A 4EI5C 1NGQL 3VRLF 3V0VA 2B5IB 3SKNA 1CICB 4FQHB 3O6KH 2EYRB 1T6WA 1Q9KB 1C12A 3H9ZA 4OGAC 4NQXB 4C58B 1QEWB 5DD3L 4Q6IB 4KI5E 2IFFL 4F58L 1HE7A 4PRBA 5BRZD 4NQDA 4LSUL 1FRGL 1IKFH 4PJ8D 3ULUE 2XXMB 4KRNA 1JN6A 4QRQA 4X6BB 5FK9A 4X80L 4DN4L 4Y4FB 4B7LA 4HS8H 4JG0L 2LFGA 3GSNB 2Y36H 3VGEA 2G75A 3KYNA 1LEGA 5ISZB 1DBJL 3QXAA 4U1GC 3SKUD 3GMQB 1MELA 3ZKMC 4JO1L 1J05B 1JI1A 2X4OA 4RNRB 2B0SL 1F90L 2OM5A 5JUEH 4OZFB 4G6AC 1S7UB 1JNHA 4R7NA 4RAVB 5SX4I 1CLZL 1UYWH 5BMFH 1RZIA 2AJZB 5D7SL 5FO9A 2PW2A 3VH8B 1MCRA 2MMXA 4GOSA 4S1SH 4XC3L 2OXGA 1Q1JH 5ICYA 3GJFA 3TV3H 4IS6B 4MJID 4KDVA 2R69L 3T0AA 1G84A 4NUGH 12E8L 3PHOB 1FQ9C 3MGOA 1IGTB 3C08L 5BS0B 5EC2A 2GITB 1XF3B 4IM8A 5SWSE 4POZC 1JUFA 1IAMA 3SBWA 3P3YA 4GQPH 3VG0H 4HH9B 3ZL4H 2X4QB 4MCZA 4N0YH 1ETZA 5SX4H 5K9QI 3QAZB 4JPVL 3VXQA 3MRNA 5GGRB 1JWUA 4OZGE 3ZHKA 1LO0L 3BN9C 4I4WB 4OIIL 2VTFA 4TSCL 4PJ9C 3MV9E 4GG8B 3KXFE 3O3DA 3B9KA 1J0IA 2CPCA 2Z4QA 2FSEB 3NIFE 2DLTA 1EEUA 5D93C 4GRLA 1ZHBB 3FN9A 4B53A 5TFSL 3VXSB 4HX1A 4N90E 1NBQA 4GBXA 5C0AB 2I26N 4HIXL 4U1KA 3V6FA 3GI8L 5CIPH 2IWGA 5DEZA 2EEBA 4WW2B 1U8MA 5SWZA 1A3LH 1PY4A 4OM1H 3ULUL 2VLKA 4X4YA 1MHPL 5GS0H 1T6VN 1WCBA 4KU1A 4X5WA 3WXVL 3WJJA 2LQRA 3LD8B 1EZVY 4P48A 4C83A 1FAIH 5E08L 1AGCA 1T2JA 2ZKHL 3GSXA 4WFFE 2BNQE 4YHYC 3WIIL 1REIA 2Q86B 1HQ4B 4I0PD 4WU5B 1S78C 3ARDA 1S7SA 4V1DA 5F6HI 1H3GA 1DQLH 2A6KA 3KPRD 2FX7L 2VDOH 4LU5L 2DQUL 3V9FA 1E4XL 3BKYH 5D70L 4I1NB 3MFFB 3RAJH 3V7MA 3OAYH 5BZDA 2NY5H 5INDB 4C56B 3IF1A 4L8DB 4LLAA 4PTTB 3BDBA 1BVZA 2NY1B 4F37F 1I7TA 4EIGB 1TFHA 1RK1B 4MXVE 4BSJA 1DQDH 4ONGL 3MLSL 2DQFB 4IRJC 4HUXA 4OFYA 4W68A 1T2XA 1HOCB 4LEOA 3HC3H 2D7QA 4UOW1 5C7XL 4J3TA 3P77B 5IW1B 3T8XA 4PJHE 1RY7B 4BZ2H 3BZFA 4NSKA 4AENA 5T3XH 3U0PA 2F19L 1WAAA 2KQMA 3NACL 4MMXC 5D7LD 3MV8D 4JM2D 4L4TB 1IARB 2I9LA 4LSPH 3T1WA 1ZLSL 4P5TC 3DRQB 1MHHB 5JIPA 2LAGB 3DMMC 5L8JB 4PJCA 4M9PA 1BLNB 3DI3B 1WZMA 4YBLB 4F33B 4FABH 4DVRH 3HZKB 4HJJH 5GSRA 1MCIA 5L0QB 3CFDB 6CGTA 5F9OL 3FFCA 4LP5A 1NCDH 2GYSA 5DS8A 5EUOB 1RUQH 2F54A 3LS5H 4YHNA 2VKWA 2EE6A 4L4VB 3BZ4A 3FB5B 3O3AB 2PXYA 3LEVH 3RY5A 3MO1A 5GISH 1P6FA 3QHZH 3C6LC 3QG7H 2P4AB 4OD1H 1HSBA 4S0TD 3W5MA 1A14H 3IKKA 4PV9B 3H3BC 5TDNA 3ZKNC 5TH2B 4JZJC 3RHWF 2NLJB 2XTJE 5BO1H 2P8MB 2EH8L 4R4BB 2IAMB 1Q9WA 3SDDA 3JWOL 1J1OL 3KG5A 3O4OC 5HI4D 3OJ2C 5HHVH 3H9SE 2VN4A 4HIIA 3DX6A 5MEQB 3PP3H 1AY1H 3V6OC 4Y5YB 3DYMA 5IVXB 3QCTL 2FB4L 4RMSA 1F4AA 3N9GH 3THML 3ZHLA 3ECBA 4Y16A 3IKCB 1UA6H 2F5AL 3B9AA 4JR9H 4E5XA 1LVEA 3QUZB 1D9KB 2GJ6A 4RMWA 5F9JA 1C5CL 4HEME 1B0GB 5JXEC 4LSTH 4XCEA 5JOPD 4JVWA 4KZDH 1PSKH 4I0KA 4G43A 1MVUA 3PGCB 4PGBA 3TZVB 4Z78A 1NFIA 1BOGB 3W81A 2FJGB 5DTFA 5EA0H 1K8DA 4URTB 1NFKA 3CSGA 1H0DB 4BZ1H 3FQRA 3G6DH 4EI5A 5EU7C 4IMLA 4MB5A 3S88L 5E95B 5MHSE 3FB6B 4L8SB 4LLYA 4MAYC 2GY5A 4DWHA 1D5MA 1MCEA 1FNGB 1NGZA 1BJ1H 1XR8A 3FO0L 3QUMB 2GCYB 5JMOC 3HR5B 4HFUL 1R3KA 4ELMB 5A2JH 4PRDB 2C1OA 5J12B 4XBGB 1N8ZB 1AHWB 2H26A 2XQYG 4APQB 4RIRB 1NLDH 1IEAB 5A43C 2E7MA 5C0IB 5I17B 3QJHA 1YYLH 3I6KA 4JHAL 4ZFFB 1NSNH 4J8RB 4JPWH 4DTGH 2JK5B 1QNZH 5I30L 4IJ3C 4GXUM 1UH2A 4P49A 1F3JA 2FATL 3H0TA 3VFGH 1N4XH 5D5MA 3CDFA 5DGRA 1YMHB 3BGFC 5D1QD 3IDMB 1E4JA 2ZUXA 3OSKA 5KSVB 3DXAE 4RFOL 2NY0D 5JR1L 1QSED 3TJHD 3TJEL 1LILA 4XCFH 1YEGL 1NCCH 2AQ2A 2V2WB 1W0WA 1WTGT 4NC1C 3T3ME 5HI5C 3HMXH 2X9YA 4OI9A 4ZOBA 5H37G 3VD7A 1WBYA 1J1XH 2P5WB 4IOFC 4ZUVA 4AY0A 2YPVH 1EFQA 2V9RA 2DLHA 4F7MB 4K71B 1XCQA 4F3FA 4X83A 3RUGE 1E28A 4PJ9A 3VXMA 4N0CD 3RWJB 5IV2A 3MRHB 4QRRB 4KH2A 3AU1B 1C08A 2NTSP 5CJQL 4E41B 4FQIL 4OAWA 1JZ4A 3VFMB 1MNUH 5KS9E 4NO2A 5DD1H 4F7CA 4DGYH 1Y6MR 2H2SD 3SEPA 5GSVB 2QLVB 4F7TB 1AXSB 2ITDB 3EYUL 4JDTH 1A6TB 5K9JH 3KPPA 4HWEL 4NHCL 3QH3B 3SKOB 3K46A 1SM3H 3O8XA 1HHJB 2X4PA 5HD8D 4D0BB 2EIBA 1L0QA 3BKML 3FO9A 2H32A 3SE8H 2YXFA 3S8WA 5I16B 3MJ6A 5IFAL 2PYFA 1QBML 1QR1B 5K9KB 3MBEA 5MI0C 1KNOA 3BKCL 4JHBA 4Z95L 2IGFH 1EZVX 1KTKE 2BX5A 3WFZA 1D5BA 4EDXA 3QRFM 1SY6A 1BM3H 4MLSA 3A6BH 1RZ8A 1OP3K 3C87A 1ORSB 4ZQKA 4QT5B 5HGHA 2I07A 5TQ2H 5E8EB 3PWLA 1HCFX 1CL7L 5IT2L 4Y1AE 4HLZH 2Y7QA 4PRIE 5BVPL 4IRJA 1IGCL 3LQAC 2X7LA 4KKLD 5HYQA 4IRSB 1GAFH 3WUWA 1ZTXL 4NQVB 1YUHB 3V6BR 3TA3B 1PLGH 4MD4B 1L9MA 3VFNA 2WWKT 3FFDB 5EZJA 2ESVE 2Z8VC 4JFPB 4PJXB 3CFIC 1S7RA 3DMMA 1X6NA 2BP3A 3HI5L 3QEQA 3RY4A 2YD1A 4CMHB 2W65B 3BUYA 1DE4B 3O4LE 3NFSH 4KTEH 4MS8C 1J8HE 3VFOB 2DWEA 5EC1A 5FGBC 2A73B 3NPSB 1U41A 3X14B 1RIVL 4KJPC 5C0CB 3JWDC 5DYOA 5DK2A 4RMQA 1I7UB 1ZEAL 4YNYB 2IPUG 3HHRB 2QSTA 5KVGH 1YN7B 2VUYA 3L9RB 5KW9H 4QTHB 1UB6B 1XCTB 4XTRD 1K4CB 4FNLL 4EVNB 1U3HC 1NPUA 1JV5A 3WKMH 4PJIA 1B9ZA 1MCPH 1KELH 2VDKH 1F4YL 2JB6A 4LIQH 1CICC 1BJMA 4XNMB 2Q87A 1OW0A 3W0WA 3C6LA 2BVTA 2BNRB 2FH6A 4WHCA 2YD7A 3BISA 1NCAL 1A1NB 2BMKA 3ARGD 4Q6IC 1SJEB 1MIMH 2JJVA 3MOBL 3L3HB 4DUWA 1KC5H 3GO1L 2SEBB 5SV4A 4AEHH 5ID1B 2AXGA 2EXYC 2E27H 1BQLH 2P5EE 4Y4FC 1KBGL 1G7LB 1E6OL 3VFTB 3DX9A 4RWYL 4NNXB 3E0GA 1PDKA 5ESVB 2WAHA 5MENE 2A9MH 3CIQA 2FGZA 4ORGB 3OGOE 3U4BH 4X0KA 2VDLL 4P5MA 1MCSA 3V6OA 1QRND 2VLJE 1A6PA 1MWAB 1J7VR 1UCTA 3UYRH 1HEZB 3MRQB 3O0RH 4N0UB 1YEDA 3GSOA 1JF6A 1TTFA 4U05A 3K2UL 2ADIA 4UMGA 3F7VA 1ND0A 2ADJB 5E2WH 2QQLH 2OZ4A 4LF3B 1D5IH 5ANME 2HFFB 1OY3B 3OGCB 3B43A 1MFBH 2CUMA 4NM8H 3S98A 5JXEA 4Z77B 1OSPH 4JFEE 3OR6A 4UBDC 1UACH 2VLRA 1WICA 3AFLA 3K4DA 3P40A 5TE4H 3SJVB 3TBWB 2NXZB 1CIUA 4NIKB 4PJCF 4BK5A 1C16A 3K81A 4GRWH 1CCZA 3QAZC 4WHYH 3QI9C 2Q76B 5EFIA 4PRPA 4LP4A 4BUHA 1FE8L 3O6ML 1IZJA 2AJVH 3G9AB 4NNPL 3AM8C 3EO0A 3P4NA 4G6JH 1A0QH 3FOLB 2AK1H 1A6UH 1TVBA 1DEDA 3ZYJA 4D3CL 5K9QG 3VFUB 3I9GH 5E00B 2ITCA 2O61B 4XWGH 4U1IA 5E4EC 2MQ0A 4PREB 1QKZL 2YKLH 3TLRA 4WW2C 1I1RA 4HG4K 1X5AA 2B2XH 4UI2A 1ZHNA 1KCSH 3BEVB 3IT8D 2PTUA 1H5BA 2X4NB 2BXZA 3ZT7A 4I77L 1VKXB 3MRRB 1FSKB 3GIZH 4CN6A 2ED8A 3FQXA 4Z7WB 3GBLA 2EYSA 1GL4B 3X3GL 1WITA 3IDGB 3MTRA 1XGQA 4IMKC 4JQIL 2W38A 1ZXQA 3AREA 2FBOJ 1NAMA 3PQYB 4HQQH 1CK0H 3NFNB 2PO6B 5JLZB 4GAGH 1HZHL 5DURB 1F3DJ 3N1MC 1T89C 4J23A 5L7XL 4K94C 2NY1C 1MCLA 3FOMA 5CZXC 5IKCA 3LAFA 1JZ6A 3B9KD 3QUXD 1T2QL 1XF1A 3SDCB 3L3DB 1UM6H 1M7DB 2VSCA 1GH7A 1IM9A 1ZT1A 5FDYA 2EO1A 4GRLD 4KRPB 2W0FB 4DCQA 1UXWB 3G5ZB 5JXAL 4LVOB 4OGXH 4XP5L 4EUPA 1FFPA 3JVGC 1OAUH 1ZWIB 1QFWI 4I9WE 5JW4N 2YZ8A 5M95B 3WEXB 1MJ8H 2E7HA 1A7OL 4YHOL 5EWIH 1QBLL 3UPAA 5BV7L 2NX5A 3V7AG 1W72H 1SHMA 4AMKH 4B5EA 2HH0H 3MRBB 4ODWA