3QUYD

Structure of the mouse cd1d-bnnh-gsl-1'-inkt tcr complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 66
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quyD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quyD02
2CKBH 3QXAB 2RHEA 1RZGA 4PJHF 2MJWA 4UOW1 2ESVE 4MJ4A 4YDJB 3GMNA 5F9AC 1TFHA 4OBRA 2XRAH 1LO5B 2VAAB 3GM0A 3U0WL 4WUKH 5FHAH 2X4SB 1D5ZB 3BIKA 3T3PE 3LS4L 3L1OL 3RKPA 5MI0C 3AREB 1J87A 3B2UD 5DJCA 5IVNA 5H35A 5F1IB 4XX1E 3OHXA 3VFSB 4NZJA 3BP4A 2QSTA 1I1CA 1VFOA 4NWUH 1J5OH 1YY9C 4PJAB 2IAMD 3DMMD 4NQTA 2DLFH 4G43B 1LP9E 4YHKL 3LS4H 1AKJA 5IK3B 1I7RA 1MFCL 4GKSA 2JE8A 4HS8L 3C60C 2Z4QA 3CU7A 3F8UB 1QRNE 5IJVB 3TPUA 2HVKA 1E4KC 1KEGL 3MTRA 3RDTC 1AGEB 4HHAB 4K2UL 4OFDA 2P7TB 2LTQC 3UTPE 1QZ1A 2IH1A 3MCKA 5DGRA 2XQBH 1PVHA 4UQ3B 3RPIB 4G3YL 1CXIA 3DI3B 3S3JA 4PLNC 5I1DB 5BW7C 5IHLB 4W70A 3U79A 1CFNB 4RRPG 3GUTA 3BUYB 1JHTA 3RGVA 5E5MB 3O6FD 4JFDD 3TBVB 5CGMA 3VD9A 4S1RH 2ZWLT 4Y4FD 1NFDB 4JFFD 3QBTB 3WHE0 1H3PL 5JDJA 1FZKA 4IRSC 2HFGL 4JKKA 4R7NA 1OQOA 1YEEL 4RAVA 3GSQA 2FHBA 4JFQB 1N0XL 4P46A 1K9TA 1TJGL 4PRDB 4HPOH 2KUTA 2V17L 4HWBH 1I8LC 5ID0B 1KLUA 3EJZC 3L3DB 5EORH 3VWKC 5FHAL 5KVGL 5KOMC 1FC2D 3QAZC 4I3SL 5HI3D 5C8JB 2O5YL 2J5LB 15C8H 3DVFA 3OKLA 3WJJA 4ETQB 2AK4E 5IESH 3ZKMD 2XKSA 2FGWL 4HUVB 1MPAH 4UTAL 3MCG1 3SKNA 3VI4F 1I3RA 5IFHH 3DLQR 3LQZB 4DK3A 3PWJB 4RAUB 2XTJD 3NA9L 3QH3B 1HNGA 3G6JF 4P4RB 5KSVB 5AD0A 1C5BL 3C5ZC 3CFCH 3U9UA 1WTLA 5GRVL 5E8NB 1A5FH 1WBXA 1I8KB 3MLXL 1J12A 2MMXA 4YHMH 1NMBH 1KUMA 2ICEB 3VGDA 4DWHA 5DMJB 4BSVA 3Q1SL 2W0FA 1U3JA 2AV7B 5T33H 5IBLD 4XCEA 1FJ1B 4NQCA 3VRIB 4YFEA 4O4YH 4NNPL 1A3RH 5CBAA 3CSYA 3ROOB 3QEUB 3HNSH 3J8F7 3O8XC 4ZFZB 4UIMA 5BRZA 3RA7L 5JTWA 1WFOA 5JNYA 1MFNA 1HHGA 5JXED 1ZWIB 3TT3H 4OLYH 1CFQB 3ALWA 3KHQA 2J8UF 5C86A 2NW3B 1QTYT 4DVBA 1JPTL 2G9HB 4LFHG 2EKSB 5INDB 4XC1L 2HN7B 3N9GL 3MXVL 2ITDA 5J1AA 1XCQB 3SPVA 1FDLL 4EI5A 4YEFA 1RUAL 4GH7B 5FM4A 2EIZB 2Y72A 5EB9A 4HS6A 4XXCA 2DWDB 3FB5A 5B38G 3PQYA 4DFHA 3UTTD 3ETBF 3DIFA 3UAJC 4CMHB 1LO4H 4P3DA 3LIZL 4F57L 2NY2D 3SDCA 5HYQA 1L9NA 3LN4B 3P4MB 4Y89A 3ILQD 4WI7A 5HI4C 4HK3N 4M5ZH 2KDGA 3A67H 4I0CC 2OJZH 4G8GB 4HT1L 2DLTA 4O2EA 5IIEA 5E4EB 1ZT4A 4NIKB 1ZOXA 1IT9L 3K4DA 3KLAA 3TIEA 5I71C 1C12A 3LEVL 5IEKB 3OR6A 5I1CL 4HS6B 4EVNA 3BT2H 3PDOB 1F3JB 4NJ9H 5ANME 2X4TA 1FLRL 1KCUL 2BVYA 4MCYA 2VNCA 3PP4L 3S3PA 2YSSB 2MQCA 1KPRB 2VLRD 1AQDA 1IAOA 2YD4A 5ERWB 1EEZB 4KZEH 1ORSB 1MREH 3T65B 2ADIB 3ZSTA 4DW2L 1HH6B 5CAYB 3QDAA 2W9DH 4MNGE 5HSFA 1I1AC 1A9BA 3FJTA 3S98A 1KJMA 1DBMH 2QADD 4KMQA 1Y0LB 4ZFGL 1L7IH 3MBXL 5ITBL 1WC7A 1QQDB 2C3GA 2IPUG 2JKXA 4BELD 3PWPA 3O6KH 2JTDA 4RRPA 4R4FL 1FVEB 1KC5H 5EOQL 4J3VA 5JIKA 4Q7DA 1WZ1L 2C1OA 2X1QA 4P4KC 4R26H 3SCMB 2WBJC 5D93C 1Q9LB 4UDUB 4FRWA 5D7LD 1WAAA 1HCFX 4PRIA 3SE9L 4F7CB 5DJXA 4BM7A 4O02L 3DURB 2EO1A 3N06B 1KJ2B 5B3JF 5HHVH 1ODAA 3VXOA 3P4MA 1ND0A 5T3XD 3WIHH 1ZLUK 1ZHLA 2GTWA 4U1KA 2X10A 5E99H 1Q1JL 4NQSA 1F00I 5HDOA 4PRHB 4TTGA 1U8HB 1XH3A 5HGGS 1QKZL 4RIRB 2C9AA 4OLWH 5HHOA 2CK0L 4QXGL 1X3DA 1A6AA 1K4CB 4NFCA 1ZT7A 2IPKA 4NRZB 2E7BA 1I9JH 4YDLB 2A6DB 1NPUA 5DQJB 3LH2L 3TBTA 1KLGA 1UH2A 3QYCA 5D72H 2CUHA 3VFPA 4CN4A 4YUEL 1KIRA 3V52H 5E7BA 2QQNL 3KGRA 4AIXA 4K7PY 2VDKH 4MNGA 2R69H 2R0LL 5EOTB 1P2CA 5EC2B 1Q1JH 3L3HB 3PQYE 4BK4A 1IGTA 1JUFA 1EERB 3V0AC 3O3DB 3ET9F 4C56A 3MRDA 3QFJB 5C70A 5IKCA 2A6KA 5B3NA 1A6UL 1T5WA 4XTRD 2Q76B 3BQUD 2F58H 3L3OA 5HDBF 2YD6A 3NFNB 2VDPL 2NY4D 1NGXB 1ZVYA 3MRCA 4AIOA 3UBXA 1OP3K 4XB7A 1JNHA 4G9FE 2DLHA 3QPXL 4NO0A 2P5WA 3FB7B 3EZJB 5CZVL 1LILA 2VUYA 3B2VL 3PWJA 4RAUA 1RFDH 3ZT6A 1FV1B 5ESQA 4Y4KA 5D7JB 3O9WA 3SE8H 3F58L 4HUVA 4HH9B 3ARFB 4Y2DD 3CFBB 4QXUH 5E8NA 5E24E 2MCPL 1LK2B 1EHXA 4J8RB 5IMMB 3BGFB 3QJFB 4Q6IB 5E00B 4NN5B 1QUNA 2J8UA 5FIEA 4P48A 3PDOA 1FL3A 1K5NB 1XMWA 4YDJA 1HNFA 3GSNL 25C8L 4HWBA 5GHWL 4YGAB 1ROWA 2VDLH 2ADGB 2VN4A 1BIHA 1PY9A 5DD0L 3BEWB 1NGPH 4KGJA 5A1AA 4H25B 5EU5A 3WDIA 3B3IB 3FQTB 3IGAA 4QNPF 4OSUH 4KMLB 4M4PA 4NQEB 5EC1B 2BVQA 3VRJA 1JRHL 3WNLA 3AS1A 4WFHD 3SDCB 5HYQB 1RZGB 5GS3A 1YYLL 3VXRE 4XNMB 4NZUL 4L9LA 4YDKL 3ZDYE 3KS0J 4AM0A 4F9PC 3SKMA 4I2XA 2VXQL 2ITCA 3FKUS 1D3CA 3CUPB 2CJUH 4I48B 2W92A 3RIAF 2R8SH 3K1KC 4HMCA 5TGBB 2J88L 4GMTH 4XAKD 2HN7A 5ICZB 1AHWB 2EH8H 2FB4L 1JMXA 5EZOH 2FJHB 2EDYA 3GIZL 3QIBA 4OLWL 2D2OA 1FNGB 1JHTB 4XVJH 2L4OA 3NAAL 4CMMB 1DFBH 2BJML 4H26B 1DBBH 1WBYA 4LCCB 3MXVH 4YJZL 4IOSD 1UXWB 1EUTA 3ULVC 4R2GD 1D5IH 1TVHB 4KUCD 4R3SA 1ES0B 4XT1C 4HWEH 4DQOL 3OXRA 4FQXB 2Z8RA 4P5MB 1G1CA 4WU5A 1RJLB 4P2RB 3RIFK 2QQLL 1AI1H 2Z8WC 2ZOLB 2X41A 1IGJA 2VDNH 3ZE0E 1NFIB 2P8LA 1JK8A 3T4YA 1F4WL 2OTUA 4AEHL 2NY2C 4Q2ZB 1WAAF 4XPFH 4CADA 3BDYL 1PW3A 3FQTA 4L8DA 5CD5D 3WD5L 4U7SA 3FHQA 1JGLH 2UWEA 2KQNA 2VE6B 5DRNA 3BZDA 5D96C 4U6YA 1I1YA 3QQ4A 4E42B 2XFXA 3RNQA 5E8DL 3U9PH 3SE4C 4MXWL 4KZEL 4ZNCD 4TVPE 1CVSC 2VLKD 4WWKB 1N6QL 4OZIE 2DKSA 2R2HB 3QQ3A 3CFEB 1MJ7L 5EPMA 5L8JB 5D1XC 2EKJA 3BMWA 3CMGA 5DJYB 5GRVK 4MGXA 3UXFA 4NFBA 4U1HA 3MOAL 4K8RD 4L4VB 1RJCA 3U36B 3QIBD 4EUPB 3ULSB 1R5IA 3B3IA 5JHDE 5A40E 1W72H 2VDQL 2BZDA 3DVNB 2PF6A 3KPLB 1JHKH 5FA4B 3VXSB 5CJXA 3VXRD 2GITB 4XHJD 3O8XA 4WI4A 3TYFA 4I18A 4HKBA 1FVDA 5HTSA 5MEND 3IDYB 25C8H 2N7AA 5F3HB 2CMRL 3LZFH 1DLFH 4KKLC 3CAFA 3I3DA 3QFJA 4RGMB 5IKCB 4KUZL 4RGNB 3KYNB 5F9DC 4YR6A 3OMZA 4YQXL 1FE8H 3H3KA 1OB1A 1T20B 4H20L 5FUZH 3O6MH 4S10A 3BGFC 4LPWA 5EU5B 2FIKB 1FRGH 4ERSH 4JO4L 5DSCA 5KSBE 3BD5A 4BSJA 3QHZL 1F4XH 5C0BE 5A2IH 4JFXA 4NDMA 2CKNA 3LN5B 1OAKH 3E3QE 4ALAH 1RJZB 4F80A 5AUMB 1FL5B 5J11B 4QRUA 1JFQH 4PD4J 4X6FB 1FZMA 3X3GH 2GCYA 2BVTA 5C09D 1JTOA 1FNLA 1CT8B 4Q6IA 3MLYH 1T7XA 5LBSL 1U8PA 4CRPA 4M7LT 4DKFH 3Q1SH 3WJJC 3O9WD 5C0FA 2I25N 4L4TE 3DI2B 1N0LA 4GRWE 4LU5L 1NGQH 3ARDC 3O6ML 2O61A 1U8IB 5JW5A 3B9KC 1KBGL 1CDGA 4L3CB 4GQPH 2R2EB 3CFKA 5GGUB 2X09A 4HIIB 1DQQA 3OJVC 5EIVA 3QDJE 3B83A 4UINH 1DTUA 1J1PL 1MHEB 4WJ5A 4E0RB 1IGYA 3QWRA 3WNKA 4YZFF 1N2RB 2EZ0C 3MNVA 2Q8AH 1QP1A 2P8PB 2V9RA 1T04A 1K4CA 4KK9D 5L2JA 2R23B 3QCTH 5CEYB 4CU8A 3U2SA 2XKNB 2W60A 4JFED 1B0RA 2Q86B 1E4XH 3OKKA 3RUGE 3QWOA 3C60A 2B2XL 1P5VA 3MV7A 1BHGA 2XI9A 1B0GA 5ADPH 4OZFG 5SX5K 3ULUD 1XR8B 4HW6A 1QA9A 3LH2H 2F53B 4Y4KC 4D0BA 1NBZA 3GIVA 2XTJC 1HXMB 2J5LC 4Z7VF 2LE9A 3EFDL 4J3WA 4YXKL 2Q8AL 5HHPB 4BZ1L 3UYPA 4NOBA 3DPBA 4PRIB 1F11B 1FGNL 1WT5C 2R0ZH 1NCAH 2YEZB 2XWBB 3TJEH 3H9SD 1ZE3C 3TBWA 3HPLB 3W5NA 3FB6B 5I8KL 1J05B 1LEIA 4AM0B 2H6PA 4PP1C 4TPRL 4AEFA 3VGAC 3MLPA 4UB0H 5FO9B 1KCSH 4WO4B 1PG7W 2EYRA 3TCLB 4M6OH 5FYLL 2JCCA 2W59A 1BJ1J 2NY6C 4HCRL 3O2VL 4YNYB 4ZPVA 3ESVF 3SDCC 1BFVL 3TZVD 4D3CL 1LE5A 3P77B 4QT5B 1LO3L 4NNYB 3V5DB 1KJ2A 4ODXB 4PIRF 3D0LA 5ALCH 2P5WE 2CPCA 1P9MA 3F12A 4M93B 2H26B 3WFHA 3C6LB 4XPTH 2JJVA 4WU7B 3SQOH 4AH2A 1P1ZA 1D5IL 5CGYC 4EI5C 1NCWH 4PJEE 3WHXA 4Y2DA 1GXEA 5LAXB 1BAFH 3C08L 1I7TB 3PV7A 3WDHA 2NW3A 3TYGL 5KG9B 5DD1H 5GGQL 2D7TH 3FFCB 3NH7H 5DYOA 1K85A 2VWEE 3SJVD 4I1NB 2X4QB 4NPYB 4NO5B 4M5ZL 1SVCP 4EOWH 4QTIL 3L5XH 3QXDB 1JWMB 5JXAH 1KPRA 3MV8B 3D3VE 4QHLB 4MNQB 1IZJA 4L8SC 1D9KD 5A3ID 1MFAL 3TBWB 4HX1A 1MHHB 5CMAA 4ZMAT 4E41B 4C58B 1RJYB 3IVKB 1DUYA 1QR4A 1YQ2A 1OP3H 4FXKA 3WN5A 4JFOB 4NQUA 4Y4HB 5F7LB 3DOSA 1TTGA 5FUOH 4PJIE 2XZQH 1VGKA 3S6CA 3RJQB 4X8JA 4L9DA 1EFXD 2WLZA 3VI3F 2QSQA 1HINH 2A9MH 3IFOA 1X4YA 4LSDA 4X98B 2F5BL 1OSPL 5HHOD 3VFWB 2AJVH 1KN4L 4YHPB 5H2BB 2DKMA 4QRRB 4QYOA 5EOQH 4H1LB 5F21B 1D6VH 4JN2B 1I8KA 4GUPA 4PJ8B 2VLJE 1AXSA 3WLWC 2J2ZA 1IGML 2JELL 1SEQH 3OKEA 3RDTB 4H0IA 2D4DA 2GSGB 3CFCL 2H32B 2AJVL 4MNHA 4LCUA 2YBRB 4KROD 3ARGB 4JG1H 4NQCD 3FL7A 5F1NB 1YYML 5IVOA 3X14B 1KSRA 3HI5H 2I60L 5EZIH 2P1YA 2PW2B 2EEAA 3GK8H 4L1HA 1MHCA 4MAUL 12E8H 4XNXL 5BS0E 2FIKA 2YD2A 3AS3A 3LVEA 1EIBA 1EV2E 3PWPE 2JK5A 4NKMA 4WW1B 4LLUA 2PXYC 2DRUA 3U7AA 3RDTA 2E7LC 2BNRD 1MRCH 1E4KA 4LCIL 1SJEA 1PEWA 5GS1A 2X4NB 3ZE1E 4JFQA 3UJIH 2A9NH 1NCTA 3HMWL 4RBPK 3E2HC 4DZBB 2VL4A 3U0PB 4UTAH 3RY5A 5DUPH 1B6UA 1YPZA 3IU4H 1S7RA 5J1SC 2N7BA 3LKOA 2MCG1 1CD1B 3RUGB 4BJLA 3TO4C 2YUVA 1EO7A 3WJLA 2R4SH 5K9KB 1KCRL 5EBGA 4FXLA 4ETQA 2NXZB 3RGVB 3QB7C 1A0QH 2VITA 4R97C 3F7VA 5GRXG 4V2BA 1PKQA 3UROR 4YR6B 5FB8A 4XMLL 2BNRE 1YMHB 3QEHA 4OF8A 2DS4A 4NSKB 4JFFA 2R23A 4K07A 1X7QA 1H0DB 5IJVA 3WN5C 4FNLH 2Q7YB 2ESVB 4GRWB 4N8VG 2CRZA 4TPRH 1LE9B 4UDTB 4ZSOB 2JF1A 3U36A 2C3WA 4WCYH 5I66A 1JZ8A 3GMQB 4M1CD 1HILA 2ZCKL 2FYYA 1T21A 4L8DB 1DQQB 1WAAE 4PRIE 5GRWA 1MCNA 3LDBB 4NZRL 1L6ZA 1CR9L 4NC2B 5TE7L 3K2MC 1CE6B 2AXGA 3C8HA 4HKZB 2F53E 1BQHA 4DGVL 3CGTA 4NO2A 4UNTA 4OD2B 4WWKC 2AAVA 1SBBA 3DYOA 1KTDA 5EZLA 1OF2B 4MQXC 5I9QC 1Z2KA 1FYTE 5TF0A 3PJSA 4P4KA 4QRTB 2XN9D 4NJAH 5EUOF 2A74A 3D2UB 3T04D 1JPFB 4FA8A 2Q3AA 4D9QE 2UZIL 1FJ1A 2WUBL 4AQ1B 3RWHA 5J9PB 3JTSA 1WBYB 5IP4A 4H26A 1A14H 4FQIH 3T0EC 1MCKA 5I18L 3QDJA 3MBED 5BOZG 3KPPA 4OM1H 1D5BA 3AB0C 3KNBB 2ZSWA 4U2ZA 3ROLB 2EC9T 3MLSL 1W72A 3EDKA 3HZVA 1A6PA 2D3VA 3G5XB 3JTTA 1P4LA 3F62A 3RI5K 2D4FA 1QRNB 5J06A 4WU5B 4CN1A 3VDCA 2MPAH 4WGVB 4LSUH 1DEEB 3EZ8A 3HE7D 4HXAL 2HLFD 3SDYL 1DQMH 4LLMA 1UH3A 3G5ZA 1UJ3A 2HT4C 3C9NB 4D0CA 3GSNB 4XAWL 5C0IB 3SDAD 1N59A 5HPMA 4YX2H 3OXSB 4OQTL 4U6XA 3D9AL 4J3OC 4WHYG 1NGQL 3NVQA 1YNTB 2IALB 3V0WL 4R4FH 2BCKA 2XWJB 3MRFA 1MJ8H 4MAYB 5T1DL 4GRMA 2QQKL 1PKQB 2VMFA 2ZUXA 3CVIH 4OAWA 3H8NA 5HHMD 5F6IC 3BOVA 4XHQA 3G5YB 4FTVA 2R0KH 1G7IA 5LWYH 1XT5A 2FBJL 5D8JH 3B5GA 5FCSH 1EDQA 1I1RA 1UJ3B 2ATKB 1IC4H 5D70L 4HWEL 5JW3L 2IBZY 4HFWA 3QG6B 1S9YB 1R5WB 2PXYA 5D7IE 3U6RA 1QSVA 1FO0B 2XWTB 2I07A 4PJDB 3ZKNC 3MJGX 1FV1A 1WWCA 2VLLA 1V7MH 4Q58C 3WSQH 4Q2ZA 5IQ9B 5J3HC 5B8CB 2BERA 1BWMA 4AIZB 1XAUA 4ONFH 4J8RA 5TFSL 2E6JA 3KNBA 3T09A 1R3HB 1T2QH 2G5RA 2OK0H 2HRPH 3O4LB 5FKPA 2YWZA 2VUOA 3DYPA 4KKAD 1ULVA 1I3GH 3I3EA 3MFFB 4PJEA 5F1OB 2A6KB 2CR3A 3STLB 4MCZA 3E6FB 1HKFA 1CIUA 2VXQH 4BQ6A 4KI1A 2VDQH 3REWB 1A8JH 1YMMD 4NQDB 4EZMA 1JHLH 2VLJB 1NCDL 4QTIH 4S1DD 2A74B 3UTZB 3VXUE 5IVXB 3BD3A 1JNHB 4LLQA 2YBRA 1CD1A 4TSAL 1GCFA 1VGEL 2QSVA 3SGDI 3NCFB 5DR5H 5F9WC 4U0QB 4DAGH 1AXTH 3HC3L 1NMCB 2EH7H 5L2KA 2VYRE 2EDKA 4TOYH 1JF1B 2LAAA 1MHPH 3SKUD 4BH7A 3R0NA 1GAFH 4AL8H 2AJXL 1G6RH 1XFPA 3QCVH 5HYJB 4NQEE 1A6TB 5M94B 4K7FA 1MCHA 4U4BA 4N1HB 3GMRB 4AIZA 3DETD 2FX7H 4HKXB 1JGEB 4JPKL 1PG7L 3HMXA 4IRZH 2QQLH 1T5WB 5TQ2L 3U0TA 4QLRA 1N8ZB 4XNYL 1TVDA 5I66B 1S9YA 4X4MA 2GSIA 3QNZA 3SDXE 3VWJB 3CVIL 4EN3C 3BZEB 3QEGH 3W2DL 5L8KB 1CS6A 4KDWA 4C56D 4L8SA 2NY5L 3LPFA 2Z92A 3D39B 3MBEA 2H32A 3KJ4C 2ZSVA 3DURA 3QPQC 2D0FA 2YPKB 4JQVC 5MEQA 2GFBA 3RWDA 1SJXA 1X5AA 3FQRB 3L5JA 5CSGA 5IUSA 2IPUK 3T0WA 2VITB 3S36L 1FVEA 2VZVA 4OD1H 2H1PH 3UJJH 2FB4H 1QSZA 4KVCH 4RWHA 4X0KB 1A1NB 1T1YA 4K55A 2EDQA 3REVB 3AB0B 2OR9H 5C0NC 2ADFL 4FQHA 4Y5XA 3GMLA 4MWFB 4Z76B 4NO5A 1P84J 1T0NA 3HB3C 1K8DB 1UWXK 3D69B 3S36X 2OZ4H 1UACH 4F7EB 2D7QA 4PREA 4JPVH 4ODWA 1QBLH 1AQDB 1IAOB 2CLZB 1NFDF 2PN5A 1ZANH 5ADOL 5HHXH 2F5BH 5FF6B 4S2SA 5E6YA 3VJ6B 4XMPL 2AEWA 3GI9L 4EVNB 3BH8B 1I7ZB 3GGWA 1Y18A 5IBTH 3CH1B 5DO2D 2OR8A 1FNHA 2L0DA 4YHPA 1QBML 5KTEH 1AO7D 4O2EB 5EU6D 1EHNA 3UJTL 1GAFL 1IQWH 4DFIA 2FZ3A 4E5XA 1NL0L 4HC1H 4M8QA 4Y5YA 4UOJA 5I8OH 3TA3A 4D9LH 1JZ2A 3QXDA 2IFGA 3S37L 3JWOC 3FT3A 4TYUA 3ZE0F 3GNML 3UPCA 4NC1E 5CJOL 3MUY1 3VMPA 1IM3B 4CMMA 3DX9B 2V2TA 5I17B 4OTXL 3KPRE 4JB9H 5CIPH 3RWFB 2B20A 1BEYL 2GK0A 2GJZB 3PGCA 5H94B 4RA3A 4Y4KD 3BPNB 2EIZA 1XGPB 1Q72H 4LF3B 4X7TA 3IVKA 3X3GL 2RCSH 1CE6A 3HMXL 2J7LA 3QRFM 4U1NA 3GSWA 4WWID 3LN4A 4XCYB 4PGDA 2HH0H 2VN7A 3S88H 4WFEE 1LK3H 3VD5A 2Z93B 2HJFA 1OSZA 2MSPA 4DKDC 2DM4A 3T0EB 4YHYC 2F54B 5KVFH 1XF4A 4QRPB 1YEIL 3HKFA 2A83B 3T0EE 1T1XA 1PJ9A 3ZYIA 1PX4A 5E6IB 4KDTC 4QRSA 2ZCHL 2G2RA 3N85H 1YEDA 2DJUA 2D7MA 4OM0H 3CFDB 3X12B 3W9DA 4G9FB 5KSAD 1ZLUH 4K94C 1T1WA 1CDUA 3DV4A 3QI9A 5F1SA 1GOGA 5EO9A 3WXWL 1BZQK 1ZWIA 4YUEH 4ZAKC 1QHOA 1RK0B 3UYOD 4NUJB 3DMMC 4PRPD 1YEIH 5T1LB 2DYPB 1J8HD 2J8UB 4JVPA 4MQ7A 4K71C 3SKOA 4MXVF 3T77A 5B22A 4NQCE 4PTTB 1LK2A 3NACL 2E9WA 1MJ8L 4XXDA 1B90A 3DHJA 1A9BB 1WFTA 2QQNH 1DQJA 4KPHL 4ELKB 3VFNA 2YD8A 1PKQE 3LRSB 4UILL 5DD6A 4C83A 2VABB 1HSBB 1E0OB 1F90H 2CIKA 4HF5H 2XZAH 4HG4K 2X1WL 5KSUB 1HHHA 1TLKA 4PJ5B 2X4OA 4JGMA 1X44A 3BP7B 3Q3GA 5F88B 4MQ7B 2XPGA 1AGFB 1IFHH 3EOYG 3JWDL 5DMYA 1JIBA 3I75B 1PEZA 4OCWL 5K93A 4OT1H 3B8YA 2VKXA 5CINH 3C6LA 4TN9A 2Y07L 1KIQA 2YPVH 5JIPA 4GAFB 4NT6B 4ODHH 5AD0B 5TH2B 1UEYA 3HG1B 1FZKB 1E6JH 3VXPA 4JY4B 4WDIB 5KSAA 1B88A 3ARGA 3KPSD 2B1HH 1M7XA 1T20A 4R0LC 5IB3B 2BDNH 3RAJL 3HNSL 4OKDA 4NQXB 5EWIH 3KPOA 1B0GB 1OSZB 2A9NL 2OL3L 1OAUL 3ULUL 1MEXH 3GSOB 2ADJB 3ULVF 2F19L 1X5IA 5IG7A 2IPKB 3IJHA 3HPLA 4HKXA 3VXNB 3MO1A 5DRXB 2DQCL 3OPZL 3QA3A 4M03A 4Z7UB 2Q1EA 4PJFF 4RMWA 4NKDA 5ANMA 4X99A 1JGVL 1GGBL 1Z9LA 3D18A 4XWGL 2A1WH 3MNZA 1CFQA 4X7SH 4PLOB 4RAVB 1FVCA 4IM8A 3B9KB 4PB0L 1I1FA 1INEL 1U58B 4JY4A 3MLVH 4GMTL 3MLWH 3QWOB 1HI6A 5HHQB 1IC5H 3CFIC 4Y4HC 4FQ2H 3VXTA 2WP3T 5BJTA 4XPAL 1A2YA 2WWMD 2CJUL 2PYEB 3WUWG 2YKLL 1P4BL 4G6JL 4ZDHA 4OFPA 5F9OH 4QWWD 5ACLA 2Y23A 4FQCH 3S97C 5D1QB 2BSSB 1VEPA 2VH5L 5FF6A 4S2SB 4HT1H 3TZVA 3OTTA 3BIKB 4XI5D 4POZD 1QQDA 2M26A 4PJAA 4EI5D 1A6WH 5DD0H 4D9QD 1CDYA 3JWDH 5L6YH 3MGTA 3EYOB 5GGVY 2A9ML 3VGFA 4L29B 1HHIA 4Y5XB 2GJ6E 5C0FB 1FNSL 3LKPB 1MHPL 2YKLH 3QQ9C 4XPAH 4PS4L 4GKOA 7FABL 2OP4H 4JO2L 1QBBA 4PG2A 1MFBH 3BGMA 2VXUL 3QIBC 3MYJA 4QXUL 3F5WA 3IAPA 2VH5H 3O2VH 2QJDA 5J56B 4OGAC 3KPMA 2V7HB 3D87B 4IRJD 3MV9D 1T83A 2HKHH 5D1XD 4JFPB 5DEFA 2Y5TB 4KJYB 2IQAB 1CLYH 2A6JB 1LDPL 3HE6D 4XBPB 1A5FL 1GGBH 1ZHKA 4L8SB 4F3FA 2RR3A 4X4YA 4CN6A 3T0VA 3WDJA 5L9DH 4P2CG 3BESR 1QFWM 1PLGH 1EA9C 5EO0A 3HI5L 1FGNH 4ZTOL 2XA8L 5E8DH 3MZGB 1R3LA 1VB9A 1GGCH 4HIJB 2WINA 2R0KL 1JPSL 5JHLL 1OAZH 3DSFL 1A47A 2CDEB 2XWBA 5FGSA 3QEQB 2VO5A 1PDKA 4M1CC 2QQKH 3MV9E 1I9RH 5J6GB 2ZSWB 3RVXC 5CP3A 4OF0A 5FCUH 3AROA 4H0GA 4LMQE 1L9MA 1I9EA 3D9AH 4CVWA 5GSVB 2EYSB 3FN0L 1E28B 1I7UA 1KG0A 1UB6A 1Q0YL 2BNQB 5DEFB 3QIUD 4IOFC 5CFHA 5TQ2H 1PAMA 4KTDH 2EDNA 1I9JL 2OTUB 4XMKL 2NQCA 4HXAH 2I5YL 2C3VB 3JUZA 4JY6A 2DTSA 4XBEH 1CGUA 1WIOA 3ZO0A 1FNEB 1JZ6A 3FZUC 5C92A 5SWSA 2J8UE 1DE4B 1ORQA 3W9EA 5L6YL 1WF5A 1NANH 2WSKA 1UM6H 4GT7A 4RDQF 4CVZA 2P24B 4Y1AD 4N9GB 4F8TA 1CXEA 1QBMH 5KTEL 3A6BL 1IFHL 5BZDA 1AGCB 3P73B 2M2DA 5CWSB 4I77L 3NACH 4PJFB 4Q9QH 2GAZB 1FFQA 2A38A 1T6WA 5K9JH 3ARSA 3HC0B 2F54E 2X4PA 5D2NB 3RL2A 4P0DA 5D96B 2D7NA 1R5WA 2PXYB 1U8LB 1A6VH 4N8CH 5K9OB 4OCRH 3O4OC 4JKLA 2HG5B 1YYLH 1U3HB 4KY1L 5C2UB 4ZAKD 5DD1L 3FOMA 3DBXA 3M8OH 1OGAB 4F7MB 5FB8B 2QHRH 2ILLA 4U1GC 43CAA 3QIUA 3IDNB 4IHOA 4JJHA 2AJUL 5AUMA 3ES6B 4GRMB 1QSFA 4Y19B 3FOLB 4HUMB 4JFYA 4NN7B 4LIQL 3EFFA 4YE4L 2Z35A 3LZFL 2I27N 5J7CC 4TRPH 3O0RL 2VLKA 4AZ8A 1AHWA 1BX2A 4TSCL 2AJUH 5L0QB 3F7QA 4PY8J 3BT2L 4U05A 4XNZB 1HWHB 3ECBB 3KWWB 4MDIB 4QOKE 1S7WB 4M48L 3IB4A 3RWGA 4PJXA 3HE7A 2APBA 1OT2A 3AC0A 2EDLA 3QUXC 2PTTB 3QDGA 3IT8D 1IL1A 4POZC 4MS8C 3ZHKA 1YNLH 2DMKA 2EE6A 3NCYS 3LEYL 3JV6B 3OBAA 4XBPA 5BRZE 3V2AR 1ZHKB 5D6CB 3ARED 3QDJD 4JFYB 3S34L 2V5SA 4BZ1H 2GTZA 5DA4A 2YPLB 4AL8L 4NFDA 4XWOC 4TTDC 3OAYK 2EDXA 4KHTH 2AK4D 1OP9A 2IBZX 4M1GL 4P2YA 3WFBL 1DLFL 3IFNL 4TVPH 2VIRA 1S9XA 4ZUUA 1H3XA 1DBAH 2B1AH 1BD2D 4JPIB 5CEZD 3NPZB 4XBEL 1E4XL 1GRWA 1PKOA 3V6FB 4U6YB 5E2WH 4JO1H 5CJXC 1QOKA 4QYOB 2QL1A 3O81A 5BS0B 3MGTB 2E8YA 3OG6B 1LP9A 5MEOA 2E27H 2WQRA 4NWTH 4ZO7A 3SGJC 2QLVB 1DL7H 5IROC 2PYEE 2PKDA 2NXYC 3EHBD 1I1AD 3SKOB 5FOBA 1I9RL 4LCWB 3HFMH 2MHAB 3IS1X 1JJUA 3NFNA 4KV5F 1X5YA 5D1QC 5JQ6H 5BVJA 1CFVL 1HIML 2I9LA 2R1XB 3CIQA 1C12B 3O6FB 1X5XA 4JFDB 1YY8B 4XRCB 1AGBA 4KI5D 3G6AB 4Y4FB 4P9HH 1K4DA 2OR7A 1ETZA 1A2YB 3MFGB 1DBBL 5EZJB 2DQCH 1CBVL 3ALXA 2Y4SA 4X5XB 3Q6FA 4LBEB 2XZCH 4POUB 4ZO9A 1CF8L 1UFUA 1EJOL 1WZKA 4QTHA 3IDMA 1KTKE 4PJEF 3I3BA 1UB6B 4MA7H 2IAMC 4ELME 1UWEH 1DP0A 5TDOB 3AVEA 1NCCL 1KN2L 2JCCF 2PYFB 3MRRB 3AUVA 2WK2A 3VXUB 2C5DC 3MRKB 4GW1B 4UQ2A 5B39G 1H8NA 5KVGH 5IB5A 3W2DH 4PTUA 3MYZA 3PHOB 1WIPA 5KJRH 1DBML 1KB9K 1VFBA 2X4TB 1MFDH 4N0FA 4TOYL 3UAJD 5IG7B 2X1PA 5L2KE 5CEXA 1XIWC 4LLVB 4KI5E 4PS4H 3WFEL 4HC1L 4GQ9L 1UZ6E 3EOAA 5EU6E 3KPOB 2ZG3A 2FX7L 2APFA 3CLEH 4TNVK 5KN5A 4GAGH 1WBZA 1KJMB 3IETA 4ZFZA 4NQEA 4Z7OF 1O7VA 2NY0C 1NAML 2FRGP 3QCVL 2AEQH 5IHZB 1IAIM 3GSRA 4G6AC 1UWEL 3FFCA 4PJXE 3FO1A 3O45A 4ONGL 3OJDA 4OF7A 4KI5C 2OQJA 5I18H 3VA6A 2BVOA 4L5FL 3DV6A 1URLA 3ZL4L 3MOAH 1RURH 3JWOL 5E00A 2WIMA 5TE4L 4X7SL 3ZKQD 5GGVL 1R3JB 4ZUTA 1NDGB 5E2TH 3GBLA 1C8PA 3VWKD 3WIHA 4XVUC 12E8L 4XNXH 3VWKA 1GC1L 3BZFB 3HAEB 4QRRA 4KAQL 3MQIA 1I85C 4GBXD 5DTFA 1Q9WB 4XPHH 3SKNB 2EDRA 1BOGB 4P46C 5JDSB 1N4XL 1VFMA 1OW0A 4MJ5A 1KPVA 3GMQA 3JSSA 4MA8H 1I1FB 1QFWH 5HD8D 1UWGH 5DJ6B 2HH0L 3K2UH 4RGOL 2Y1VA 5MEQB 3TH4T 2PYEA 2ZZUT 5I8CA 2XRAL 1MEXL 4ORGA 4JG0L 2O5XH 3CFDA 1H3WM 4C54A 1C5CL 1IKNA 5DDHB 5I1AB 1A1MA 5C0CE 5E6ZA 5ITFB 3SDYH 3ARBA 3RAJH 1RUMH 2XNAA 4WW2C 1IAIL 1UYWH 3TF7C 2XQYK 4HG4J 4DGIH 2VR9A 3SGKC 4IIQC 2EDBA 3KVQA 2RIKA 5CGTA 3RWIB 1JI2A 2EDJA 1U3ZA 4OFIA 4MD4B 5A2JH 4HKJB 5JZ7D 2VLRB 4UQ3A 2M1KA 2Y6SC 4RSVA 1YC8A 2VDPH 4H8WC 5INDA 1KCRH 5JW4N 1T89A 5EU3B 5IHUH 5LG1A 2FO4A 3NCCB 3RWJB 3K81A 5HGAA 3MPCA 3K46A 5L2KB 3QULA 3MR9A 5E94B 3WL9B 1DUZA 4KC3B 4PRBB 4UILH 4HIIA 4DUWA 4MJ2A 2X05A 1ND0B 5MHSE 5IK3A 4ZFOL 1YUHB 3C5SA 4LCIH 3AS0A 2GQHA 4WHTA 4L8BA 3V52L 1DQDL 1KEML 2OZ4L 5E5MA 2EC8A 2NY1B 1KTLB 4ONFL 4F7CA 4OZIF 4H8WL 3IKKA 4I2XE 1WTGT 5D6CA 3S7GA 1CWVA 2JCCE 2VDOL 4B50A 4P2OC 4Y2OA 5DK3A 2IJ0C 1BVZA 5I15L 5I1KL 2JCCB 1FH5H 3GK8L 4MAUH 2GUOB 3LKSB 3KYNA 1H3PH 5H37H 3MR9B 5E94A 5BXFA 5GS2H 1FL5A 3WIIL 4UMGA 4AT6A 5E2JA 1FN4B 2AJYL 5BCAA 1DN0B 4M43H 5EU3A 2F8VA 1FAIL 4ZO6A 3N85L 3L3JA 1IGCH 5E99L 5GS0H 4ZUVB 5ECJE 4F7EA 1M6OA 1BD2A 2VZ3A 5EA0L 5IFAL 5EBLB 3P4OA 2NX5D 4KQ3H 2AK1H 1RHHB 5GZNC 4XP9L 5DJZA 3WFCH 1F5WA 1ZS8B 4XP4L 4WHYH 4N9OB 1OTTC 4OLVL 3QHFL 3QUKB 1T89C 3OV6A 1U6AL 1Z0NA 5DA0B 3HLAA 4LLWA 4TSCH 1G84A 3MREB 4XP6L 2NY0B 1FVDB 4WCYL 5HHOE 2LFGA 3G6JE 1TVBA 5B4MD 1PG7H 1QYGL 5D93B 5EO9B 5BRZD 2KKQA 1R3JA 1TCRA 5F7EH 1MFEH 4EBQH 1TZHB 4PJCF 3BKYL 3A6CH 1XIWB 3C6SA 5L2JB 5EUKA 1YEFH 2E6PA 3HUJB 5DQDH 4E42A 3WFEH 2FWOA 1G0XA 3RVUC 1G6RA 4JZOA 4LSTH 1EVUA 3MRRA 5IB2A 2V5YA 3RQ3A 3G9AB 4LASL 1P6AB 5BMFH 4MJ5B 4HUXA 4DVRL 2NY4B 5IHZA 2PTVA 1ZK9A 4ODUA 1QBLL 1SBSH 1T7VA 3QWRD 3EO1A 2B2XH 1NCDH 1EH9A 3M07A 1A14L 1JYXA 4I18C 5BS0A 1W0WA 3WLBB 1KPUB 1AIFB 4NM8L 4X4ZA 1NCBL 3ARWA 3VXMD 1FO0L 4CVZB 5FDWB 3SDDD 1YY8A 4N0FB 1JVKA 1RUQL 4HQQH 1TQBB 3IXAA 4OLUL 5B4MC 4YC2B 1JYVA 1NEUA 2WWKT 3DTXA 2UV3A 3QO0B 3QEUA 1PLGL 3LKQB 2VXVH 5CEZL 1XF1A 2BSRA 2C26A 1JGLL 1NLDH 2G5BB 4OBSA 2HFFA 1HOCA 1UXSB 1GYAA 2VJXA 4KHXL 5TDPA 2FJGA 3V7AE 4UZGA 3GZKA 1YZZA 1OWRM 4LPCA 4LRNL 2V5TA 3BE1L 3BH8A 5D70H 1P7QB 2XXMB 5GQBA 5HHVL 3ZHDA 1IAKB 3OAUL 1RUML 2VR4A 2Z31C 3R0MA 1RZIB 5E0QA 2APTA 5DT1H 3PUCA 5DVOA 4NBZB 5I6XC 3EYUH 5LGJB 4C56E 3ALPA 5J8OA 1FZOB 1BJMA 4WTZA 4GRLD 4HIJA 1VESA 5I71B 2ITCB 2YUWA 4NBXB 1VADA 3OX8A 3IFPA 4A2MA 3GDBA 4GRLA 4PYGA 3SEPA 3VH8G 1BFTA 2AJXH 5HHNA 5ICZA 2CKBA 1A6WL 1MJUL 1HCVA 3INUL 1AXTL 1BQHG 3RBGA 5EUOB 3QXVA 3WNNA 4D0BB 3DX8A 3MRBA 4RMQA 4JRXD 4RCAA 3T3PF 5DS8B 4CGTA 2GJ6B 1XF2A 3U1SL 1FBIH 1P6FA 3MRPB 1ACZA 2FECL 3MLXH 1AD0B 4HF5L 5IV2B 3DROA 4JAMB 4NHUA 3RTQA 3FQWA 5EC1A 1Z9OA 3ECBA 3KWWA 3RWGB 4JQXC 4L4VE 4L3EA 1MQKL 5C0JA 4P23B 4F37F 4N0CC 1MCWM 5F7YC 2CKBB 1R3IH 3G6JA 1XGUB 5IVZA 3TBVA 1MFAH 1UENA 4IS6A 3O2DL 5I76A 1MCBA 2VXUH 4O9HL 1CFNA 4ONGH 4KJPD 3EYOA 1JTTA 3FT4A 5DQDL 4JLRB 4Z5RA 1MJ7H 2M8XA 1JYWA 1FZJB 2Z0BA 3U1SH 4LLDB 5DFTA 3LKSA 1RZIA 3MJ9A 3NGBC 3E6FA 2DLEA 2HT3D 5I8EA 3EHBC 4X5WB 3ULUF 2AKRA 4S11A 2Q3ZA 1EMTH 1CL7H 4YPGB 5TPWL 4GLRI 3J7HA 3BRGC 2H9GA 3GJFH 1LGVA 4U33A 4D94A 4NYLB 4HJJL 3QFDA 4FQ2L 1KCKA 4OD2A 3RFZC 4R2GC 3GMOA 4JM2F 2ZJSH 1AXSB 3VD7A 3CVHL 2QADC 4ZS6D 1JUFB 3OR7A 1KOAA 4JANA 5HI5D 2H41A 5DK2A 5ILTL 3MJ8A 4HH8A 4XMLH 5EUOA 3WS6A 3PGDA 1J7VR 1WK0A 5FHBH 3VXSD 3GNMH 4MD4A 3TNNA 3V9FA 4R4BB 3VD4A 2JIXB 4FZEL 1EVTC 5I8OL 3MLSH 5CZKA 3MODH 4LHJB 3VFRB 1HQ4B 5AYUL 4XGZA 1F6LL 2BVEA 3VFUB 4Z95L 4MS8D 1G7QA 3P9MA 1D5XB 4RGND 5HXMA 4LSUL 3MRHA 2HLFC 4YGVB 5DJDA 5CBEA 4PJGF 3CX2A 5CKAA 3MUZ1 3HR6A 3V4VH 1YN6A 1ORQB 3CX5K 4TUJA 2XPGB 4KROC 4PJ9A 5I73B 1NGZA 3MNWB 4HWUA 3OXSA 3CFJA 4U6XB 3TM6A 4YWGH 4KRPC 1ZSDA 4UT6H 1E27A 4G6FD 4HWBL 5KSUA 3UO1H 3TYGH 5C09B 3QSKB 3MOBH 2FSEA 4OFKA 3QJHA 4OD3H 1IEAA 2GEEA 3EYQD 2CXKA 2Y5TA 4DKFL 1M05B 1V3LA 3FQUA 4HIHB 2P5ED 3BJ91 4NC1C 4ZXBA 1GVIA 4UT9H 3P2TA 5CLTA 4AG4L 2EICA 3V6OA 3UBXB 4HEME 3R8QA 1GZPA 1VKXA 3IKCA 3K4AA 5SWZA 1IAKA 4QGTA 2FECI 1HWGB 2CRIA 3FRPA 1LO3H 3N1FC 3GBMH 1KNOA 3MC0A 4AEHH 4RWYH 5IM7A 4OTXH 2E5EA 4I0KA 4ERSL 3W9DB 1DBJH 1G7LA 4ZFGH 1PBYA 3CVHH 1I9IL 2R1YA 5DO2C 4KKAC 5EA0H 5AZ2H 3I6KA 5IFAH 3C5SB 5CILL 1REIA 4AEIL 3F6LA 3OKMA 4DEPC 1KC5L 1MCRA 4RMVA 1TZHA 4KJYA 1F3JA 5F9WB 5A43C 3UJTH 5C3TA 3K2UL 3P4LA 4HUXB 2EYSA 5DRWA 1SEBB 5I2IA 1Z9SA 5DFVD 4JZOB 5DJ8B 2HTKD 3SGDH 4JN2A 4LHUA 1FLRH 1M7IA 1YECH 3HI1A 4XCNA 1A4KB 5CP7A 4OF5A 3CZFB 3IJYB 1UC6A 1A6AB 4K8RL 4I4WA 3VI4E 4ZUSB 1MOEA 4ZQKA 2DM7A 2WINB 3SY0A 1JGDA 2FR4A 1MCPH 5EU7C 1AD9A 1EFXA 3WO3B 3SDXF 3UBXI 2NXYB 3MMEA 5HDQL 5GRYA 3UDWA 5JPNA 1IM9B 5KSBB 4XNMA 1UACL 5CD3A 1L0QA 4L4TA 1Q94A 4XP5L 4HAGA 5FGBA 5EOCH 3QI9D 1YQVL 2XNAB 5HGHA 4WO4D 1JWSA 1B3JA 1I75A 4NSKA 1EO5A 1OPGL 4PJCE 1T7ZA 3ILPB 1KIQB 5JOEA 1BFOB 5EBLA 1TNNA 3LKOB 3MRGB 1TNMA 1B2WH 2ED7A 3RWCB 2CXGA 3VFVB 2ZUYA 5ISZD 3AREC 2P8MA 1MFDL 5GGRB 1NC2A 1B4JL 3NFPA 1CU4H 2E7HA 4PLJD 2DJSA 4OZGB 2XG5A 2DI8A 4OLYL 4MXQD 3L5HA 5HGDA 3GRWL 2I5YH 3B8SA 2H3NA 3GHBL 3WUWB 5IEHA 1DUZB 5D7JA 1TTFA 2AI0L 2P5EA 1XGYH 2BXZA 5AZ2L 3UDWC 1QLFB 4MLSA 3H9YA 1P7HL 4ETYA 4G8EB 2JELH 2NZIA 1T1ZB 1FFNB 5HJ3B 1TQBC 1E6JL 3NFPB 2VLRA 2DI7A 5CCKL 3VFMB 4ZS7L 4G6ML 4OLZH 1L7IL 3FQNA 4ZDHB 3RBSA 2YUZA 3DSNA 3PXJA 3ARUA 1AO7A 1G1YA 4QRRE 1YN7B 3QXWA 1R3KB 5HGAB 5FYJE 1TZGH 5DLML 2ZCLL 2GTZB 4LSVL 1T22A 1LNUA 3VGAB 4NNYA 3QZWG 3GRWH 1FNAA 4OLUH 1HHKA 3Q48A 4U7MA 1N6UA 3V6OE 2BRQA 3ZDXE 5F8RC 3IDXL 5I1IL 2VXTH 5HGDB 3BP6A 4ZOCA 5H37G 2Y7QA 1NANI 1HKLL 2LU7A 3MRLA 1T03L 4HJ0D 1U2HA 2AQ1A 3BIBX 3WFZA 1N64L 4HLZH 5CJQH 2R2BA 4RBPH 1HZHH 2WZPD 5D5MA 3G6DL 4OF6A 3IJYA 4Q97A 2Y06L 4AEEA 4M00A 4JCLA 5EN2B 3OR7B 4JANB 5MHSD 1ZLVK 5HYJA 2UZIH 2UUDH 4WFED 3BUTA 4QRRD 1OLZA 4P5KB 4NN6C 1F42A 1YECL 3RWFA 3NCEB 4PV9B 2Z91A 5F93C 3GIVB 4FMKA 4PJ8D 5IT2L 3B6SB 1VCAA 3MV7D 5DZLA 3OKMB 5AYUH 1RD6A 2MNUA 5I30L 3MZTA 1XGTB 1BQLH 1NCNA 1P9MC 4GS7B 1MVFA 2YN5A 4MVBC 2Q86A 2W60B 1DQTA 1Q9KA 1I8IB 2LVEA 1W0VA 4R4NC 4XC1H 1I9IH 3CZFA 1CK0L 3UTSA 1F58L 5GHWH 3K8LA 3AREA 1UKTA 1Z5LA 4LVEA 2BHUA 4KXZI 2ZKHH 4G9DB 4HD9A 2AJSL 2FD6L 3OGCB 2DQHH 1AC0A 1QYGH 2VAAA 1LO5A 2G2RB 4YAQB 1HHHB 3WO4C 4LSQL 3IDJA 1U95B 3ARQA 1MHEA 1SY6L 4WJ5B 4FXGB 4Z7UF 4CADB 4ZYKB 2BNRB 3S4SB 1Q94B 2B4CC 3QDGD 2VOTA 1RZ8B 2HKFL 4YO0A 4D9RE 1HH6A 3SDXB 2H26A 3PXHA 5FO8B 3D0VA 1AP2A 4LL9A 3GJFA 1DZBA 4PGDB 1IAII 1S7VB 1CLOL 1RFDL 2ATKA 2VZOA 4FOMA 4PTTA 4MSWB 4PD4K 1MH5A 1F6FB 5LAXA 4CNIA 4N5ED 3PIQA 3PV6A 2DN7A 5DHXB 2CLRA 1YMMA 4M7JL 1NCAL 2VISB 1KCLA 4OGZA 3Q6GL 1AQKH 2H6PB 2PO6B 3LMJH 3MLRL 4LLVA 2AV1B 3W0WD 2IALA 3O3EA 2CDGA 2HT3C 2FX9L 4PREB 3BXNB 2A6IA 3JV6A 4UAOB 5GRUL 1WEJH 1A9EA 2R1YB 1U3YA 3L7EA 1DQLL 4WEBH 3Q6GH 4ODHL 4DGYL 3BUYA 2ZUQC 2YXMA 3EDFA 2CDEA 2XACC 4OZHF 4YX2L 5HYSA 4IDLA 1I7ZA 4UUJB 5JHDB 1JRHI 5F3HA 1TDQA 4KHTL 3PHOA 3MXWH 2CKBL 4DEPB 3WIHL 1VACB 1NJ9A 1UH4A 1U91B 2VZTA 5HVGB 3LMJL 1M71B 3VXUA 2RBLA 3V4PH 1I3VA 4APQC 1MY5A 1XGQA 4MA3A 5IVXE 2CGRL 1LDSA 4DKEL 4XBGB 1K8DA 3L7FA 3C2AL 5SWSD 2UWEF 4LBEA 3CSYB 2YC1A 5FHBL 2DQHL 4WNQB 4PRNB 3Q0HA 3TO4B 4FABH 4G3YH 1FL3B 1K5NA 3DGGA 2J8HA 1B0RB 1AGDA 4EIGB 5ID1B 1MWAA 1Q9OB 4QF1B 3NCYP 5C07E 4QXWA 1W8OA 2GHWB 2IC2A 1KEGH 5I8EB 5K9OA 1AJ7L 1SY6A 5KZCB 3ZDXF 4OZGE 1YMME 1CFSA 1WFNA 1N2RA 2CK2A 3SDDA 4JEGB 4ALAL 3MBEB 3HC0A 5I30H 3BDXA 5DGQA 4OZFB 3EOTL 4U6VL 1QLRA 4OM0L 4B7IA 3FQXB 4HK0A 4A6YA 5C0BB 3ABZA 2NY6D 2YZ1A 2IANA 3TO4A 1K2DB 1LD9B 2FLBT 3JWOH 4RFNC 5TE4H 1U93A 1MVUA 1R24B 4MA1B 4WHDA 4O9HH 1YDPB 3MRQA 4ZTPL 1NQBA 5EZOL 4IIQB 1CQYA 3QP3A 1MWAB 1BZ7A 2AEIT 1KGCE 1T03H 4KK8C 5DMGD 2UY6A 3UYRH 1JHKL 3BO8A 3Q5TA 3ARRA 3MREA 4ONHB 5DFWH 4NKQB 1J11A 3HR5A 3R8BB 1NUDA 1GGUA 2BSTB 2C1PB 2KL6A 2EYTA 5JO5B 4C4KO 3PE9A 1A9EB 4JG1L 1FDLH 5E1AA 5J1TC 2O5ZL 4TVPD 4F2MA 4OLEA 4M1DL 5HVHC 4EN3D 3U7WH 4XC3H 5D2LE 4GW5A 3HI6H 3NPSC 3U30C 4OZHA 1MFEL 3MRLB 4I18B 3JTTB 1D6VL 1KN2H 4LCYB 4U3XA 5E03A 1WLHA 4J6RL 3EYSL 4HHAA 1BZ7B 2DIBA 3DGCR 5D6DA 4CDHA 3IU3B 1UVQB 1U8KB 1U8JB 3VU2A 1Z3GL 4ZD3H 3QUZC 5SX5H 5I1GH 1LO2L 3FOLA 2EE3A 3ULUC 3STBA 1NMBL 3D0VB 3VGHA 3WLWD 1YN7A 4XNQA 4XWGH 1S5IL 5C0EA 4P9ML 3QO0A 4A6YB 3MYJB 1UM5L 3DMMB 4KQ4L 3NCJH 3MCLH 5F88A 3PIQB 3MJ9H 4I9WE 5H35B 1MY7A 5LGJA 4MSWA 1RQ5A 2DLIA 3BE1H 4RFEB 1CBVH 1AIFA 1P7QA 8CGTA 5GS0D 1KELL 3UTSB 5ESVB 3KLHC 4KK6C 1S5IH 2CDFA 2D03L 4P99A 1RZ8A 4YO0B 1A7NH 1XGQB 1WCBB 4MA3B 2BDNL 1BGXL 4QHUA 5IW3A 5JXAL 1RMFH 4BKLA 4BH8A 1B2WL 1LO2H 3QXAA 4E41E 4NHCH 3CK0H 1A6ZB 3I85A 3T2NL 5IFHL 2RGSA 3FO2A 3W39B 5BMFL 5C0CA 5GGQH 3RKDD 3VFTB 4F9LA 3IXAB 5DJ0A 4LNVA 1OM3L 4G7YH 5E2UH 3U83A 5F8QC 1UB5B 2IANE 3UZEA 2HFGH 4Y4HA 4Z95H 1P4IL 2OJEA 4Z6AT 3STZB 4IDJL 3WUZA 4IRJA 1QR1A 4LEOA 5D7KE 1A7RL 3LHPH 2ZNWA 1NKRA 5CD3B 5FFLA 4O2CB 4P3DB 1KENH 4KRPB 2DAVA 4Z9KB 3O6LH 3SJVE 1DBJL 1G6RB 1U9KA 3P4OB 5MP6L 5L0QC 3B43A 1ZLSL 4PJ5E 3G08A 3MLYL 5F7EL 3P11H 1IKFL 1RIVL 1NCCH 4L3EE 1DCLA 2OMNA 1S7XB 3OJ2C 2O5XL 3KPMB 1A21A 3SGJA 2HWZL 1MAJA 4BQ9A 1YA5A 3RY6C 1NGWB 4KK6D 3T3MF 2AJSH 3FQNB 4G6AD 2V2WA 1UA6H 1Y6NR 5C07B 3O4OB 3TA3C 2ZG1A 2ZCHH 3MBXH 4QGYA 5E2VL 3WFHB 4QWWC 3VXQB 3CX5J 5TJWK 3UP1A 3M8OL 2IEPA 2FWOB 3C6LC 1PY4A 4KZDL 4GAJH 1A0QL 3PWPD 1ZKAA 3MUGA 4ACPA 2D31A 2VSDA 1YPZE 3NA9H 5EFIB 3T2OA 3VFGL 4HUWB 4K3JH 2WANA 1OT1A 3LKPA 4HEPG 4JRWA 2QHRL 5KANI 5I1CH 4QRPE 3AM8C 1U58A 3WS6C 2FX8H 5IESL 1M05A 1HHJB 4QNPE 4RX4D 4H8WH 2JJSA 1WWWX 1F4AA 1NAMA 4ZNEE 1NMAL 4JRYA 2NY7L 1CYGA 1MLCB 2X9YA 4MQXD 4Z7OE 2RCSL 3BJLA 1UM6L 3I6GB 1S78D 1UWXH 4ZUVA 1U2CA 1XF3A 5EUOE 3VXNA 2DTMH 2E8ZA 2GSGA 2NNAB 2Q7YA 3HRZA 5ICXB 3SQBA 4PRAB 3U82B 3PWVB 2NY2B 3IDYC 3GI9H 4QRPD 4GQ9H 3KPSA 3ARBD 4WIQA 3TV3H 4RGMC 1U8QB 1RJYA 1ZTXL 1WZ1H 3PL6D 3MRJA 4G8GD 5EU6A 4G9FD 1EGJH 3MV8E 4WDIA 5KSAB 4GG6F 5FO7A 5I1LA 4H0HB 3QIUC 2FLRT 5DJ8A 5SWZE 3QNZB 3VWJA 5E8OA 3DO7B 1C1EL 2P47B 3RZCC 1OGTB 4PRPB 3TBTB 2DYPD 2GTWB 5F3BA 1EMTL 4CBPA 4NP4L 1I1AA 4TUKL 1FC1A 5HDBE 3VCLB 1EHAA 1RIHL 2X6MA 3VXOB 4NM4H 1D6EA 5FV2A 2OM5A 5DRXA 4MMZC 3ULVH 3QULB 4FN0A 4MZ2A 2EKSA 1F3DH 4YE4H 1DDHA 1RU9H 2WBJD 2HVKB 2VABA 4OJFL 4PRHA 4JN1H 5SWQA 3NZHL 5JUEL 5JNYB 2QADB 1KNOB 1RUPH 1CT8A 2FBOJ 5I74B 3VFMA 5KVFL 5GGSY 1N4XH 4P5TC 1TPXC 4WFFE 2ZG2A 2H1PL 3NZ8A 3I6KB 4R6UA 2BX5A 4P2OD 2OCFD 4P59H 3BP4B 3IJSB 5BQ7A 5GGRA 2VZUA 3SCMD 1NBYB 3N1GC 3RKDC 3HS0A 4KTYA 2E9JA 4FHBD 4CU6A 2GIYA 3QUYB 1ZGLP 5CJBA 3RU8H 3KXFA 2R9HD 3FN9A 3I75A 2P48B 4WW2A 1TJIL 3KG5A 3U9UB 3GBNH 3O6FC 4U1JB 1FBIL 3KPSB 4IOIB 3KPQA 1MCSA 1WC7B 5ACZB 1VSCA 4L5FH 3O6LL 2DBLL 2IQ9L 1MFBL 5KS9A 4HPOL 3PNWB 1EXUA 1F02I 2FH6A 2YS4A 4M7LH 2I07B 5GZND 5D7JC 2AP2A 2H8PB 4JDZA 5LGKA 3VFWA 5KJRL 5IVZB 4IDJH 3EJZD 3QUMH 3DJ9A 5JPMA 2CR6A 2FNBA 4Q0XH 1NCUA 4S1RL 2K7QA 1J0KA 2Q20A 3WKMH 3EFFB 5CZXC 1G7IB 4X4XB 3IETB 2CRYA 3K80A 4XGZB 4L4VA 4XH2A 4P46D 1RUAH 4M7LL 5JPNB 3VG0H 3EOAB 2AGJL 5JR1L 3OB0H 3P0VH 4JQVA 4FG6C 5DRWB 1F4HA 5DJDB 3GSQB 4R7NB 4U1NB 5GRJL 4KJQD 3DX8B 1UB5A 3OB8A 3O6FA 3KJ6H 4JFDA 5HYSG 1BREA 2ENSA 3CDGB 3QFJD 3LAFA 3QDGE 4GAYA 2IADA 3C2AH 4LLMB 2F54A 1IC5L 3AAZA 3BQUB 1KV3A 2XICA 2VZSA 2X4RA 5I2IB 2W9EH 4WTZG 4RX4A 3GUTB 4GG8A 4KU1A 1DEEA 3RX7A 3ZT7A 2CD0A 3M1BA 4BKLB 3IDMB 4LIQH 3QG7L 4ODTH 4MX7B 5D7LE 2F19H 4U7KA 1CTOA 4ZFFA 4LVOB 35C8H 5LCVL 4U49A 3BEVB 2AABL 3C60B 1KJ2L 3ESUF 5I73C 5DRZB 5CHNB 4KHXH 1M4KA 2EXYD 1QFWI 4UT6L 1J0HA 4Y19E 3EOTH 4Y2DB 2UY7A 4QOKB 2APVA 5SWZB 2P5EE 5M95B 1WBXB 2FJGB 2VR5A 4JY5H 4D0DB 2HMIC 5KS9E 1JL8A 3VXSE 4S0TD 3LB6D 7FABH 2AJZA 4LIQE 1YY9D 5HYJE 2AV7A 3HUJF 4Q9QL 1LP9B 5F7FA 2VLRE 2V7NA 1QLRB 4PRHE 4UV4H 4GXUN 4IRJB 2MPAL 1QR1B 3QJHB 4CVXB 1U8KA 5C0RH 3VDBA 3FB8B 3NIDE 3HE6B 5E56A 2K9UA 1LQSR 2Y07H 1ETZB 3F6IA 3CSPA 1MI5E 2NY4C 4J12A 3NN8A 4I48A 5HI5C 2XXCB 4PLKC 5FYKD 1J18A 2LAGB 2FYYB 3BKYH 2IF7A 1RZKC 4XMKH 5KS9F 5BV7C 3CSGA 1VFAA 5DS8A 5DSCB 1T5XB 4XVSL 1QO3A 4LPVA 2DQGL 5ALBL 1A3LL 3PABB 3L95B 1UQSB 2PTUA 4Y4FC 2HYMA 3BSZH 4GXVL 2R0WH 1XR8A 1HQRB 4JGUA 3WEXB 4QY8B 2VQTA 4GAJL 4PB0H 1S7SA 4YPJA 4LSPL 2GFBB 1IEBA 2BNQD 4CVXA 5CP3H 1FRGL 2C7UB 1Q9OA 3PGDB 4IIQA 3BYTA 4X6FA 3RIAK 2J6EA 5IGXL 5JOFA 5GRZA 1U36A 3RNKB 1ERNA 3VFOB 3K0WA 4AEIH 3U0TB 3OX8B 4M7KL 1BMGA 3L3JB 3HC4H 3QCUH 4R8WL 1S9WA 3H7BA 2F74B 2CUIA 3O4LA 2O26U 4OQTA 5DVMA 1GZQA 4UNUA 3VE0A 3G5XA 5MI0B 2COQA 4PY8I 1C5DA 3IDNA 2B1HL 2BSRB 3T08A 5FA3B 1JYNA 3QR2A 4FABL 1BBJA 4W4OC 3NTCL 1QACA 1OW0C 2D0HA 4WWKA 4G7VH 4HKBB 4FQXA 1HDMA 1T66D 3TV3L 5F7MC 4RFOL 1JPGA 4WWKD 2VLKB 3V6ZB 2VSCA 5D2NA 5GS0L 1W0WB 1TMCB 4FTVD 2WMPA 1AHWC 4AMKH 3CLEL 3OKOB 1OGAD 5IHUL 5IQ9A 5D9SA 4ENED 4XMPH 4TTDD 5DVNA 3GM8A 1KIRB 4G7YL 5E2UL 4L4VD 1FNGA 3QIBB 4CW1A 4LQ1A 3T4AA 5EIQA 4HKZA 4QO1A 1P4IH 3BI9X 5I1JH 4LNRA 3TGXA 3VRLF 1IGIH 1ACYH 4DN3H 1FLTX 3L95A 3PABA 1RMFL 5C6PB 2FGZA 3G5YA 4LOUD 3R06A 3V7AG 2CUMA 5FM8A 4BFGA 1ES0A 2ADFH 5I1EL 4R3SB 1JPSH 4X5LA 1J8KA 1YEGL 3RWEB 3BQUA 1J1XL 2ID5A 1E4WL 4X4XA 1MRCL 5D7IA 3OKDB 1OL0A 5C0IA 4PV9A 3HPJA 5C08E 3T0BA 4BQBA 3BXNA 1NFIA 2VQ1A 3EO9H 4FFYH 3HE6A 2BHYA 2Q8BH 1IGMH 1LP9F 4MJIA 2VXVL 4OLXL 5CEZH 5I1GL 3QQ3B 4YXLL 1UA6L 1E4WH 1P4LB 5GS1C 2IAND 4P4KD 2AK4B 3FHAA 3W0WE 1HOCB 1UXSA 5GS0C 4KTEH 3H2WA 1IRAY 1ZS8A 3RNQB 1ZHNB 3DARA 1A3LH 3PP3K 3L5WB 2DQEH 3FO0L 1IKFH 1MCDA 1RIVH 2FATH 3QUYA 3O3BB 5D5MF 2HKHL 3FMGL 4I3SH 1NGYA 2A6JA 5KAQF 1S78C 5DYOB 5IB4A 1QRKA 5KS9B 3AAZB 5GZOC 4OI8A 1CK0H 4PG9A 2ARWA 5DHVH 3ARDD 4HZLB 3X11B 4KRNA 1NJ9B 4JFEE 1AFVH 4LSTL 2ERJB 4OCWH 2VLKE 1VGEH 4QOKA 2DIJA 3GHBH 2NX5E 2GK2A 1BJ8A 1R5VA 4I9WD 2CMRH 1WCQA 3EYVB 1UKQA 2Y7QB 1I8IA 1G6RL 1F90L 2XZQL 4QRQA 3NIDF 5I1LB 3CDGA 1OM3H 4JFEB 4Y16C 5KSAC 3DRTB 3WUWA 2Z9TA 4WRLA 3QHFH 4GKNB 1HILB 1JBJA 3BW9A 1BF8A 4K94L 4LSRL 3PWVA 5EDXA 2IPTH 3DUUA 5F9JA 4YHNA 4LKXB 1QFHA 1BAFL 3C08H 1IARB 3JV4A 4Z7NE 5ACZA 5INCA 1I3GL 2VXTL 4X7TB 1W0YT 3CUPA 1KB9J 2W65B 5EZIL 3H9SB 4WW2B 2E7MA 2H8PA 5HGHB 3W0WA 3U4BH 3MJ7A 1T3FB 1U8NA 2I9TB 5I1EH 5IMOA 1H0DA 4XB8A 3NIGF 3E2HB 1LK3L 3JVGA 2A6DA 5T1KD 4PGBB 1T22B 3GO1L 1KCSL 3HZYB 1MCEA 4ORGB 4N5UA 2X70B 4CKVX 4LLUB 3OWEA 3CH1A 3V5KA 3HAEA 5F89A 2X2YA 2Q76A 2NNAA 3BISA 4HDIA 4QXTA 3C6LD 2X4NA 3NIFF 3MNVB 4J6RH 3GMMB 4YIQA 3W11C 1C16B 2WWKO 1ZHLB 1DBAL 2B1AL 4LRNH 3RUGA 4C83B 4OI9A 3B9KA 3TNMA 4YHML 2RFXB 5F6HI 3ARDA 1ZEAL 2DMBA 4Z7WE 3GMPA 2OTPA 1NAMB 2WIIB 4M1DH 1FYTA 1NBYA 3VWKB 3V6OC 3P9LB 4JGJA 4PJXF 4BZ2L 4PGJA 5KSBF 4L1DA 3SJVB 4XCFH 2UVEA 5ANMB 3C5JA 3ZE1F 2VTFA 3FB7A 1NDGA 4GBXB 4NKOB 4CMHC 4OI7A 1VFUA 2YSSA 1N3NA 5E08H 1X9QA 4TQEL 4DJMA 1B9ZA 4PRBA 3EJYD 3OF6A 1IAIH 4U1IB 2XZAL 1TJIH 4QHMB 1ZA6B 4M61A 2XYCA 3QIWA 1D7FA 4LPXA 3E8UH 2BHZA 2LQRA 2MOVA 5TE6H 5JW4Q 1D9KB 1DDHB 3OZ9L 4ZXBB 4HMEA 4YXHL 1JNLL 3R1GL 3V95A 4FP8L 5HBBA 3CDCA 3ILQC 4PJ9C 2X89A 1FYTB 3GJEB 1G7JA 4RISH 1JE6A 3P77A 4QT5A 5CSBA 1FIGH 4Y4HD 5A16A 1JRHH 2R2CA 3EO0A 5MENE 3DVGA 3FRPG 1IVLA 4IRSB 2MKLC 3TPKA 5KBNC 5I8CB 3A0OA 1YEKL 1C08B 4QHMA 3ARXA 4CUCA 4ZG1A 4GSDL 2NY5C 4YHOL 5ITFA 2DQJH 4M7JH 1WT5A 3O8XB 2EDDA 4MJIB 4RIRA 2YOCA 4K9EC 3CXHJ 3WN5B 1Y0LA 2QHLA 1A1OA 5AAMA 5GJSH 2A0LC 2DD8L 5DTFB 3V8OA 5C0AD 2UVFA 2X4QA 4U1KB 3LEVH 1ED3B 2H32H 1J0JA 4QRPA 5ILTH 1DQJB 5L2KD 4OV5B 4V1DD 4LEOB 5GGSB 2HKFH 4JFZL 1F6AA 4M7ZC 4YDVB 4XPGH 4OZGA 1JGUH 1V7NH 1FORL 1OGAA 4IRZL 4XCEB 1NGZB 3MNWA 3TA3D 4G80A 1UM4L 5EFIA 4NPYA 5LJYH 4ZOAA 1Q72L 5IM7B 3WKML 1ZEAH 2R0ZL 2G60L 5BVJB 4JRYD 2NY1D 4P57B 3U4EB 3WE6B 3P3YA 1I1YB 5CBEB 2DQUH 5IMKA 3WS3A 1S7XA 3EFDH 2PCPB 3RL2B 2DTML 4RDQG 4W4NA 5T1MA 5FECB 3F7YB 3O3BA 2HFEA 4ZPVB 1JV5A 1WQVT 3MJ7B 3V6BR 1WV7T 1ZHNA 2J4WH 3TH2T 4QRQB 3TC9A 2ZOLA 4F37K 4EKXA 3EYFA 3L3GB 4F7TA 1C7SA 4ZUSA 4ISVA 5I74C 2OS7A 5D1ZC 5KAQG 3PHQA 4PJ7E 3IS0X 3OR6B 4FFZL 2IGFL 4JRYE 4ZOBA 1RJZA 4ZTOH 5D2LA 4LEXH 1JI1A 1TZGL 5DLMH 1J0ZA 1PYWB 3DECA 3TBYA 4MZ3A 1CFTB 4FZ8L 5JHLH 5KVEL 3ARYA 3Q5YA 1NLDL 1TQCC 4JN1L 2AABH 3QQNA 5FYKH 3G5ZB 3HFML 5LCVH 4UTBH 3SDAA 5IFJB 4DTGH 4QHUB 2ESVD 5EZJA 4HZAA 1NBZB 4L3EB 2CDFB 4LHUD 3V0VA 1ZGLB 2W0KA 1H8OA 5L9DL 4KQ4H 1OGAE 4N90E 4PJXB 1SVZA 1YN6B 4CDGC 3M45A 1FSKB 5DEGA 5EULV 3MUJA 3GMRA 1TJHH 3DVNA 3ARFC 4JKMA 1KYOK 5DJ0B 2DQDL 4OKVA 1T04B 4JDVB 1YEHL 4NBYB 4WFFD 1OAXL 4LCWA 4TULL 3SDDB 1TJGH 2OI9C 4NYLA 4Z76A 2D9CA 3T0DA 1EAJA 2ZPKH 4JM2D 3BO8B 4PJHE 4X0KA 1BQLL 2RJMA 5E9DB 2JIXA 1TZIA 3LRHA 3DXAD 4WENB 1AC6A 3CFJB 4UBDC 3F7PC 3K8MA 5DC0A 3D2UD 3FQWB 4N1CA 4PY7B 5FA3A 3LEYH 4PJGE 1WZMA 5FKPB 4OZHB 5GGVH 1DVFD 1FORH 4JPIA 3WHE1 1T0MB 1JMZA 4XCCH 1P7QD 3KPNA 4TNVF 3TPUB 3WYRA 5CS7A 5SX4H 4Z78A 2ICWI 5AG9A 4X80L 1OAYL 2NZ9D 1RIUL 3FT4B 1M71A 5E9DA 3T4YB 3BKML 5KW9H 4JFDE 1QVOA 3UYRL 4HGWA 3S35H 1IL1B 3QG6A 3ZKSD 1X5GA 3ZMRA 3HR5B 4EQ3A 2Q87A 3L7FB 4P2RA 2VQUA 5IMLB 1RU9L 5F1IA 3T8XB 2AEPH 4WTXA 4AENB 3FT2B 4LNRB 3QNXB 4OSUL 3TIDA 3VGEA 1CGVA 3DGGB 3SDAB 5IFJA 4K8RH 1AJ7H 6FABL 1MJUH 3S4SG 2GY5A 4X6BB 1P2CB 3KYKH 2OMBA 1JGVH 4NOFA 2FH8A 5F6IB 3GMNB 4NZRH 3TBYB 1G7PA 4RWYL 4LLQB 1FAKT 1NLBL 3VWJC 4MVBD 1NMCC 3O11A 4WUKL 1X5LA 2X4RB 3N1QC 1N5YH 4HJGA 3VW3H 2FBJH 4X6CA 4HFWB 2D7OA 3T2PA 4OZFH 2VISA 3REWA 3HMXH 5C0BA 2R2HA 3QEQE 2V5RA 4XVSH 2FD6H 2Q6WA 3QUXA 4MQSB 4OLVH 3ZSSA 1S7UA 2CDGB 4F15C 5DJCB 3MUHL 4YXLH 3WIFA 4OCLC 4U1HB 1GGTA 1U93B 4Z7UE 2G75A 3PDGA 3ES6A 3CXHK 1C5DB 4FZ8H 3L7EB 3Q2CA 2CIIA 3S37H 1B4JH 5JQ6L 1AGDB 2J6EH 1MWAH 4APQB 2VWEC 4M43L 2IH3A 1AGCA 4PJDA 2Z4QB 3V4PL 1MI5A 2P49B 4QKXB 3BEWA 1IQDA 1S7VA 5E8PB 4N90D 1T0MA 2OX5A 4UV7L 5FYJL 5D7SH 1MCOH 4U3HA 4DZ8B 1BBDH 3JV5A 2HA1A 4YBLB 3NFSL 4OGYL 5DUMH 2EIDA 4P2OA 3RVTD 2D0GA 5EOCL 1YMMB 3DTXB 4JO3L 4NQDD 2VLJD 3FQXA 4PJCB 2LVCA 5L7XH 2XN9A 3BPLC 1P7KA 3VG9B 3F65A 2PCPA 4P2QE 4R97B 1CD8A 1QKZH 3RHWF 4LAQL 1J1OH 1I3UA 1BVKA 3FONB 4M1GH 3QZWB 3TO2B 3BPOC 3DUHA 2X9WA 3M1BB 3IDIB 4RMTA 5HYJD 5HGBB 5ID1A 4PJGA 3NABH 1CI5A 1M7DA 4JE4B 3VFGH 1JPFA 4HV8B 4NO3B 4YAQA 5AWNH 1VACA 1UJ3C 2GT9B 4JDZB 5LKNA 3C8DA 4O51B 1FQ9C 2B0SH 1IMHC 3LSOA 3RY6A 2NR6C 3VWJD 1JGUL 4MMXC 1FGVL 4Z0BL 2NY5H 3MRIB 1CR9H 3RVTC 4NQVB 2P42B 4D8PA 2UYLA 5MP6H 5C0GB 4Z7UA 4CNIB 4L8CA 4HUKB 4KQ3L 4MNGB 4WFHE 3MV11 1MF2L 1DANU 4ZNEA 3B9AA 5D2LB 4I3RH 1NL0H 1XZ0B 3EOBA 1EEUA 1QVOB 3R4DA 1DN2A 2AEPL 5AG8A 1OP5K 4HUNB 4NKDB 1LE9A 1FCGA 1ZT7B 2FHCA 4GAGL 1F2XK 2A6IB 3BPCB 5HY9A 4X6CF 5HJ3A 2BOCA 4LDOB 1BOYA 5DC9B 3GSUA 3PG2A 2YN3A 3HCVA 2R56L 2FO4B 2K3TA 1FN4A 3ARFA 4YBHA 1Z5LB 2GK0B 2GJZA 2XN9E 3PGCB 1CL7I 2FEDC 2F5AL 2ATPB 1W8NA 2P5EB 5ADPL 1MIML 2MKWA 5CLWA 4JY5L 5CJQL 4DGYH 5C3LD 4WEBL 2P5WD 5IBUG 3ROOA 3BP7A 3Q3GB 4FXGA 3DNKA 3HG1E 4ODUB 3D25B 3KPRB 4WY7H 5L7XL 1OARH 5D72L 3QNYB 4OZHE 3V7MA 3AY4C 3MBEC 5ISZA 3B4NA 4XX1G 5IW6A 2D03H 2JLLA 4X7DC 4F57H 3X14A 3RY4A 3P9LA 4X9IA 3C09C 4GAYB 3LRSA 4G5ZL 1NBQA 4OZ4A 3CC5B 4JDVA 1AO7B 1HZHL 5EU6B 1NSNL 3WCYA 5CJ5A 4G80B 1BECA 4WO4A 4ZFOB 1OD9A 4MDJB 4PGBA 4TULH 4FFVC 5DQ9B 4P4RA 3MRMA 1F6AB 1G9NL 1RUPL 3BN9D 5EH1A 3ZLQC 5ICXA 1JWUA 1NCWL 2XQYG 2X7LB 3KHOA 1O0VA 1TJHL 5B39A 5GRJH 1RHHA 2Z31D 2W65A 3DVGB 1JGDB 4JKWA 1Q9WA 1IJ9A 2AI0H 5JLZA 4R7DB 1JFQL 3MRCB 1EXUB 4K3DH 2A83A 2WBWB 2VXSL 4F8QA 1KGCD 5DJAA 5DWUL 1IM9D 1C08A 3LY6A 1T2XA 3UTQA 1Z3GH 4ZD3L 1QFWL 4GUPB 4PJ8A 4U1JA 1T1WB 4L4JA 4MA8L 4OCXH 1G7MB 2EDHA 1CE1H 5EIIB 1M1SA 3GEWB 4DKEH 4E41A 4GKZA 2Z31A 5HY9B 2VC2L 3MO1B 3TBSA 2BSED 5DR5L 4MA1C 2L7JA 3HG1A 1CFBA 5D1ZD 5C08A 3GHEH 1XH3B 2IGFH 1CD0A 3UTOA 4KJWC 1E4XI 3ZTJG 1D9KA 5ISZB 4FQLL 3TWCH 4MJ6B 5T1LD 3HRPA 4LPTA 1IZKA 1QLEH 1OLLA 3RVWD 4X8JB 5E2TL 1T4KA 3DUSB 3ELAT 1RZ7L 2MFNA 1PSKL 3RUGF 2V2WB 5E5UB 2BMKB 4Z7VA 4M8QB 3AU1A 4HIXL 4Y5YB 4E5XB 4TSAH 2EDWA 1RZJC 2QSCL 3BN9C 2H2PC 3SJVA 1Q9LA 4UDUA 1JF1A 1CICB 1H5BA 4ZUTB 5IB4B 4H1LA 1B0WA 2FIRT 1OCWL 1IM3A 4NCC2 3IRPX 5K59F 2B4CL 3LQAL 4BSWB 4PJ5D 1I7RB 3HZYA 3ARGC 2DQUL 3ILPA 3X3FH 4U1MA 4R4ND 3RVUD 3U4AA 5MERA 3OKYA 3OJDB 3BRFA 1MIMH 1ZT1B 4KK9C 1ZA3B 2HT4D 4PJGB 4GG6B 3I02B 4GRWF 5JMRA 5MEOB 2YXFA 5J6HB 4N68A 3I84A 3D3VA 2W91A 5E9DE 3TN0C 4P2QB 5E6IC 5T3XE 2VDLL 3HCVB 1RZFL 4QHKJ 4EXPX 2CH8A 3S88L 4XP9H 2QBWA 3AU1B 3WFCL 4GLRH 3CXDL 3JV4B 2I9LB 2R1XA 4PJCA 5T1LA 1U92A 2BRRL 1EBPA 1XF3B 3FQRA 1TITA 2ORBH 5FEBA 2YEZA 1IBGL 5C08D 1ZT4B 3KPLA 3VXSA 4YHIA 4ZS6C 4UNVA 3ZYJA 4UAOC 43C9B 4JM2C 5JW4M 4CJ0A 4F7PA 4JO4H 2E6QA 1OVZA 2CO6B 3BPNC 2F58L 4U31A 3TBSB 4YXKH 1L7TL 1QSEE 4MCYB 3V0WH 5C07A 1EO8H 3KLSA 3BZEA 5FYJU 1UADC 3BKJL 5JXEA 3UPRB 2XKUA 3LOWA 3MRIA 5ETUB 4JREB 4RFEA 1OAQH 3ISWA 3PQYB 4JJ5B 1K8IB 1K3IA 2VDMH 2YRLA 4KWUA 2G9HA 5GPRA 4DN4H 2PW1B 3AS2A 3I2CL 2CO7B 4PJ7B 1SEBA 1HHGB 1EEYB 4HWZB 5FYJH 1DVFC 4NZTL 5IB1A 1KIPB 1LVEA 4KKCC 1U42A 3TO2A 2BK8A 4XHJC 1RI8A 3R1GH 1VKXB 5I75B 3CJJA 3FO9A 1XCQA 4EI5B 5FO9A 3O9WC 4JO3H 1OAQL 2JJTA 5CUSL 4LP5A 1KXTB 1ZVHA 4MDJA 4JHAH 4ODVH 1SM3L 3CPLB 1FPTL 4ODWB 1NGPL 2VIRB 5F1KC 4X5WA 3QO1B 3VH8B 3LV3B 4U6TA 2VRAA 1Z6JT 5DD3L 1UYWL 4UIMB 1VEOA 4LFHD 5T3ZH 2EE2A 3HAEG 3N1MC 2PYFA 5JOFB 1MI5B 1QFUL 5C1MB 2ORBL 4N0UE 2GAZA 1KXQE 1HSAB 1BPVA 1EJ6A 2P46B 4JFHD 3AGVA 2MTPA 3NTCH 1WCBA 1A7QH 4I5BA 3EYQC 1KB5H 3D69A 3HNVL 3MV9B 1U8IA 3BFOA 5GIRB 5CEZE 3SE8L 1EZVY 1F58H 2W0PA 4PJDF 4PRDA 1XGUA 3KYKL 1NEZA 3HZMB 4OZGF 1D9KC 2DI9A 2OP4L 4JO2H 5FDYA 1CZ8L 4PY7A 3OAUH 4KMTH 4HJJH 4A2LA 2MHAA 1OTSD 4MDIA 4QRUB 1FSKC 3TYFB 5JO5A 1QSEB 3UZVB 3N50A 1HEZA 1HQRA 3DX7B 4MJIE 1VADB 3M17B 3QFDB 3UC0L 3VXRA 1E28A 1I7UB 1KG0B 2GY7B 4TSBL 1D5XA 4OKVB 4K8RC 2Z35B 4KUZH 4EEEA 1OB1B 4XPBH 5IVXF 4BFIB 1QNZL 1NBVH 4KAQH 2HTKC 4J3SA 2A0LD 4OCRL 4XCCL 3LS5H 5DFVC 43CAB 4JHZA 2GJ6A 3ZDYF 2EXWC 4OGXH 3GSXB 4NUGH 5HD8C 3CMOH 2AEQL 1TIUA 1GOHA 4G43A 4FQPA 2Y06H 1PZ5A 4JM4H 5J3HD 3K8KA 2F15A 3H7BB 5C9JB 3GHEL 5FK9A 2P43B 1GIGH 5HGBA 3S3SA 5ESQB 1MQKH 2AXFA 4Y1AB 3LV3A 1WFUA 1EEYA 3NIGE 3DO3A 4N0UA 1QFOA 1UM5H 1BJ1H 4B0MM 4FZEH 3T2QA 4NNXA 1AKJB 1WZLA 3CDYA 1BBJB 5LQBL 2V7HA 5AZEH 1WGOA 1ADQA 2W1NA 4NO0B 3LPGA 5IWLA 3GSNH 4QRTA 4HK3J 1P7KB 1KCVH 4DGIL 2IAMB 4N9GA 4B53A 4JDTL 4I3RL 1U3HA 4MA7L 5DXWA 2OL3H 4ELMB 3ULUH 1YDPA 3MRQB 3U48A 5HHXL 1RIHH 2C4FT 4KTEL 4TUKH 3N9GH 4I0PC 2A2QT 2PW2A 4IS6B 4CVUA 1U3HD 1VHPA 2AXGB 2G5BA 4JPVL 3CDFA 5C9KA 3V5HB 5FGCE 3QWQB 1RK1A 4KUCF 4MB5A 3OAZH 1OD7A 3ME0A 2VAJA 4JVUA 3GB7B 5DJ2A 5HHNB 1WUNT 2HMID 2GW5A 4JKPL 2HFEB 4PUBL 1U8MA 4Y2DC 1OAZL 3RWEA 3T1WA 1AD0A 4ZOEA 3L6FB 2PO6A 5LXGL 1CFSB 2LABA 4RMRA 4PV8B 3U4BL 5FM5M 1TCMA 3BYYA 1DQML 3I50H 3KDMB 5DD3H 1OY3B 3W9EB 5TGBA 5E70A 7CGTA 4K3EH 5JPMB 2J88H 4FFYL 1FCCA 1TCRB 1TVHA 2C3VA 3EO9L 3QUYC 4JY6B 4XXCC 4J7RA 5FGBC 1G0YR 4JO1L 4LLAA 1A4JB 4HIEA 2CQVA 2WUCH 4NUGL 4WVRA 3TFKC 4F33A 3JXAA 2KH2B 2ZUTA 4LSRH 4LAQH 1MCWW 1MJJA 4XVJL 4H5SA 5GGTA 3TJHC 1OAYH 2R15A 1HSAA 1MCFA 4X4YB 2D7PA 4ZYKA 1UG9A 5TDPB 1DANT 1NDMA 1RK1B 4UIKH 3EIFA 4IOIA 3SGEI 1WWAX 4HULB 1LO0L 1YMHA 2FGWH 3DVIA 5JOPE 1Q0XL 4M6MH 4HS3A 5FKAA 1XR9B 3MA7B 3QDJB 4OUUA 15C8L 4P2RE 3VA2C 4P5MA 1MH5B 1XEDA 3L3GA 3DRQA 4Z7VE 3VXTB 4UINL 1NBVL 1G9NC 4QHLA 4XWOD 1S7TB 1T6VN 1QG3A 2XTJB 4LLYA 4U1LA 3WFBH 4PRNA 1EK3A 3X13A 5DJZB 1XGTA 3OSKA 2BVQB 5IWLC 5J12C 3LQAC 3AFLA 4LU5H 3D3VB 1BD2B 1DVFA 2AXFB 4Y1AA 2FO1A 1V3JA 4NN7C 4PGEB 2W38A 4TUOA 3KPNB 3EJYC 4M48H 3QIWC 1A1OB 1BQHB 3IDUA 5DD5L 2JJTC 1YUHA 3VD3A 3WKNA 3H6JA 4TNWF 5EZLB 1IGCL 1TQCB 4MX7A 1PGRB 2EEDA 1QBAA 4O4YL 4Y16D 4Z7QE 3DHMA 4YDVA 4LCWD 4KK5C 4S1SL 2DM3A 3IAGC 2NTFB 5IB2B 3CLFL 1G7HB 3H42L 4QY8A 4ZODA 3QDMD 2EDEA 5D2NC 3B6SA 2W9DL 3LKNB 4LSSL 5HPOA 3PGFL 1UT9A 1UQSA 3AXLA 3KYOA 2RFXA 5I8KH 1CG9B 3V4UH 1BIIA 4YDIH 3LQMA 4FFWD 2CLVB 2EDTA 1IC4L 5EN2A 4YIQB 1JZ5A 1AXIB 1J0YA 4L4TD 2DQFB 4FP8H 3PNWA 3V4VL 1ZMYA 2P45B 3UTTB 2XZZA 3S9DB 2C4FU 4J4PC 1DBKH 5DHVB 5L88H 1P84K 3V0VB 3QUKA 1ZGLA 2NY1C 5EIIA 1PG7X 1U41A 2X70A 4UIKL 1NEZB 3N1PC 2AXJA 4IMLA 4RISL 3KXFB 4O58L 4R0LB 5ICYB