3QUYD

Structure of the mouse cd1d-bnnh-gsl-1'-inkt tcr complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
239
Chain Sequence
b'AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 66
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quyD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quyD02
2CMRH 2UZYB 3EFFB 3PL6B 3VXRD 3RJQB 2M2DA 4DOHE 1MCDA 2O5YL 3UZQA 3VFRA 3NCCB 1X4XA 4X7FC 4OJFL 4YDVB 2A73B 1E4WL 1P4IH 4TRPH 1CVSC 4NBXB 1UA6L 2UZIH 1P7KB 4YHOH 5DURB 5D7LE 2B1HH 3ZE2E 1X7QB 3NA4A 1JBJA 2PYFB 5K9KA 4M6OH 4AQOA 2XACC 4LCUA 2C9AA 4BQ8A 3UJIH 4YXLL 3DROA 4HWBL 5C0AD 3ORJA 4K7PH 4I18C 3OKLB 3RJDA 4IOSD 3UTPD 3MPCA 4XVSH 5CD5C 4OLZL 4UDTA 2E7HA 5AYUL 2F19L 2FEEL 1J8HE 3TA3A 1T7XA 4A6YB 3MR9B 5SWZA 2C3HA 5ITBL 4PJBE 5C9KA 1S9YB 2E3VA 4OV6F 4BZ1H 3V7AG 2DOCA 1V3KA 3S37X 4N0YL 5B3JE 4QRUA 3QXWA 4K7FB 2WQ8A 5HYFA 3JTTB 4KJYA 5ID1B 4D9RD 2DQFB 3ARXA 5DC9B 4IIQC 4Y4HC 4MXQD 1DUYB 4MCYB 4LBEB 4X7SH 4R3SA 3K1KC 5C0FB 3SO3C 2MOVA 2W1NA 5IUSA 4NKOB 3BUYB 1A7OH 4S1DD 3WIHA 4Z7WB 3SGEI 3RA7H 3TVMC 2ICWA 5T1KB 5J12B 3V6ZB 4ONHB 2O5YH 5HYJE 3KLAB 1P4BL 1MAKA 4L4TE 4P0DA 3VXNA 1E4WH 4U49A 4FG6D 3N1PC 1UA6H 3HC4L 4HZAA 1OTUC 4X6DF 1IGML 5FFLA 4QOKE 3EYVB 2VXSH 1JCKA 2AXHA 3GMMA 1L4IA 4PGEB 3DI2B 3H6JA 4JFYA 1K8DB 1U9KA 4K23L 5EOTA 4BFIA 3HI5L 5AZ2L 3OKOA 4OLZH 1GGTA 2HTLD 3V6OC 1CDYA 1NAMB 4AM0B 4Q6IC 4PRHB 5ITBH 1U8MB 1FC2D 5FAAA 4QRRA 3CPLA 4UV7H 1OARH 4IOFD 4N0YH 2CDGB 4TUKH 4UI2A 4J6RH 5FYJU 4G8FB 5IF0B 1MFBL 3GMOA 1ZLUH 3A0OA 1SVZA 3P73A 5DZOA 2R69L 4XP1L 3R06B 1EGJA 4NO2A 3BRDA 2VXVL 2VLKB 5TDOB 1E27A 3SDAD 4F7EB 3QUYB 3EFFA 3TBSA 3EO9L 4FFWC 5JHLH 3NPSC 2N56A 1CK0H 3ROOA 3C5SB 4NKDB 1P4BH 1FLRH 3TO4D 1T83A 1BBJB 4X6EB 2HJKB 1A2YB 2JJSA 4YDVA 4KK6C 4LDLB 4TSCL 4G9FE 1XFPA 3LPWA 5ADOL 1RAMA 4NDMB 1W0WB 3PDOA 3T1WA 1KELL 4K23H 1UM5L 4LSPH 3W0WB 1YN7A 3QUML 2X1WL 3HI5H 2EXWD 1WJ3A 3OKLA 1JYXA 5DRWA 5DVOA 4XP5H 4LCWA 2OLDA 4L1HA 4ZUUA 2W9EL 4JHAL 1BD2B 3UTTD 1Y0LA 4FXLA 1HQRB 4GRWF 1LK2B 2AK4B 4JREC 4BFEA 4XWOC 1S9YA 2GYSA 4Z7VF 1CD0A 3ELAT 4NCC1 3WYRA 3Q5YA 3JTTA 2APBA 4Y0GA 2Q20A 3QQ3A 2DQFA 4AH2B 3QXDA 4KKCC 1J8KA 5JUEL 2W9LA 4LBEA 2E5EA 1FL3A 2PW1A 2R69H 4GG8A 4P4KB 3QXUA 4M4RA 4XC1L 5IHZB 4BYHA 2VXVH 4MVBD 4NKOA 2ZOKB 4DWHA 2VKWA 4Z7WA 1A9EB 3OJDA 1WZ1H 3EO9H 1CVRA 1A7RL 5E24E 4X8JB 4Y5VB 4QTIL 1NEUA 2VLRB 1MJ8L 2GTWB 3UBXI 3CC5B 5ELIA 3FT4B 1VFMA 3O9WA 1MCSA 4QKXB 4V1DA 2MHAA 1J05A 4TSCH 4X6BB 5IR1B 5L88H 5FUOH 5ADOH 5F9WB 2QADC 4CW1B 5GGRA 1D5MB 1KELH 1UM5H 2R0ZH 3LKRB 3QUMH 4OUUB 1Z0MA 5F9AC 4JHBA 3QHFL 3VGFA 2I9TA 1PAMA 4XNZB 3DETC 1EVTC 2W9EH 4JHAH 4LU5L 4PJ8C 5SWSD 1MAMH 4NN6C 2FJGA 1J87A 5KN5B 2BSSB 2DBLL 4Y5YA 1DDHA 1WQVT 5GGUA 1NMCC 2FH6A 1INQB 2CDGA 3SY0A 1NCWH 5J9PA 2GKIA 2B4CC 4G8FA 4ZSOE 5IF0A 3VD9A 3MCLL 3C5ZA 1J9CT 1H5BA 3E2HB 3IRZA 3U2SB 3LEXB 5EOCJ 3ALWA 2HT2D 4GG6B 4ODSL 1T22B 5TDOA 1W8OA 3PP3K 3BQUC 3MLWL 3ZMRA 1BWMA 4XPTL 4TVPE 1A7RH 4ZO6A 1IC1A 1AO7B 3CFDB 4NKDA 4XWGH 1MJ8H 4AL8L 1YECL 2BNRB 3ZKND 1BBJA 4X6EA 3TF7C 3MJ8A 4FTVB 2IAMD 2DTSA 4PY7B 2O5ZH 5D1XD 3LN4B 3ARFA 2RHEA 1UJ3A 1W0WA 2WBKA 3BD4A 1CZ8L 5E94B 4JPKL 1KJVA 2WNGA 5IIEB 2AQ3A 4LU5H 2MCG1 4X7CC 1IM9A 1BD2A 4YNYA 5CWSA 3VWKA 2ZSVB 3D39B 1LK2A 1BJMA 3VFWB 1UZ6F 4MXVF 4CJ0A 2A83B 3G08A 3MNZB 5JHDB 2JK5B 5F88B 4B53A 2FB4L 4AH2A 4X4YA 1JPGA 3TESA 5IHZA 2P5WD 3HE7C 3SGJA 3EOAB 1V5JA 3ES6B 3PHQB 3MLWH 4XPTH 5HGAB 1CR9L 3GSUB 1I7RB 3JV4A 4X8JA 2AGJL 3DARA 1YECH 3AUVA 1BFVL 2GTWA 2X4OB 3CC5A 4LCYB 4LRNH 2VE6B 3FT4A 4X6BA 3WEXB 2IG2L 3BDBA 5DA0B 4XBPA 4MQXC 1EMTH 3R1GL 1YNKH 3IETB 4BFGA 3CVIL 3BYTA 1V05A 3LKRA 5C0DA 3EYUL 3QUXA 1J18A 3QJHB 4L8CA 3HC0A 4YFDB 1M6OB 5EZLA 4WFFE 3ZE0E 1KC5L 2FWOB 1F2XK 3B6SB 1AH1A 1Y6NR 3HC3L 3KAAA 5KN5A 2BSSA 1I3RB 1HINH 1DVFD 3TWCL 5C08B 1NGQL 4WDIA 1YDPB 2ZCLL 1MCWW 4BQBA 5KSAB 3U2SA 1FAKT 5HHPA 4HBCL 5DRNB 1T22A 5ALCL 3AS3A 3X3GL 2AGJH 4NUJB 4KRNA 3CFDA 5ABDE 2AVGA 1BFVH 3HZVB 3G5XB 3QA3A 3WFHB 1U8IA 3SCMC 2OBGA 1ZT7A 2Q8AL 2NYYC 3EJZD 4MD0B 1QHOA 2OJZH 3O4LB 1N8ZB 3LN4A 3R1GH 4HKBB 4N0CD 4XHJD 5L2KA 2ENYA 3CVIH 5D96C 1U8LB 3RI5K 1NJ9A 1U41A 4P2YA 4L3CB 3L3KB 3EYUH 5C0GB 3VXQB 5JO5B 3OXSB 4KTDH 4LPVA 3U1SH 1B0RB 5CSZB 1T6WA 1NGZB 4ODVH 1UWXK 5E2JA 3SQOH 3HC3H 5EFIB 2ZSVA 2W9DH 4QRPA 4AEHH 3D39A 3P0YL 3WIFA 1AD0A 1YMME 3VFWA 2A83A 4EBQH 2D9QB 3QNXB 2QQLL 2JK5A 1EEZB 4YDLC 2P5EE 5C0IB 1NGQH 5TDPB 3VI3F 3TPUA 1MCNA 2ZCLH 4Z7UE 3GRWA 1MCLA 5F7DA 1FNLA 1YNTB 1A64A 4HBCH 3OAYH 2GJ6D 3PHQA 5H37H 1KG0A 4PG2C 5ALCH 3A67L 3X3GH 5HVGB 4NFBA 4UTAH 1LHZA 1RJCA 1I75A 1KPRB 2DYPA 2YD2A 4XH2B 2X4OA 5I71B 5IFJB 4KQ4L 4YDJB 4KI1A 1U0QA 2VE6A 3VMPA 4LP4A 3WEXA 4O5LL 5T5FL 1KXQE 3BJLA 4NUGH 2CLVB 5GHWH 4M62L 3HMWH 5FYJL 3GM8A 3Q48A 3RY5A 3W9EB 5ECJE 4MXQC 3QJHA 1M6OA 2YPKB 1PG7W 5C8JA 1FVCB 3B6SA 3LEYL 4A6YL 1L7IL 3HR5B 4S1DC 2W65B 3R0MA 3P0YH 3BVNA 1I3RA 2JCCE 1EHNA 4NO3B 1A47A 3VH8G 4PJEB 4M5YL 4U1IB 4JGMA 1OF2B 1IGCL 2IPKB 3F58L 3BPCB 3S5LB 5LQBL 4FG6C 5B38G 2AEWA 1ZXQA 2XWTB 4OLWL 5IW1B 5D71L 5I1GH 4MB3A 3QCTL 2ZNXA 5DRNA 2D7NA 4ZDHB 3BP4B 4XXCC 3MQIA 2H8PB 4NUJA 4JPVL 2X40A 5JOFB 1JTTA 2HTLC 3HZVA 4KQ4H 4GAFB 3FO9B 4GW1B 2GUOB 2L7JA 3QXVA 2W91A 3HUJE 4TULH 3RIAK 5IJVA 2X89D 3BN9D 3O4LA 5DJ0B 5F6HI 4O5LH 3TCLA 4HKBA 5T5FH 5I8EA 1JF5A 1M7XA 1XGTB 4IOFC 4MJ6A 5IB5B 3HI1B 1GHFL 5FYJH 5DD3H 5C0GA 3L3KA 1AQKH 3I75B 3OXSA 3I2CH 1GH7A 4E5XA 3MRDB 4NQDE 3HAEB 1EEYB 2VITB 3IJSA 5T3ZE 1NAML 1NGZA 3LEYH 5IMKB 1L7IH 3GBLA 2J12B 3I6GB 3Q2CA 3SDAC 4C56D 3QFJE 3O6FD 5D1ZC 1IT9L 5TGBA 2Q3ZA 3TO4C 1DN2A 2VZSA 4NQCD 4NO0B 3F58H 4GG6F 2H3NA 5JW4Q 3IDGA 4OLWH 5D71H 4W70A 1DQLH 3RVUD 1YNTA 1DLFL 3GI8L 43C9B 3MUGB 3KG5A 3QCTH 1Z5LA 5C1MB 1SVCP 5DGQA 3QI9B 2N7BA 3B9VA 3FT2B 5A16A 4JPVH 4W68A 3PNWA 3BH8B 2FECI 1KEGL 4DVRL 1G9MC 1OGAA 4XH2A 4YDJA 1WZMA 1RZ8A 4XNUL 5KSUB 5HYSG 4J3WA 1RJYB 2E9IA 5ICXA 1T1YA 4JO3L 1GHFH 3ARBD 5F8RC 1IAIH 1VKXB 4NHUB 4U1GC 1JZ8A 2E27L 1AFVL 3B4NA 1QKZL 3RAJL 4APQA 2JIXD 3SDCB 1NAMH 2YPKA 4HC1L 1VGEL 3RDTD 1FVCA 4MVBC 3EGSA 4CMMB 5FGRA 1ACZA 4HPYL 4KK5C 4NO3A 4PJ7E 1ZGLP 5IB1B 2FJFB 2Q6WA 2IPKA 5GZOD 3TBWB 3T0ED 5K9OA 3U36A 4PRDB 5HGDB 3NABL 1DLFH 4KK9D 5E2WL 1TQCC 1Z6JT 1K3ZA 5T5NG 2GJJA 3D18A 4X6CE 4UB0L 2FX9L 3WFCH 4JKPH 2VYRE 4D0CB 3ARDD 2MSPA 1OW0C 2JJVA 2H8PA 2Z92B 2D03L 1A4JA 3AVEA 5AEAA 1KEGH 1PYWA 5EG6C 1LMKA 2DF3A 4MQTB 3BP5B 5CMAB 5SX4I 2UWEB 2X7LB 3CLEL 1HHIB 4WEBH 1YEEL 3O3BB 4R26H 2DKMA 2NY5C 2ZNWA 1JV5B 4X7TB 3ARWA 5DHXB 4FQLL 4OLVL 5DJ0A 2BOBA 3O3EB 1UXSB 3PWVA 1MREL 1OM3L 3HI1A 5IB5A 1K85A 2E27H 1AFVH 1FO0B 4E41A 3RAJH 1JRHL 1HYRC 4JLRB 1PX4A 3CFCL 1MCBA 4P23D 5ETUA 4HC1H 1JHTB 1EEYA 2VITA 5E6ZA 4ZTPH 4Y5XC 4JM2A 4RRPA 3L3HB 4JANB 2CRYA 3S34L 1KJ2H 3VA2C 3E6HB 4HPYH 1IKFL 4MMZC 2IALB 3LPFA 2VTFA 3ZKNC 1FZKB 4NO0A 2IAMC 3OKNA 4DGYL 4UTBL 5KJRL 5GQBA 2VDKL 3U79A 5D1XC 3NABH 4M7KL 1XGYH 43C9A 1JGUL 2PO6C 3I50L 4UB0H 35C8L 3QI9A 1T66D 2LTQB 5IMOB 2D03H 3KPTA 3FTGA 3BH8A 3LQZB 1RUKH 2XN9E 3D0LB 4PB0H 3BOVA 1XIWA 4P3CL 5L0QB 3T3MF 2MKWA 3MACL 3S96A 2C1PB 3HCVB 4FQLH 4OLVH 1FBIH 1MREH 4PJAB 1OM3H 1NEZB 1EV2E 4NHUA 3PV6A 3L95B 4RGMB 1JRHH 1JPTL 3GUTB 1J10A 3MOBL 3MRRB 5MERB 2EECA 1WWCA 1D3CA 2IPTL 3PL6D 4IJ3B 2DBJA 3EAKA 4CVZB 2CRMA 1AP2B 5FEBA 4DGIH 3S34H 1B2WL 1O5DT 3B8YA 1IKFH 43CAA 4CVUA 1S7TA 2JJWA 2OR9H 4NFDA 5IB1A 2FJFA 3QIWA 4Z0BL 5IV2A 4DGYH 4UTBH 1RD6A 5KJRH 3TBWA 2VDKH 3MC0A 3GRWL 4LARL 4RGNB 1KPVB 4XB8A 2ADJA 4PJDA 1SYVB 4PRDA 5FYJD 2OS7A 3U7AA 1JGUH 4KRLB 1CBVL 3I50H 4PYGA 35C8H 3W5MA 1OB1A 4PRPB 1JE6A 3BN3B 2D3VA 1ZHKB 3PWNB 2KH2B 1G7LB 4HDIA 1L9NA 1RQ5A 2GSGA 1CICB 2L0DA 2UZXB 3BP5A 2UWEA 4P3CH 2X7LA 3MACH 3FN0H 3O3BA 1LEKB 1IE5A 1MCPL 1WFTA 4ZOAA 3MLZL 4MJ5B 2Z4QA 4X7TA 2ICES 5D1QA 4LASL 3O3EA 1UXSA 1G1CA 1DVFC 2Y6SD 5AD0B 4R7NB 3OPZL 4M7JH 1JPTH 4PJ5B 1MEXL 2WM0A 1FRGL 3FOLB 5EWIL 3QUKB 2FEEI 3VE0B 1OD9A 4PY8J 5T1KD 3QWRD 4MQ7B 4BQ6A 5MEOA 2DLTA 4PJEF 1YQVL 1VFBB 1B2WH 3NFPA 3L3HA 4PBWD 1MI5B 4LPCA 5J11B 4MDJA 1OP5K 3E6HA 3AB0B 5MHSE 1FE8H 4Z77A 5DMGD 5TDNB 4Z0BH 2XY1A 5F7NC 3Q1SH 3B9EA 1UM4L 1WC7B 3LN5A 3EJZC 5DJAA 3TH4T 3ULSB 4EJ1C 3EYOA 2H9GA 4N0CC 4XHJC 5TE4H 4ALAH 1CBVH 1YEKL 2VMFA 2GEEA 2IMMA 1EBPA 4XPAH 5D7JA 3V6FB 1UZ8B 1J5OL 4PRHD 3TIDB 4BZ2L 1CD8A 5GS0C 4RFEB 3T0VA 3H9YA 5D5MA 3VI4E 1ZS8B 1MCPH 5KS9A 5AWNL 4LCWE 4NNXA 3MLZH 4KJWD 5EU3B 2AJYL 1MVFA 1RK0A 3O6LL 4BFBD 5KG9A 3OXRA 2JF1A 3OPZH 4L3AA 4AEFA 4LHUB 3L95A 3UJTL 1MEXH 3GUTA 1FRGH 5EWIH 2VLKD 3MRRA 1KULA 5H35B 4BKLB 3QUYD 4CU7A 1YQVH 5SV4A 5ID0B 4CVZA 4PJXB 5HPMB 1QA9B 4WNQA 1AP2A 4UZGA 3VXUE 3MUJA 5E8NA 2ESVB 5IT2L 1EXUB 3S35X 5EU6A 2WV3A 1ZT1B 3H9ZA 3BRFA 4FQQA 4OUOA 3PGDB 1UM4H 1IBGL 4NZTL 1LP9B 1I9RH 4YBLC 3GSNA 4Y19E 1G6RA 4MA3B 1SYVA 3W0WD 4V1DE 5ANMA 1YEKH 3DVGB 1EX0A 3IDMB 4G3YL 4JFDE 4PRPA 2F8XC 2PKDA 1VPOH 1BD2D 1J5OH 1ZHKA 1FZMA 4BZ2H 5A1AA 1JNJA 1G7LA 1QLRB 2AK4D 4L9DA 1CICA 2NX5E 4LRIA 4GW4A 5IMMA 2CK0H 5EIVA 3MV8E 3DRQA 4HLZH 4X4MA 4PD4K 5IB4A 2ADGA 2AJYH 1S7VA 3O6LH 5INCB 4MJ5A 2YXMA 1JI1A 4ZPTB 4P4KD 3D3VB 4EUPB 4R7NA 4UQ2B 4KMQA 4PJ5A 3SE8L 3QUKA 3DYMA 4PP1D 5EZOH 4JQXC 3VE0A 3ZKQD 1WITA 1NCCL 4UBDC 1UJTA 5D9SB 5GGSA 3VRJA 4CMHB 1K8IA 4M6NL 4IRJA 1VFBA 3VD3A 1NC2A 1G7JB 2VLRD 1R5IB 3VFVA 3L5JA 3FONA 5F96L 5IT2H 4KPHL 4AIOA 4B0MM 4ZXBB 4Z95L 3TFKD 4N5UA 1MFDL 3LRHA 4POZD 4JQVC 1INDL 1OAYL 3UBXG 4DN4L 1IBGH 4NZTH 2FIRT 2OI9B 5C0ND 2CIKB 3G6JF 4XNQB 1JGLH 3JBG7 1F6LL 3I6LD 1R3KB 4WGWB 1NBVL 1IAIM 3QRGH 1Z9OA 3RBSA 5DHVB 3LY6A 3V6FA 1UZ8A 32C2B 1HKLL 4MLIA 1BJ8A 3TIDA 4JZJA 1UQSA 2EYTB 2I60L 5GRWA 4BJLA 1BZ7A 1G7HB 2VDRH 4DFHA 3IAPA 2F53B 5IB2A 2I9LA 2R2HB 1ZS8A 2VRAA 1YNLL 5GGTH 3FQUB 2XRAL 4D0BA 4JFEA 1OAXL 4Z76B 5E8EA 1IRAY 3T4AB 1MCRA 3LS5L 3LRGA 3WLWD 3LRSA 5DC4B 2EH8L 4E0RB 1RZKH 4LHUA 4JDZB 5C3LD 4ETQA 3ZZ1A 3NOIA 5J06A 4BKLA 1NCCH 4QRTB 3TN0C 3RVUC 1OHQA 1AO7D 3DX6A 4PJXA 2IQ9L 5ACZB 1RK1B 1CD1B 2BNRD 5F96H 1QQDB 4FTVD 2HT3C 4Z95H 1LEGA 1R0AL 2ERJB 1XAUA 3DO3A 2ZJSL 1INDH 3U4BH 4DN4H 1JWMA 1MUJA 3QEGL 4FMFA 3PGDA 1LP9A 1YY8B 4P2OB 1OAKH 1U92B 4MA3A 1NBVH 3DVGA 3ARBC 2GITB 3IDMA 1J1PH 5DJCB 3IU4H 5D2LA 4CDGC 4AZ8A 1HKLH 1KV3A 4RA0C 1N4XL 2CJUL 1UXWB 4U0RB 2DLFL 1CDIA 3FN9A 1JZ6A 5IEKA 4PJAF 5LGHL 1DFBH 3RDTC 1NUFA 2XRAH 4HMCA 4Q9CA 4OCXH 5IB3B 5JHDD 1OAXH 1P9MC 2B0SH 4YAQB 5F8QC 4PTTB 1ZLSL 2J8UB 1K4CB 3TBTB 3CDCA 4JFZH 5DVNA 1XF2A 3LS5H 1KYOK 3QQ4A 2J88L 5F9DC 3D3VA 3DV4B 1MHPL 2GT9B 3RBGA 3ZDZF 2VSCA 1IAOA 3HAEH 3T0EC 2HFTA 1JTOA 4KK9C 4PD4J 5D9SA 2AV1B 4DZBB 4OLUH 4S1SH 1FIGH 2IQ9H 4KMLB 1R5IA 3RX8A 3ZT6A 5ESVA 1R0AH 4ZXBA 2LVEA 2ZJSH 3MLYL 4P4RB 3RP1A 3X3FL 3QEGH 3W11D 2CIKA 3NZHL 1BMGA 5LKNA 5DJYA 4ZFGL 4XTRD 3HI6L 2XTJB 5L2KE 3D25B 3V4PL 1N4XH 3LKQA 4P23C 4R8WL 4WCYL 2DLFH 3OJMB 2VZTA 1P4LB 4OZIB 2EYTA 1PZUB 3QDGE 4LSTL 2F53A 1JK8B 3FQUA 4LNVA 3CD4A 4C4KO 2C4FT 1ZLSH 5IW6A 5C08D 4Z76A 1OP3H 4MSWB 1EJOH 4MJIB 3ZDXE 1YEGL 3U48A 4OCMC 2BHZA 3EOYG 1MHPH 3RI5F 1JFQL 1FO0L 1VESA 4QY8B 3KXFE 4OZGF 4TN9A 5KSAD 2K1MA 3C8KB 4GBXA 4L9LC 5FOJA 4YHZL 3UMTA 2ADFL 1Q9OB 1TQBB 3R8BB 1RK1A 1QQDA 1MWAA 1T66C 4QNPF 1T4KB 5IKCB 1HOCA 3X3FH 4WIQA 3LN9A 5TQ0L 5HGBA 2H45A 3O4LD 2DM7A 4ZFOL 1S7SA 3FFCB 3IJYB 2XWBB 4P2OA 3HTLX 1AIFB 1D5IH 1U92A 4ZFGH 3FZUD 5CLWA 3HI6H 2GITA 1MF2L 2RFXB 3V4PH 5E4IA 2ZUQC 4FN0A 2LU7A 2IADB 3U83A 4KI5C 2VOTA 2NQCA 1HCFX 1UXWA 2X6MA 5DLML 1XZ0A 2KZWA 3PL6C 4YO0A 1A1NB 4TQEH 4LSTH 3VRLF 4EVNB 5BZWA 3M07A 5IB3A 5C0AE 4YAQA 1QRND 1CFNA 4PTTA 5B39B 3G6AB 4RDQG 3C08L 5TJWK 2J8UA 1K4CA 4L8BB 3TBTA 4YUEH 1GCFA 1MY7A 1FO0H 4HBQA 4O58L 2GT9A 3ISWA 4GS7B 4J1UA 3RWDB 2PXYD 3NH7L 5JQHC 1GJIA 4R2GB 1TVHB 5GISH 3MOAH 3VGEA 4YHZH 5I1AA 2DJUA 4DZBA 2R2BB 3VMNA 4FMKA 5EUOB 5IHLB 1NLDL 4YHNB 1KYOJ 1BAFH 3RHWK 3CFBB 1JYVA 5C0EB 5TQ0H 4OCNC 2ZCKL 4P4RA 2AJVL 2Y4SA 3DX8B 2V7HB 4QHMA 5LAXB 1PD6A 5IESL 1PKQB 1Q1JL 2GTZB 5EDXA 4HUWB 5MENA 5GGVL 3RVXD 1MF2H 3ZSTA 1KFAL 2GAZB 1FFRA 5HBBA 3D25A 2FX8L 2VAAA 4L8SA 1IZKA 2KQNA 3T4YB 4JN1L 5DLMH 1DANT 4Q6YA 1FFPB 1AE6L 1P4LA 2YA0A 5J12C 4OZIA 1U8NA 4LF3B 5DEGA 2DDQL 3MV01 5J13B 5FYLL 3B9KA 1JK8A 3IGAB 1SBSL 3LPGA 3RIAF 3C08H 2OP4L 5T3XH 3AC0A 3L5XH 4MSWA 4ELME 3H8NA 4MJIA 4Z7OE 2VDMH 2X09A 4O58H 2HTKC 5DMGC 2KQMA 1XF1A 3NH7H 3ARYA 3C6LA 4YC2B 3RUGA 4OQ1A 2DB8A 3HNTL 2BHYA 3VFUA 4R0LB 4Z7NF 3C8KA 3ZKXB 2VQUA 4KTYA 1RZGA 2VR9A 3LB6D 4PJGB 1Q9OA 3I3DA 3AREB 1NLDH 3KJ6L 1I1AB 1T4KA 5IKCA 7CGTA 1UWGL 2AJVH 1JPFA 1LO5B 5IESH 3DTXB 4OGYH 3FFCA 4D9QE 4ZUWA 1OGAE 3WHE1 4HW6A 2XWBA 4UOW1 3LVEA 4KJWC 1TCRB 3GBMH 5GGVH 3VXSA 3UC0L 2Q3AA 1H5BC 3OSKA 1KFAH 4W6WB 5F9JB 5J1SC 1ROWA 1CN4A 2K9UA 3ARVA 3C60D 1AGCB 2FX8H 2D7OA 3QB7C 4OCRL 2IADA 1MJ7L 1FFNB 3QUYC 3P9LA 4WI8A 2DDQH 1QBLL 4FA8A 3VD4A 1QSFB 4P9HL 3X13A 2F74B 4EVNA 1SBSH 2BSTA 1UKSA 3QSKB 4NO0D 3FB8B 4ORGB 5EU7E 3G6AA 4JFPA 4L8BA 3PABB 2VABB 3TBVB 3L5WA 4WV1B 4F9PA 3T0AA 3AMLA 3UTTE 5IEHB 1UJ3C 3MRMA 1N59B 2E6QA 1CU4H 4RA3A 1U3ZA 2EDQA 3MJ9L 3QI9D 5GGRY 2YOCA 1NCBL 3MRJB 2R2BA 3UZVB 1JNHA 2OCFD 2YK1L 1ZE3C 2X4QA 1M71A 4ZO9A 2A6DB 3IAGC 2UV3A 1UWGH 3U6RA 3KPMA 3SN6N 3BAEL 1QFWM 1Q94A 3DX8A 3V0VB 1OOAA 3WIIL 2YZ8A 3MGAA 1F58H 4V2BA 4JJ5B 2FYYA 3GBNL 4HUWA 1FZOA 5ACMA 2AEPL 4L1DA 1QZ1A 4P4KC 3SDCD 4QHKJ 1I3GL 4OCRH 4OD3H 3DYPA 3FQTB 4NPYB 1MJ7H 1U8JB 1GOGA 4RAVB 4PP1C 2AXGA 4ODWA 1FFPA 5GSRB 4P9HH 2YC1B 4Y5VC 2EZ0C 2WLZA 4PJIB 3IGAA 3F62A 3SHSA 1Z3GL 1MIEL 4U7KA 1F97A 1RUPL 3MGOB 15C8L 3KPRB 4WRLA 3V5KA 4PLNC 4U3HA 2VNCA 4POZC 2V7NA 1MRDL 5F9WC 5C0NC 1BF2A 1N0XL 1O7VA 3HZYA 3MJ9H 4R0LA 5E1AA 4QXTB 4OCWL 2AW2A 1YC7A 3QUXC 2V5TA 5CZVH 5JZ7D 4XNZC 3AREA 1I1AA 1Q8MA 2YD6A 3O8XB 1N7ML 2AXFB 4CVXB 2F54A 3D2UB 4YX2L 3PE9A 1KLUA 3DX7A 1IGIL 3PDDA 4KROC 3STLA 3WIIH 1LO5A 4JY6B 1GC1H 2OTWB 1U2CA 1GL4B 2CLZB 3GBNH 4KC3B 4R4FL 1FN4B 2Z9TA 2BC4B 1G7QB 4ZOEA 3KPSB 2AEPH 1O7SA 2EEAA 2G75B 3E2HC 3HNVH 5F9JA 5MEQB 1I3GH 5L2JA 3BEWB 4XHQA 5T1LA 5E6IB 1FFNA 2OR7A 2VB5A 4JAMA 3C5JA 3MA7A 2DQDL 4F7PB 2G60L 1T04B 5CGMA 4FQHB 1W72L 5K9JL 1MIEH 3HG1A 2VAJA 15C8H 2VABA 4EUPH 4ZNEE 1F4AA 4X9IA 4WV1A 3U9UB 3Q5OA 1IMHC 1N0XH 3K81A 4QGTA 4M02A 5TF1L 3C9NB 5J6HB 4X5WB 3BP6A 3MRJA 3QH3B 1HNFA 4YH6A 5E8OB 4PJDE 4XVJL 3WO4C 1KNOB 4HZLB 2QL1A 5F7HA 1T7WA 1T7VA 3IYLW 5FKPA 3VFPB 2VJXA 3MO1B 1WAAA 4YX2H 2G5RA 3VXTB 4NKMB 1WZKA 4Y16A 2P5WE 5DTFA 3D5OF 3VFTA 2V9RA 4F33B 3V2AR 3V0VA 1QOKA 4JJ5A 4R4FH 5HDOA 1AKJA 3OJVC 3MREA 1E0OB 1BHGA 2Q86B 5I19L 3GMPB 5DHVH 2FO4A 3CXHK 3JTSA 3T04D 4LKXB 1NMAL 4QXUL 3FQTA 4NPYA 1U8JA 2CO7B 5GSRA 2DQDH 2YC1A 2HAZA 4WFEE 4PJIA 4KJPD 4LCCB 3IXTA 1W72H 3MLTB 3RY6C 5K9JH 3E6FB 4RGND 2Y9RT 4XPBH 4WY7L 3REVA 5EUOF 3W11C 3BKML 4NOBA 5ESQB 2VN4A 1KIPA 5TF1H 3MUY1 2OJEB 4UUJB 3C8DA 2HWZL 4OZ4B 3M45A 4XTRC 1I3VA 4XVJH 4OGXL 5IHBA 2WIIB 1CICD 1X44A 1F3DH 3MLSH 1JZ4A 5I6XB 1NC4A 3O8XA 3U0PA 3CAFA 3TLRA 8CGTA 4BK5A 4CVXA 1EFQA 4W6YB 1TJHL 1ZAGA 3RNKB 3AAZA 3DV6B 4OGZA 3FT3A 4R4BA 3KYKH 2Q8BL 2OTWA 4FZ8L 4U1LA 1UYWL 5D6DA 2EDXA 5D5ME 4OCSL 1A6ZA 1G7QA 3BXNA 4OFVA 4PJ5D 4PJHF 5KVGL 3KLHD 1YPZB 3KPSA 3MCKB 2G75A 2AP2A 3C6SA 5MEQA 3F7QA 3QEUB 4G8EB 4YZFF 5KSAC 3CFKA 1NMAH 4IOIB 4QXUH 4H8WH 1GRWA 5EO1A 3CK0L 3PWPE 5IVXB 1AQDA 1MI5D 3MFFB 5E6IA 1NPUA 4HKZB 1JI2A 4OLXL 3MYJA 2EIBA 4DVBB 2D0FA 4F7PA 4PREB 4HK0A 1T04A 3WXVL 2YRPA 4FQHA 1HH9B 1NFDE 4Z6AT 3X11B 1S3KL 3U9UA 4PJCF 2FX7L 5DVKA 3BKMH 1NUDA 1S7XB 1S7WA 5EU6E 3TO2B 4XXDB 2HYMA 4I3RL 3MZTA 5BXFA 3ILPB 3IF1A 2HWZH 3C9NA 5J6HA 3FZUC 4HJGA 5CEYB 5FA3B 5FM5O 1VEOA 5ANME 3VFNA 1BREA 3OGOE 3BW9A 3TYFB 1QO3A 3VGAB 2YUVA 4H25A 1NGXB 4NKMA 1TJHH 5E5MB 3K3QA 4DCQB 4F33A 2OK0H 2GJ6E 2Q8BH 1T03L 4FZ8H 5E2VL 1UYWH 2XICA 1R5WB 2BNUB 4OZFA 4OCSH 4LHUD 5KVGH 3UTSE 3K46A 1A1MA 1TNNA 3SO3B 2BSRA 4MMXC 3VXMB 2MQ3A 1CGYA 4GMTH 1JJUA 3QPXL 4LIQL 5JIHA 1QEWA 1QRKA 4HX1A 3P40A 2ESVD 3TGXA 4OLXH 4N8VB 2VL5A 3DIFB 2O61B 4R90L 4QHLA 2BCKB 5I71C 3WXVH 2BVOA 4LVOB 4UNTA 3LKOB 3CXHJ 3E6FA 4X98A 3U46B 1AHWA 3DVNB 3MLRL 4CAGA 4I3RH 1M05B 2HT4D 3UCRA 2QBWA 3LMJL 4F7TA 1EHLL 1VB9A 3KPLB 3BUTA 4UUJA 1J0HA 3ZYIA 1FP5A 2LFGA 5CJBA 3RVXC 5I76B 2WIIA 1HDMB 1DTUA 4Q6IB 4K8RL 4EDXB 2APWA 1J1XH 3DECA 1FPTH 4X6DE 1UADC 3VG9B 1OSZB 1NANH 5C09B 5JXAL 1UCBH 3DV6A 1T03H 5E2VH 3D3VD 4WI2A 3MRGA 4PRBB 1YPZA 4L3EB 4JFEE 4LLMB 1PY4A 2Y07L 3HE6A 2VLJE 3QPXH 4IOIA 2R29L 1A4KB 2QSTA 3S37L 3QDME 1G0YR 5IVXA 1ZT4A 4U6XB 4IMLA 1OGTB 4RGOL 3MFFA 5F89A 5D7IB 4Z5RA 2EXYD 4R90H 3LB6C 4RIRB 3F8UB 4ZXBD 3SKMA 4GSDL 4PRIB 5EBWB 5DQDL 3OZ9L 3GKZA 4XCEA 4YHKL 3SKNA 3X11A 4Z8FL 4I48A 2EIDA 3G9VA 3MLRH 2DLEA 3TO2A 3H7BB 4OD1L 1ZWIA 4P2RD 3LMJH 4FZEL 3GB7B 5HYQB 1AY1L 1VFAA 1KCVL 4JG0H 4LEXL 3IS0X 4M1GL 4MX7A 5CEYA 3CSYB 5FA3A 3QHZL 4NQCE 4K8RH 5K9QG 1CE6B 4HIIB 1J0IA 3PXJA 4L4VB 4PLJC 2F53D 4MDIA 4FXGB 2H1PL 5A2JH 4XAKD 2KBGA 1EJ6A 3NFNA 3OKDB 3FRUB 1LDSA 5EU4A 4DCQA 1OP5H 3BPOB 3BKJL 1QG3A 1R3JA 4K07A 1X3DA 1F5WA 5CJQL 1SJEB 4HQQL 2X9WA 4LLVB 2Y07H 1I9JH 1P84K 1GOHA 3VXMA 5C0CB 1XGRA 3OAZK 3S37H 3Q3GB 3QI9C 4RGOH 3SDXB 4GRWE 3SJVE 1T7ZA 4PRNB 2VH5H 5F7YC 2QJDA 3VDCA 1WZLA 1OAUH 4GSDH 5I0ZA 1Z9SA 2V2XB 3ZKMD 2BCKA 4FQJL 5D2NB 5DQDH 1H15B 1W0YT 3ZDYE 2A6IB 3L6FB 3SKUD 3LKOA 4YHKH 2IFFL 4P2OD 3PWJB 1JZ5A 3QP3A 1JNNL 3F7VA 4JZNB 2WUCL 3U46A 3MV9B 1HWGB 3F12B 1D5ZB 3DVNA 4OD1H 4FZEH 4FP8H 1M05A 5MEPB 2QHRL 2OQJB 1KCVH 4M1GH 4FFYL 3QHZH 3SDCC 3KYMB 3FQRA 3BZ4B 3MTRA 4ODHH 2EYSA 4MS8D 3HPJB 5J6GA 3T0EE 2HFGL 3IDJA 1GZPB 3SKOA 3FQWA 5C09A 4P59L 2XQBL 3BKJH 2NPLX 1D9KA 5IBLD 5CJQH 5E9DB 3ARUA 4HQQH 2AJUH 4PRBA 5AYQA 4LLMA 3DXAB 2BERA 2HFEB 4DZ8B 5I0DA 1U3HB 2JTDA 4Y2DB 3CXDH 5EC2B 4RIRA 5CUSH 3RWCB 5JZ7C 2G2RB 1ORQB 3B9AA 2E7MA 1C5CH 2R8SL 3TT3H 4PRIA 2E6JA 5F7LB 3RL2B 2IFFH 2VDNL 1JNNH 5FOBA 3JVGC 4R7DB 5FGBA 1QYGH 1IILE 3FB5B 2QHRH 4U2YA 2XTJD 3AU1B 2R1WB 2EEBA 3UTQB 1FVDA 2IFGA 4FFYH 4DUVA 4JZOA 5KVEH 1QBML 1CE6A 2ORBL 4HIIA 4U6HB 4DQOL 1OY3B 2IQAB 1MFCL 3CMOL 4OF5A 2HFGH 4FXGA 1IGJB 3VRIB 4KJQD 4P59H 1HYSD 3FRUA 4BA8A 2X4RA 3P30L 4MJID 3QO1B 4TNVK 4U3CA 1QP1A 4JCMA 2LABA 3U9PL 5GRZA 4AIZB 1YYML 3WNOA 4KTEH 5CHNB 4M7ZB 2GHWB 5I8KL 1FYTA 3Q5TA 5F9OL 3VFMB 1P7HL 2WUBH 4LLVA 4FQ1H 3KNBB 1DUZB 4WWKD 1DEDA 4K3JL 4Z7QF 3K80A 2E7BA 1B0GB 2AI0H 1DQMH 1B3JA 3Q3GA 3SDXA 2LTQC 5E8DL 4P57B 1ITBB 1RIUL 1JZ7A 1UZ6E 1PQZB 1BPVA 2OTUB 4HUUA 3KYOB 3FFCD 3GMRA 5L0QC 3L5IA 2A6IA 2VDNH 5CZKA 2IBBA 3QJFA 3PWJA 2FHBA 4JZNA 4LLYB 5IK3A 3GMQA 5K93A 5F3BB 1TZHB 5MEPA 2J4WL 4C58B 4RGMC 1CFBA 4F9LA 5KSBF 1L0XA 5IFHH 5H37G 2ORBH 3TIEA 5MENE 5DFVC 4DQOH 4IJ3C 3BZ4A 2EC9U 3CMOH 3BIBX 3QYCA 1CLYH 3DGCR 5D7LB 3SGKC 3IVKA 4X9GA 3ZKSD 3U9PH 1KJMA 4YGAB 2BVUA 3NIFF 1YYMH 4FQCH 4KJPC 1ZLUK 4J2XA 2ZG1A 5I8KH 2YN3A 2EYRB 4R2GD 4ZO7A 4RGNC 5C71A 4GQ9H 2VQ1B 4K3JH 1J8HB 1MFAL 7FABL 1M7IB 1F11A 1U3HA 2FJHB 3O2DA 2DIBA 4Y2DA 2ZUWA 4PJBB 1QSEB 5FV1L 4K8RD 3RUGE 3U7WL 1HXYB 4PS4L 5E8DH 1I1YB 1NBZA 1RIUH 4TOYL 3RWCA 1CICC 1DSFL 1ORQA 4LRIC 4RZCA 5I30L 1C08B 1AXIB 1KIRA 4PLKD 4CADB 4K9EH 4QTHB 3SE4A 3M17B 4IS6B 5K59E 3LAFA 4EIGB 3WFZA 2L4OA 4JFFB 1I7TB 1P7QB 1C12B 1RV6X 2R1WA 3UTQA 3KLHC 5HYJB 2QV2A 4L4TB 2EDFA 4RMQA 1CI5A 4NRYA 3GJFK 3DGGA 3D69B 2M26A 4HIJB 5BW7A 5L8JB 2X9XA 3V0WH 2XPGA 4QOKB 5F7KC 1IGJA 1QFWL 3RU8L 3VRIA 5J11C 2VR4A 4L8DB 2WK2A 3OL2A 1HQ4B 3CH1B 3AXLA 3PG2A 4AIZA 3J8F7 4H88L 3RWEB 4YBQC 4NQSB 3VJ6B 4PRHE 1ZKAA 3ZSSA 4QHNB 5D7IF 5ICZB 3V5HB 1BOYA 4QCIB 1LNUB 4IHOB 3KNBA 4UDUB 1QBBA 7FABH 3G6DL 1ADQL 1CTOA 1T0NA 2IC2A 2FCBA 3DBXB 3WS6A 2EIEA 3ARED 1B0GA 1I1AD 4PS4H 1UH4A 3VFOB 2AJSL 3MYZA 5I30H 5E6YA 3EDJA 1RY7B 4WUUB 1BGXL 1P5VA 3DMMB 1KT2A 1GZQA 4YXKH 4P9HC 3VI3E 3FHAA 3VD5A 1QLFB 3LCYA 1XMWA 3ZT5A 3RZCA 5EOCL 1RZ7H 4NM8L 1MCKA 4FRWA 4NQEA 4WU7B 4KAQH 5ENWB 1VEMA 4OT1L 1C7SA 1BLNA 5I1KH 2K3TA 3BZFA 5BS0B 4NWUL 1QSFD 3NN8B 1K5NA 5F7MC 3WSQL 1NGYA 4G9FB 1EIBA 3N0PB 4HSQA 3PQYB 3ECBB 5D7LA 3T0DA 2XWJB 3TNMA 4HGMA 3L3IA 5EOQL 5IWLA 4MJ2A 3ESVF 1RJZB 2NXZB 3PWUB 3WCYA 1CXLA 2EYRA 4MYWB 4RNRA 2DQEL 2AK4E 4L5FL 1A0QL 2VQ1A 3G6DH 1ADQH 1J8HA 4CRPA 3CU7A 3IDYB 5DQ9B 2W92A 1NGPL 2FJHA 5FHBL 4PJBA 2FBJL 1IAKB 2DMCA 2ZG3A 5C0JA 2ADIB 4LSRL 3UPCA 1L7TH 1MCFA 2EDLA 1D5BB 3SGEH 3S3SA 3JWOL 1AGDB 2UYLA 3NA9L 3EFDL 3RWIB 3O0RL 3K1DA 2NY0B 4WENB 1A02N 4RFOH 3IB4A 4NM8H 3B2VL 2VLRE 4MWFB 2WMPA 3HNSH 1XGPB 1P7QA 1WFNA 3KPNA 2YBRB 4JPWL 2GCYA 1C12A 2VZUA 4DK6A 2AEQL 5HYJA 3WXWL 2UUDH 2YKLL 4K3EL 4CL7A 1SEQH 4NWUH 4G6KL 4KRMB 4CMHC 2APTA 4H1LH 1ED3A 4IDLA 4QOKA 1FH5L 3HLAB 2NW3B 5IVOA 1G7PB 2EXYC 4L8DA 3W2DL 4M1DL 1U8QB 1P6FA 4ZXBC 2P8LA 3KPRD 1BX2B 1H8SA 4A2LA 4M43L 2OI9C 4NQSA 1I7UB 3QG7L 3VJ6A 2DQEH 3N1MC 4H20L 1QTYT 4L5FH 3DVFA 5ICZA 3V5HA 1LNUA 4IHOA 4UDUA 4XZUB 3HG1E 3F6LA 5FO7B 4P9ML 4JDTH 2DLHA 2LAGB 5FHBH 2FBJH 4PLOB 3VFOA 4LSRH 4OF0A 1Y18A 3O8XD 5C2BL 1S5HA 4QEGA 2V9QA 4OZHB 3D2UD 1W0VB 1EO8L 1G1YA 1FJ1B 3CVHA 1OTTD 3JWOH 4KMTL 1U58B 4ZSOB 3DMMA 1IJ9A 2XZCL 4GG6E 5JOPD 4J4PA 1IGYB 1AO7E 2YZ1A 2VXQL 3B2VH 1WAAE 1MCHA 2X4PB 3K8KA 3TBYA 3ALXA 4HS3B 4Y1AA 4BELD 2BNRE 2OZ4L 4JPWH 2QSCH 3GM0A 2AEQH 5KTEL 3MLXL 2AJ3B 3WXWH 2R23B 4CU6A 4EQ3A 1KXTB 5F1NB 5E6ID 3BP7A 3EYQD 4G6KH 4LFHG 2NTFA 3H3PL 4AEEA 1T2QL 3DUSA 1IQDB 2CKBH 5HJ3B 3ECBA 2AJXL 2YUZA 4M1DH 1H3XA 4P48A 1CLZL 2ERJC 3ZKMC 5IQ7H 5IOPB 4M43H 1RJZA 3QG7H 4H20H 1M4KA 4P2OC 4W81A 2B8OT 4P5TA 1X5FA 4PP2B 1I4FB 5D7KE 4P9MH 1KCRL 3V4UH 3GSXB 5I17A 5ITFA 1KCUH 1VGKB 3RZWA 3KPQA 3WUWG 4U0RC 1KTRL 3A6BL 1K2DB 4KMTH 3OX8B 2C3VA 5JNYA 4MS8C 1DLHB 2XZCH 1AGDA 4P5KB 4LMQI 3RWIA 2Z35B 3OKKB 4MA8L 2VXQH 4TUJA 4P5MB 1H8NA 5JOEA 3PP4L 2NNAB 1LVEA 4L4JA 2HRPL 4MWFA 1AD9A 1XGPA 2EE3A 5IBLC 5I1IH 2YBRA 2X70A 3LKPB 5KTEH 5DMJB 5TPWL 5EO9B 3LKNA 1MJUL 4KHTL 4WW1B 1D6VL 2Y5EA 4Y5XB 3CMGA 5IVZB 1ZLVK 1TPXB 1TLKA 1QVOB 1T2QH 2X9YA 1ES0B 4XI5D 5DGRA 2AJXH 1U8QA 5IG7A 1VACA 3MRHB 1J1OH 1BX2A 1CGWA 1WISA 5FUCC 4YDIL 1I7UA 4NHCL 2O5XL 5B3JF 1FG2B 5DF0A 4O2CB 4XZUA 1KBGH 1FORH 5C2UB 5LGJB 3NFSH 3PIQB 1CFQB 2BY2A 2YEZB 3LZFH 3A6BH 1W0VA 5JDSB 4O51B 1FJ1A 4ZYKB 4ZSOA 3CFIC 4HUKB 4MA8H 4KJQC 1HYSC 4HT1L 3HZKA 3K4AA 3PP4H 2H32B 1HK6A 2HRPH 4HS3A 4LAJH 3VFSA 2P8MB 3C6LC 2EIZB 3WUZA 5ALBH 3HPLA 4LDEB 5TPWH 1A14H 3WFEH 2AJ3A 2HJLB 4NN5B 3QULA 1MJUH 1D6VH 2FL5B 5F1NA 2CUIA 1QFOA 4HGWB 4O9HL 3P0GB 1TQBC 2WINB 3BT2L 3MNWB 3T3ME 5HJ3A 2DQGL 5E8PA 4N9GA 2V6HA 2B4CH 2EDOA 4ZS7L 3K4DA 5CP3H 2O26U 3PJSB 4YDIH 3VH8B 2O5XH 3BYYA 4LEOB 1LO3H 4M7LT 1I4FA 1ZGLB 4X83A 3OR6B 3LQAL 3NZ8A 1T89C 5B22A 3GSXA 5GRJL 1QRNE 1YMMB 4LLQB 2Y5TA 4U1HB 1QR1A 1VGKA 3BFOA 1LO0H 2P5EB 1K2DA 4RWYH 3CNKA 1INEL 3OX8A 3WLBB 5M95B 1DLHA 1J0JA 4P5KA 4GUPA 5HGHB 1AJ7H 2GK0B 3FRPG 4HT1H 4IMKA 4P5MA 1IL1B 2NNAA 4HF5L 4GS7C 5EUKB 1Q9KB 2VXTL 3UYRL 2VC2L 1IC7L 4Y7MA 4O9HH 4RMSA 4WW1A 5BVPL 4KKBC 2QKIB 1JUFA 4Z9KB 3BT2H 1QVOA 5EO0B 12E8H 4DEPB 1MAJA 2DQGH 2QR0B 4K8RC 5T1MB 4HLZG 3GJFB 5GPRA 3H0TB 4ORZC 1SY6L 3MRHA 2ATKB 4PLKC 5TQ2H 4KK8D 4MB5A 4Q9RH 1FG2A 3MLVL 1S9XB 1NL0L 1REIA 5B8CB 5DD0L 3QISA 5EIIA 4BSVA 5LGJA 2P7TA 1CG9B 1GGIL 1CFQA 2DS4A 2JCCB 3UDWA 2WQRA 1AGEA 2YEZA 1JNLH 4HPOL 5I1EL 2B5IC 3MLUH 2VWEE 1INEH 4O51A 5JDSA 5C09D 3AS0A 1V3JA 5DT1H 4ESKA 3KLSA 4ZYKA 5J13C 1MRCL 4EOWL 1OP9A 2PCPA 1BOGB 4ZODA 1V3LA 4ZAKB 4L3ED 3PDGA 5CKGA 4HF5H 3S36X 1G7IA 3DSNA 2FIKA 2VXTH 4YC2C 3UYRH 2E7LC 3ESUF 2VC2H 1IC7H 4R0LC 1UG9A 5I66B 3UAJD 5BVJB 2A38A 2ICEB 3AREC 4NKQB 3HUJB 1I1AC 4PRID 1T1ZA 2XQYG 3X12B 3IDXH 1CTNA 1SY6H 5EIQA 5I9QB 1FVEA 1JWUA 3B43A 1TJGL 3W81A 3PJSA 1FGVL 4OIAA 4NQDB 3VH8A 5F1IB 1KIQB 1BQHG 1H3TA 4FXKB 1TDQA 1NL0H 5DD0H 4LEOA 4OZHF 1A9BA 3F7YB 1KCSH 5B38A 3OR6A 1A7PL 3QFJB 3HMXH 5J4MA 4J12A 2CRZA 3WDHA 3H9HB 4L4VD 4U1HA 5HPOA 4HPOH 4U6TA 5I1EH 2AV7B 4XWOD 5F6IB 1JWSA 2P5EA 1YC8A 3IKCB 1MRCH 4F2MB 4Z7UA 4M3JA 4GQPH 3S5LG 1ERNA 2EH7L 3MXVL 4M6AA 2C1OA 3Q6GL 4WO4B 1M7DB 4X7DC 4IRZL 4WV1C 1NFKA 5LGKA 2WBJB 5C0CD 4IDJL 1QFPA 1Q9KA 3B3IB 4W4NA 1T7YA 5JQ6L 4NBZB 1NKRA 3AFLA 2EDWA 2Z31B 4XP6L 1MOEA 1EPFA 4GAGL 4MAYA 3MBEB 3WJJC 1E6OL 1BZQK 3GK8L 5J89A 3RGVB 2Z0BA 5I18L 3H0TA 4YQXL 4Y16C 3KR3L 1TJGH 4C4KT 3MV9D 2V5YA 1FGVH 1T5WB 1J0KA 4I5BA 3UROR 3OV6A 1F8TL 3MRBB 1S9XA 5B8CA 1KB9K 3M8OH 5HHXL 3GSRB 4OD2B 4DGVL 3HAEG 4K71C 3KHOA 3N06B 4EIZC 2BX5A 3FJTA 3MBXL 4PTUA 4PJ7B 2XFXA 1KLGB 5E2TH 3H9SE 4YEFA 2LE9A 2OL3A 3GMLB 3E3QE 5GS3A 5I2IA 3G6JE 1EBAA 1JGEA 2FECL 5E9DD 1JGDA 3PV7A 5CLTA 4S1RH 1BOGA 2VDPL 3TP4A 1TZIA 5DEZA 4IRZH 4X6CB 3DXAD 2UY7A 3OAUH 5HYSA 2X05A 4IDJH 1A6AB 9CGTA 1U3HD 5CEZL 3S4SB 4Y2DD 3TPKA 3RWFA 4G8GB 5I66A 4JO4L 5JQ6H 2GSIA 1P2CB 4XP6H 5CIPB 3E0GA 2ICEA 1GGCH 1GIGL 1CDUA 3MRCA 5HHQB 3HUJA 1E6OH 1OT2A 2J6EA 2NW2B 2OTPA 4Q74A 3GK8H 1RHHB 3O8XC 4HXAL 4TNVF 2PTTA 4YQXH 1OTTC 1ZSDB 1Q9LB 5D6DC 1KIQA 5KOMC 3WJLA 4FXKA 3S35H 3L9RB 4DGVH 3F7YA 1DQJA 4GXUM 1XF4A 4RQQB 3QFJA 3H9HA 4AEIL 4NC1C 4MNGE 4HCRA 1XT5A 2DMBA 4JB9L 1F2QA 5E6IC 3EYQC 1HHHA 3VFRB 4F2MA 5LVEA 5IBUB 4WVRA 1BVKB 4WO4A 1HEZB 5DD1L 4TVPL 3CDGA 2WBJA 3A6CH 3QQ9D 5CEZH 4LCUB 3DROB 4JO4H 4X9FA 1C8PA 2YD3A 1K6QH 1VADA 5T3XE 1GIGH 4NJAH 2RGSA 2Z31A 4UDTB 5EBMA 3MBEA 3PWLA 2E9WA 3TA3B 3KPPA 4HXAH 5SWZB 2QQNH 3GO1L 4WI9A 2DTML 5E70A 1CT8B 4LPTA 5ISZE 4YHIA 4U7MA 3U7YH 4QRUB 3ZDZE 4KJYB 4I2XA 3RX5A 4AJ0A 4MGXA 5I1HL 2WLYA 2OXGA 2OMNA 4R3SB 5HHOD 4AT6A 3GSRA 4OD2A 1KN2L 1GGBL 3MMEB 2MQCA 4AEIH 2ICWB 4UT9L 4PJ7A 4D8PA 5I74B 4HIXL 4JB9H 1KLGA 3FO1B 5D7LD 1A7NH 2DL9A 3GMLA 2NY5L 1QR4A 3CH8A 4XI5C 4J3UA 4LCCC 1WIUA 5SX4H 1JHLH 2B7DT 4TVPH 3NBNA 3GMMB 3LV3A 4IRSA 4PFEA 4WHCA 1J8HD 1A6AA 3DOSA 3WBDA 3LH2L 1QSED 1F4YL 5E95B 1P2CA 3OKOB 5CIPA 1HWHB 5C70A 4WW2A 2AQ1A 2VDQL 4B41A 5I6XC 3GGWB 3GO1H 1RHHA 2DTMH 3QZWG 3G04A 5JW3L 2V2TA 4AQ1B 4QXGL 3BDYL 3CFEB 1ZSDA 4OZGE 4JFFD 1NEZG 4XP4L 1MI5E 2JCCF 1Q9LA 1F3JA 3DPBA 3P73B 5HYJD 1KN2H 3NMEA 4L4TD 4LPWA 1GGBH 4X8XA 3EO1A 4LLWB 1F4WL 3HE6C 2BVPA 4RQQA 5BQ7A 3UX9B 1P5UA 5DDHB 1E27B 4UT9H 4ZNCD 4LVEA 4HIXH 4QOKD 3WNNA 3TBSB 1I85A 3ROOB 2EEDA 3ZL4L 4GW5A 4HXBL 2NY5H 2IH3B 5GS2H 2CR6A 1BVKA 4OKDA 4FQXA 2DM3A 2HVJB 2WIMA 1J0YA 4G6FB 1HEZA 3P9MA 5DWUH 3WNMA 5EA0L 4R97B 4TTDD 3PDOB 5BRZE 5HDBF 1QACA 2HFFA 4G8IB 2E8YA 2CKNA 3LH2H 2CUHA 4HG4K 1YN7B 1F4YH 2XN9A 5I8OH 5HY9B 5DRWB 1QFWI 2X1QA 4LCWB 3V52L 4ZUUB 5IJKA 3VRLE 3QFDB 1FSKB 2QQKL 3T65A 2VDQH 4HAGA 4ZOBA 4WUUD 1Y0LB 1EFXA 1X5GA 3DMMD 3D6GA 3DNKA 4NP4L 5JW3H 1CT8A 4UAOB 3VGAC 3BDYH 3N1QC 1LO2L 2D0GA 5CS7A 4P99A 3BMVA 2M8XA 4M6ML 3QQ3B 2RB8A 4N1HB 3QXDB 4F7CB 4LGSB 1FL3B 2PW1B 4GG8B 4OIIL 5ADPH 4XMKH 5DR5L 4OV5B 5BS0D 5JPMA 3MMEA 4P3DA 4TVSa 4BM7A 2XQYK 3OJDB 4G9FD 5HHMD 3PQYD 4NQXA 5D4QA 3FO1A 3ZL4H 4HXBH 4XMLL 4OFPA 4Y19B 4OJFH 3MA9L 4N8PA 3NAAL 3O9WB 1ZVSB 4V1DB 2MHAB 1J05B 2NXZD 4LVOC 3JWOC 2H32H 4I4WA 3UTOA 1ZANL 3BHBB 3O3UN 5EA0H 4K3HA 5GGRB 1YA5A 4KK8C 4YXLH 4HWBH 1EHAA 5HDQL 2NX5B 3LS4L 3L1OL 1F3RB 2I9TB 3MV8B 3KDMA 3TVMA 1DJSA 5AYUH 2F19H 5ESAA 3RNQB 1RU9L 1KTDA 4JRYE 3EYFB 4LK4A 3GGWA 2FJGB 1CXHA 5IROA 2PYEE 4N68A 2HLAA 1J0ZA 3P4MB 4Y5YB 3VG9C 1DDHB 4G43A 4HJJL 5GGUB 2CDFA 3SY0B 3CFEA 3ZE1F 4OI9A 5J9PB 4GXUN 1D9KC 4JKLA 4Z7NE 3C5ZB 4JY5L 1L0YA 1H5BB 1F00I 5CEZD 4GKNB 3U82B 5DR5H 4LLWA 4OTXL 1HNGA 4Y1AE 3WL9B 4J3XA 5DDHA 5GS0L 5D1ZD 3UAJC 4BUHA 4Z78B 2DQHL 2OYPA 1ACYL 4XMLH 1F45A 1HILA 1DP0A 4X6CF 4XCCL 2AABL 2R2CA 4ODUB 3QWOB 4P2RE 3MA9H 2IH3A 1JIBA 4CNIB 3MJ8B 3HC4H 4B5EA 1IGMH 1KN4L 1BFOB 4RCAA 2HVJA 5C86A 4ZUVB 2X4SA 3ARFB 1UJ3B 1I3UA 4G8IA 4MA1B 5HDQH 5JDJA 5GRUL 4YGVB 2E8ZA 3HN3A 2ARJQ 3LS4H 3L1OH 5AZ2H 1KJVB 5HY9A 3RVVD 2X4NA 4LSQL 2DQUL 1LE5B 3QFDA 1RU9H 2J6EL 1IM9B 4YNYB 5CWSB 2XI9A 3VWKB 4OQTL 1NCAL 3GJFH 3LKSB 3IRPX 4YPJA 4BH8B 1I9IL 2VZ3A 4XGZA 2V5RA 2FDBP 1CDBA 4HG4J 3G08B 4YHML 4YXHL 3D85A 4EUPG 5A2KH 3BPOC 1FC1A 4TVPD 5T1DL 4QXWA 2A9NL 1MFBH 4JY5H 5A2LH 4F7CA 4X4YB 5AG8A 3UBXA 3O41A 4RX4D 1UCTA 3VD7A 4OI8A 3HFML 4XP1H 1JPGB 2HJFB 2VUYA 3VXUA 4OV5A 2EDJA 4BUGA 3MRKA 5GS0H 4HCRL 3JV4B 4XCCH 2AABH 4KK5D 2DQIL 4Y19A 1OP3K 2G9HA 5I1DB 3KVQA 2FLRT 5D2NC 1ZVSA 3K8MA 5F97E 3WHXA 3CJJA 1FYHB 1YEIL 4XBPB 1RUML 3BHBA 4JFDA 4QRSA 1FCCA 3D87B 3BWAA 2P8PB 2BK8A 5C0DB 2EDBA 1SM3L 2NX5A 3EO0B 3QEQE 3QUXB 4UT6L 4L8CB 4LSQH 1MRFL 1B4RA 5E00B 4F9LC 1G84A 2DQUH 3MV8A 3HC0B 5EZLB 2X42A 3FOMB 5JLZB 3B2UD 3RNQA 4OQTH 1NCAH 1DR9A 2FNBA 3EYFA 4GRMA 2YUXA 1IARB 1GXEA 3MRPA 2FGZA 4YR6A 1I9IH 3P9WB 5JXED 5GS2D 4KROB 3P4MA 4YHMH 4YXHH 3HR6A 3O2WL 4Y8AA 4JGJA 4Y4KA 5C07A 3NCFB 4XMPL 5DD5L 5FYKU 2A9NH 4WDIB 4JY4B 5JUEH 2MNUA 4LPUA 5CP7A 25C8L 1ZHBA 4XC1H 5IW3A 4GKNA 5JR1L 5JIIA 4M93B 4DAGL 4KDWA 5HHPB 3GEWB 5A3ID 1U3HC 1QBAA 3WL9A 5DUML 4Y2DC 3GJEB 4Z78A 1PEWA 4QTIH 4X6FB 2DQIH 3T1FB 4ODUA 3QWOA 2XTJE 3QA3B 4CNIA 1U8IB 5TE7L 1ZT7B 1A3LL 5E1HB 4JO2L 4X0KB 4EI6B 1BFOA 1E4KA 1YEIH 4WFFD 3SE4C 3RQ3A 5L2KB 4ZUVA 1A5FL 5CP3A 3P2TA 2PO6D 1NJ9B 1XR9B 3F5WA 1SM3H 4YGVA 1Q0XL 3QHFH 1KB5A 1RUQL 5BV7B 4CN4A 4RMVA 3WO4B 3BQUA 1LE5A 2DQTL 1AC6A 1BF8A 3SE9L 3MXWL 4JJHA 5BW7C 4QRPB 3LKSA 5FO8B 3ZYOA 4L29B 3SDYL 3NACL 3WIFB 1AD0B 3CSGA 4NO5A 4BH8A 2DBLH 3KXFB 4HGKC 2F9BT 3ULVE 3WDJA 5A40E 1S9KC 4KI5F 2UVFA 3TPUB 2IBZY 3RWJB 3MCLH 3BGFB 4GKZB 1H9VA 4M7ZC 1I8LC 4RSVA 25C8H 2KKQA 4I8DA 5F7DB 3GIVA 4GRLB 5JR1H 2HJFA 3WMSA 5I1JL 4DAGH 1GSMA 1RFDL 3QQ9C 4ODSH 5DJ8A 5DUMH 1TVDA 1KG0B 1KPUA 5BO1L 3KHQA 2V2WA 3TV3L 3LQAC 1FNEA 5CSBA 2ZUYA 4AL8H 2DYPB 5GGQL 1UC6A 3RVWC 3BE1L 2BMKB 5TE7H 1A3LH 4JO2H 5I1DA 3ROLB 1UVQA 2FD6L 3L7EB 5F3HB 3G5YA 1MHEA 2DIJA 3T09A 5BOPA 2EKSB 1BJ1H 4N0RA 3ALPA 2Y7QA 3DUUA 2I07B 1CZ8H 2P8PA 1Q0XH 3NCMA 5F1KC 3HB3D 1YMMD 4JPKH 3EO0A 2ITDA 3CX5K 5DHYB 3MRNB 3QHTC 4YDKL 5E00A 1VERA 4F58L 3FOMA 5JLZA 2DQTH 5C8JB 3ZHKA 2P5ED 3SE9H 1XR8A 3MXWH 1KXVC 3SDYH 4WI6A 3NACH 3BVNB 2RQ8A 3SPVA 4HFWB 3IJHA 4M3KB 5EUOE 2FB4H 3TJHD 4FFVC 5IWLC 4JN2A 4Z7WF 3MSPA 4JY4A 5C0BA 5I1JH 2DI7A 5DS8B 2NZ9D 3WIHL 5JMOC 3TV3H 1PKQE 1CR9H 1D5XA 5ICYA 3GJEA 4GKSA 3NIGF 1DBBL 4FFZL 5GGQH 4X6FA 3K7UA 3T1FA 3BE1H 5IM7A 1UENA 4XC3L 4EI6A 4X0KA 2DIAA 2IG2H 4PJHE 3EDFA 5IJVB 5JW4M 3TCLB 5I8EB 4MJ6B 2DWDB 4FABL 1IEBB 1SMOA 5DSCB 4YZFE 2WWKO 5KW9L 2IH1B 1XR9A 3VCLA 2SEBB 3QDGA 2GJZB 4E5XB 1E28B 5GS0D 4FS0A 3IJSB 1KC5H 3HHRB 1NKOA 2V9TA 5FO8A 4LDOB 2JKXA 2V17L 1V8HA 2XIDA 2EKJA 4L29A 5B39G 1ZLVH 1GYAA 4JRXE 3KXFA 5TGBB 3SCMA 3QDJE 3JV5A 4PJCE 4HFUL 3TWCH 3WKNA 4ZAKD 4LSDA 1CDJA 1JZ2A 2H3NB 3RWJA 4FQIL 3IDGB 4GKZA 4YBHA 4NT6A 2IANE 4GRLA 1EGJL 4PJFA 2KDGA 1BEYL 3L3GA 4TTDC 1SHMA 1Z5LB 3LD8B 3WIHH 1HHKA 2X1PA 3S9DB 5A16B 3PNWB 1DBBH 4FFZH 1OGAB 2D9CA 4DFIA 2ICCA 1B88A 4J3VA 5EORL 2BMKA 5DEFA 3DMMC 3ROLA 2Q8AH 4RFNC 1RZ8B 3L7EA 4J4PC 4NQDD 5F3HA 2ARWA 5ICXB 4FABH 1T1YB 1XH3B 2EKSA 4AENB 4M8VA 5C6WH 2I07A 1V3MA 3QFJD 4APQB 3ARTA 3F65A 4NIKB 5DHYA 4KKNA 3MRNA 4PV8A 5F1OB 5C0AA 4RMWA 2Q7NA 3EGSB 2AXJA 1X5KA 4YPGA 1SQ2N 5L6YL 1WBYB 4HFWA 3MCG1 3UTTB 1QFHA 1QUNA 3GSQA 4HFUH 4WO4D 2QQLH 4LKCA 3CX5J 2Q6WB 1XCQB 2NXZC 5K9OB 3U36B 1BQSA 1R3LA 1EGJH 4UBDD 1BEYH 4NWTL 1AR1D 5DS8A 1GAFL 4NYLA 4WTZG 3IDYC 3DLQR 2Z31D 5C92A 3D18B 3A67H 4U3XA 4ISVB 3MBED 5K33A 1SJHA 3FQXA 1A4JB 3LDBB 4C55A 3BI9X 1PYWB 3RGVD 1XF3A 3OKEB 1IFHL 2DN7A 1CD9B 5L8KB 2YRZA 2GY5A 2IPUK 2NY0C 2BOBB 5FHAL 3PWVB 2YA2A 5DSCA 2DWDA 1IEBA 1CLOL 4M62H 2IH1A 1ODAA 4E41B 4DN3L 1TMCB 5ETUB 4CVWA 2SEBA 5KVDL 1YEFL 4XBEL 2GJZA 1E28A 3KPRE 1ZA3B 3DURA 4XXCA 4A6YH 4JM2B 4ELMA 5DJDA 1YEJL 2OM5A 4O2EA 1HE7A 4MNQE 4KVNL 4M5YH 2XG5A 5DK2B 4ELKA 1IGCH 3NCJL 2FH8A 3FB6B 5LQBH 3OKNB 1NUGA 4W4OA 1YJDL 4G8GD 3TN0D 4OF7A 3C2SA 4U1MA 5M94B 1H3GA 2E9BA 5TH2A 3GSOA 1HCVA 3RWGA 1DQDL 4LCIL 3QG6B 3BO8B 2HT3D 3FTGB 4EN3B 2YWZA 3RVVC 2BP3A 1IFHH 3SDAA 2ZSWA 5BZDA 1XIWB 4NC1E 3TO4A 3S96B 4A2MA 3CSPA 4UILL 1CL7I 2N4IA 5FHAH 2Z91A 2NLJA 1NCDL 1XH3A 1CLOH 4AENA 5FYKL 4LQFL 4OLYL 3PV6B 4DN3H 1SEBB 2EDDA 1JHKL 3ZDXF 2IBZX 5KVDH 4N90E 5DJ6B 4RISL 4I2XE 3MRIA 5GSVA 4UU9B 3T2OA 5IVNA 1FDLL 3UJJL 1IAMA 3QNZA 1YEJH 5IQ9A 1IT9H 4PY8I 43CAB 1WBYA 3UTTA 3QDAA 3ARZA 1S7TB 1CE1L 3NCJH 4MXWL 1DQQB 3QIWB 3ZTNL 5IV2B 2COQA 4X9HA 1XCQA 1NFIB 2ADJB 3L3JB 4PJDB 3GI8H 4G5ZL 3R8QA 1OB1B 2I25N 2DWEA 3B83A 4ISVA 2Y23A 3TA3D 2P5WB 4HDIB 5SWZD 4DVRH 2D4DA 2GSGB 5JW4N 1G7MA 3OKEA 3GMNA 3B2UC 3IFLL 4TNWK 4XNUH 4HS6A 4UILH 3TNNB 5JXEC 2Z4QB 5D1QB 1DL7L 4FQPA 4IMKC 1EAPB 1NCDH 4PGZA 4JO3H 4EZMA 5FYKH 4LQFH 4OLYH 1JHKH 1QKZH 4PGBB 1FZJA 4HKJB 3GFUA 5MEOB 1ZA3A 1VGEH 1FDLH 3UJJH 2BVQB 2ZOLB 2YPVL 5A3IC 3NFPB 1TPXC 3ET9F 4MDJB 1HHGA 5SWSA 1CS6A 4Z77B 4MXWH 5I75B 3QXAA 3IS1X 4NJ9L 5DK2A 3ZTNH 3FB6A 2R1YA 1Q38A 3LN5B 3O3DB 4NQUA 5DJAB 1IKNA 4I9WE 5E2WH 3EYOB 2H9GB 2CLRA 4LGRB 4I3SL 2FX9H 3N9GL 4U6VL 4ERSL 5D7JB 3QG6A 3BO8A 3N1FC 3QUZB 4EN3A 1R24B 2ZG2A 4PG9A 4QRRD 3CLEH 4OCYL 5D5MB 1YEEH 2B2XL 2BSED 3E8UL 1A3RL 2A74A 5KS9B 3MRFA 4NNXB 4JKMA 1UWEL 1BIHA 4D3CL 1RK0B 1DL7H 1R5VA 5KG9B 2IAMA 3QIBB 3OXRB 4X5XB 4CN1A 4F8QA 4Z7QE 3PWPB 5D1XA 4KV5F 1TFHA 1SEBA 3CFCH 1RVFL 2FATL 3LHPL 4KI5D 4Z7OF 5MHSD 3OR7B 5DJ6A 5BV7L 2YPLE 4N1CA 1JN6B 4JFHD 4UU9A 2ZCHL 4NN5C 5JIPA 4WNQB 1MCCA 3JV6A 4DKEL 3MRQA 4Q0XL 1OSPL 2NY3B 5J1AA 3VXPA 5E8NB 2P47B 4ZNEA 1T5XA 5EU6B 1QLEL 1DE4B 4BH7A 4FQQB 4G6FD 5JW4R 1IVLA 5J57B 2EE6A 5DURD 5JPNA 1DQQA 1F3DJ 4NCDA 3GSNB 1NFIA 1G6RB 3L3JA 4M7KH 2J1KA 2ITCA 5KSBE 5ANMB 4LCWD 2Y06L 4U6VH 3TYGL 4ERSH 2A6KA 2R1XA 3T2NL 2GQHA 3HB3C 5DFTA 1FZMB 1RZIA 2P5WA 4YWGL 2GJ6B 4UIMA 4F37K 4HUVA 4OCYH 4GW4B 4U33A 5IMMB 2B2XH 4MNHA 1I1CA 1A3RH 3DRQB 3UTSB 3K8LA 5IB4B 1UWEH 2GY7B 4HJ0D 4D3CH 2ADGB 1S7VB 3TNNA 1EAPA 3FQNA 4NN7C 5ERWA 2Q1EA 3TJHC 3C87A 4JGUA 1RVFH 2FATH 3LHPH 3MOBH 4PGBA 4YHYB 2IPTH 2NY7L 2ZCHH 4HKJA 5DYOA 5GGSB 2DI8A 3VRJB 2NZ9C 2CR3A 4DKEH 3AY4C 1K8IB 2BVQA 4IRJB 4Q0XH 2ZOLA 1NC2B 1WBZA 3VFVB 1GOFA 3FONB 4Y19D 4MAYC 4DEPC 3O9WD 4V1DD 1K9TA 1QLEH 4KVCL 4OF8A 1T1XA 3V6OE 2HTKD 4HIHB 3QRFM 3NVQA 5J0BA 3GRWH 4LARH 1N0LA 3O3DA 1DVFA 3PGCA 5JTWA 2PTUA 5DUPL 2H2PD 4KKAD 2JLLA 4CUCA 3MV8D 5B8CC 3TYGH 1A7BA 5I8CB 5SWQA 3T2NH 4NRZA 4X6DB 1AGBA 3IDNB 4PR5A 4YWGH 2MKLC 4F80A 3QUZA 1TZGL 1R24A 4H1LG 4JZJB 1UQSB 2PUQT 1BZ7B 3MODL 3BZEA 5IB2B 2I9LB 2IGFL 4E42B 2A6JA 4D0BB 4JFEB 1RPQA 2VLME 5E8EB 3HS0A 4LASH 2VLJB 3C5ZD 1C1EL 3QIBA 2C7UA 4X5XA 3LRSB 3QDMB 3PWPA 4ZAKC 4WU5A 4JM2F 2X4TA 1FIEA 1MIML 4PBXA 5LCVL 1OWRM 4U1JB 4ETQB 1ZA6B 3FHQA 3OR7A 1F42A 1JN6A 4ONGL 1XF5A 1EK3A 5GRXG 1OLLA 4N8VG 3DX6B 2P4AB 3U0WL 3WV0A 3A6OA 1NFDA 2G5BB 2F5AL 4GAYB 1TVBB 4U6YB 4B50A 1MFEL 1XGQB 2AKRA 1LEGB 1II4E 4KVCH 1NLBL 1PDKA 1DE4A 5I9QC 4WFHE 1JWMB 1MUJB 3CZFA 3O6FB 4OM1L 3ARFD 4TSBL 3KYNB 2AAVA 1NAKL 3W39A 4TSAL 5FYKD 5DUPH 4Y4FB 3WJLC 3T0BA 3FMGL 5DZNA 1OL0A 4OB5L 5D2LB 1LWRA 1IM9D 3QUMA 2HN7B 3VWKD 1TZGH 4RWHA 5GIRA 2GJ6A 1ZVYA 2C26A 4NQVB 1K4DA 5IEKB 2XNAB 5F6IC 1DEEA 2IGFH 4XCNB 3UTSA 4JCLA 5AWNH 5KSVA 4IBLT 3ILQD 4JVPA 1C1EH 1XF2B 3OG6B 2VXUL 2C4FU 3QQ4B 4WO4C 1FG9C 3UJTH 5E0QA 1MIMH 4GRWB 3SJVB 4P49A 5LCVH 4OBSA 2V5SA 2WBJC 4WI4A 5C07E 1IAOB 4ONGH 5FCSH 3EHBD 2V5MA 1R6VA 5DJZB 5IP4A 1AR1C 5BCAA 2NR6D 2EZ0D 2Z31C 3IFOB 1T3FA 4FNLL 1MH5A 4M5ZL 4NNYA 3KS0H 3MBEC 5ESVB 5HVHB 4PJDF 5FGCE 3VGDA 3RGVC 3ZYJA 2BOCB 3BD5A 4YHLL 2D7TL 4OM1H 2CXGA 2D31A 4HIHA 5FDWA 2X44D 4TSAH 1BBDL 2P44B 1HHJA 1I1FA 1LO4L 5DJYB 3QUXD 2AERT 3NGBB 1S7UA 4JPIA 4G3YH 5CFHA 2UWEF 5I8CA 3FCTB 5L7XL 4X6DA 3IDNA 5E9DE 3LKQB 4EQ2A 4I0CC 2W0KA 1FL6A 3H2WA 3S88L 3RWHA 4KROD 5MP6L 3NCYP 4FQ2L 3VMOA 4E42A 3BISA 5HI3C 5IW6B 5GRVK 2Y25A 1YY9D 1X5XA 2VLJA 1RZFL 1MSPA 3QDMA 2DQJL 1H0DA 1F6AB 5DQJB 3SE8H 4U1JA 1ZA6A 4GBXB 3MJGX 5D72L 1BP3B 2BNQE 2PNDA 5F1SA 4M6NH 2PTVA 3VXOA 4KH2A 2G5BA 4GAYA 1MWAB 1TVBA 4KPHH 4U6YA 4U1KA 1XGQA 3O3AB 3QO0A 1HOCB 1MFDH 5HGBB 2D7TH 1OAYH 1S7SB 1PBYA 2F8VA 3O6FA 5L2KD 1BBDH 3KYNA 4TRPL 2YR3A 4NQCA 2P1YA 2B1HL 4Y4FA 5DK0A 1WTLA 4M6OL 1CF8L 5F7EL 1GGYA 5KS9F 2W0FB 3UJIL 4K7PL 4XCFL 2HN7A 3V95A 3S88H 4QRPD 4XVSL 3SGDH 3D39D 2I60H 1XZ0B 4NQVA 3NCYS 1U8HA 1I85C 4YO0B 2XNAA 4XCNA 1DANU 3ARGB 1EEUA 1YNLH 4HMDA 4I0KA 5BZWB 3VGBA 5LJYH 4K94L 2OSLA 2J3SA 5DRZB 1CFNB 1KOAA 2GFBB 1G6VK 1JYWA 2Q76A 2F58L 4GRLD 1ORSA 1LEIA 2EH8H 4J1UB 2DQJH 3MV7E 4O02L 3SJVA 5LBSL 2FHFA 4HIEA 5D72H 2HLFD 4X7SL 4Z7VA 5I1AB 3EZ8A 1YYLL 5DJZA 2PW2A 5C0BE 2JIXA 2DYPD 4JE4B 1FQ9C 3RA7L 3IFOA 3TA3C 3RDTA 5HHOE 3V6BR 2I5YL 3OHXB 2BOCA 1P9MA 5KBNC 5FB8B 4QHMB 4QRQA 5DRXB 1U42A 1JVKA 3BIKA 2VXSL 5MENB 3NIDE 4QYOA 3I9GL 1CF8H 5F7EH 3T0EA 3FCTA 4JEGB 3OB0K 4S0TD 2E6PA 4XCFH 5JORA 2CJUH 2VAAB 4L8SB 1OCWL 5BMFL 2FR4B 5I74C 5F7UA 1U8NB 5LGHH 5DEGB 3CCHA 3ARDA 3B9KB 1S78C 4H26A 4K94H 2VZ1A 2P42B 1QSEE 2E7CA 2CGRL 4UV7L 1OARL 2J88H 2F58H 4Z18A 4TUKL 5GXBB 4J6RL 4O02H 1YN6A 3C6LB 5LBSH 3RUGB 5DQJA 1F6AA 3VFUB 5HTSA 5H8DA 2CRIA 2CK2A 2PN5A 1YYLH 1RZGB 5TF0A 4P23A 4JFFE 5JMRA 1OT1A 4PJFE 3BX7C 3HZMA 4D94A 4JO1L 4P2QE 2JB6B 3CZJA 4XP9L 5JHLL 1MJJB 2XKNB 1CK0L 2L7UA 2I5YH 3O3AA 1FLRL 3MLYH 5IROC 1JPFB 3HRPA 4ZMAT 3NZHH 4J8RB 4ZUWB 2H26B 3BEVA 1F6FB 3IKKA 1ND0A 3VXRE 4ZPVB 2MPAL 3VXSB 2ICWI 3I9GH 2DI9A 1WCBB 5FECA 2C5DC 2W0FA 4L9LA 4LSPL 5E4EB 1DZBA 4R8WH 4WCYH 1D6EA 1KGCD 1OCWH 5BMFH 4XP5L 2P24B 3P9LB 4WHYH 3X13B 3ARGA 1T83C 3JWNC 2BSTB 4QHKI 1JP5A 3RFZC 3S3JA 5DRZA 2JJSC 2CGRH 5EC1A 1X5IA 2GFBA 4KKLD 2YA1A 4JFPB 3UTPE 1YEGH 1CQYA 4OI7A 3L5WB 1JFQH 4PJXF 3EIFA 4POUB 1BVLA 4WUUE 4U31A 1HI6B 4FOMA 3MRMB 4ODBD 4R97C 2UUDK 4WI3A 4OF6A 2DICA 2ADFH 3PHOB 1JNHB 2CIIA 4D9QD 1OGAD 5EBLA 1ONQB 3HRZB 5J3HC 2X4QB 4D9RE 4JO1H 4XNMA 1LP9F 1M71B 4XP9H 2D7QA 3PL6A 1FSKC 1WZ1L 3PGFL 2H6PB 3QQNA 4GAJL 4YFLI 3VU2A 1V7ML 3U6RB 4K2UL 3KPMB 3OHXA 2QTEA 4UAOC 1Q94B 5BS0E 2A73A 3WKML 5D93B 5FB8A 5D2LF 1N6QL 5DRXA 3GSNL 3JWDL 4HJ0C 5C6PB 2CPCA 1G6RL 2FYYB 5HHME 3TJEL 4XVTL 3PQYE 5L88L 2MPAH 5FUOL 1P7KA 4APQD 1FZOB 3BD3A 2FRGP 1X7QA 2GW5A 2NY4B 2PYFA 1MVUB 2A9ML 2R0ZL 4O2FB 5HVWA 1FFOB 2AXGB 4ODWB 2B5IB 2FR4A 5DMIL 4A6YA 3S6CA 3MR9A 1MAML 4WEMB 1WFUA 1KJ2B 3O9WC 3V5KB 3UXFA 4K7FA 2MWCA 2V7NB 1NCWL 5ID1A 3ZDYF 3HZYB 1DUYA 4MCYA 5E1AB 3RTQB 5C0FA 2H2PC 4KKAC 1MPAL 1EO7A 2R39A 2YUWA 3BUYA 4GMSL 4G6AD 4HULB 1KENL 3PGFH 3QWRA 5T1KA 1B90A 4GAJH 2JB6A 5JA8B 3V6ZA 4KGJA 1MJJA 2XKNA 4ONHA 1V7MH 1XEDA 4K2UH 5CEZE 4XWGL 2F54B 3KLAA 3AGVA 2ZCKH 1KLUB 2DRUA 3DX7B 3SEPA 3VDBA 2ID5A 3WKMH 3STLB 3IFNL 4Y5YC 2YS4A 1N6QH 1Y6MR 4RAUB 3GSNH 3JWDH 3MROB 4J8RA 4Y4KC 1Q1JH 2H26A 1G6RH 3TJEH 2O5ZL 4XVTH 4E41D 3EYVA 2H2SD 4ZPVA 3C5ZC 4PGEA 2OR8A 4QGYA 3AS2A 2A9MH 1K8DA 1YJDC 1WCBA 3WNPA 5L2JB 4PLJD 4JM2D 2QHLA 4JN1H 3FKUS 1ZHLB 4J3TA 1AE6H 2BHUA 5T1LB 2P24A 5DMIH 1NAMA 4JAMB 3C5JB 4AM0A 3MA7B 1GGUA 1UB6B 4PRHA 5FYLH 3K74B 1CWVA 1U8MA 3WUWB 2OP4H 5CJ5A 3HG1B 5IGXL 4JVWA 1E4KC 4OZHE 5FA4B 2DKUA 3HNTH 3ARFC 1HI6A 1X5JA 1A6PA 2GIYA 2A2QT 3T0XA 3KGRA 4MA1C 3BP6B 1MPAH 3QEHB 3R06A 4EN3D 3PHOA 2WBWB 2VLKA 4GMSH 3KJ6H 1ONQA 3HRZA 1KENH 1VENA 4F7EA 2YRLA 3QUYA 5FKPB 2H6PA 1XIWD 3S36L 3VWKC 3C5SA 4Y16B 3IFNH 5DTFB 4KUZL 4RBPK 2HJKA 1A2YA 3VFTB 3ULUF 3B5TA 4LRNL 3RL1B 4LPXA 4JRWA 1AKJB 3I02B 3ILQC 3MREB 3UC0H 3GHBL 4NDMA 1EMTL 4PRAB 2WW8A 5CILL 1L6ZA 1YNKL 4K71B 4DUWA 4N0UE 2K7PA 1MVUA 2FO4B 3JTSB 4WEUD 3TZVB 3W0WA 3SGJC 4O2FA 4LAQL 4QT5B 2J8UF 1FFOA 3EHBC 1AGFB 5DI8B 4HC1A 1QBLH 3NCBB 4G6JL 2NR6C 3OGCB 4TNWF 2DD8L 2B39A 2YHGA 1HQRA 3UTZB 3IXTB 2AK4A 3QIWD 1VEPA 5IGXH 1KJ2A 1HINL 3REVB 3TEUA 2HKFL 5SWSE 1KIPB 3SDDB 4P4KA 3RTQA 1NCBH 3FFDB 4G80B 4URTB 5CGYC 3ZO0A 3IXAB 2ZOKA 4JM4L 2YK1H 5DUBB 1A9EA 3S36H 5J8OA 4XPGL 5I73B 1NC4B 3U0PB 4Y5VA 2LQRA 5F7FA 2VLRA 3BAEH 4KUZH 4LGPB 5D1QD 3AAZB 4MD5B 3FT3B 4R4BB 4RAUA 3MROA 4U1LB 5IR1A 2OJZL 3GHBH 1A6ZB 3BXNB 1YY9C 5C9JB 5CILH 4NSKB 4CW1A 4OZIF 1D5MA 3C6SB 3EOTL 4WFED 2MQ0A 4DTGL 3CFKB 4LAQH 4OUUA 4M93C 1WICA 5EO1B 1X5YA 4KTDL 1AQDB 4LLUB 1JMZA 1ZHLA 3U1SL 1JYNA 3AM8A 4G6JH 3QAZB 4ODVL 3MYJB 2AS5M 2DD8H 3SQOL 1UB6A 2W9DL 4WHTB 4HK0B 3RUGF 4AEHL 5H94B 3WUWA 1Z3GH 1FCGA 1RUPH 3MFGB 4EBQL 4UQ3B 1INQA 2VZOA 3L5HA 1MRDH 4GRWH 5FA4A 2HKFH 1S7WB 1U6AL 4MHHI 4OCWH 5BXFB 5K59F 3IF1B 5D7JD 5AG9A 3QEHA 2ZP0T 4ZUSB 4ENED 3LEXA 3QUZD 4HJGB 4JHZA 3QIUB 4JM4H 5BV7C 4GG6A 5SX5K 1MWAL 1MHCB 1NSNL 4XPGH 4UTAL 4JFOB 3VFNB 1N7MH 1AO7A 3BW9B 5FCUL 1QO3B 4H25B 3OTTA 1IGIH 3PF2A 2BNRA 2LAAA 4FTVA 2R56L 2R0KL 3QIBD 4PY7A 3RL1A 3PWPD 3ARPA 4X4ZA 5TE6L 3I02A 4OZFB 2PR4L 3BGFC 4NKIL 5HHNB 1A1MB 4F15B 4PRAA 3EOTH 4G9DB 4ZUTB 3ULUL 4Q7DA 4GRLC 2BSRB 4NUGL 3BWUC 5DFVD 5GHWL 4DTGH 3TZVA 2NZIA 3HMWL 1QEWB 5E94A 1OAZL 4HX1B 4QT5A 4F37F 2HLFC 2NY3D 5IIEA 1AGFA 5DI8A 5CZXD 2VL5B 4QHLB 3GNML 2IWGA 5EU6D 3OGCA 2G60H 2BVOB 2DLIA 4BK4A 3UTZA 4UIKL 2R4SL 4KFZC 4X98B 3MNZA 5JHDA 5F88A 1QRNB 1AHWB 1U6AH 1I7ZB 3SDDA