3QUYD

Structure of the mouse cd1d-bnnh-gsl-1'-inkt tcr complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
total genus 66
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quyD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quyD02
1FZOA 4EI5A 4JFHE 4CVUA 4GBXD 2JLLA 5D6CB 3ZO0A 3DURA 1NC2A 4N68A 2FEDD 4KH2A 1NMBH 3QDGE 4WFHD 4PP1D 1TVBA 1NKRA 4WRLA 3V6ZA 5D7LE 3BE1L 3D6GA 4KVNH 1LD9B 2FZ3A 2A83A 3MNVB 4MAYA 3GMOB 3HE6C 2UWEB 4PJCA 1MWAA 4LGPB 3QO0A 4PRHA 2ZG2A 3MYJB 2VLJE 5F9DC 2EKJA 2VLRA 3VG0H 2IADA 4R2GD 3VXSD 2DQHH 2NXYB 3ARDA 3VH8G 4NJ9H 2JB5L 1HOCB 3PDGA 3BZEB 3WIHA 5E5RB 2EYTA 4GSDH 4KQ3L 2Z91B 2YRLA 3QHZL 3MLVH 5D2NA 1JVKA 1M7XA 4XNMB 1M05A 1GIGH 4MZ3A 3VXRB 5SV4A 4L4VA 1WVZA 2UVEA 3S3SA 3P4OB 3RA7L 4Q9QH 3TO4A 5E1AB 1EHLH 4GRWE 4NP4H 3IJYB 3W5MA 5EH1A 3QCVL 3AAZB 4NC0B 3FB6B 4GLRH 1LO5A 3P9MB 1MAKA 4LLMB 3KWWB 3FQWB 4XBGA 2IEPA 2X4QA 3KJ6L 1HQ4B 1ADQA 4QYOB 3GBNL 3WD5L 2RAMA 3TLRA 2UZIH 1MCFA 4LP4A 5EU3B 4TULH 5HYSB 5ID0A 2AAVA 2FH8A 4DCQB 1JYNA 5HPMB 2UUDK 1HYSC 2WBJD 3HAEG 1CT8B 4O51A 1YEDB 3MRCB 4YBQD 4KI5E 4PJIB 2J8UF 5C0CA 5TE6L 3VI4E 5F7LB 2W59A 4KHXH 4OZHE 5DJZB 1CGVA 1T66C 3NH7L 4OD1L 4NQEB 1BVKB 4QHUA 3MBXL 1EIBA 4BH8A 5F1IA 4MAYC 5T1KB 3HZKA 4JPVL 3C60D 3MJ9L 3TYFB 4YHOH 3CZFA 4RDQG 3X12A 5JMOC 4N1EA 1BJ1J 1EFXD 5IB5B 1QBMH 3ARDC 2W0KA 4JGJA 3OKOB 1OD9A 3QWQB 1A3LH 1NPUA 3WEXA 1AGDA 1KJ2H 1MF2L 2Q6WB 1T83A 2PO6B 1Z9OA 43CAA 3S97C 3LS4L 3KS0J 1D6EB 5DMIL 1KN2L 3D0VA 1OAZH 3OXSA 1H3VA 1OAUH 2V5MA 5BS0D 3DXAB 5BRZB 3LMJH 2GUOB 4JFFE 4OJFH 2OJEA 4OT1H 4U1IB 3L3IA 2D7MA 1TVHB 2J8HA 3S34L 2ITCA 3NA4A 4HLJA 2GSIA 3ET9F 4GG6E 3MRKA 1EEUA 1ZVHA 3LB6C 4YFEA 1O7SA 2P46B 4JRYB 3BJ91 1KEML 1IM9D 1VGEH 1IKFL 3V2AR 3OF6A 4X98A 5HDQH 2A73A 4KK8D 5HGDA 1QFPA 1TIUA 2BJMH 3ALWA 4KRMB 1CFTA 4N0FB 4ODHH 5IEKA 3B2UC 3QEQD 2DQDL 1RIHL 1W72A 2EDDA 3ZL4L 3RUGE 4EDWH 3UYOD 4P2RB 3X3GH 4L9LA 2PNDA 3BPOC 4ZO7A 3UC0L 1EGJH 4BZ2H 3DV6B 1IL1A 1MCRA 1BEYL 3CFDB 1U0QA 4OM1L 2X1OA 3LIZL 1RIUH 4N0UE 2RGSA 2VITB 4ODTL 3T4AB 5LG1A 3LKRB 4ZOCA 4RGND 4TVPL 3WUZA 1AFVH 3QCUH 4P57B 5IVNA 3ZLQC 3W39B 4FQLH 5SX5K 1CLCA 1BD2B 1KJVA 4HUXA 2IF7A 4G6FD 2FLBT 4XBPA 1T83C 5FA4B 3ZZ1A 1IC5H 2N7BA 1I8LA 3HC0A 3MLXH 1JZ7A 5IR1A 2M26A 5GJTL 3ZT6A 3FO2A 1QPPA 3UJJL 3V4PL 2R69L 4IHOB 4UV7L 2DLHA 1CLZL 4P23B 1NSNL 1UA6H 1MJJA 4A2LA 2XA8H 5ITFA 3IF1B 3BDYH 4KUCD 2CDEB 3RDTA 3QFDA 4KKAC 1T7WA 4XHJD 1G7HB 1M7IA 3HS0A 3MJ7A 3DETC 1K6QH 4UIMB 4XPAH 4MJIB 3E3QC 1FYTA 3OR6B 3QJFB 2ZKHH 3DMMB 3WUWA 4ELMA 1A64A 1IM3B 4OFYA 3WS3A 4X7TA 3V0WH 3WCYA 1DQMH 3VWJA 4OCXH 5BQ7B 3U0PA 4XI5C 1TZGH 1O0VA 3LRSA 5C0RH 5AD0A 3BW9A 1D5MA 5ICZA 1T1ZB 5MEOA 3LAFA 4I4WA 4L9LC 4U05A 4G8GD 4ZOAA 2Y1VA 1OPGL 1N5YH 5ETUA 5EO1A 1W8NA 1DL7L 2VOTA 1FNAA 2Q86A 4URTB 5DK0A 3DARA 4HJ0D 5BMFL 4Z7NF 1MAML 4M5ZH 4CNIA 4XH2A 5D9SB 3CFCL 4CVZB 1UXSA 3J8F7 5D5MB 4GAYB 3PV6A 1IQWL 4C56B 1G1CA 4ZOBA 4JJ5B 4PJ9C 4XNZB 5FHBL 4MA3B 3PHQA 4CMHB 3EO0B 1WQVT 3IDIA 2MSPA 1OT2A 1KJ2B 5L9DL 1R0AH 3QWRD 3PWLB 4U6HA 1WITA 2Y07H 4FP8L 1FCGA 1I8LC 2DQFA 3DSFL 1FE8L 5JUEH 3HA0A 4L5FH 3MLRH 1CD1A 4MA7H 4JAMA 3RZCA 1LEGB 3FO1B 4MSWA 4MDIA 3NZHL 1CE1H 5T1LA 1D7FA 1NDMB 3OV6A 5GGRB 3RDTC 5IJVA 2X41A 1YYML 1LILA 3DRTA 5K9JH 4U6TA 5T3XH 5J6GA 4EZMA 3PDOA 2C3HA 4UTAL 2YR3A 3PQYD 2X1WL 5DT1H 1R5WA 3D3VA 1ZA6B 2V17L 3MV9D 4QTHA 3CFJA 4HJGB 2J7LA 2BNQB 3LEYH 3VWJC 5E9DA 1MJUH 2NNAA 2I07B 1CQYA 3HMWH 3DX7B 3HTLX 5JZ7C 4JKPH 1AHWC 1MH5B 3U7WH 2EDEA 4ZNCD 5GGTA 1FIGL 1LO2L 3GIVA 4UT7H 4ZXBA 1DFBL 2IALA 4PY7A 2IGFH 4OFVA 4NO2B 3KYOA 2OQJA 3HG1E 2Q3AA 1FZMA 3O2WL 2O5YL 5GGQL 3MCKB 3O6FA 2HFFB 2J8UE 4WHYG 5B4MC 1A0QH 5FF6B 1FFPA 1M71A 1KLGB 2A38A 5EU6B 1LEKA 5I1DA 2DM3A 1HSBB 4TUJB 2ZCHH 1CF8L 3CFKB 4PJ5B 1CS6A 1OTTD 5ICXB 1SYSB 5C6WH 3MV11 2VZTA 1JHLL 5IV2A 2QKIB 1IGIL 1Z5LB 4QRPD 5KVMC 3MUJA 3CU7A 4KXZH 2NXZB 1HNGA 3VFSA 1MHCA 1ETZB 1CN4A 3MTRA 5DWUL 1D9KD 4ZAKD 3L1OL 3UO1L 5GS0L 1QO3B 3MCG1 1EBAA 4ZTOH 4CJ1A 4ZS7H 2F5BL 4Q2ZB 5DFTA 3VDCA 2R8SH 2KPNA 3QZWA 4MYWB 3JBG7 5GGUA 3BN9C 4ZFFB 3AC0A 1P2CA 1S7RA 1MHPH 2XQYK 3HC3L 3QWOA 4WEMB 4LKXA 4ZNEA 2CD0A 5T3ZE 1Z9MA 1H5BC 3MRMB 2HLFC 1FNSH 1C5BH 1QSEE 4FFZL 4G43B 3RWHA 5ESAB 3RPKA 1UZ6E 4S1SL 1BJMA 2NLJA 5INDB 4Y2OA 1VADA 3PHOA 5DVLA 3LKQB 4UB0H 2CUIA 2EYSA 4G6KH 1U93B 3W9DB 5I1IH 1WWWX 2WINA 2PYFA 4WHTA 4ZXBC 1K2DB 3S3JA 3KLAA 3ABZA 5MENE 1A14L 2BFVH 3VRIB 1NGQH 1ITBB 3O4LE 1DLFH 1EK3A 4NHCL 3MXWL 1TJIH 1BMGA 4D9QE 2UZYB 2VXSL 3ULVF 3SPVA 3HPJB 2B2XH 3KYNA 2PTTA 3K1DA 5DYOA 4P2OA 3AMLA 1MFCH 1UYWH 1A1MB 2A74B 2CLVB 4UQ2A 4OKVB 2VZVA 5J11B 3RAJH 2BY0A 4K7PL 2EDNA 4GS7C 3OQ3B 1QSFD 4G7VL 2R2EB 4WWKB 1RK0B 4HEME 4QTIL 3UTQB 1QBAA 4HXBH 4YGVB 1KCVH 5FCSH 1VERA 4K7FB 2Z31B 4HAGA 4FHBD 4YPGA 4TOYH 5DSCB 4N0CC 3PXHA 1QPXA 1TTGA 4WEBL 4DW2H 1S3KH 1YNLL 3EYQC 3FQNA 1NCAH 2HMID 1YN6B 5ANMB 2Z93A 3GSOA 3QXAB 5F1KC 1BPVA 5LAXA 3QSKB 4GRMA 4GW4A 5D7JA 3IRZA 4PJHB 4M5YL 4RFOL 3D39E 3ROOB 3IAGC 3UTTA 1I3RB 1S7QB 1MHHA 1OF2A 1QLEL 3IJSB 4GQ9H 4PGEA 3WFHA 4R6UA 3FQUA 4QRUA 4A6YL 2NY7L 3MODH 1E6JL 4YHKL 4K3EH 1JNNH 3QI9D 1FDLL 5FO7A 4J7RA 2HVKA 4P4KD 2A0LC 2YD8A 3FRUB 5LBSH 5CSGA 5C0IA 5B39A 4AIZA 1FFNA 1MAJA 4O9HL 4K55A 1WSST 3EJYC 1NFIA 4G8FB 5E2VH 1I8KB 4H20L 12E8L 2CMRH 4Z0BL 4ZUVA 5I1LB 4JFYB 2YEZB 4KWUA 3GUTA 2BDNL 2BC4B 2MHAB 2CDGA 1S7SB 1DLHA 3EDKA 3S4SG 3BEVB 1U8IA 3OGCA 3Q5YA 4P2OC 3G6JB 3VXQA 3X13B 4X6FB 4HWZB 4P5TA 1BAFL 4JRXE 3CFBB 4EOWH 4BJLA 5KSUB 5HHVL 3QNYA 5I2IB 1AO7D 2KBGA 5B38B 3SE9H 1SM3H 1FJ1B 4H25B 2W9EH 2X5PA 3C5JB 1B3JA 4GFTB 5D7KD 5CP7B 2Z9TA 1S9XB 2HRLA 4WO4B 3HLAA 1FNHA 3C8KA 1RURL 4J3VA 4U6YB 4JCMA 4KMTL 4RWHA 4NQSB 2R2BA 4QCIA 4RZCB 2Y7QA 5JXAL 4ZMAT 1N59B 5E2WL 2OBGA 1NFDB 4U1JB 1GGIH 5E94B 2V2XB 3E6HB 4GG8A 5D7JC 3RNKB 3TFKC 2H6PB 1MCNA 3H7BA 3HN3A 4JJHA 4XNXH 4QXUL 4K3JL 3HMXA 4PJEF 1G7IB 2N56A 2PR4L 5DD3L 5C92A 3HZYA 2GT9A 3SDCB 1J0HA 1H3XA 1ZT1B 1G9NC 5I8EB 5GRJH 1CDHA 4NGHL 3PWUB 1QFWL 3BGMA 3QG7L 3R06A 1WEJL 5DRWA 3WFEL 3VFPB 3VRLF 1KULA 2VRAA 1MRCH 4J6RL 3RPIB 2NR6C 1I7ZB 2VH5H 2AI0L 4IRSC 4Y88A 4R8WH 3T2NL 4XP5L 4P5TC 4LSRL 2CXKA 1JHTA 2QQLL 3QPXH 1SBBA 4YDLB 5L2KE 2W0FB 3ZKMD 2YRPA 4MQTB 1TZHB 4LPXA 4XRCB 4F7MA 1R24A 4P2QA 4KQ4H 3EOAA 3SO3C 5LGJA 3CMOH 2Z92A 2DQGH 4D9LH 5D1XB 2V5YA 3TJEL 1FVDB 4JM4L 3REWA 3DYPA 3ARYA 4KV5E 3MV8E 3L9RA 1RZ8A 5H35A 3C9NA 4TTDC 4BZ1L 1IGFL 2F15A 2UYLB 1T1XA 2IBZX 5FYKU 2OJZL 5GSVA 3BRDA 2CKBL 1Z9LA 3TBTA 3PIQA 4QHNB 4YPJA 1W2KT 1RUQH 4P23D 5FO9B 5IG7A 3NH7H 4LEXL 3U82B 1AP2A 1A4JA 1L7IL 2MCG1 3MBXH 4UT6H 4HS8L 5C0DB 1XGRB 2VSCA 1S7VB 5FYJE 1E4XL 1FFQA 3MJ9H 2XKUA 1GSMA 5GIRA 5H94B 5E95B 2HJFA 4LLQB 2VDQH 2XPGB 4NBZB 4RRPG 4U6VH 5ISZA 3FL7A 3VH8A 1DANT 1SJHB 1BOGB 3MA7B 3RY6A 5EO9A 2J6EH 4JLRB 4N0YL 2FJGA 1NANI 4PJFE 3EYVA 5T3ZL 4LVHC 4YE4H 4XAKD 3L3DA 1UB5B 1OT1A 2VR9A 4L29A 1QRNE 1SJVA 1O7VA 1P4LB 5F6HI 3BZFB 4XP6L 4FQHA 3VD7A 1CR9H 3MV01 1T5WB 3LQAH 4D9RD 4O02H 1OOAA 5IFJA 3ULVE 1BIIB 3TN0B 4NZUH 1D5IL 4LNRA 3C5ZA 2DLTA 4XB8A 2FNBA 4RMTA 4J3TA 1KT2B 1U8PB 3MGTB 5GRUL 4C56D 3GB7B 1KNOB 1BWMA 1SHMA 4OZGF 4ODUB 3QDMB 2XWBA 5CMAB 3VI3F 3LQZB 5FM8A 1XGTA 2CR6A 2Y72A 4GKNA 4LGSB 4Q6IB 1TQBC 1YPZA 2Q7NA 3IDMA 2GY5A 1WFNA 5CZVL 2AV7B 2ZP0T 1JGDA 3NCMA 1OWWA 1H0DA 1E4KA 1IKNA 1Y6NR 4WW1A 2Z8VC 3FFCA 2PW1A 3B2VL 5GGSB 3KPPB 2W9DL 5DJDA 4NPYA 1PY9A 1JPTL 4RAHA 2NY2C 2E27H 4PGDA 2QSCL 3ZHKA 4NNPL 2ZSWB 4Z8FL 1L0YA 1CXIA 2IQ9H 2J1KA 4FTVB 4YEEA 2DIBA 4HX1A 3MREA 1INEL 3ARBB 5LXGH 5DUBA 4JZOB 4WJ5B 4QRRD 5C0BA 5T1MA 1JFQH 4X4ZA 1Y0LA 5F72S 1JZ5A 2H2SD 1HXMA 2MCPH 5CGYC 1QEWA 3UJJH 5CBEB 1GC1H 2EIBA 2R69H 2GJ6B 3IDXL 1FH5H 5ACZA 4QO1A 4BSVB 4MNHA 1CTNA 1NSNH 4RMSA 1X6LA 4I2XE 4BH7B 1OM3L 4K8RC 2OX5A 4GUPB 3IU4L 4XMKL 3RJDA 1EA9C 3MGOA 1FLRH 4M6MH 2YZ8A 3CH1B 2VISA 1FGVL 3F7RA 3T65A 4EI6B 3C5ZC 4OLXH 5C9KA 4OLZH 5TFSH 4XPTH 3QUZA 4DQOL 1XF2A 3GI8H 3QQ4B 5EPMB 1CFNA 2Q8BH 1Q94B 2OTWB 2XN9A 5DO2C 1DBMH 5I0ZA 1MCSA 2J88L 3CX2A 1WCQA 1XEDA 5JA8B 1A21A 3VA6A 4NRYA 1ACYH 1E4JA 2Y36L 5ESQB 1BREA 5SX4I 4PRID 1LK2B 2ICWI 4QRSB 2HFGL 3HZVA 5IVXB 2ILLA 1F6FB 3LZFH 4ODWB 3U2SB 3VGGA 4KRPC 1DVFD 4XPGH 4LVOB 4F15C 1AXTL 2BZDA 4WGVB 3QUYA 1EXUA 1YY9D 5BMFH 4MJ4A 2VLMD 2X7LA 2NY1C 2JJUA 4PJBA 4U1HB 2VDPH 2NY3B 1K4DB 1JWMB 3MRJA 4JM2F 1FNEB 3X3FH 1TMCB 2BNRA 2B0SH 1K8DB 2VIRA 3C6LB 5FHAH 3OKNA 2R29L 1H3TA 1AKJB 2KKQA 4DKEH 4JREB 2WBKA 3JTSA 4N5EC 5TPWH 2VLLA 4WFEE 5HYQA 3VGEA 4ETQB 2JELL 1U91B 5F9JB 2DQUH 4LSUH 3KPSD 5KSVB 4Z7WA 5JOFA 4GBXA 4FMFA 2X1XR 4OI9A 1P4BL 3IKCB 5IB4A 4I9WE 1M7DA 3BFOA 3WE6A 3VRLE 5CJ8A 1J11A 4IDLA 1PKQE 3MV7B 4S1RH 4LSVH 1ZT4A 3V4VL 4HUUA 3HKFA 4WTXA 2V17H 4RQQA 2YD6A 4G6AC 3LS5L 4HFUL 4M1DH 3V7MA 4YDJB 4HUKB 3T2QA 4X0KB 1AGBB 1QLRB 5JHDE 5I1EH 1DBBL 4J23A 3NABH 3VXSA 5CCKH 4UUJB 4Z7VF 3P30H 3ARTA 1BZ9B 1YJDC 2EXYC 3MR9A 4B7IA 4UQ3A 4M43L 3KYAA 1BLNA 1QQDA 3C5SB 4G9FE 4F7PA 5F6IB 4WWKD 2V5TA 4AH2A 2F74B 1DFBH 2FGWL 2B8OT 4Q9CA 4HK0A 4KHTL 4KROC 4WI8A 4GQPH 3QUYC 3MJ8B 3F7YA 1A6VL 3ULUD 1QP1A 3TYGH 1WF5A 2LV4A 3SY0B 3GJEB 3H3BC 1MCEA 2L7JA 1WIUA 2DLGA 3Q0HA 3VWKB 5KJRH 3EKCA 2I60L 1CGSH 1A8JH 3T0EE 4XMLL 4EEEA 4FNLL 1FL6A 3QFJD 1D5ZB 5TDPA 1MVUB 1KG0A 4DOHE 1KIRB 2DOCA 4XX1G 2JK5A 3ORJA 4NZDA 5F9WB 2WBJA 3MUGA 4HZLA 3L1OH 4OCLC 4NNXA 1LP9A 4AL8H 1UEMA 2FEDC 5BVPL 4MNQD 3DO7A 1B0RA 4KZEL 4OSUH 3T77A 5ADPL 3B9VA 4HMCA 4M6OL 4PRPE 2DS4A 4HQQH 3WNMA 1OLLA 4PD4K 3EDDA 4X80H 1KGCE 2FD6L 2FGZA 5FYJL 1CD9B 5E7BA 2I9LA 3U46B 1ULVA 3C60A 5DEFB 4HULB 3MRIA 2PXYB 4HCRH 4R2GC 3ZKNC 2C7UA 5F7DA 2AXFA 1EFXA 2OK0L 1F90L 5T5NG 5IEHA 1KIPB 2DL2A 2E9BA 1JN6B 1HHJA 1PYWB 2GHWB 1X5YA 3MRPB 4OZGE 4LQFH 2YD1A 4XCYA 3LKNB 2GYSA 5BS0A 1NMCB 2DWDB 4U1SA 4OFKA 2DL9A 3ULVL 2Y23A 5C0AB 2PW2A 4PJAB 2JIXD 5KTEH 3FFDB 3SKJL 1C08A 3BT2H 3QUXB 1MPAH 2MPAL 2EC9T 2A9MH 4QRQB 2VDOL 4WDIA 2VDLH 2ARWA 5IB1B 2VWEC 4NUJB 2ADIA 4EJ1C 3X11B 4P3DB 1IM9A 1OGAE 1P1ZB 4JFED 5J57B 1XIWD 2VR4A 2GJJA 2LU7A 2VLKD 4LCUA 2R1XA 1KC5L 4P99A 1CU4H 5CKAA 2WBJC 3IFNH 2DQTH 3QEQA 2O93L 4WUUD 3NTCH 5DLMH 1HEZB 4QTIH 4YBQC 2P49B 5IF0A 5CGMA 1B6UA 1DQTA 4YGAB 3SGEI 5I16B 2Q76B 3BQUD 4N8VG 1KCLA 2BRQA 4HUVB 5C07E 3C6SB 1AQDA 4WEBH 3Q6FB 4PRNA 1RJLB 1BBDH 5FOBA 3P73B 2F8OA 1KPVB 4PD4J 3RI5K 3WHXA 5IJKA 4JFQA 4IOFD 2CH8A 4F2MA 4AEEA 2G75B 3A6BH 1S5IL 1UT9A 5HHOB 3MRBA 1MJ8L 5GISH 4JO4L 2B5IB 3F58H 3TPUA 2NY6C 5I75B 2R2CA 5IROA 2W1NA 4KKBD 1A7NH 4FZ8H 1EO7A 1FDLH 4Q74A 4UT9H 3THML 3M8OH 1IC7H 3I6LD 2XTLA 1NGPH 3HZMB 5JOEA 4QNPE 2XV6B 1D5XB 1FO0H 2Y06H 1EZVX 4MWFA 2R1WA 4YLQT 1RZKL 4IMLB 4C57C 1II4E 5IFHH 1L0XA 3SGDI 1JZ6A 3DECA 3NPZB 3RP1A 3TNNB 1U41A 2EDFA 3C09B 3S88H 1YMMB 3DLQR 4MMXC 4EDXA 4I5BA 4P5KB 2PN5A 1Z0MA 3NCYS 1HHHB 3BPLB 1CDCA 1A2YA 4OIIH 3KYKL 1TDQA 3FQTA 4KK8C 4X6CE 1KJMB 3KLDA 2RIKA 4G9DA 3HRZB 1MI5B 2P1YA 4NKDB 1YEKL 4LF3A 4HDIA 2YPLB 2C1OB 4M8VA 3FZUD 5A43C 2MQCA 3O3AB 4K3GA 1F11A 1VKXA 3WLWD 4NO3B 5FV1L 5KAQG 1RUPH 3AMKA 4CMMA 3GSNA 1NBZB 4G8GA 2XTJD 5KZCB 1QHPA 5BZWA 3CVHA 2IAND 5I15L 5FK9A 5JW4R 4XT1C 4KMTH 5GRXG 1UM6H 4UDTA 2AK1H 1S7XA 4GW5A 1HE7A 1MELA 3SJVE 3CK0H 2OTPA 5IJKC 5IHLB 4N90E 4RGNC 2G5RA 5ILTH 3G6DL 2PYEE 4YC2C 1I9IH 1ES0B 5A2JH 4XXDB 3QWRA 3TN0D 4KRNA 2FL5A 2PCPB 3HCVA 5DD3H 2FWOA 3O6KH 5F8RC 4XVJH 1JF1A 4AG4L 4DFHA 5EORL 2YC1B 4Z7VE 2YD5A 1KCSL 4Y16B 1T89A 5C09E 1WJ3A 2EIDA 3PNWB 2BOCB 4NGHH 1ZANL 1WZ1H 3JV4B 4QWWD 4OGAC 3M17A 1NBVH 3AVEA 3WFDL 3F5WB 2OR8A 1EAPB 2HJLA 1LNUA 5CJXA 3S36X 2J5LB 3PQYA 1ONQB 4JFZH 5CJQH 3O3BA 4HWNA 2NMSA 3MV9A 4NCC2 3E6FB 5I76A 3TNMB 4MCYA 2N1KA 3EYUH 1R3LA 1VFUA 1JPSL 4MLSA 3CX5K 1U8MA 2CLZA 3OAUL 3TVMD 4OZIF 2F8XC 1UZ8B 2FJFB 4PJCF 5F3BB 3WN5A 3IDYB 3IFLL 3KPQA 3HNTL 5CD3A 4PJ8B 1UH3A 5KSBA 4CN4A 3SE4A 1E28B 2X9YA 4EVNA 4R26L 2HH0H 3UPRA 3LEXA 1RU9H 3OKKB 1NCUA 4XCNB 1CVRA 5HHPA 4M00A 1QNZH 4HJ0C 5E7FA 2LE9A 1I1AB 4M4PA 1WBZB 3KHOA 4X9BA 2CKBH 2X1PA 4G80A 2Z35B 1OP5H 4HIHB 1JF5A 1XGYL 4HKXA 4LEXH 4R7DB 4YHYB 4F7TA 3LCYA 4F33B 5HSFA 4KTYA 3QRFM 5I1CL 4QRPA 1X3DA 3S36H 1CCZA 1E4XH 1S9WA 5F7NC 1YDPB 3FT2B 4V1DD 1A1OB 1I9EA 3ECBB 3KGRA 1MFEH 4S10A 4LHUG 1D9KA 2G60H 5HTSA 1AGCB 4L1DA 2W0PA 1J8HD 1FO0B 4ZAKA 3FT4A 2FB4H 4HWEL 4I48B 4QOKD 4Z18A 3DV4A 3RTQB 1DQJB 4JO2H 1S7UA 3VXNA 2MKWA 3L7FB 4AMKH 1MWAH 4UNVA 5ESVA 1IGJB 2D31B 5FKPB 4D0BB 3UYRL 4JFOB 1Q8MA 3JWDL 4KVCL 4PYGA 1J8KA 2OZ4A 4J12A 4NKIH 3KDMA 3S3PA 4R4FL 3WIHH 3KNBA 1YNTB 3DYMA 1NAMA 4IOIA 4K71B 2EE3A 3WN5C 4GRLB 5GRUH 2NY3D 4DZBB 1VEOA 3CDGB 3P0YH 4P9MH 5HBBA 2W0LA 1J1OH 3SE4C 1MQ8A 3CX5J 3CAFA 4BFIA 1ZV5A 2YRZA 2ADFL 5CHNB 1KFAL 5I1HL 3OKMA 3REVB 2AP2A 4KJYB 4HLZH 2ARJB 1MLBA 4D3CL 2ICEB 5CBAA 2VR5A 2R2HB 5DA0B 3JTTA 4JZJC 1CDYA 4Y19E 3BEWB 3EO1A 2APFA 5DHYA 4HWBL 1ADQH 1INQB 3DWTA 4XPBH 1X5AA 2JF1A 1HNFA 4U6XA 3OSKA 1CL7H 4PLNC 2FYYA 1OARL 1OTTC 4Y89A 2X4PA 1QBLH 2D7OA 4H0IA 3MV7D 4NT6A 4W4OA 3MNVA 1DEEA 4YK4C 1QSFA 3GMOA 3GSUA 4Q0XL 1D9KC 2UWEA 2MOVA 1T3FB 4ZAKC 4RRPA 3SDXA 1T0PB 4JHAH 2VXVH 3HE6B 4NDMB 3RX5A 4XZUB 3VFUA 4AM0B 4ISVB 1Q1JH 3MLWH 4F7CB 3MMEA 1RMFL 2HT3D 5FA3A 3W9EA 2Z91A 3IDXH 2JB6B 5FYLE 3T08A 4BKLA 1OM3H 3ARFD 2W38A 3OL2A 1IEHA 1YMHB 4HS3A 4ZFOA 4PJ7F 3P4OA 2E7CA 4MZ2A 4NRXB 4TVPD 3I3EA 2NW3A 2WM0A 4BK4A 1BOYA 3KPRB 3IJYA 4R97C 4POYA 1BECA 1MNUH 3CLFH 1HWGB 3AAZA 5EZJB 2DWEA 2CDFA 1K3IA 2VL4A 4L4TD 5GGVY 1WCBA 2FH6A 3FQWA 5DR5L 5J1AB 3VWKD 3QI9A 4QYOA 3PL6D 1VACA 4P2YA 4PLJD 4P4KA 4KDTC 4MXWH 2FO4A 4NQDD 4YHLH 2CKBB 3VGAC 2EDOA 4P9HC 5C6TH 1DBJH 2HFEB 3SQOH 2D9CA 1BX2B 2VTFA 4TSAH 5D7SH 1FZOB 1BFVH 3VG9C 4K23L 3QAZC 2YXMA 1UKSA 3DURB 5HD8D 4HC1L 4IRZL 3N06B 1CK0H 3VGHA 3VFWA 1AO7A 1W72H 4Y1AE 1MJ7H 2ORBH 1TVBB 3B3IB 5EIQA 3V6ZB 4EXKA 5DURD 3LH2H 4JRWA 2DBJA 1AGEB 4ELMF 5HYJE 2AEPH 3D48R 5EWIH 1JJUA 2FZ3B 1CICD 4MAYB 1C5CH 4WW2F 1G7JA 2IMNA 1MWAB 1OSPL 3QO0B 5MI0C 4WV1A 4PRHB 1VCAA 3U36A 4G7YH 2GAZA 5LCVH 5A16A 2IADB 2Q6WA 5D7IA 4XPFH 3U30C 2HMIC 3ARDB 3O45A 3WXVH 1PEZA 3JWNC 2EYTB 1GAFH 2B1HH 1FIEA 4LCYA 2JCCF 1M05B 1T04A 3QO1A 1TVHA 2F53D 4L4VB 4X7EC 3AY4A 3PWPD 3CFEA 4KKCC 1J0JA 5DRXA 1ZXQA 3MRGA 3QI9C 4JHWL 1U3HC 4P4KC 1MCWW 4MDJB 4JFHD 4XWOD 4OZIE 1LO5B 2EIEA 5LGHH 2AV1A 2LU3A 3BGFC 4XBGB 1IAIM 2QADB 5AZEL 5HYEA 3GSXB 3BKCH 3QDGD 1MFNA 5F1OB 4N0FA 4HIJB 2CIIB 2AJYL 1TCMA 5D7LD 5I9QC 3GMQB 5ID0B 1FNLA 1T03L 25C8H 4HT1H 4P2CG 4LCWE 4O51B 2YMXH 4DGYH 1S9VA 5C0CB 2VLJD 1RVFL 4XNUL 4ZS6D 3VFNA 4JPKH 1FCCA 1KIQB 3CZJA 4QHUB 3H9ZA 4BH8B 2I60H 2YXFA 4KMLB 5F1IB 1MFBH 3QNZA 1KEGL 4XMLH 2EDBA 4M7LL 2ZJSL 3HZKB 3MBED 3U0TA 4WV1C 4ZQKA 1WAAA 3CZFB 1UJTA 4YO0A 3BIAX 2VXUL 4G5ZH 3X12B 3EJJX 2APTA 1JWSA 4FQCL 4MD5A 5FUCC 1GGBL 4X6EA 4YXHL 2C9AA 4KY1L 4OD2B 4M62H 1CDGA 1AGDB 3VXUE 4IHOA 4EQ3A 4P23A 4JO1L 5I71C 43CAB 1I8MA 3GHBL 1HHKA 1WC7B 4WI2A 1GOFA 3D0VB 3IDGA 2CDEA 4ZFGH 3OXSB 4HFWB 1FSKC 5FYJH 5D71L 4NRZA 5GSRA 1KJ3H 5ABDE 3DVGA 2FBJL 1EX0A 3OR6A 3L3IB 4UNUA 1OWRM 2E7HA 3N1FC 4RIRB 3FQRA 4MA8H 2XOTA 3EYFA 3PGFH 3AU1B 1C1EL 4AT6B 2GSIB 4N8PA 3O8XC 2OK0H 3MRKB 2ED7A 3C08H 1RZIA 2V7HA 3Q5TA 1F90H 4FQ2H 5BQ7A 4KAQL 1FP5A 1UWGL 4KI5D 5GS0D 1JHKL 1GGCL 2CO7B 1MIML 3IVKB 4X98B 5B3JF 5EBLB 2A73B 3RWCA 3VDAA 5HGDB 1SEBB 3QDJE 4G6ML 1UCBH 2J4WH 1E6OL 1CFTB 5IEKB 5KVFH 4OCRL 1T0NA 1W72B 4Y8AA 5I1GL 3K46A 5J89A 1V8HA 2IPKA 4L9LB 3ZKMC 2MPAH 5IVZB 2QEJA 3WLBA 1S7TA 5JA9A 2BSED 3QPQC 2IH3B 5GGTH 3V6FA 4P4RA 1DQLH 5EB9A 4C56A 4LKCA 4JFDE 1OP5K 3P11L 5DGQA 1SEQH 1F58L 4NC1C 5FXCH 5DQDH 5CD5D 3MLYH 1JZ8A 1F4XH 2DQIL 4PJ9B 5FM5M 2O26U 3EJZD 4X4XB 1KJVB 4X5WB 1EV2E 5GS1C 3I02B 4JFFD 3RGHA 4HUXB 2C5DC 4X4ME 4XBPB 4XBEL 5EOCH 3FO1A 1HIML 4N8CL 3BXNB 1CI5A 3CXHK 3HC0B 3Q5OA 3ARXA 2GITA 5MEPA 2F54E 2WSKA 5GGRA 2VN7A 5FO8B 4K2UH 3G9VA 2DF3A 2R0KH 5ECJE 3OHXA 1MJJB 5ITFB 2RR3A 1HHIA 3RDTB 4PJ7E 2IH1A 3QFDB 5IQ7H 3SGJA 4Y4KC 1M7IB 4HPYL 1FQ9C 2CUHA 5IMKB 3FB5A 1F4AA 2EE2A 1FYTB 3GSVB 1MJ8H 1T2XA 3TH4T 4QRRA 3CC5A 5ELIA 3WUWB 3TBWA 4ELMB 3ARRA 2HJKA 2ZCKL 4DGIL 4LVNC 5DHVH 2HT4D 1JI2A 3WS3B 4X7TB 5FYLL 3VWJB 3U0PB 4PJ8D 2WWKO 2OMBA 4KTDL 5L2KB 3ZMRA 3H8NA 2DM7A 5AD0B 1AHWB 3BW9B 5K9QI 1D5MB 1OAXL 3LOWA 3V6BR 3WO4C 5E8OB 5F89B 5MEOB 1XCQB 2OP4L 4S0TD 4TPRH 2NZ9C 1FZKA 2WQRA 1YEGL 4I4WB 4EBQH 4GMSL 4J1UA 5ETUB 4K07A 5JLZB 5EO1B 3VW3L 4K94L 2Q86B 4OB5L 5DK0B 1KLGA 3W2DL 2AW2A 4NZTL 4E41D 4R7NB 1IAOA 4KK6C 4RGMC 4BFEA 2EDTA 1OQOA 3PV6B 3OG6B 4UU9A 1YEKH 3PHQB 2EDLA 3IDIB 5HYFA 1ETZA 1Y18B 4NOFA 3DX9A 4PRIA 2W91A 15C8H 1TXKA 2DQFB 4Q2ZA 3RWFA 1DVFA 1G6RL 4JAMB 1UXWA 4S2SA 4ZFFA 1AI1L 3QQ9D 4GAGL 4TUOA 4MSWB 3CXHJ 4MDIB 3R1GH 5T1LB 4OFIA 4LRIC 2AGJL 1CFVH 4J4PD 1GVIA 1TCRA 5IJVB 1MCKA 3DRTB 5E2UH 4MD4B 3BUTA 3PDOB 2APXA 2JCCE 5AAMA 1CD0A 5GS3A 4G43A 4PJFB 1T80A 3GNML 5EZIL 5HVGB 5I18L 1R5WB 1H5BB 2BVYA 4FFWD 4H5SA 2H2SC 4QTHB 4TNVF 3SDYH 3CFJB 4PS4L 4HD9A 2K7PA 3BPCA 4PJXA 3KPSA 2NNAB 1X7QA 5IP4A 4DN3L 1KCSH 3FB8B 5E5UB 1T2QL 5CGTA 3KJ4C 1KLUA 1WWCA 4ZTPL 2HAZA 3WFDH 4JKMA 4LSQL 4YIQA 3VGFA 1Z0NA 4ZXBB 3GIVB 4OTXH 4BZYA 2IALB 4PY7B 4OCSL 3KYOB 1LO3L 1YEHL 1ZHBA 5TQ0L 5CLWA 4HKZA 4NFBA 4GT7A 3BKYH 1G0XA 1OP3H 1G9NH 5D2LF 2XZCH 1XH3B 2OR9H 1M71B 5I1DB 2EDJA 1TTUA 2WIMA 2BSSB 5J3HD 4XWGL 1ZTXH 2H1PH 4OCYH 4WWKA 4F37F 1X5GA 3A67L 3UTQA 4YGVA 5GGRY 3VFSB 1DVFC 4GS7B 1WBYA 4K7FA 1U3JA 3D69A 3IU3A 4ZO6A 5FM5O 5DSCA 1IMHC 5DQ9B 1GHFL 2WMPA 3MJ6A 5HHXH 2B4CC 5IVOA 1P5VA 4NBXB 3EOTH 3QZWB 3O6MH 5GGUB 4DTGL 1P2CB 1S7RB 4JY5H 4J3UA 7CGTA 3QXAA 1XGYH 35C8H 3QWOB 3D5OF 4JG0H 1AY1L 5HYSG 4H8WL 5DHVB 1CQKA 2CKNA 3ROOA 2NW2A 1KXTB 3QFJA 2A6IB 4HZAA 3BIBX 2WWMD 2WAHA 3B83A 4I2XB 2AQ2A 3RWHB 2R15A 4LPUA 3MXVL 4LSTH 3HG1D 1URLA 2NLJB 4DKFH 4HWEH 4X8JA 1VADB 3PHOB 4MNQA 4Z7UF 1FG2A 4HUMB 1VEMA 4HJJL 1JGVH 3FRUA 2EYSB 1J18A 3WDJA 3P0VH 4LASL 4MVBD 3R4DA 3HMXH 1FPTL 2WINB 2PYFB 4WHTB 4M7KH 2VZ1A 4WY7L 1V05A 3KLAB 4W6WB 4LARH 4W70A 5FGSA 4X9HA 3UYRH 4L3EE 2MHAA 4U33A 1FHGA 4L3CA 1S7SA 4M7LT 3TBVA 2ZUUA 3MLUL 1QKZH 3QEHA 3BEVA 1HYSD 5I30L 3G6JA 4X6FA 4WHDA 3SPVB 3KYNB 5SWZE 5L8LB 2PTTB 5DYOB 1EHXA 4JPIA 4P2OB 4X5XA 2DTSA 1V7MH 3VMOA 1A5FH 1M6OA 1I85A 2IQAA 4YWGH 4UBDD 5I1HH 1A7QH 1Z3GL 5T3ZD 5KBNC 8CGTA 3ULUC 4M61A 4FQQA 3ZE2E 3MLPA 3ARPA 1RJYB 3G5ZA 3RBSA 5EU5A 5HDLA 2JIXA 1QSED 5B3NA 3DVIA 1Z9SA 4HWBH 3ESVF 3KR3L 1ED3A 3GMMA 3T1WA 3RNKA 3VCLB 1FZJA 4JFEA 1AJ7H 3SQBA 3FQNB 1XIWA 2Z93B 2VLKA 2YK1H 3S5LG 5J13C 5IQ9B 5SV3A 3HFML 4GRMB 4GW4B 3G08B 1LK3H 3G6AA 5D7JB 5MEND 3RKPA 4QHKJ 3WFCH 3O4LD 4WUUA 4WHCA 1IAIH 5E2TH 5JHLL 1MHHB 1OF2B 4YR6A 5KS9F 4PGEB 4D9QD 4LEOA 3WFHB 3FQUB 3LKPA 4QRUB 3QJHA 1YPZF 1ZT1A 3BQUA 5JW3L 2EH7H 1HDMA 3BKJL 5FO7B 1KBGL 4IRJC 1FL3A 4HXAL 2WNGA 5T5FL 5JHDB 5BV7C 5C0IB 3VFPA 5LGKA 2P45B 3WKML 5B39B 4AIZB 3LEVH 4XTRD 1FFNB 2K9UA 4IBLT 2ZZUT 1NFIB 3SE8H 1EUUA 4M6NL 5HVHC 3Q6GL 2CDGB 3OG4B 4YHZL 4HBCH 1NFKA 3NA9L 2W0FA 1U8IB 3OGCB 1IARB 4IRSB 4OUUA 4FQJH 4TSCH 4LIQH 4P5TB 1EMTH 3QNYB 1ZS8B 3MRDB 4JEGB 5B22A 4Y4HD 2YS4A 4K8RH 4KZDL 1GOHA 5IHUL 5KG9A 4H0GA 4WCYL 4JB9L 1QYGL 3SO3B 1Q9KA 4NN7C 3K4AA 3Q1SH 3HLAB 3C8KB 3WDIA 3D39D 3GFUA 4RWYH 4WIQA 1CLOH 4QHNA 5J6HA 4DOHB 4K23H 1MSPA 2R2BB 4QCIB 3O2DA 1DBAL 1XIWC 4MNGE 1GPOH 4GG8B 3MQIA 5E5MA 5FB8A 1RUML 4PPTA 1VESA 3EZJB 5H94A 5F7MC 3UTSE 2XPGA 3BQUC 4LAQH 4XPHH 1OSPH 5E99L 2IANA 3HZYB 1A7RH 1IBGL 2GT9B 3SE3A 5C7XH 5HDBF 1TJHH 3HE7C 3GBMH 3UJIH 4JRXD 1X5IA 1UB5A 3BGMB 3R06B 4XI5D 4ETYA 5DRWB 4O2FA 4YJZL 1T5WA 3UBXG 5K9KB 4LVHB 3TN0A 1PBYA 1CZ8H 1BZQK 4K9EC 4KKBC 4LHJB 1NL0L 3MGTA 5DD1L 4Z95L 5DVOA 4Q9RH 5D2LE 1KNOA 3QHFH 1N3NA 4HW6A 1R5IA 3I75B 1JBJA 1R3HA 1KCRH 1A6UH 5FOJA 4Q6IA 5C8JA 3OR7A 2ZG1A 4U1KA 5JR1L 4PJ9D 5EUOE 4NZRH 5LGJB 2Z92B 5CUSL 5F96H 4Z7WF 3BYTA 3R8QA 3QUML 3REWB 2P7TA 4R4ND 1EUTA 1T03H 2X40A 4N1HB 1TQBB 2XRAL 4XAWL 4PJGF 1RZ8B 5H35B 1IAKA 4LDOB 1MCWM 2FCBA 1T1XB 3E0GA 2NY0D 5GSVB 1RUAL 1YJDH 1FBIH 3TBTB 3PIQB 4Q97A 4MHHI 3BH9A 4WU7A 4BQ9A 1JNJA 2APBA 3S37L 4OM0L 4OI7A 3TVMA 4U3HA 5IG7B 4PTUB 3FZUC 1AP2B 2B1AH 4NIKB 1AR1D 2NY2B 3WLWC 2VDRL 2D03H 1NKOA 1PFCA 2XTJC 3JV6B 2P42B 4WJ5A 1YEIH 2WK2A 1XAUA 5GIRB 2HJFB 3MRHA 1UKTA 2I25N 1MRFH 1V7NH 3SE3C 1VB9A 1XMWA 5ISZB 1TZIA 5JO5A 4Z7UE 3VH8B 2O5XL 4X7CC 4YXHH 3RIAK 5L2KD 3GMLB 3ZDZF 3K7UA 2CLRA 5DD0L 3MROA 5JZ7D 4I3RL 2FJGB 5FIEA 3EYVB 1NUNB 4GUPA 5FYKE 1FRGH 2WQ8A 3L3DB 4L29B 5D71H 5DUPL 5E8NB 3CH1A 4FQIL 2F9BT 4FQHB 3V4UH 3EAKA 2FBJH 2YD7A 4V1DA 3HUJA 5IFJB 1OAYH 3MV8D 1C1EH 2YD4A 1J8HA 4LNRB 1OP3K 1Q94A 3C5ZB 2OTWA 4QOKA 5CJBA 4QWWC 1UWGH 5IGXL 4KKLD 4ZSOA 5JPMB 4U1MA 3RY4A 1OQXA 4YBLC 3RWGA 4FA8A 4U0QB 2XWBB 1Y6MR 1LP9F 2X42A 1XGTB 2ADGA 3K8MA 3FOMB 4GKNB 4J3OC 4X6CB 1YPZB 4QRSA 5DDHB 2WUCH 3SOBL 1AH1A 4ODWA 1K4CA 5FYJD 1W0VA 4WW1B 3FFCB 1KXVC 3MJ9A 3N85H 3VFRA 2R39A 4LLUB 3TVMC 2DJUA 2DMKA 3C2AH 3L3GB 4KRPB 5L6YL 1MCPL 3BESR 2Q8AL 4QEGA 4F15B 5C0JA 1SBSL 4Y5XC 2HTKD 4JDTH 1F58H 1G7PA 2NY1B 5I74C 2DDQL 3EIFA 4H88L 3TT1L 5F9OH 4V2BA 1OAQH 3DHJA 4HX1B 1QRND 2EO1A 5DUBB 1I4FA 2V5SA 5KSVA 5KS9E 4P3WA 1GH7A 3BSZH 1D3CA 3ULVD 4ODVL 5GJSH 1Y0LB 3DRQA 3GGWB 3WJJA 1HXMB 5A2FA 1QEWB 2VMFA 2F5AL 1XR8A 2V9QA 3HHRB 3MV7A 3H3PL 5SWSE 4D94A 2FECL 3MNWA 1NLBH 1YQVL 2VISB 4D2NA 1Q9OB 3T65B 4X0KA 1AGBA 3H42H 4R90L 4RMRA 1FL5B 4GXUN 4U49A 4JKWA 4MA1C 1XF2B 1BZ9A 4DGIH 1CFNB 2DBLL 2A1WL 2MWCA 2XN9B 5FYLH 1H3PL 2X2YA 4MX7A 1KTKE 3EYOA 4KTDH 4PJDA 5GGSY 2CRMA 5I1JL 2FATH 1I3VA 1NBYA 3ZTNL 3WS6A 4NRYB 3J7HA 3ARFA 5F7EH 4DUWA 5H2BA 4ONGL 3SY0A 5JDJA 1D6VL 3BRGC 4KROB 4NZTH 1N6UA 4L4TA 3QUYB 4NCC1 3VMPA 4M7ZC 3OKYA 3RGVD 3VWKA 2QHRH 4PJBB 5FECA 3PL6A 3NIFF 4KTEL 3BKMH 4RGOL 1RULH 3GO1H 4NQDA 4HIXH 4WHYH 2ZUYA 3UPCA 3OPZH 2VIRB 3E2HC 3F62A 3FN0H 4U3XA 3OKNB 1F4YL 1FNFA 5J8OA 3OJ2C 4CN1A 3JTSB 1YUHA 2VLLB 4Z77A 3WJJC 3EO9L 5HYQB 4X99A 1G6RH 5ICYA 4JFEE 4Z7WB 1AI1H 4JPWL 5B38G 4DVRL 5JQ6H 1I9JH 5KW9H 2VB5A 4NN6C 5IB4B 4KUZL 4HPOL 2GCYA 1M7DB 3WE6B 1XCTA 1CE6B 1NAKL 5IIEA 2DJ4A 1ZSDA 2XG5A 4NJAL 2V9TA 4S1DC 1CICA 4KGJA 5I18H 1RZ7L 1ZT4B 4HUUB 4RQQB 1IGMH 2AEWA 4Z76A 2AJ3B 1NCWL 2AK4E 3L3KA 2Y4SA 3LV3A 3NCFB 2WUBH 3UMTA 3GI9L 4NQCE 4R2GB 3VXSB 3PP4H 3WS6C 3V5HB 5HHME 4UQ3B 2KH2B 4KJPD 1CFBA 1BLNB 3ARFC 1E4WH 4JN1L 4KPHL 1G9EA 4M3JA 4F7PB 4F58L 1ZK9A 3K4DA 4HK3J 4RAUA 1HN1A 5I66A 1BFTA 3VE0B 4K3DH 1RD6A 2F53A 4PJAA 3FFDA 4PJGE 3RVUD 4HK0B 3PWPA 4JG1L 4P5MB 3F7YB 4NUJA 3PL6C 4PLJC 4WFED 3X11A 1NEUA 1FAIL 1FGNL 3BMWA 3S35X 2R4RH 1MY5A 4KK5D 4OLWH 3QDGA 2VC2L 5GRVK 1YC8A 4I9WD 3L5JA 3GJFH 2ERJC 5D7LA 4C54A 1FL6B 5M7QA 5TDPB 2IBZY 1KG0B 4WUKL 3TEUA 3LHPL 4BSJA 4XCFL 4OIAA 3SDDD 2JK5B 5I16A 3GSWA 2WBJB 5D93C 4E0RB 4HZLB 3LN9A 1GHFH 3DO7B 4OCWH 1B0RB 2VLJA 5JHDD 2AABH 3T77B 3ZDZE 1RJLA 4WVRA 4UIKL 1KB5L 4CAGA 4JO3H 1FFOA 3GSNH 3SBWA 4DKAA 4UOW1 1CICC 4YAQA 3CVHH 3QEGH 4X7SL 4G9FD 3CD4A 3W0WE 2I9LB 5HY9B 3MBEA 3KVQA 3TH2T 5IBLD 1CFQA 3MRIB 3O0RL 3FCTA 4IRSD 4ZODA 3GIZL 1EO5A 5F7DB 2AXFB 2YUZA 4XMPL 4U0RC 1Q38A 4RX4D 5GZND 3BPNC 5KN5B 4WU5A 1IFHH 3KS0H 4RISL 5EN2A 2AKRA 5IEHB 1HHJB 4LASH 3S35H 2NY6B 3L5WA 5FYKL 3OGOE 1D5XA 1OTSC 3QIBD 4XCYB 1VSCA 5ERWA 5IESL 5AYUL 2ADJA 5BS0B 1AQKH 5DJYA 1KV3A 4U1SB 3T0ED 3MLUH 3O6LL 5MP6H 5A2IH 2PW2B 4TTDD 1PSKL 4P5KA 1C08B 3LKSB 2AJXH 4XWOC 3IAPA 5LWYH 4PBVC 2BNUB 2AQ1A 1JMXA 4WDIB 1NEZG 4HV8A 2ADIB 1DN2A 1LEIA 1IM9B 3HRZA 5I19H 4U7KA 2C1OA 4OZHA 4H0HB 1G6RB 4PRPD 1P7QD 3PABA 2R1XB 4ESKA 1KGCD 1Z3GH 4LFHD 3CDCA 2AS5M 3F65A 1A9EA 3QEQB 3PDDA 4WTZG 4RFNC 5D70L 4WFFE 2DTML 5F44A 2V2WA 5IF0B 1HWHB 4QXGH 4ZS6C 1N0LA 2F58H 4H1LA 1Q9LB 3SBWC 7FABL 1QA9B 1AQDB 4PRDA 2OR7A 5HI5D 3GK8L 2BY2A 5FOBB 3MBEC 3UDWA 5C08E 3RVXC 3WL9A 4FZEH 5CJ5A 3WHXB 4JFQB 4X7DC 4RGNB 4ZUTA 4F2MB 3TA3C 1QHOA 1KLFA 4YC2B 4ZO9A 4JFFA 5F21B 4ZPVA 3K3QA 4FRWA 4O4YL 2YC1A 3S6CA 3O9WD 4HF5L 3W81A 3TPUB 2DLEA 2BOCA 4GG6A 2P5WE 1MCDA 1MFDH 3BAEH 1OGAD 1T1WA 1V3JA 2X10A 3S96A 4L8CB 3LN5A 1TJGH 5I6XC 5I8CB 1MCQA 4MWFB 2R1WB 1NCTA 2VQUA 3L5XH 3MRFA 1DEDA 1MIEH 2E9WA 1F02I 1ZVSA 4YXKL 4TQEH 2ZWLT 3HR6A 5CILH 3RUGA 4AEHL 4KI5C 1JGUL 3AROA 3GJFB 4OQ1A 3SCMC 5GS0C 4LSSH 4EDXB 4I5BB 1TQCC 2UWEF 4BQCA 5BV7L 1K9TA 3UYPA 4B53A 3EFDL 3FQTB 3NIFE 4PJ8A 4M1GL 5C07D 2IPTH 1E28A 2OZ4H 4G9DB 2LFGA 1F13A 4LF3B 5HHNA 4HDIB 4E9LA 5EA0L 1NAMH 3OKKA 4AIXA 4N0UA 3BVNA 4XCNA 1F11B 1VKXB 3GSNB 4G8GB 5B8CA 4F57L 1G7QA 1I3GL 3CVHB 1UENA 1N0XL 5FK9B 2FSEA 1F3RB 2Z35A 3I50H 4UDTB 5D72L 5E8PA 1S7XB 4GW5B 3UDWC 1BFOB 1MFAL 4LU5H 3QYCA 4P9HH 4A6YA 1EO8H 3S8WA 3QXUA 1ROWA 1JPGB 1T4KA 2ZOLA 3EJZC 3VFGH 4DUVA 1RUMH 4K8RD 1A1OA 3VRJA 1KPUA 2ITDA 2FL5B 1MCHA 2FR4A 5FUZH 5E99H 3EDFA 2CGRL 1JF1B 5DFWH 4XC3H 3QNXA 1XR9A 3HB3C 2XZZA 4X6DE 1HZHL 2LVEA 3L7FA 1U8HA 5DJ8A 4HKJA 1L7TL 2BMKA 1MCOH 4GLRI 5DJ0A 4J4PA 3M17B 1AR2A 2HJLB 2DI9A 3WSQL 2BCKA 4YHIB 4EN3D 2EH8L 1B4JH 4J8RA 4LSPL 3PQYB 5JXED 4MB5A 1YNTA 3QG6B 1F8TL 3P4MA 1GJIA 1NGWA 4TSBH 5TE7L 2HT4C 1JNLL 3LSOA 1CD8A 4RMVA 1TTFA 1ZHLA 2APVA 4KRPD 3CDGA 2B39A 5DD1H 3U0WL 2R0LH 4MCYB 5I76B 1R3LB 1U8MB 1IQDA 2CLZB 4X4YB 3HNVL 1KF9B 3SJVD 3WN5B 4C83A 1PAMA 2GK2A 3BD4A 3KPQB 5CD3B 3REVA 5GPRA 5KSAD 4N90D 5KSBB 4KJYA 4D0DA 1LE9A 4EVNB 5B8CC 2ICEA 1GXEA 5BW7A 3UPRB 2PYED 4NCDA 2R2HA 3LEXB 4K9EL 4OCMC 4WI4A 5HHPB 5LQBL 4N5ED 2R4SL 3ILQC 5C0EA 2BXYA 1RUAH 1YNKL 3JZ7A 4XVTL 2ESVE 4JZJB 3D9AH 1B2WH 2ZUSA 4G80B 4LNVA 3MOAL 3R0NA 2F19L 2NX5E 4HKXB 5C09D 4FABL 3MUZ1 1LDPH 4F7TB 2AQ3A 1FVCB 3O3EA 1KTLB 1BQHG 1S9WB 1NC4D 1M1SA 1T20A 4GMTL 2VL5A 4LFHG 4YK4B 2C3XA 1D9KB 2X4OA 4AM0A 3MPCA 3QQ9C 4M93C 1PVHA 4U1NA 4YQXL 4ZAKB 3FT4B 1YA5A 2O5XH 1OVZA 3GRWL 3DV4B 3OKDA 3EW3B 2I27N 4UINL 2JB6A 4BA8A 4YFDB 4AENB 3JWOL 2EXYD 3UX9B 3VXNB 2K1MA 4W4NA 3UBXA 1Z6JT 1RHFA 5ESVB 3EOBA 3LDBC 2VZUA 2XZQH 5ALBL 2XWJA 2V7NA 4FFWC 4NRXA 3IKKA 5HPOA 3EGSA 3QEUA 4ONFH 3WXWL 4L4JA 4M7JL 2CJUL 3KDMB 3QH3A 4KROD 3KNBB 1KN4H 1NAMB 4IOIB 3HG1A 3KXFE 4OGYL 1LMKA 4R97B 2J8UA 2L0DA 2DLFL 1CTOA 1YECL 1KUMA 1ZEAL 2CKBA 1JF6A 4PFEA 5T33H 2DQJL 5D8JH 5F88A 4BFIB 4MMZC 5MHSE 1B4RA 1B0WA 3OKMB 3GJFK 4AIOA 2P8LB 3VGAB 1BX2A 1MLBB 3CUPA 2HKFH 5A40E 2KQMA 5CBAB 1VPOH 4TRPL 2H32A 5CINL 3JTTB 4TUKL 3EO1B 4FS0A 1YQ2A 5DHYB 2EO9A 4O58H 4U6XB 1IT9L 1LO0H 4TTGA 5J3HC 2FYYB 2EC9U 1NBQA 2X4PB 3B3IA 3VG9B 1HQRA 3QAZB 4BQ6A 1AGEA 4NM8H 1MEXL 4NWUL 4NT6B 5I8KH 1DEEB 3TWCH 1J05A 1QSFB 2ZUVA 3GSUB 4X9IA 4RA3A 4ZOEA 4OLYL 3SDXB 2L4OA 1N64H 4OD3H 2AEIT 5DMKA 4CMHC 2RBLA 2XQBH 3ZKND 1QSEA 3GMRA 1INDL 3F12A 3HC4L 4ODVH 1ORSA 3VFUB 2P5EE 4XNYL 5MI0B 3I3DA 2A6JA 3MMEB 3W9EB 5FA3B 3WBDA 2W60A 3NFPA 3U30B 2XXCB 4XP1H 4BKLB 1FAKT 1U92B 2WWMC 2FEEI 5F9AC 5J7CC 5D5MF 4HS3B 4ZFOB 1AXSB 5MENA 2D7PA 3DIFB 4U3CA 3O4LA 4P0DA 2NW3B 2EZ0D 1R5VA 3LVEA 1NLDL 2Z4QB 2DWEB 4MDJA 2CDFB 4NFDA 4Y19D 4DGVH 4MVBC 1WCBB 1RJZA 2IAMD 3MC0A 3GSXA 3FOLA 3QI9B 1VACB 1U3HB 3VFVA 4P4KB 2FO4B 1EZVY 4HIJA 2AJZA 2CIIA 2R0ZL 2W9LA 2VAAB 2GEEA 3GMQA 3BGFB 1MRDH 4KC3B 4AEFA 3N9GL 4PRAB 3IXTA 1OSZA 3BYYA 5C2BL 5I9QB 1ZLSL 2E8YA 1DBKL 1IEAB 4J3WA 5F71A 3VXRE 5C71A 3V52L 4UV4H 2BVTA 1KIQA 4B50A 1TNNA 3VFWB 4UBDC 1PX3A 1AO7B 5B21A 4Y4HA 5FYLD 1J5OH 4UOJA 1NMAH 3SKMB 1F00I 1F4YH 4OI8A 1G7JB 3JV0A 3EYSH 3CXDL 4KK9D 3D39A 4WV1B 4N9GA 2AXJA 1QUNA 2H8PA 3U36B 4OD2A 2GAZB 4W68A 5A16B 2D7TL 1I3UA 3H7LA 1HCVA 4RBPK 5D7IB 2NY6D 4DVRH 3KLHD 5KVDH 2VDNL 5M94B 2VDML 2XWTA 3O45B 1WC7A 2QQKL 4QY8A 1QRKA 4PJIE 3OAZH 4HFWA 1RUKH 5I1KH 3ME0A 3RIFK 4LCYB 3X14A 3SGKA 3EZ8A 5I71B 4LVEA 4NJAH 4NQEE 1T04B 1WV7T 2HKHH 3QO1B 4RIRA 1FSKB 1RZ7H 2EDYA 3AU1A 3GMNA 4U31A 4AT6A 4LLDA 3CFEB 3LKOA 1QG3A 5DRXB 3D25B 1NCWH 3NCEB 3MRGB 5CZXD 3TF7C 1IC4L 2PETA 3PXJA 4XVUD 3QIWD 3RJQB 3IVKA 1R3IH 5EBLA 4ALAH 2AV1B 4XTRC 1SEBA 4JRXA 4DEPC 4KPHH 1HINH 4Y1AD 5CEZE 1XZ0A 3TIEA 3U9PL 5HYJD 3K8LA 4PRBA 3BUYA 4KXZI 5IVZA 5TF1H 2UVFA 2BRRL 3P2TA 3NN8A 1H15A 2EDQA 2IH3A 3DXAE 5BRZE 3IETA 3S7GA 4X8XA 1S9VB 1OCWH 4Y4HC 3VFNB 3ZYOA 1WK0A 1U42A 2VC2H 4JRYE 4ZDHA 4PJXF 4PJ9A 4NKMA 3K1KC 1LO4L 3GHEH 3QNZB 4LCIL 4X4XA 1WFTA 4X5WA 4JR9L 3U0TB 3I02A 4ZQKB 1BIHA 4WUKH 3LHPH 4YO0B 4E41E 2ZUQC 4ENED 3T0AA 5IBUG 5ALCH 1JYVA 3BXNA 1JWSB 1N6QL 4NM4L 3CGTA 4XP9L 1EAJA 1F2QA 4LCCA 3VXOA 4MD5B 5GS1B 4X6EB 5ACLA 3MOBL 4HMEA 1ACZA 1UM4H 5FO8A 4P2RE 2CK0L 5EBGA 1MY7A 1U6AL 1V5JA 3RFZC 3SGKC 4NWTH 1I8MB 1HHKB 1YYLL 4OGAD 2IG2L 2ZG3A 3IDGB 2V9RA 5GSRB 4NRZB 5TE4H 1I1FA 4UILH 1E27A 2Y5TA 5IMKA 3DVGB 5TH2A 3GSVA 1IE5A 3H9YA 3FQRB 2B4CH 5GGVL 3GIZH 3EYFB 4Y4KB 3V0VA 4LCWD 1YN7A 4JN2A 1P7KB 1RZIB 5FUOH 2V7HB 2N7AA 1BD2E 5TGBA 5L2KA 3RL2A 1X5JA 1AHWA 1WGOA 4LVNB 2BY1A 4NQTA 5D1ZD 5DJ2A 5E8OA 3RWCB 1J86A 2XI9A 5F89A 3ULUF 1XCQA 4KJWD 2FX8L 5AYUH 3TH3T 3W11D 4PUBH 8FABA 1RHHA 5JLZA 4I77H 5FDWA 1T0NB 1A6WL 1I9RH 2I5YL 1A9BA 3WO4B 2VXQH 1XGPA 4LPTA 3O6LH 5K59F 2IPKB 4AQ1B 3MV8A 4R7NA 5D1QC 1YZZA 4PJHF 3WLBB 1S7TB 1F4WL 5DJAA 3IFOA 3V6FB 4NKQB 4P4RB 4LKCB 4MJIE 3FHAA 4OQTL 3TV3H 1N4XH 3VXUD 1AE6L 4Y2DD 3O81A 4RGMB 3DGGB 6FABH 1OAKH 4R4NC 1Y18A 3DJ9A 2AJUL 3H2WA 5BO1H 1F6LL 3QRGH 3P77B 3TT3L 3V6OC 2ZPKL 4YFLI 4I0PC 2GI7A 4JY6A 5D70H 5I8OH 2NY0C 4LCCC 5FYJU 2RB8A 2MJWA 4NUGL 3QCTL 1N5AB 3KPOA 4XCCH 4PGJA 2GITB 5MEPB 2H45A 2D7QA 2FJHA 5DFVC 1AR1C 3JVGA 1B0GA 1IRAY 3JV5A 1A7PH 3G6JF 5HGAA 3CNKA 4MD4A 4CUCA 3V95A 3OHXB 4PJFA 3ULUH 3QDJD 5CEYB 3VXME 5D5ME 1HHIB 4OFPA 3T0DA 2IH1B 1H5BA 1QRNA 3FB5B 1DQQB 4QRRB 1RZGA 2B7DT 3CC5B 2GIYA 3FB8A 3TBWB 1BGXH 3BZ4A 2ENSA 2HJKB 5ADOH 2HWZL 5C1MB 1QTYT 4OBSA 3MLTB 4MXVF 4JFDD 3ARGD 4YDIH 3DUSA 1PLGL 4XVSL 3C2SA 3V79C 5SWQA 3KJ4B 1FFRA 3DI3B 1CYGA 1NFDF 1FZKB 3FO0H 1WWBX 4J1UB 4YXKH 1NEZA 1XH3A 4KKLC 5L2JA 1NCCH 4ZD3L 2X9WA 3UZVB 5E8DH 2AXHA 5E8EA 2BSSA 1IAOB 4J3XA 5BV7H 3EFDH 1NUGA 2F54D 1KACB 2BNQE 4Y7MA 4UU9B 5EA0H 4BFGA 3DSNA 1OTUC 4IDJL 3GZKA 5DD5H 3DX9B 4PRIB 5DQJA 2X05A 3H9HA 2HFTA 3T8XB 1VHPA 4IMKC 4N8VB 3NFNA 5DQ9A 2EICA 3RWFB 1DVFB 3JVGC 2WIIB 2O5ZH 2IC2A 1UXWB 5HYIA 4S2SB 1DP0A 4OLVH 2HTKC 1C16B 2G5BB 4TUOB 3RGVA 1MFAH 5ITBH 1P6FA 2P24B 1A3RL 3AUVA 5DI8B 5DHVA 1TCRB 4LBEA 5KVEL 5EU6E 2A6IA 3HNSH 2AJVL 4I2XA 5F70A 4PJ5E 4I3SH 3ULVC 4XP4H 3UXFA 4H5SB 4H26A 5IT2H 3BPCB 4PJXB 1T7XA 1G9ML 3KPSB 1IGCH 1X7QB 3KPLA 3OJVC 1P4IH 2DKSA 4LPVA 1SYVA 4UTBL 2MKLC 1HZHH 2DQEH 4YFLF 4OIBA 1KLUB 1P69B 1SQ2N 3HI5H 4LLVA 4G8IA 4O5LL 4YIQB 3TCLB 3SEPA 3NFSH 2XA3A 1HI6B 3A6CH 4LSPH 1KELL 1RFDH 1ZHBB 4AQOA 4KGLA 3MLZH 4HKZB 2XKNA 2HRPL 2DAVA 4ERSL 1WIOA 2R9HC 3WKNA 1HYRC 4PIRF 2VKXA 3FMGH 3MA9H 4S1QL 5CEZL 3TC9A 1RK1A 1MQKH 3NPSC 4YUEH 3U48A 1G0DA 3K2UH 3T2OA 4Y8DC 3GSRA 1RJYA 1ZLUK 4NQVB 4PB9H 4K9EH 3IAQA 3L95A 1WBYB 1J1PL 3D69B 4HLZG 1OGTB 3IU3B 1LQSR 1PG7L 3RGVC 2H3NB 4PB0L 4XVTH 1H3GA 1YNKH 1N7MH 3A0OA 3MLSL 3VCLA 5IB3A 5JIPA 3NAAH 2YUVA 2ATKA 2NY5L 3T0WA 3PE9A 4G6JL 2PTVA 1FORL 3KYMA 5IQ9A 3OAZK 3O2VL 1SVCP 1CWVA 1A47A 3G08A 4PV8A 3CSPA 5JW4Q 2NW2B 1RZKC 4Y5VA 3QFJB 5J13B 3O2DH 1PKQA 3BWAA 3SDDA 4TNWK 1NMBL 4KKCD 2DRUA 5DRZA 4YQXH 5FDYA 1FLTX 1Z2KA 2E7LC 4X8JB 2A9NH 4MNQB 1U3HD 1FG2B 4NFCA 1UJ3C 5JHDA 4NO0D 4KVNL 4I13B 4FMKA 3WIIH 1DUYA 2DI8A 2ZNWA 3JXAA 5JDSA 3BO8B 4IRJB 3PHSA 4FQ1L 5DTFB 2HT2D 1SY6L 4ZFZA 5BV7B 4G9FA 3TP4A 3VG0L 4L3CB 3ZYZA 4AEIH 3TBVB 2DQHL 5ANME 2ZUTA 3QEHB 6CGTA 4MXQC 1VEPA 5DZNA 2JE8A 5HVHB 4IRSA 2DYPD 4Z7NE 4HIEB 3AS3A 4PJHE 3DBXA 4GSDL 4RX4A 3EDEA 1NCBH 5HJ3A 4ACPA 1ZS8A 4KJPC 4UDUA 3MRDA 1UM5H 4JPIB 3QDHA 5E70A 2YPVL 4X5XB 2Z0BA 1YECH 3CFIC 1GIGL 3FO9A 3B6SB 1M6OB 3QIBA 5IFAH 1JRHH 2QSQA 2IQAB 3MCLH 4KKNA 4MQ7B 1S78D 3U1SL 3RVUC 4Q9QL 1EHLL 4NP4L 2FX9H 3GKWH 1LHZA 4M61B 4FQQB 4FFYH 3T0EA 5T1DH 1WTLA 4LP5A 5CINH 3G5ZB 5EU5B 3D85B 2JIXB 1HH6B 2R1YA 4MJ2A 1TETL 3ALPA 3WYRA 2PF6A 2DI7A 4NN7B 4QT5A 2UZIL 3P9WB 4PREA 4KK5C 1ED3B 5L0QC 3GMMB 2EXWD 3ETBF 4TULL 1SMAA 5HVFB 2C3VA 2M2DA 3STBA 1I1CA 1FZJB 4JFEB 3ELAT 3BE1H 1XIWB 3RHWK 1VFOA 4PRPA 3DOSA 1P7QA 4Y5VC 1BQHA 2VLKB 4JDVA 3V5DB 3V6OE 3SDDC 3G6AB 4M48L 4LHUB 4L3ED 4OLYH 4WUUB 4JDZA 4KHXL 2EIZA 4YR6B 4LEOB 3LKPB 2QQNL 3OX8A 3QJHB 3O8XD 3BQUB 2JB5H 2WW8A 4UAOC 5SWZD 5IVXF 1HDMB 1VFAA 2AK4B 3IRPX 4KQ3H 1FL3B 3ZHLA 4APQD 1I1RA 3QHZH 4YHOL 1JL8A 4B7LA 4P49A 3D18B 5K9KA 3HE7B 4OZGA 5IBLC 4G8EA 5IUSA 1QBML 5HHMB 1NFDE 4LLYA 1Q0XL 1A3LL 2D4FA 3RA7H 1KJ2L 5GZNC 3INUL 3O4OC 3QCVH 3O9WA 3I75A 4OUUB 2IJ0C 4HKBA 3QPQD 3CMGA 1OAUL 3QIBC 2CXGA 3KJ6H 4HWBA 3LMJL 3GBNH 3WD5H 3K80A 3RI5F 5E6ID 4OJFL 1OGAA 4OT1L 3T0EC 3BJLA 4P59L 1BF8A 5KG9B 1S9KC 1R3KA 3DVNB 5J06A 1Q9KB 1G7LB 1YEEL 1ZLSH 1I7RA 5TE6H 5HDQL 5J6HB 4PTTA 1CIDA 4PTUA 4OD1H 4PV9A 1A6TB 3FT3A 4L1HA 4ODHL 1JMZA 4ZYKA 4LPWA 5C07A 3OAYH 3A6OA 5E5MB 4EDWL 3ARQA 3JV6A 4JPVH 5FB8B 3X3GL 1TPXC 1WZKA 1EGJL 3JWDC 4Q58C 3WNLA 4Y4KD 3ZT7A 2XTJB 1DDHA 2IANB 3GMLA 1RIUL 1MF2H 2D7TH 5HI5C 5JTWA 3NCCB 1DQDL 3QCUL 2VDMH 1T1YA 3LS4H 3G5YA 5DMIH 2QQKH 1KN2H 3QP3A 3MACL 3K74B 2IPUG 5E8NA 2GSGA 2YSSA 2PTUA 3T1FA 4O2FB 1F42A 1JTPA 2GY7B 5F7WC 3VJ6A 1P84K 3OTTA 4P48A 3MLXL 2NZ9D 5HI3D 3S34H 3O9WC 3L6FA 4CDGC 2YHGA 4ZPTA 2COQA 5JPMA 3KPTA 1KEMH 1JNHA 1N3NB 1UA6L 1IKFH 1R5IB 2EDKA 2XA8L 3QXWA 4KK6D 1A22B 3BDYL 3T4YB 3ZTJG 1R3HB 1A1NB 1C5DA 3FOMA 5C8JB 3OR7B 4X6CA 1K6QL 2NTFA 4U1KB 5DDHA 4P46D 5IMOB 4HC1A 4XPAL 3HAEA 4F7EA 1SJEA 4YBLB 2DQDH 1RIHH 2ZKHL 4OF0A 3ZL4H 4EN3A 2P7TB 1QFWM 2O61A 5JXEA 2E6PA 4NN5C 3V0WL 1JUFA 1DTUA 3UTSD 4LLUA 1IAKB 1DQML 4OCXL 3UC0H 1EEYA 1V3MA 2P43B 1TZGL 3L3GA 5C0RL 1BEYH 3BOVA 1HKFA 4HH9A 1H3WM 3BH9B 4WU7B 3QXTA 4OM1H 4PGBA 3TVMB 3LIZH 3SJVA 3BX7C 4ODTH 1N5YL 5CAYB 4TVPH 4C4KO 5KSAA 2NYYD 4Y5XB 4LCIH 1JP5A 1QZ1A 3LN4A 2PYEA 5I74B 3QDME 4M5ZL 3EFFB 4Z7QF 4C4KT 1O5DT 3MRHB 3I6KB 3GGWA 4JVUA 5GJTH 5IW6A 1J0KA 1TZIB 2MQ0A 5JO5B 2N4IA 1X4XA 3V4PH 3ZE1F 1UC6A 3WV0A 4PJAF 2CLRB 4UV7H 3MROB 2CK0H 1R0AL 4Z7VA 1CLZH 3TESA 2OCFD 5C09A 2Y07L 1FV1A 2GK0A 2IG2H 2AJSL 3IS1X 5JUEL 4L5FL 1UQSA 1IGTB 3MLRL 1QFOA 4MA7L 3V9FA 2HA1A 1Q9OA 1NC4A 3T3MF 4JGUA 4V1DB 1FL5A 4FTVE 1EEQA 1P84J 3HUJB 1B88A 1CE1L 5K33A 5IW1A 3NCJL 1J8HB 4QOKB 5K9JL 3OZ9L 4ZUWA 5T3XL 4ZSOB 4CKVX 3LPGA 1DN0A 4U1MB 4MGXA 2X70A 4MA1B 4JM2C 3RWGB 5DT1L 1ZHKA 3FQXA 1EERB 3H9SE 4EN3C 5I75C 2R23B 2ADGB 5JXEC 5BVJA 4U1GC 2GJ6E 3LEYL 1OPGH 5J12C 5K9OA 3HMWL 3VD5A 1DL7H 4OKDA 1K4CB 1W0VB 3ES6B 1X5LA 3W5NA 3U7WL 1MAMH 3VFRB 2X4RA 3F7PC 3WNPA 2XICA 3CFCH 4Y4FD 3DI2B 3MFFB 5BJTA 4UT7L 1IQWH 2KL6A 5C0JB 5KSAC 1MOEA 2IGFL 5FHBH 5GXBB 2X4SB 4FG6D 4M7ZB 4WI5A 1G7PB 2A77L 2ICWA 2YWYA 3ZYIA 3FN3A 5L9DH 1PX4A 4PJEE 5HI4C 1ERNA 5FYKD 4FP8H 4YH6A 2ZPKH 5MEQA 4LLWA 1A0QL 2E5EA 1QLFA 3DSFH 1FE8H 3ZKQD 4OUOA 2QQQA 3E2HB 1I4FB 2W92A 4MJ5A 2ZCHL 1CIUA 3UCRA 3FONA 3DRQB 5IVXE 4OF5A 3NZHH 3OJDA 2ENYA 3T0XA 2ZNXA 1YYMH 4BSWA 1XR8B 1CE6A 3M07A 1Q72L 1LGVA 3O3UN 4X6DB 4UTAH 4NN6B 3KG5A 1J1XL 3I9GL 2CO6B 4LL9A 4ZTOL 3TBSA 2D9QB 4KI5F 2YZ1A 2AJ3A 3MNWB 5BZDA 1FC1A 4P3CL 5DS8A 2VQTA 3E1F1 1MHPL 2DKMA 3V8CA 1WUNT 3QIUD 4JY4A 1HSAA 3ARSA 3V5HA 1F3JA 4OF8A 4UOW0 3U6RA 4MX7B 5C9JB 3EYOB 3IDNA 4PJDB 1C5BL 1FIGH 1LO2H 1NBYB 1XGUA 3VE0A 1ZHNA 4F3FB 2CRZA 3ARFB 1WFUA 4L9DA 3CJJA 3STLA 4DVBA 4GRWH 1AD0B 2O5YH 3O2WH 4P5MA 5GGQH 3ULSB 2CPCA 4G6KL 5I1IL 5H2BB 4ZD3H 4Y19A 4L4TB 2EDHA 1A6ZA 4WGWB 1CF8H 2IAMA 2BFVL 4X9FA 5HGHB 3FHQA 1NGQL 5FECB 1DLFL 3PL6B 1TJIL 1JHLH 3MJGX 4NQDB 1X6NA 1IGIH 4LOUD 2EDWA 1JGEA 1IGYA 2NX5B 5DMYA 2BERA 5DZLA 2FHFA 5SWSD 5DWUH 1N8ZA 4E0RA 1YUHB 4Z5RA 3UO1H 5GS0H 2ERJB 4Z77B 1DUZA 4HMDA 1MFCL 1UYWL 2F5BH 1NJ9A 4X99B 5ICYB 3RAJL 5EZLA 4U2ZA 5D93B 3VA2C 3HC3H 4OAWB 1FN4B 4K7PX 2BOBB 1A3RH 4IRJD 4ZUSA 1NGZB 4RFEA 1BJ8A 5FGRA 2GCYB 3RUGF 5HY9A 5DURB 1XCTB 4HXBL 5KVEH 1KCVL 1U8NA 5IIEB 4H1LH 1ZSDB 4FFZH 4TOYL 1CICB 3U4EB 4S1SH 4Z76B 5EU4B 4DW2L 2PKDA 5KN5A 1S3KL 3L3KB 1IAMA 3LV3B 1NCAL 4D0CA 1UFUA 2H26A 1SVZA 2MNUA 4U0RB 3VI3E 3BPNB 3KPNA 5FCUL 1EVUA 1A14H 4M9PA 3VFMB 4GQ9L 4NHCH 3MXWH 4RAUB 1RIVL 3T0VA 2EZ0C 2WBWB 5I66B 2HN7A 2F53B 3D85D 2VXSH 4K3EL 1JNNL 1KOAA 3LKSA 2PUQT 3PWPB 4GO6B 2BNUA 2IAMC 5LBSL 1U3ZA 4EUPG 3IS0X 3PGCB 3QIWA 1W8OA 1QVOA 3OJMB 5E2VL 4KU1A 1G6RA 2CMRL 3ARED 4K7PH 3ARVA 5K9QG 3OAYK 5F7UA 3QDGB 2IMMA 4Y1AA 4G7VH 4LHUD 5KVGL 4YDVA 2WV3A 3KLSA 5D7LB 3WFZA 3PG2A 5HYJA 4Z6AT 4Z7QE 1J1PH 1E4XI 3WDHA 4EOWL 3GSWB 1PJ9A 1AC6A 1Q9LA 4RFNB 3STZB 3SE9L 4PB0H 1QA9A 3ZE1E 2AK4D 2D7NA 2YBRA 2VLJB 4MCZA 2W9EL 4NQCD 2L7UA 1YNLH 2VZ3A 5C0AE 3HE7D 4NOBA 1FFOB 2XNAA 5HHMD 1ZWIB 4YAQB 4M5YH 4RFOH 2Y25A 5E24E 3TM6A 3OKEA 3DGCR 3H6JA 3MBEB 4KK9C 1CFQB 5DD6A 3T3ME 1QLEH 4PP2A 1B9ZA 3OB0H 4M6AA 5EOQL 3FCTB 3SDAD 1WTGT 1GGIL 3TA3B 4K94C 3DHMA 2NY7H 4YHKH 1CXLA 1E6JH 4A6YH 3KLHC 5CSBA 2DD8L 4AJ0A 4WU5B 5IM7A 4Z78B 5J4MA 4V2CB 4GRWB 4NSKA 5EN2B 5KANI 2AKRB 4XNXL 2VZOA 5M95B 4L8CA 3L5WB 2CQVA 4O9HH 4OZIA 1I1YA 5I8CA 5ERWB 4H20H 12E8H 4Z0BH 4FQ1H 1SY6H 2ADJB 2BDNH 4HS6B 1JV5A 5DJYB 2QSTA 2E7BA 5I6XB 2LTQC 1UWXH 2HLAA 5CZXC 1X5KA 3GJFA 4XVUC 3QIWC 5GRJL 1T5XB 1B90A 5AG9A 4FQXD 1BAFH 1KIUA 4LCWA 5HHVH 4HV8B 5HHOE 5DK2A 2EKSA 4QKXB 1MRCL 3SCMB 1VFBA 3GMPB 1OB1A 1LEIB 2YPVH 1CL7I 1TQCB 4OZHB 2VH5L 5D1ZA 3PABB 4R8WL 1U8QB 3U9UB 1GYAA 3U1SH 3QPXL 3TGXA 1UB6A 1A9EB 4AZ8A 1RURH 3W0WD 4JE4B 4R4BA 5BCAA 2V2WB 1S7WB 5CLTA 2BSTA 2X6MA 4PGZA 1TETH 4H1LB 5J9PA 5JXAH 1BFOA 4I0CC 4KQ4L 5E2WH 3CMOL 2DQGL 4D9LL 4PRDB 2BXZA 1YMME 5CEXA 1JPGA 4OV5A 3VXUA 4Y2DA 4EI5C 4HAFA 4QXUH 3WL9B 4K3JH 4ENEC 4ZUTB 2VN4A 4M48H 3BISA 1MI5E 3VFTA 2PR4H 4JFPB 2YPLE 1RUQL 4JFFB 3BP5A 4ZPVB 5E00A 4DZ8B 5FFLA 2FX7L 3ROLA 2QQNH 1RZFL 2HVJA 4UT6L 4WTWA 4GG6B 4X6BA 4XGZB 1QFWH 3QG7H 1WEJH 2OXHA 3K81A 1WT5A 3I84A 3WFEH 2E8ZA 1T1WB 3TZVD 3S96B 3LN5B 2BVEA 4YHIA 4J6RH 1UGNA 2VDQL 4U6VL 1S8DA 3S4SA 5D96C 1GRWA 3QDJA 3QG6A 2AI0H 1Q0XH 3UTZB 3T2NH 3MRFB 3BD5A 4XP5H 5DXWA 1OL0A 4ZUUB 4JFXB 5JW5B 4LSRH 5K93A 1ZVSB 2QQLH 3INUH 2J6EL 4WFFD 3B9KD 5D2NC 3RUGB 5IB2A 4YE4L 2FDBP 5ACMA 4X4YA 5D1ZC 2VXTL 5HHQB 5E2JA 4KJWC 1CR9L 3W11C 3LQAL 4JFDA 3ARGA 3TO4C 2QR0A 4O02L 5HHNB 3TJEH 4JM4H 2LABA 4P59H 4H8WC 4PG9A 2KQNA 1UZ6F 2GJZA 4NZUL 3RX8A 5C08D 1OLZA 1FC2D 3BVNB 2X4TA 3PWVA 4N0UB 4WFGE 4BZ1H 2QADC 1IGFH 1YEEH 2OJZH 5B8CB 1GZPA 1G7QB 4JZJA 5MERA 3IXAA 2FSEB 4E41B 4X4MA 1BZ7A 2J2ZA 5E8PB 4Y2DC 5JW4N 1FVCA 1L7IH 2BK8A 2F54A 2P5WD 3S5LB 3P40A 3MRNB 4HS8H 4A6YB 1KTDA 3D1MC 4WNQA 5EULV 2H32H 2XFXA 1KTLA 1T4KB 3LRHA 2ZOLB 1T21A 4BFBD 5I17A 2Q1EA 4QHKI 2JJSA 3PJSA 3VRJB 5E08L 1KPUB 1GZQB 4PJ7A 3HI6L 2ITDB 2E27L 2FR4B 5EIIA 3RX7A 2XZAL 2IQ9L 1WT5C 1XR9B 3K2MC 3MGAA 3QNXB 4AENA 2V2TA 4OF6A 4JZNA 4M93B 4N0YH 3RWIA 1DQDH 5T3ZH 1U8HB 5DJ8B 4HKJB 2BMKB 5DJ0B 2D3VA 3MACH 5F7FA 5LXGL 5A2LH 1AGFA 4XP6H 5F7YC 5HDOA 3RKDD 4BK5A 4AYFA 1U8LA 1JFQL 2BCKB 4J8RB 3LDBB 2C4FT 3GDBA 3P4MB 2MCPL 1D5IH 1NGYB 1GC1L 1NGWB 1I7TA 4ONOA 3LSOB 1FH5L 1ZHLB 3DO3A 3ARGC 1IQDB 2QHLA 1UG9A 4DAGL 4EIZC 1S9YA 1FLRL 1I8IA 4C83B 4M6ML 4KDTA 3V5KA 3C8DA 5CZVH 3SO5A 4CU6A 2P8LA 4D0DB 4OLXL 1LE9B 4OLZL 5TFSL 4XPTL 2NY4C 4QHMA 3GI8L 1NDGB 5HGBA 4CGTA 2Q8BL 4WWID 3B2VH 1AIFB 4WW2A 1DBML 2UY7A 2W9DH 3G04A 5C0EB 1J7VR 1CXFA 1JPTH 2QSCH 4NNPH 4Z8FH 1ACYL 4L8BB 1T7ZA 2JJSC 3LZFL 3RQ3A 4XPGL 1INEH 3O3EB 4OGZA 4U4BA 1F2XK 4XC1L 1WZLA 2OI9C 4S1DD 2JCCA 1T20B 2VL5B 5D4QA 2VDPL 2X4OB 1EEZB 3VXMB 3NMEA 2DQCL 4U1NB 1MVFA 5J1SC 3L3JA 3T3PF 3X3FL 2ZUXA 3OKDB 2B0SL 5FHAL 3UZQA 4QRTB 4IM8A 4DKEL 1U92A 5TPWL 3UBXB 4XMKH 1C12B 3IU4H 3EOBB 3QQNA 2AJSH 1AXSA 3DIFA 1FGVH 2XWJB 2DQUL 2V7NB 4LSUL 5EUKA 1JE6A 3TCXA 4F8TA 3EGSB 3QEUB 5CSZA 2Z4QA 3QH3B 4R9HA 3SKNA 3QUMA 4DQOH 2ARJQ 2OL3L 2VSDA 32C2A 3NCJH 1QR1A 3HG1B 4X7FC 1JZ4A 4Y5YA 1U3HA 3OZ9H 1N2RA 4POZC 2J8UB 4NO0A 2ESVD 2J88H 2VAAA 3WNNA 1GGYA 1H9VA 3QXDB 4S1RL 4LSVL 5F88B 4KJQD 5C70A 4JCLA 2NX5D 2Y36H 4QXTB 4PRAA 5IK3A 4M1DL 1JZ3A 2HFGH 5I1EL 4WW2C 3QQ3A 3CUPB 3NABL 5CCKL 1KPRA 1CVSC 1IEAA 2H32B 3P30L 1AXTH 2DYPA 4LSDA 4NNYB 1TFHA 2ZSVA 2YKLL 2VJXA 3KPRE 1QFUL 3L3HA 1HQRB 1SMOA 4QGYA 2A77H 1XGQB 4ORGA 3SKMA 3DX6B 2R29H 5DC4B 1J05B 3TYGL 3CH8A 1X44A 3OB0K 3BZDA 5DMKB 4R0LA 2JELH 2NCMA 3I6GA 1X5ZA 1QSEB 3GMRB 3F12B 5KJRL 1ORSB 4MHHG 1CGSL 5C0GA 2A6JB 4PY8I 1P4BH 5AWNL 3KXFD 2W60B 3NFPB 3D0LA 4KV5F 5TDOA 1OTSD 3RZCC 1Q72H 1HH9A 4AL8L 1J1XH 3I9GH 5D6DA 1JPFA 3V4VH 5MHSD 5MENB 3DVFA 4AY0A 4L3EA 3LS5H 4OSUL 1UWXK 3O4LB 4HFUH 3D25A 4P3CH 4Y5YC 1R5VB 1DBBH 1J88A 4HQQL 4JKKA 3B5GA 2V6HA 1JYWA 3O8XA 4X80L 1RJZB 4PJCE 5SWZA 5DVMA 4M43H 3FOLB 4PRHE 2E7MA 3VFVB 2HT2C 4APQA 2VLRE 3U79A 2AJZB 4HCRL 4OCNC 2FGWH 4DEPB 2FHBA 4CW1B 4KHTH 1MCIA 3IXTB 4GKSB 1OSZB 1EBPA 3R0MA 1A6VH 2I9TA 5D2NE 1HILA 4LQFL 4DUXA 4PJFF 2EDXA 3BPOB 4L4VE 1EJ6A 1PQZA 2P5ED 1BVLA 1VGKB 1ZKAA 5FEBA 1ZA3A 1S78C 3OMZA