3QUZC

Structure of the mouse cd1d-nu-alpha-galcer-inkt tcr complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
203
structure length
203
Chain Sequence
b'TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 45
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzC02
1NCNA 5DUPL 1YUHB 4LCCC 2BVYA 4FQXD 1DVFB 4PJGA 5E8EA 1YYLH 3TZVD 1MFEH 1XZ0B 5F9DC 4FQHB 3NCCB 4TSCH 5ADOH 4Y16B 2J5LC 5GS0H 4XTRC 4ALAL 5DR5H 3V0AC 2OTUA 4K23L 2K9UA 1X4YA 3CFEB 3F7VB 3S3SA 2D7PA 5KVEL 1IAMA 3KPMA 1MHEB 1R3LA 3LPGA 1B6UA 2VYRE 4JKLA 1SVCP 3OQ3B 3DV6A 3KXFD 3TV3L 5JXAH 1ZVSB 4JPIB 2ENSA 1MY7A 1NGPH 3F5WB 3U4AA 3VWJD 3LIZH 5KVDL 3VA6A 5HVWA 4F3FB 2ICWI 3QZWB 3AREC 5I16A 1YPZA 2R69H 1BOGB 1QHOA 1ZSDA 5J6HA 3RDTD 3LRSA 5DFWH 3VD3A 1S7RA 5I1HL 5D7LD 4KV5F 4LFHD 4RMRA 1R5WB 1OW0C 2D7NA 3MRPB 5E2UL 3OXSA 5E2VL 5BRZD 4JHZA 4RFOL 1J88A 3CCHB 3MLZH 2FL5A 3LVEA 4M1GL 4HAGA 4LRNH 1ZT1A 4OD3H 5E9DB 1J1XL 3WMSA 5HPOA 1KEML 1BEYL 4ONGH 1X6LA 1DZBA 2EKJA 5C0GA 1HI6B 3OKKB 2VQ1A 3SKOA 5FYKD 3BN9C 5EDXA 2AERT 2JB5H 2DLFH 3NBNA 1H15A 3IAGC 2DQGH 4I9WE 1LK3L 3GMLB 1FVCB 1AGFA 5HHQB 2DI9A 1KTRL 1NCCL 2X10A 3QHZL 2E9IA 1YEIL 3MODH 5D93B 3T77A 4EUPG 2AK4B 2UWEB 1A4JB 3RIFK 5ESAB 3EOBA 4IM8A 4M9PA 2IMMA 3GSNL 3EOAB 4OF0A 4N9GA 3QWRD 4L4VD 5A2JH 4LOUC 1QBBA 1RUPH 3SDAD 4LASH 4DWHA 1CDIA 1KTLA 1N5YH 1ZOXA 3EO9L 5J8OA 2CK0L 3D69A 3TA3A 1IZJA 3WFEL 1OGAE 3C6LA 3DX9B 3FT4A 3ZDXF 5HVFB 3JSSA 4OLWH 2H6PA 4NQVB 4JRYA 4Y5VC 3VXPA 2FIKB 5HYJE 2YN5A 3E8UL 5F96L 2HTKD 4BZ2L 5E4EC 1UXSA 2KQMA 5IHZA 1J0YA 1CGSL 3HRZB 3MRJA 4HXBH 4YLQT 3D39E 5MEQB 2VH5L 2CH8A 4LNRB 3GUTB 4HC1H 1HIMH 3HAEA 1FL3A 2DJSA 4PRHA 3FQUB 4TUOB 1MCPH 3EYOB 3MLUL 4Y16D 4Y88A 3FAXA 3BP6A 3S35X 1H3PL 1MCJA 3QO1B 4YZFE 2FX7H 4MB5A 4NN6B 2EICA 3H9YA 4YFLF 4TVPL 3MNWB 5IK3A 1DN0A 3G6AA 3RZWA 3S98A 2YPLA 4NSKA 4N68A 3WN5A 1X5JA 4ZFFB 4P2CG 1BQHG 1B0WA 3ARVA 4YR6B 4R2GC 1AR2A 1OSZA 4MD0A 2DYPA 2B1HH 2MNUA 4HWNA 2Q6WA 4FQQB 2R0ZL 4FABL 1IFHL 4I1NB 1AO7B 5LQBH 5IV2B 3X11B 1T7ZA 3HTLX 3GHBL 5BZWA 1W0VA 5IF0B 1RHHA 4J4PC 4UT9H 2MHAA 5DD0H 4APQA 1PKOA 4KQ3L 4ORZC 3FKUS 1A47A 4JHAL 5I8EB 3OXRB 32C2B 3IYLW 3SGDI 5E2WL 2ADGB 3L5WA 1RK1B 2AJSH 2ESVA 1XGUB 3OMZA 4HX1B 4U49A 4FOMA 4K71C 5EC1A 4G8GA 1NGZB 3JTTA 1KG0A 4JKMA 4LMQI 1C12A 1VFOA 3TO2B 5C0CE 5EU4B 1KLUA 1RZ8A 5IEHB 4ZAKA 3UYRL 4F8QA 4BUGA 4KI5E 1MVUA 3U7WL 4HCRL 2V9TA 1REIA 1X7QA 3D2UB 4RMUA 2GSIB 4WO4A 4Z78A 2DQHH 3EYVA 4UILL 2N4IA 2P24A 4JFZL 1EJOH 4H1LH 4HBQA 4XBGA 1JUFA 3BGAA 4TUKL 4S2SA 2A6JB 2R9HC 5HDQL 3TNNA 4WY7H 4IMLB 4HUWB 2JJWA 2J4WL 3DRQB 3NCJH 3RVVC 4MCZB 4G9DA 1P2CB 2JKXA 5KW9H 5B3JE 3TFKC 4YDIL 5E2TH 1EV2E 5IESL 1KENL 3DLQR 1I85C 2OJEA 1JK8B 2VLRE 4C59B 2WQ8A 4O5LL 4PB9H 1MCWW 3VH8B 2OR7A 1CICC 2ITDB 3DBXA 3IRPX 1T22A 1BAFH 3UAJC 5F1SA 1KPUA 3RWCB 1WT5A 5FYLL 1RIVL 1UKQA 3VDCA 4L8SB 1RURL 5MEPA 3QA3A 1VFUA 1JPSL 2OMBA 5C0DA 3RWJB 3UJJL 4OZIF 4J3UA 1F58H 1W72L 3QNYB 2JK5B 4ZYKB 1IM3A 2C7UB 2CRMA 3QHFH 3QO0B 1UJ3C 3RVTD 5DZLA 1UVQB 2X1PA 4MLSA 4FTVB 4JM4H 1JNHA 4XP1L 5GS1A 3BX7C 2F53B 5FOJA 5F88A 1H5BA 4X7CC 4XPAL 2LE9A 4JFXA 3RTQA 5CEZD 5L2JB 5DURB 5LGJA 3TBSB 1IAIH 2VLJE 5BVJB 1ZT7B 3DETD 3HE7C 4ODHH 5JW5A 5SWSE 3EYUL 3MCG1 4M3JA 1AO7D 5HHNB 4F57L 3GKZA 3VFSA 2A0LC 3GIZH 1IZKA 2ICWJ 5D9SA 1MJUL 5ANME 1PBYA 4QXTB 4QXUL 4JO1H 5FHAH 2W60B 2VQUA 1FC2D 4ZS7H 5BV7C 4PRPD 4K7PL 1AKJA 2ARWA 2W0FB 3WIFB 2OJZH 4GAFB 3GMRB 1MWAH 2FGWH 4MNHA 4X6FB 5CBAB 3VXRA 1TNNA 1M1SA 4RISH 5BVPL 1JGLH 3VGAC 5JR1L 3DROA 4WW2A 5FA4B 3O3EB 3C60C 3HLAB 3DNKA 4FN0A 4ZTOL 5I8KH 3ULVD 3WFDL 1FYTE 3MV7E 5IWLA 5EZOL 5EOCH 4JN2B 3MCKA 1NGWA 3SGEH 2G75A 4LHJB 2AJ3B 3QULB 4MHHI 3T2QA 5E7BA 2HLAB 2CQVA 1MAML 3IDIB 4QRPD 5FYJU 5C0BE 1URLA 4GKNA 1HYSC 2ICWA 1I3VA 2VKXA 1U3HC 2IC2A 2R1XA 2HT3D 1NCDH 5EH1A 1ZANL 5EU6E 5T3XH 2DM7A 4G6JL 4K07A 3SJVE 1NPUA 1JE6A 3ZE0F 4CGTA 1RUQL 3G04A 4M1CC 3BEWB 3KLAA 1YUHA 2W92A 1DVFA 1FVEA 2EYSB 2DLIA 2QKIB 2KZWA 3RWGA 1XZ0A 1EUTA 2CKNA 4FQHA 2DM2A 3MLXL 1P7QB 1OM3L 1GGCH 2QSQA 5FCUL 1CXIA 2XNAB 2X9YA 1A7RH 2QADD 4RIRB 4HEPG 5I1EH 3CFEA 3F7VA 3IFOB 4XB8A 2W0LA 2IWGA 4XB7A 4QOKB 1MHEA 4ZO6A 3SOBL 5IG7A 5F7KC 4PJXF 3S5LG 5TPWH 1J12A 1GHFH 4K3JH 4JPIA 2FDBP 1ZKAA 3Q3GB 4O9HL 4V2BA 1MRDL 3BQUC 4X6DF 5T1MB 1JFQH 1SBSH 2ZCKL 3CAFA 3MRBB 1EGJL 3VFNB 4EOWH 4F3FA 3P30H 4Y7MA 3QZWA 4KXZH 5SX4I 1BOGA 1AD9B 4N5EC 4N90D 4XAKE 3LN5B 4HLZH 4OIIL 2HRLA 3SDCC 5FEBA 3MRPA 1I9JL 3TBTA 3IFPB 4OM0H 4JHWH 3VXQA 1H3UA 5GZOD 3OF6D 1MFCH 2MSPA 5DURD 3MLWL 5LGHL 3IETB 1VEOA 2FH8A 2ZNXA 3MOBL 5E9DA 5EO0B 5CCKH 1MCFA 1MI5B 3H9SB 4WNQB 5SX5K 2B1AH 3MRQB 5CJQH 1HI6A 5DK3A 5FGRA 1D9KD 3TN0B 3MV8E 2DQJL 4S1DD 2Y6SD 1NLBH 3H42H 2ZCHL 3SDXB 4U2YA 5T3ZL 3OAYK 3R4DA 5K9OB 3GMLA 1FVCA 1U91B 5I75C 1VPOH 1JN6A 1Z9SA 3SHSA 5A43C 3JTSB 2AK4A 1A4JA 5MP6H 4UQ3B 1U41A 4OLZL 4G6AC 5FB8A 4WRLA 5IUSA 3BGMB 5JLZA 3C5ZC 2UZIL 2FEDC 4V1DD 1OAYH 5C0RL 1QBLH 2EDYA 5C2BH 2NW2B 2XRAL 3UTPE 4RCAA 4WUUE 5H37G 5ACZB 3TM6A 4FRWA 2HJLB 1KB9K 2A6DA 4OD1H 4FMKA 5MEQA 3GM0A 2VMFA 4LNRA 4W70A 2FJFA 3S7GA 4H26A 3NGBC 3FQUA 4OLEA 4TUOA 4XBEL 4PJHF 2NCMA 2Z0BA 3RUGF 5IFHL 3LEYH 4PJFB 2DB8A 3MZGB 1MRCL 3BZ4B 4XVUD 1CLOL 4GSDL 1A6VL 4MVBC 5C07B 2NY5C 5DF0A 4WFGE 1Y6KR 4AIZB 1G7LB 4NM4L 2DLTA 4EDXA 4LARL 3CC5B 3L1OH 3WV0A 3QNZB 3HUJA 5DO2D 1BMGA 1NQBA 2EDHA 4OZGA 3TYFB 3GHEH 5IV2A 4U1GC 5J9PA 3IKCA 4WI9A 3TH3T 5IF0A 5GHWH 1M7IB 2FX9H 4F15C 4J1UB 4MMZC 6FABL 3LQMA 4M8QA 3ZSTA 5BOZG 4OGAD 3TJHD 2PYFB 2O5XH 4L8DA 5I8EA 5SWZB 5HPMA 1MFAH 1UCBH 2ADGA 1I8LA 1RK1A 3JUZA 1XGUA 1KB5L 4HX1A 5FKPB 4L4TB 2Z31B 1INQB 4YJZL 5HD8C 1MI5D 4GQ9L 2BSSB 3MFFB 1MJ8H 1YECH 4NM8H 2BRRH 2ZNWA 1NGZA 2ZG3A 3CFBA 4NT6A 3TO2A 1KIUA 5FYKL 1IAKA 5IEHA 1KGCD 3HPJA 4OFKA 3BW9B 2YD5A 4WWID 4CJ0A 3PP4H 3D2UA 3MJ7B 4WU7A 4P9ML 4BQ8A 1QFUL 4XGZB 3TT1H 4G8IA 3RNQA 4AENB 2AJYH 1I3UA 4DEPC 3L3OB 2A6JA 4Y2DD 4IMLA 2P5WE 3DRQA 4ZUSA 2NX5E 4IOSD 1P2CA 4ENED 4Z9KB 1HH9B 1FNAA 3ZE2E 2A2QT 5J06A 1N5AA 3RWFB 4ZOEA 4KWUA 3IAPA 5DS8B 4I4WB 4PJCA 4OZHB 3BKCL 1OGTB 4TULH 4PJ9B 3NCYP 4J4PA 2Q76B 4PJEB 3VH8A 4OLVL 2ITDA 1J87A 2MWCA 2DQEH 4K3HA 1I9IH 2ZUTA 4TNVF 3RWCA 4I48A 4KI5C 5EZLA 5L8JB 4XNZB 5CGYC 4IJ3C 4L8SA 1UQSA 3OAZH 3NFNB 3RWJA 1RZJL 3WHE0 2PXYD 2AJUH 1S7XB 1IL1B 3ZHKA 3V0WL 2OZ4A 1LK2A 2IAMB 3QNYA 4YBQC 2H2PC 4OUUB 3VFOB 1U95B 3QIUC 4ZYKA 2C7UA 2LABA 3K1DA 1KSRA 1UVQA 4P23B 1AXTH 4FTVA 3UO1H 3L9RA 3FN0H 2ZG2A 4OCRL 5DDHB 5C07D 3Q5TA 4NGHL 1JMZA 2F53A 2W0PA 5DLML 3DXAE 2L0DA 4E9LA 5I71C 4P4KA 2P49B 2VDKH 2IG2L 3ZKXB 5LWYL 3LV3A 2VXQL 3QQNA 5HHNA 1J8HB 5IVXE 2EXWC 3WXVH 4WUKL 5D7JD 3SKJL 2YC1A 5C0ND 4QXTA 3UEZA 1N64H 2W60A 3RZCC 3LS5H 2W0FA 3WIFA 2J6EL 1ZK9A 3S97C 3ZYJA 3GMRA 4QTIL 5AYQA 4DVBA 1F02I 1OLZA 4DN3L 1F11B 3ZKND 4JQXC 3HLAA 4L4TD 3RVXC 4YHMH 1IEBB 1IQWH 2Z31D 3BRDA 1F4HA 3HC4H 5HGDB 3BEVA 4JN2A 4HXAL 3UZEA 2AJ3A 2EXYD 3K2UH 5DI8B 3EJZC 4DN4L 2HLAA 2PTUA 3PGDB 5GISH 2X1QA 3IDYB 4H20H 1HKFA 1YYMH 3GI9L 2DQIH 3B83A 3OGCA 3QG6B 3WO4B 5D70L 2AEIT 4OM1L 3FN3A 3IRZA 3WNLA 3IF1B 1C8PA 1Q0XH 1UWGL 4KU1A 2EYSA 5AYUH 1OSPL 4PS4L 3FRUB 4QLRA 1P7QA 1XF5B 5E8NA 4M6AA 3IDGB 1SYVB 4ONFH 4XWGL 5CZVH 3V4VL 1K4CB 2UY7A 2XNAA 1OQXA 3FOMB 2CLVA 4G9FE 4RIRA 1OD7A 3QUKB 2RB8A 1H8OA 3BH9B 4WCYH 4ZUVA 4OF3A 4X98A 3LOWA 4NIKB 3GBML 3FJTA 4QOKA 3TVMC 5CFHA 3TPKA 2CK2A 4GMTH 1RPQA 1H0DA 4X6BB 2GJ6E 4N0UB 5C0AA 1J0KA 1BJ8A 2GQHA 4OLXH 3Q3GA 1IGML 5I1JL 4UU9A 2EDDA 5T1MA 3MRBA 4OLUL 1NBVH 3QIWC 1YQVH 4BZYA 3OKEA 4D9QD 3U7YL 4XVJH 1AD9A 5INCA 2ADFH 4P23D 4D9RD 2BVTA 3SGKC 1NUNB 3IXAB 1A8JH 3I50H 1VFAA 1FDLH 2J88H 3IFPA 1QYGH 2AXFB 3Q48A 4HFUH 3K1KC 4RGNB 5BV7H 4RFEB 1U2CA 4PJAE 4PJ7B 5EO0A 3H9SA 4WNQA 1J8HD 5FXCH 4YXHL 2DBJA 4NQXB 3TN0A 5CP3H 3C8DA 4HQQH 5DUBB 4DFIA 1QR1B 1U8LA 5CGMA 2RJMA 3DPBA 3O4OC 1DBKH 3VD4A 1U91A 2ENYA 3GKWL 3ZTJG 1RVFH 2E27L 5DHVA 3HG1E 4DAGL 1GC1C 4LLQB 2XKSA 3JTSA 4YXLL 3JWNC 1OT1A 4UQ3A 1I3GH 3GGWB 4XH2A 3SDDB 4U6VL 5C9JB 4F7TA 2H2SD 1SM3L 5D1QC 4BSVB 1FPTL 1NC2D 4CRPA 3Q6GL 1RUMH 1EJ6A 2NYYD 1LO4H 4U1IB 5T1DL 3NH7H 5JQ6L 4GRWF 4XX1G 2HLFC 3BOVA 3WXWH 4NQCB 1JYWA 1ZGLB 3SCMB 2AEPL 2NW2A 5D1XB 4HWBL 1ZWIB 1AY1H 3L3GB 2VDRL 1BP3B 2R4RH 3D5OF 1DR9A 3VXOB 4NN5C 3OAYH 1A6AB 1ED3A 4P46C 3MYZA 2V7NB 1PKQB 3B6SB 5F3BB 2R2BB 4WTZG 1FE8H 1F97A 3D18B 4C54A 4L5FL 1QLEL 2A1WH 4P2RE 1MIML 2I5YL 1X5YA 1VACB 3G5ZA 3EYFB 3KG5A 5IEKB 4RAUB 4LVNB 4PJFA 1VEPA 1NMAH 2VQTA 4JFYB 2CGRH 2P7TA 2Z35B 1EK3A 4K94H 3ALPA 3BZ4A 2NXZB 3UTTA 1N3NB 4H8WC 3RBSA 3KWWA 5K9QG 3GI8H 4A6YA 4KZDH 3VRLF 1HHHB 1G7LA 2DM3A 4ODXB 3CC5A 3C2AL 4TSAH 3GO1L 1IKNA 4P2QD 2J3SA 3IVKA 3DI3B 5CBEA 2P5ED 3NTCH 4FMFA 1UA6H 3TYFA 2EEBA 5I6XB 1UM6H 1RJZB 2B0SL 1EFQA 4HMEA 5EORL 4DOHB 3BZEA 1MCLA 3VXUA 3MRFB 1LO0L 1MCNA 2ILLA 4XCYB 2B7DT 4OQTH 2PTVA 5T1LD 5SWZA 4JFFB 3V9FA 1I7TA 4RGND 2AI0L 1D5BB 5IW6A 4KTEL 3ARGB 1I1AB 3LZFH 3BPCB 2BSSA 3MFFA 5GGVY 4L9LC 5JMRA 1RZFH 4LDLB 4H1LB 3ARRA 4X83A 2Z8SA 4QEGA 3BW9A 3MO1A 2DLHA 4Z76B 4LCIL 5DK0B 1E4XH 1HNFA 4OLYL 2DD8L 4J3XA 3E2HC 1N6UA 3G5XA 3MOAH 5DC0A 1BOYA 3DYMA 3TO4A 4BA8A 3U9UB 4QRTB 4OI7A 2NY3B 3P0VL 2IF7A 4I3RL 4AENA 2BNRB 2QV2A 2A9NH 3OPZL 5TF1L 1EZVX 1FAIH 1OP9A 5TDPB 3BSZL 1T7WA 4XAWH 2DQCL 4OTXH 3W5MA 3CXHJ 4IIQA 4NQCD 3GMOB 4WTXA 3RWFA 5D6DC 5L9DL 2PN5A 3D39A 2DQTL 4OZHA 4XCCH 3S35L 2YPVL 4PJ9A 5DZNA 4NFBA 4ETYA 3QI9D 4PJEA 4OCLC 3NIFF 5E03A 3GNML 5ILTL 5CINH 3MLSL 2KUTA 1QKZL 1FZMA 1UEMA 1E4JA 2YD2A 1HZHL 4KRPC 4FFWC 3NFNA 5GGUA 3K8KA 4X80H 1S7XA 2NY5H 4OFDA 1IL1A 1INDH 2A77L 1EEZA 5C0FB 1G9NC 2IAMA 2WBJB 5HHVH 1AJ7L 4OUUA 3VFOA 1U95A 2I9LB 3P4MB 5EBWB 5I9QC 4WFFE 4H25A 5IW3A 1L7IL 5TE7H 3W0WD 5JPNB 3RU8L 4PY8I 2LU7A 5FK9B 4HAFA 1G7MB 1MFNA 2GK0B 4I2XE 1RFDL 3HNVL 3QIBC 1MWAB 3X3GH 3DO3A 3U82B 4YC2B 1EHXA 2KQNA 1UENA 3MMEB 1LO5B 1R24B 4Q9RH 1VCAA 2RFXB 3SE3A 1NMBL 1HILB 1QSFD 5AZEH 3PUCA 2DQFB 4GG6E 2YXMA 3PP3K 3L3DB 4XMKL 4PBVC 3U9PH 1N26A 3WD5H 4JFDB 2B2XL 1LP9E 2AQ1A 4F9PA 3OTTA 4K7PY 3NFSH 5CD5C 1LEKB 4NNYB 3RVUD 4XPTH 5I74B 1IEBA 4S1SL 4RFNB 3QXVA 5HGDA 2RHEA 1J1PH 1IAII 2ATPA 4WHYH 3HAEG 5DMKB 5DRXB 2F8VA 4XXCA 1BM3H 4LLWB 4NDMA 3WSQH 1OTSD 5I76A 3H3PH 3QUXC 5KJRH 3QEQD 3QIUA 2FLBT 3RWIB 1ZHLB 4OFPA 3NAAL 1QVOB 2UYLB 4E41E 4HZAA 4ZSOE 1T2QH 2EECA 3IF1A 4QRSA 1IQDA 1TQCC 2OK0L 1JNJA 5C6TH 4I5BB 3FRUA 2X44D 3N1QC 3RPKA 1CE6B 1KXVC 3UTQB 3MJGX 3FFCE 1XF5A 3O6LL 4HMDA 4DJMA 4ZQKB 3EO0B 3V2AR 1RAMA 1K3IA 1SY6A 3N06B 3QUKA 4P2YA 1H8SA 1AI1L 3RVWD 3ARQA 3QBTB 4JPWH 1XH3B 3AM8A 3GSVB 5MERB 1CFBA 4W6WB 4N0UA 1OY3B 2DBLH 4HJ0D 3U30B 3S9DB 1LVEA 3F12A 1GIGH 1IT9L 5INDB 1QP1A 4XPFL 4JJHA 3BIKA 5D71H 2NW3A 5GGQH 1TDQA 4NO0D 1X5GA 3TP4A 1CU4H 4S10A 2X2YA 4TNWK 4Y4HB 1X5IA 2WBJD 3HI1B 4GKZA 1EHLL 1NCWL 1PG7W 3MRLB 4JZJB 5IKCB 1FN4A 1G0YR 3LKNB 1TLKA 4LCWB 1KCUL 1OB1B 2F9BT 3LY6A 1CDBA 4F7EB 1S9XA 1U3YA 1YY9C 3BZFA 5DGQA 1QFWI 3F58H 5DD5H 5ANMA 2IFFH 4RFEA 4PJ7A 1QUNA 3ULUF 4UIMA 2VR9A 5JPMB 1R0AL 4NQXA 3ZTNL 5EZJB 5J6GB 2YD9A 1PAMA 3IU4H 5DUBA 5L0QC 2FATH 1VHPA 1HH6B 2G9HB 1OAQH 4H5SB 1JWSB 3MV7A 4KXZI 3QCVH 2MJWA 4JFDD 5AZ2L 5JUEL 4NQEE 4XC1H 2XICA 1A6PA 2H8PA 3RRQA 1MHCA 3TLRA 2CLZB 5T3XD 3EZ8A 3NZHL 3O9WB 3MCLL 3GGWA 3RGVD 3SDDA 3UBXB 4Y2OA 2IMNA 3EJJX 2J5LB 1IGTB 1FLTX 2ORBH 4BSVA 4EI5B 3SJVA 1I3RB 2XQYG 3HMWH 1BX2B 1DANT 4NWUL 4L3EB 5T1KA 2E5EA 3AFLA 1F4WH 1NSNL 1F8TL 3PWPB 1DUZB 1T66D 2XN9E 1ZGLA 3NA9L 4JFQA 3SCMA 3N85H 2IQ9L 1IBGH 1CZ8H 5D1XA 1DLFL 2D3VA 1FVDB 3SGKA 3L3GA 4JKPL 4KV5E 5B4MD 1J8KA 3VXOA 4OJFH 1CFTB 4JQVC 5DWUH 1A6AA 3MA9L 5L2KB 3KJ6H 4LPYA 2VDPL 4WEBL 1PKQA 1ES0A 2BC4B 4ZFZB 5F3BA 2R2BA 3LKOB 2QTEA 3HR6A 1VACA 5T33L 3EYFA 1TTUA 4EDWL 2Z35A 5CZKA 4MB3A 1FL5B 2J8UA 1L6ZA 1N3NA 4O4YL 5C0JA 3KPOB 3O6MH 5DYOB 5EO9B 1A3LL 4FNLL 1GJIA 4LDOB 3Q5YA 3FB5B 4Y4KC 4TPRH 4JVPA 5FGSA 3VG0H 4LHUB 5IW1B 4CVZB 4Z77A 4NP4L 1RJZA 1S7QB 4FFYH 5D1QA 3QFJE 2H9GA 4GBXB 1P4BL 3G5YB 4LCWD 3O6FC 1NFIB 1YN7B 3QQ9D 4XCYA 5DJ8A 4TOYH 4O2EB 3ZDXE 4DGYH 4PY8J 4JFFA 3VWKC 5ETUA 2CPCA 4M9OA 4LLVB 3BESR 2OI9C 3ARGA 1I1AA 3V6OA 5M7QA 3BPCA 3UTSE 2HWZL 5CWSB 4QHNA 1A7OL 3K7UA 1RHFA 4EIGB 4H1LA 4OAWB 1FH5L 2Q8AL 3BJ91 3LQAC 2BXZA 3BKYL 1QPPA 2AGJH 3EOTL 3C6SB 4LPVA 4O2FB 2R1YB 1XAUA 4NFDA 5GGSB 5IHBA 3U9UA 1CIDA 4QRTA 3WHXB 3HPLA 1T6VN 1LDPH 1D5IL 3I2CL 4POZD 3U0TA 2BNRA 4O02H 4LSUH 3MBXL 3GB7B 4XTRD 4IEFB 1JZ4A 2VDOH 4L3ED 4OUOA 1YYLL 4ODWB 4WHTB 1MFEL 1NBQA 3GMOA 3SQOH 2DTMH 3QZWG 5TE6H 4K9EC 1AIFB 4TSCL 5ADOL 3HUJF 3NCBB 3MQIA 5GS0L 3ARXA 4ZO9A 5DR5L 5JHDD 5HHPB 5LBSH 5IB5A 1TFHA 5I1GH 1MHPH 3ARED 4YDJA 4YFDB 1ADQH 1FNEA 1MCEA 4RZCB 3BN3B 2FWOB 1KUMA 4HK0B 5JXAL 3HZVB 1D5MB 4OZFH 5EOCJ 1U8QB 1TJHH 1NGPL 1QR4A 4JG0H 4L9LA 4YHIB 4RDQF 3M1BA 4G43B 2I9LA 5EBWA 3LIZL 5I1LB 4DTGH 5JPNA 4OFIA 4PTTB 5HY9B 5FK9A 2R69L 4MNGE 2GK0A 3GJEB 2HT4C 5DC4B 2W9EH 3OB0K 1O5DT 3TT3H 1QEWB 5I1KH 3BN9D 4LHUD 1G7IA 4JKWA 3DSNA 3MLZL 3MMEA 2E7HA 2YPKA 2RFXA 4LRNL 4OD3L 3JWDC 1CVSC 3VXMB 4ONGL 2DQFA 2XWTA 2DICA 3K0WA 2D7OA 1IGYA 2WIIA 5DFVD 3L3DA 3PDDA 5EPMB 4POYA 4GUPB 2JB5L 2DLFL 2DQGL 4NRZB 4Y19D 4LOUD 4LCUB 2OSLB 4DKFH 4X7EC 3AC0A 1MLCB 1MFBH 4PJCF 3MODL 5IVZA 5KZCB 4M7LT 5DMKA 4OZIE 5DRXA 2QQLH 4EI6A 4R0LC 4M7JH 1S9VB 4RGMC 5LCVH 4UOW1 1RUPL 1NEUA 4LASL 2VDMH 1ZHLA 1B4JH 4AM0B 1CDUA 1N5YL 1QVOA 5H2BB 2P5WA 1G0DA 2UYLA 4HKZA 4CJ1A 3HB3C 1R3JB 3KPSE 3QDMB 3VG9B 3CXDH 3MROA 3V4UH 4OLWL 4I5BA 5CIPA 1UACH 4NO3B 4HG4J 1CE6A 2CSPA 4HXBL 1AR1C 2E6PA 4UIKH 1BZ9B 5BZDB 3BGFC 4HGKC 1G6RH 4HC1L 4N9OB 1HIML 1QSEE 1FSKC 2JE8A 1MCPL 2PW2B 4R2GD 4LLYB 3FQXB 2FX7L 2Y07H 1KLGB 1XH3A 2V6HA 1KJ2H 3MRKB 2D7QA 4RDQG 3WFCH 4G8EB 1V7NH 1DQJA 1NMCC 4R97C 5INDA 1KXTB 1XGQA 3CK0H 1R3IH 15C8H 4X4MA 1KIQB 5BV7B 4Y4HA 3HI1A 2B1HL 1UWXK 3MRLA 4JCLA 1J5OH 5IKCA 1FFOB 1LO2H 1GGIH 3LKNA 4LCWA 4NN7B 4MA3B 5LQBL 3OZ9H 4ELMB 1OP3H 4YEFA 2OM5A 4UT9L 3ZE0E 5DD0L 3FQNB 1JVKA 4LRIA 4W6YB 5IGXH 3OKYA 2JLLA 2W9LA 3IT8D 1ZHBB 3JVGA 3CDCA 1LE5B 1M05B 2AJSL 2WV3A 5GRVL 1EHNA 1I1YB 3QDGD 5EZJA 2G5RA 5C1MB 1IKFH 2VZSA 2JCCB 3MJ8B 1HH6A 4HKBB 3NIGF 3I3DA 4JVWA 5GSRB 2R56H 4H5SA 4IMKC 5DJXA 4LQ1A 1JWSA 1T0NB 1M71B 3KPQA 1EHAA 1S9YB 1SJXA 4PRDA 4BFIB 2R9HD 2CLZA 3JV6B 4PJXE 3VH8G 4PRAB 3O9WA 3RVVD 1IC4H 2X89A 3WFZA 2DQHL 3TFKD 4QY8A 1EJOL 4EI5A 5KZCD 1I3RA 2BVQA 2CR6A 3AXLB 5E56A 4OCMC 2JF1A 5ISZE 1ND0B 4PR5A 5IM7B 5J1AA 3EHBC 4WY7L 3DARA 1CICD 3EJYC 3PWPA 4MHHG 1DUZA 1WZLA 3O8XB 4HSQA 5CGTA 1YEKH 3QHTC 3UAJD 3NCJL 3U1SH 3STBA 3B8SA 5KW9L 2BJMH 5JOPD 5E2TL 2GY5A 3DUSA 2IBGA 1CFTA 5FDYA 2Q86B 1HHIB 1LEGA 5L2KA 3W5NA 1BHGA 1FCCA 4PB9L 2BC4A 2V5TA 4Y4FB 3LKOA 1BAFL 4GAYA 4OCSH 5F71A 3TBWA 3VCLB 5FM5O 3WJLC 2ARJB 1S5HB 4WI6A 1MJJA 5I15H 1ACYH 1F58L 1FL5A 3NMEA 25C8H 2HG5B 1AP2A 5EO9A 1CL7H 3RI5K 3QHFL 3FB5A 4JM4L 2Y5TB 4QGTA 3QWOA 2Q7YB 1QBMH 3VFMB 4JDZB 1PG7X 5C0IA 1A7BA 2LTQC 1YMMB 2NLJA 3U0WH 4GBXA 4Y5YA 1WISA 4ODHL 4F8TA 2P42B 4PJAA 4EBQH 1EO8H 4JFED 1YN7A 3GIZL 3C60D 4RQQB 2D7MA 4LVEA 5T5FH 4O2EA 5FHAL 4JO1L 4U7MA 1F6AA 4ZS7L 5HGAB 1T20B 4LIQE 2A83B 2OJZL 2ERJC 1MWAL 1V7MH 2FGWL 2Y36H 4LVHC 4RISL 2ICES 4LSPH 3GMMB 1JGLL 1N0XH 4FQLH 2R15A 5K9JH 3IJHB 1HYSD 2NY6B 1U3HD 1E28B 2P46B 5E00B 3RQ3A 4CDGC 1FAKT 3NCYS 5I8KL 4MD5B 4G7YH 5J13C 5BXFA 5EOCL 4PJHE 4W4NA 3RUGE 3BUTA 3GJFH 4ZO7A 5ECJE 1CQYA 4M1CD 4O2FA 3OX8A 2GW5A 2R1YA 4C55A 3BI9X 4Q6IA 3C9NB 5GGSA 7CGTA 1NCDL 1CXEA 1PEWA 3WHXA 2M26A 1WCQA 5T3XL 1CCZA 4PJFF 1BBJB 3L6FB 3S3PA 3GB7A 4Z6AT 5F7MC 3P73B 4MZ2A 4MJIB 3ORJA 4B5EA 1K85A 4ODWA 4HT1H 4P49A 4WHTA 3D3VE 3PWVB 4NUJB 3I6GB 3FQRB 5D8JH 1GGCL 4HZLA 3MRNB 3BH8B 4P2RA 1A7RL 5HYQA 5I1EL 2GJZA 2E7LC 1B0GA 3BQUD 4MA1B 2DL2A 4KROC 3SKNB 1JF5A 3DVNB 3W9EB 5EN2B 3GIVB 4LQFH 2ZUUA 3PABB 4Y4FD 5CAYB 5DVOA 4U6XB 2MTPA 5TPWL 1CK0H 5KVGH 5KSBB 2FWOA 4F15B 1GHFL 4HK0A 4N5ED 4K3JL 1D5MA 1U8QA 3MV01 1KTDA 4YHIA 4G43A 4KDTA 4OI8A 3SDCD 4ORGA 3BDBA 2AKRB 3L95A 1JFQL 1SBSL 1RJYB 3AUVA 4EOWL 4WFED 3P30L 3BKMH 4W4OC 4I3SH 3M17B 3CUPB 4N0FB 4PG2A 4RX4A 2BFVH 2R1WB 4XNMB 3GJEA 4HWZB 3FFDA 3VW3H 2CUIA 2ZG1A 3OR6A 2DQUH 4AEIH 4OM0L 4X4XB 5E8PA 2CUMA 3OB8A 4JHWL 1MFCL 2XXMB 4AYFA 5BS0B 1S7WB 3H3KA 1ZEAH 5C70A 1YMMD 2VR4A 4NKOB 3VXMA 5J11B 5CCKL 3MV9B 3M45A 5F8RC 1ZLVK 1ZHKB 5JTWA 2B1AL 1BVZA 5CJQL 1EFXB 4B41A 4MNQB 1UG9A 4OKDA 3TPUA 5EPMA 4M61B 1PEZA 5D4QA 1NLBL 3H42L 4GUPA 2CIIA 4KKLC 5F9WB 4RMTA 3WL9A 1MCIA 1QRKA 4G6AD 43C9A 3TBVB 3CLEH 5CJBA 4LCUA 3M07A 4HD9A 1VPOL 3UROR 1TJIH 1MLCA 2NY6D 2HA1A 3ESVF 4OZHF 1JZ3A 1RZ7H 4D9LH 5MP6L 4JO2H 3DVGB 4PJEF 1NAKH 3EBAA 1P5UA 4J3OC 5FDWA 3U2SB 1DFBH 3C87A 4I9WD 3P9WB 4AM0A 2VUOA 1Y18B 1OAYL 4D0BB 1R3HA 2YUZA 1QBLL 1R3JA 3QDMA 4CVUA 2KDGA 2X09A 3ME0A 5SV3A 5GRJH 4RRPA 5C2BL 1A0QH 4YWGH 2WZPD 2B4CC 5A2FA 8CGTA 1XEDA 2BCKB 2V5MA 3NFPB 4DZBB 4N1EA 4JY6A 4NO3A 4MJID 2CR3A 3AAZA 3WEXA 4OD1L 3IDXH 3O4LB 1BZ9A 3PDOB 4M62H 5BZDA 5TF0A 4MVBD 5F1OB 1YJDC 3WFHB 3VFGH 5C09E 4X6EA 5IIEB 5TQ2H 4LLYA 1J0HA 3FQXA 1OGAD 2EE9A 4RNRB 3LEYL 2WWMC 4MAYB 2HJFB 3MRKA 5LAXA 3TIEB 5HYJD 1AE6H 3BP4A 4G6KH 5DJ6B 2EDTA 4G8EA 1WZMA 3P4NB 5K59F 3BPNB 5BOPA 3WUWA 5K9KB 3L1OL 4TVPE 3DI2B 3EKCA 3IJYA 4I2XA 1X4XA 4TN9A 1NUFA 4XNYH 1G9MC 1IGFH 4DKEH 4ETQB 1F00I 1TVHB 3C5SB 3GHEL 1ITBB 2IEPA 4HS3B 4ELMA 1Z5LA 1NC4D 3PL6C 1VGKB 5HD8D 5GHWL 2FX9L 2BNUB 4XX1E 2VLKE 2ED8A 2O5XL 2KKQA 4P5TC 4LKXA 1MFAL 1UCBL 1LE5A 1M05A 5BS0D 2EIZB 3TESA 1I1YA 2DWDB 3BWAB 4JFHE 3MJ8A 4WJ5B 3MV9D 4PGDB 1JF6A 1MJ8L 1YECL 4NM8L 3HKFA 2BRRL 5GSRA 1EFXD 4ODUB 3MLPA 1OTTC 2X4NB 1T0NA 1M71A 5LXGH 1UWXH 4BFIA 4XP9H 1QSZA 3JV6A 4DGVH 3PP4L 4NHCH 4PRAA 4NRXA 2DAVA 4Q0XH 5A2IH 3QDJE 4OB5H 1DLHB 3TT1L 1T80A 1HOCB 1EH9A 4YPJA 3AXLA 2AJYL 4QRRE 4C56E 2X4OB 5C0CD 3SE4C 3O8XA 4KJPD 5CGYD 1T89A 4EN3A 5JORA 2DJ4A 4HUVA 4PLOB 4YDLC 4JREC 1A6UH 4I0PA 2JIXB 2Q86A 4TULL 1HHIA 5D1ZC 4TUJB 1Y0LB 3QIWB 3AS1A 4UB0H 1BWWA 2H2PD 4YBQD 3BHBB 2NY7H 2DQEL 1CIUA 1I9IL 3ARBB 1Z0NA 3O4LD 3VMNA 3VCLA 3PJSB 1RULH 4Z7UB 2ARJA 1S5HA 5TJWK 1BFVL 2ED9A 2HVJB 2AJUL 4U1NB 1G9EA 3O3UN 5JQHC 35C8H 4PJ7F 5FYLE 2VLRD 1ULVA 2R0KH 4KKBC 5JO5B 3KPRE 1AXTL 1L0XA 1V3MA 2Y5TA 3UO1L 2EXWD 3FN0L 4GRLC 5KSAC 2DN7A 4X8XA 5EO1B 5J57B 1T0PB 3RZCD 4CNIB 3SGJA 3VFMA 3GEWB 4JDZA 2Q1EA 3UYPA 1WZKA 5C8JB 12E8H 1RK0A 1OF2B 1T1YA 2VDKL 1H9VA 3A67H 4GRWE 3IU3B 4EQ3A 1N6VA 3WXVL 2PNDA 4RQQA 3RVXD 4M5ZH 3AU1B 3QUYC 1N64L 4W68A 5CEYA 3UP1A 2XWBB 4PRNA 3LS5L 5HYSB 5HGAA 1T20A 4P59H 4HK3N 3QNXB 3EJZD 5IFAH 3L3HB 3QXUA 4JRWA 2VOTA 1AGBB 3GMMA 4YHYB 2VC2H 2VLJD 2E7BA 3IJHA 4ZOAA 1E6JH 1E28A 4PJ8C 3MUGB 5E95B 5SWSD 4YHML 1TQBC 1IQWL 4MD5A 3HC4L 1GOFA 3QAZB 3K2UL 1JJUA 1CI5A 2C4FU 3T0BA 4RSVA 5D96B 2ZUQC 5GISL 3C9NA 2FJHB 4EVNA 2A73B 4H20L 3CFCH 1YYML 2DQIL 1NDMB 1SMAA 3VRLE 2F54E 2VDQH 3VRIA 1BBJA 3L6FA 1QG3A 3T09A 1FYTD 2D9QB 4CUCA 2J8UF 3TH4T 2V7HB 1QA9B 1Q0XL 2DIAA 1JPGB 5AYUL 4BSWB 3T4YB 3EOYG 3TVMD 3TBYB 1I1FA 4LPUA 5C0BD 4U1JB 3ARDA 3FQRA 3FCTB 4ONFL 4OZFB 5CZVL 3QT2A 5EU6D 1KT2B 2VXVH 3BH8A 2ITCB 1OPGH 3ES6B 2JIXD 4WCYL 1G7HA 2BX5A 3SKNA 3W9EA 4NOFA 3VU2A 2UV3A 1XGPB 3GIVA 4HIEB 3QIWD 5EN2A 3LDBB 1HEZA 4QKXB 4U6XA 4GMTL 1CGUA 4OLXL 5EZIH 4R4NC 1MQ8A 4JRYE 3SKMB 1CF8H 4WHDA 4KK8C 3ZDZF 1EAPB 1F42A 3MYJB 3W2DH 1NBVL 1HINH 1YQVL 2CKBH 4XVJL 3M17A 3CUPA 4N0FA 5DA0B 1HSBA 1N8ZB 2ADFL 4XNMA 4HWZA 4Y1AB 3S6CA 1ZGLM 1QFOA 4PRHE 2AQ3A 3GMPB 3I50L 1E4WH 5KANG 1K4DB 4X6CB 1FDLL 3THMH 2J88L 2PYEE 4X4XA 3CH1B 1QYGL 4HFUL 3S4SB 5BV7L 3V5DB 1S7WA 2E8ZA 3T0EB 2YPLE 3QJHB 4F9LA 4QTHA 3TCLB 1ZHKA 4X7SH 3PXHA 3AS3A 4MNQA 3V7AG 4AZ8A 4HQQL 4JLRA 4M61A 5B8CC 4XAKD 3REWB 5IR1B 1WBYB 5I30H 1DBKL 1NL0H 3TBVA 3HE6B 3NIFE 4YK4B 2AV7A 4XHJC 4PGCB 1RVFL 4XPHH 3OL2A 5H94B 1CDJA 2BK8A 5KS9A 3RWEB 5FO8B 2C1PA 2HLFD 3TCXA 4PJ5B 4Z7OF 3DVGA 4P9HH 3TIDB 2HKFH 5FIEA 2DOCA 3VGGA 1CFNB 3MV8D 1I3GL 1X5XA 3RY5A 5KSUB 3U2SA 2I07B 1RUML 3QUMA 1JF1B 1LO4L 2ESVE 2IH1B 2D9CA 3UPRA 1KBGH 2EDWA 3NH7L 4P46D 4D0BA 1G6RB 3MNZB 1Q38A 3WXWL 3ZHLA 1BLNB 4ZS6C 2BCKA 4GQPH 2QLVB 3NFPA 4DZBA 1AY1L 1T21B 2R4RL 1KJ2B 5I9QB 1ZLUK 4YGAB 4R6UA 2G5BA 4ZPVB 3DURB 1OVZA 1ZAGA 1JV5B 3IB4A 4OV5A 1FE8L 4G7VH 3WFHA 2A1WL 3LEXB 4GOSA 4KK9C 3SN6N 1QHPA 2VABB 2FYYB 2O93L 3UTZB 1KCLA 1NMAL 3ZZ1A 2CGRL 4MAYA 3G9AB 1KELH 1X5HA 2HJFA 4WUUD 3B9KC 4K94L 1ZMYA 3TIEA 5A16A 1OOAA 5DJ6A 1KC5H 1ONQA 4N0CC 3LD8C 3GI8L 4IDJH 4KZDL 5K9KA 1FO0A 3GSQB 1IGCH 2C3VB 4TSAL 3GBLA 5DRNB 2FBOJ 3NTCL 4H1LG 1CGXA 3MZTA 3D0LB 3V5HB 1LE9B 1UA6L 1TVHA 3C5SA 4JB9H 2NXYB 1UM6L 4OQ1A 4GS7B 1VGKA 4XCEA 3LCYA 2WINA 1QFHA 4WFGD 4KK6C 1JGDA 4G5ZH 1FV1B 4OQTL 4UAOB 2BSED 5I1JH 2WP3O 2FCBA 4BKLB 4IRJC 3U4BH 2EIZA 1JZ6A 1EUUA 2UZXB 3LZFL 2DWDA 3BWAA 2CRZA 3QUXB 1GZQB 4NUGH 4WJ5A 1TXKA 4TNVK 4PGDA 3NCMA 4ODUA 5GGTH 1D5XB 5BRZE 1RZFL 4Q7DA 3ZE2F 4U7SA 2FO4B 3G6JB 1PLGH 4XVTH 1IAIM 4U1KA 3LKQB 1QFPA 2MCG1 5I73C 4W81A 1PSKH 3Q5OA 5CEZH 1E4XL 3GMNA 3S5LA 4ZUTB 3MOAL 4M02A 4U6TA 1J0ZA 2XTJB 4WV1C 5FYKE 1HOCA 4PJ5D 4PLKC 4QHLA 2K3TA 4HH9B 2O61A 2BNQB 2A9NL 1RD6A 3KPSA 2B4CH 2X4OA 1WIPA 4WI8A 4EXKA 1IE5A 1FAIL 1G7PB 3DRTA 4R7DB 3RY6A 1FG9C 3KPPB 1D5ZB 4DQOH 2WWKT 1OT2A 2BVPB 4JAMB 4XAWL 1XIWB 4KRPD 1N2RB 2OTPA 4OTXL 1HYRC 3FT3B 4FFWD 1TTGA 1KJMB 4G42B 3WS6C 2HFFA 5E6IC 1DBJH 1RJLB 1YJDH 4XCCL 2PF6A 3N1MC 4TUJA 5EU7E 1Y0LA 3ULVH 1FYHB 3L3JB 5BJTB 3BHBA 4UT6H 5CINL 3ARBA 1YA5A 4UNTA 2QHRH 5C08B 3PJSA 4XBPB 4Z7UA 2NX5D 2XZCH 4PRBB 1E4KC 4X80L 2HVJA 2X1OA 2NY5L 1AGCB 1INDL 1AFVH 3UDWC 3SPVB 3GSUA 5KOVC 3H6JA 4MJ4A 5HHVL 4PY7B 3QIBD 3QG7H 5JO5A 1S78C 5TE7L 3OJDB 2BSRB 2PO6C 2GJ6B 4PJDB 5HHXH 2YR3A 3VXSB 5EO1A 3LPFA 5GXBB 5IB1B 4M7ZB 1QFWM 2NTFA 3L7EB 5C8JA 3X3GL 4DFHA 5JW4R 3BXNB 4X9GA 1NDGA 1FL6B 4MX7A 3ARFC 2RAMA 5CD5D 1T2XA 4U3HA 4Q9RL 4YHPB 3AU1A 3SE4A 5AZEL 3SO3B 4UDTA 2XWBA 5A2LH 3T3PF 3GJFB 3GDBA 3QNXA 3U9PL 3L3HA 3WD5L 2CRIA 3DXAD 5MHSD 1MH5B 1AGEB 3NFSL 3RL1A 1T5XB 3MUGA 4IRSC 4XPTL 3QUXD 1BIIB 5IJKA 1VERA 3OKDB 4RWYH 4MD4B 3OKNB 3U46B 3CX2A 4XNXH 1J1PL 1U6AH 1A64A 1BM3L 2D7TH 3FO9A 2FJHA 2XFXB 3OHXA 4MB4A 5E9DE 3WSQL 3ARWA 3HI6H 4YPGB 3UPCA 3H3PL 5DHXB 5KJRL 4PP1C 2NY0B 5TE4H 4YHNA 1A4KB 5CLWA 2XTJD 4U1HB 4RMSA 3K4AA 1T2QL 2AJXH 4HLZG 1MNUH 3VA2C 1IAOB 4JE4B 4K3DH 5IMOA 5C6TL 4BSWA 1RSFA 3TBYA 3FL7A 5BMFH 4U1JA 1DDHA 3T3MF 4KKCC 1ADQA 1K6QH 3FCTA 1T6WA 2HFEB 2AK4E 2UWEE 1KT2A 5I1CH 1CD9B 1TZGH 1Y6NR 5IBTH 2F5AH 2ITCA 3ES6A 3BPOC 4RMQA 4HIEA 1XGPA 2XKNA 4DCQB 4JPWL 2X4SB 2X4UA 3EIFA 2BOBB 3SE9H 2VL5B 4NKDA 5HYIA 1T3FA 2DBLL 3O6FB 4BM7A 2HJKA 1YY9D 3DX7A 1GIGL 4X5WB 5D71L 4Z95H 3WNNA 5GGQL 1EAPA 4Z0BH 4G9FD 3VWKB 1CU4L 1A2YA 3RNKB 4JR9H 3BDXA 2OP4H 3GNMH 2NY1B 5FF6B 4Y1AA 1PZ5B 3J7HA 4OT1H 2VTFA 3MFGB 1KULA 4JGMA 1K4DA 2C3XA 2D03H 3VFPB 2GJ6D 3ECBB 1A9BA 3PE9A 3F58L 3O11B 5DD5L 2EH8H 3S4SA 3V5DA 3CFDB 3UBXG 4GG8A 2IFFL 1OWRM 3T0EA 3OJVC 4ZFOB 1AQDB 1R5IB 4Z5RB 2X4RB 3QJHA 4JM2B 1R3KB 5BQ7B 1QRNB 3DYPA 3TA3C 1ZTXH 3IU4L 2FATL 3C6LC 1L4IA 2D31B 3HR5B 1G7QB 3ZO0A 4ZFGH 2AAVA 5EU3B 5IR1A 3HUJE 1WBYA 2WW8A 1C5DB 1OAKH 1OAQL 1Q9WA 3HE6A 4FQIL 3QCVL 1AO7E 5H94A 3RUGA 3C5JB 4XC1L 3G5VA 4P48A 1MFDH 1QLFB 4IRZH 5FO8A 1B0RB 2WBWB 4OCXH 3TIDA 1HHKB 1CFNA 3F62A 5F9OH 1E0OB 2RGSA 4JZNA 2ORBL 4FXKB 4Y8AA 2I07A 5AAWA 4FQ2H 3HMWL 3CPLA 3CFIC 1EZVY 1JF1A 4BQBA 1F4WL 1VESA 5F21B 3WN5C 5CJXA 3PV7A 3QJFB 4OGYH 1BLNA 3HG1D 3N85L 1IBGL 1CZ8L 3D3VA 4PRIB 5D2NB 3CLFH 3KYMA 1T21A 4KPHH 4LNVA 1T1ZB 4OJFL 3RL2B 3F7YA 5DJCB 4ZPVA 3AS2A 3KJ6L 4LHUG 1JV5A 3MSPA 1ZV5A 1V3JA 4U05A 3S34H 2O5ZH 3LEXA 1YDPB 4NQDB 4HBCH 2FYYA 4Y4KD 1ROWA 3UTZA 4APQC 3BAEH 3MBEB 3GK8H 1IM9B 1GSMA 5B8CA 2UVEA 1UFUA 1T7VA 3X17A 3O6ML 3VDAA 4UOJA 1CWVA 1A9EB 2YRPA 4OFYD 1GGUA 1BWMA 2ZSVB 3O6FD 3GSQA 1A1NB 4TPRL 4WI4A 3ZKQD 4PJCE 1QSVA 4ZDHB 3CVHH 1MVFA 3V95A 5EUOB 3VG0L 3D0LA 3V5HA 1LE9A 2DIJA 5ID1B 3VWKD 4YBLC 2PETA 4ZAKC 3FAWA 4AQOA 1TJGH 3FZUC 4FFYL 4AIXA 3MPCA 4G80B 4WO4C 1FV1A 3PWNB 4TOYL 4DGYL 2FZ3B 2OTWA 5EC2A 3VFRB 4R0LB 4XP6H 2EDJA 1GZQA 1XGTB 4FTVE 1P4LA 1S7UB 4QHMB 1GAFL 2B39A 5MENB 2F53E 1QRND 1D5XA 4X8JB 5HHOB 4MJ6B 2FO4A 3DGGB 3G6JA 3WLBA 1BVLB 2VITB 4MSWB 4ZXBA 3RHWF 4HF5H 3LKQA 1LNUA 2AGJL 2CIKA 4X4YB 5EG6C 2BHYA 3AB0C 4ZUTA 1AHWB 1WT5C 3JWOH 4N8PA 1C5CH 1XR8B 4JKKA 2VXUH 3BGFB 4HH9A 1NANH 3V6ZB 2MQCA 5JW4Q 1FSKB 1DN2A 1LDPL 1U8HA 3WE6A 4O02L 2BNQA 4LSUL 2CMRH 4HIHB 5IQ7H 4R7DA 1K5NB 1AXIB 2VDOL 2P8LA 1D5ZA 1TZHB 4GT7A 4TTDC 3FOLB 3RDTC 3RBGA 1KACB 1XIWA 5GS1C 4CBPA 3SQOL 4EZMA 3MUJA 2DTML 3UC0H 5TE6L 1RJLA 1XMWA 1H5BC 4PRID 3LMJH 5JIKA 3RTQC 4JJ5B 3L3JA 5BJTA 5GGSY 2ZPKH 3HNTH 4GW4B 5LBSL 4PLJC 5I1GL 4MDIB 2WNGA 3QR2A 5C08A 2YN3A 5ALBH 4ELMF 4FQXB 4XBPA 1MHPL 4BQ6A 3TZVB 4OGZA 3I6KA 1ADQL 3WDJA 3NIGE 1FFPB 2GFBB 2HT4D 1U8NB 3SPVA 5IBUB 2O5YH 2B5IB 1TJHL 4JG0L 4PY7A 1IM9D 4UUJB 2JCCF 4DTGL 1NAMH 2BSRA 4DKAA 4PJDA 2GT9B 3VXSA 5IB1A 5IWLC 2Y9RT 3CDGB 1BD2B 2XQYK 2W9EL 3P9MB 4JFOB 4UBDC 4ZUUB 5J0BA 5EU7C 3CGTA 2NY4B 3TT3L 4MQ7B 5TQ0H 4QOKE 4CVXB 1KIPB 5I1KL 1FL6A 4HV8B 2VLKA 5DK2B 3BUYB 3ULUC 1FBIH 5C0AE 4D3CL 1P7KB 1MCHA 2W59A 4FQJH 3DTXB 5F1NA 3CSGA 5D7LB 3NABH 2UUDK 4RRPG 1DVFC 3N0PB 3DHMA 2OL3H 3HZKB 1T5XA 5GRUH 1RZJC 5F1IB 4DKFL 3OKDA 4ODTH 4B7IA 3QPXH 1X44A 5CS7A 4MD4A 3OKNA 3U46A 2JB6A 2FEEL 3ZKMC 1MFBL 2AW2A 5HHOD 3LRGA 3QDJA 2R2EB 4NZRH 4X0KB 5FKAA 2QQLL 4Q9QH 4M7JL 5LCVL 3HNSH 3H9SE 1LHZA 2LQRA 4QRRA 4HCRA 5JZ7C 3QUZA 5FO9A 1HDMA 2VDML 1B4JL 1EVUA 4GW5B 4EJ1C 4TTGA 2HWZH 1IC1A 4U1HA 3SBWA 5ESVB 4NO2B 5JXEA 2LVCA 3IFLH 4WW1B 5C0EB 1KGCE 3CXDL 5TFSH 5KG9B 3V4UL 5GGVH 4KKNA 5HI3C 1D6VH 1ZLWH 3EFFB 2WLYA 3TC9A 1UACL 4HWUA 4WWKA 4L4VB 1KLFA 3ESUF 3SDAB 5DD1H 4Z7NF 4UIKL 4M4PA 3MLVH 3RIAF 1G6RL 4OV6F 2Y4SA 4IS6B 4GLRH 5MI0B 3O81A 4E41D 2YRZA 2Z4QA 2CKBB 3W39B 5IB4A 5J12B 2X4SA 4RBPH 4FP8H 4J23A 2Y07L 5CP7A 2BOBA 1FNGB 3CU7A 4F7PA 1KJ2L 2P4AB 4XXDB 4L4JA 3NOIA 4LHQB 1MCQA 4ZPTA 3WFCL 2APVA 1V7NL 3RJQB 1I8KB 3FFCD 3KPRA 1NFDB 4X5WA 4IRSA 3CK0L 1R3IL 15C8L 4DGIH 1WWBX 4NYLB 2CLRA 2V9QA 2XTLA 1DEEA 1W72A 5IB3B 4HUUA 3RNKA 1J5OL 4GFTB 5IHUH 1LO2L 5FF6A 1GGIL 4LVHB 3P40A 3G6DH 2YEZB 4MWFB 3S36H 4MXWH 3OZ9L 5BW7C 2FR4A 3ECBA 1F90H 1B6DA 1BD2D 4PJFE 4KMTH 3O11A 1TCRA 3RJDA 5FYKU 4KJQC 1H3WM 2EYTB 3EYSH 3NPSB 2NR6C 4GH7B 5IGXL 3UTTE 2NY4D 4ZFOA 1R5IA 4M3KB 4XMPH 4Z5RA 2X4RA 5E94B 3E1F1 4JM2A 1R3KA 2ADIB 4HHAA 1IKFL 5HGHA 3HR5A 2D31A 4PLNC 5EU3A 3BKJH 1ODAA 2X1XR 2R56L 3EYQD 3OV6A 5I1AB 3DMMB 1CXFA 3C5JA 4XP5H 3D85B 3AY4A 2IPTH 4I18A 1Z2KA 4WI3A 4X7FC 3EHBD 4KMLB 3UTSB 3EJYD 4O51B 3VXUE 2YD3A 3WIIH 1CFQB 1AC0A 3GSXB 1IC4L 3MLYH 3I6LE 4R4FH 5SWZE 5D7IB 2F54A 4B7LA 4NN6C 1U8KA 1ACZA 2BOCA 1JMXA 3A6BH 2VN7A 1U92B 4P2OB 1FC1A 4NQED 5E6ZA 5IFAL 3QJFA 5JNYB 1YEKL 3U48A 3U1SL 5DD6B 5D2NA 5ITFB 2BJML 2BVOB 3QH3B 3IDJB 1T1ZA 1ZE3C 3F6IA 1GL4B 1MCDA 3OAUH 1CT8B 5KAQF 4WIQA 2WUCH 5GPRA 1MCBA 1YDPA 4NQDA 1EXUB 4OCSL 2XN9D 3UYOD 1MQKH 5GJSH 2QBWA 3MBEA 5I15L 4IOFC 1VFBB 4IDLA 3ALXA 1ACYL 4F37K 2EKSB 1I8LC 25C8L 3Q0HA 1A9EA 1CL7L 4YE4H 3MREB 4KTDH 2ZSVA 3VGEA 1Q94A 4P4RB 1ZHNA 4OZHE 1RI8A 5EUOA 5CEXB 4PJEE 1T1XB 3KYOB 1QBML 1EGJA 3R1GH 1DJSA 2HTLC 2PYEA 2HT3C 5KS9F 4PJIB 3A6CH 5F7DB 3U36A 3U0WL 5E24E 1X6NA 3ABZA 4NNXA 4PYGA 4EBQL 3MRRB 5DMIH 1EO8L 1TNMA 4MNGB 3PWNA 5T5FL 5DMGC 4JEGB 1CE1H 3E6FA 1L9NA 3U0PB 1KCVH 1E27B 3VFRA 4Q97A 1MPAH 1Z3GH 1FZJB 1NUGA 1WGOA 4EQ2A 1V7ML 2Y36L 2FJGB 2J7LA 4LSPL 1S7UA 3KPNA 1N0XL 4FQLL 4QHMA 4YXKH 1P4IH 5K9JL 4HULB 5MENA 3QFJD 1P53A 4MJ6A 3DGGA 5JOFB 1BVLA 4MSWA 4G7YL 3Q1SH 4G3YH 3GSRB 4PRPB 4X4YA 3DMMD 4B53A 1O7VA 1AHWA 3D85D 3U83A 2FB4H 4CKVX 4L8SC 4YAQA 3UTSD 3B3IB 2QR0A 3V6ZA 4WI2A 5K59E 5I8CB 1TZIA 3FONB 5F1KC 3HCVA 2QQKH 3NN8B 3LKSB 1HQ4B 1ZT4B 4HIHA 4F7MB 3O2DH 4OZIB 5ACLA 1BVKB 1TZHA 3PGCA 3FOLA 4ELKB 4P2OD 1IJ9A 1TTFA 4QRPB 3ROLB 5HVHC 3MRCB 3F6LA 4HT1L 3OWEA 3FB8B 3LAFA 5KAQG 3GSOB 5D8JL 2VUYA 4JJ5A 4P4KC 4ODVH 4GW4A 1A6TB 1T5WB 4BZ1H 3D0VA 4LQFL 4FQXA 2JJSA 3TWCH 3C8KB 3D1MC 3TZVA 2EZ0C 2HRPH 2JJVA 2Z91A 4KZEH 3PL6B 1T7XA 1CK0L 5EBGA 5KVGL 1OAUH 1U8NA 1EVTC 3WJJA 1T2JA 3LQZB 2QADB 4HKJA 4WHYG 4P5TB 4UUJA 3I3BA 2FD6H 5JDJA 3BE1H 3FO1A 1PD6A 3BKML 4BK5A 4I3SL 2ED7A 2IADB 3ARSA 2BFVL 1X9QA 4BH8B 4F33B 1S5IH 4QXGH 3VW3L 3P9MA 3KXFA 4Y5XB 1JI2A 2DQUL 4BELD 3X13B 2IPKA 4AEIL 3KPTA 3VWJA 4CVXA 1WC7B 4FZEH 4KKLD 1LEIA 5CUSH 4HV8A 1LO3H 1UXWB 5DK2A 3BUYA 1U8IA 1ZEAL 4N0UE 4XNQA 3BO8B 2XA3A 3V7MA 4Z7WB 3BRGC 3RDTA 2KBGA 1MSPA 1AXSA 5GIRB 5D7LA 1QO3B 5TH2B 4CU6A 5BRZA 2FBJH 1UT9A 1KN4H 3CLEL 5F1IA 1KB5A 1QOKA 4ZFOL 4Q9CA 1TJIL 5GRZA 2IGFH 1FGNH 1RZ7L 1D9KB 4RGNE 5IMLB 4D9LL 4JO2L 1NAKL 5D1ZB 2AXGA 4PJ7E 4XVUC 5IT2H 4FG6C 1DFBL 1C16B 3PV6B 1SEQH 5DJ2B 2VO5A 5F7WC 4Z7UF 3B2UC 5ESVA 2ID5A 4WW1A 1Q9KB 1Q72H 5GRJL 1A0QL 1II4E 1CD0A 4YWGL 3WUZA 2BSTB 5DJYB 3EFFA 2NNAB 1MUJA 1FG2B 4X6DB 4PJBB 3QWRA 1CFSA 4L4VA 1ORSB 3MACH 5ISZB 1WWAX 5EFIB 3SDAA 3IDXL 3NPZB 2V5RA 4M62L 4V1DB 3TJHC 5TDNB 3VFUB 2I27N 3VFGL 4GRLB 4NPYB 1QLRB 5TQ2L 2CKBA 5DFTA 5EOTB 4ONHB 1FNGA 4XXDA 5C86A 3L5XH 3V7AE 1AE6L 4G6KL 4NQCE 4N1HB 3L3IB 4JGJA 1I8KA 3TN0C 1CLYH 1CFVH 1NFDA 4EIZC 3ZDYF 3RKPA 4KHXH 3QUYB 3PL6D 4HIIB 1JZ2A 1X5FA 1G1CA 4NYLA 1QSED 1WWCA 4Y16A 5E99H 4L8CB 1FZKB 2ICEB 4LLMB 4NCC1 3KNBB 4XNYL 2FHFA 4P5TD 1PKQE 1IGFL 4DKEL 2HFGH 3ULUH 1JZ7A 1TQBB 2VXSH 2YSSB 2M1KA 2EYTA 1OTTD 4HIJB 1ZVSA 4AH2B 1WWWX 3MNVB 3F5WA 5DEZA 2J8UE 5F7YC 4F80A 3FMGH 5E94A 2ADIA 1WFUA 4L9DA 1MCRA 4K7FB 4CW1B 2J6EA 1Z9LA 1IARB 3DUUB 1SJHB 5I1AA 3DMMA 4UQ2B 3BFOA 4KY1H 1R5WA 2DKMA 5LXGL 4PBXA 4DOHE 4ZMAT 1A6WH 4XP9L 3CCHA 4O51A 4DGVL 4NHCL 1IC7H 1MHHB 4Q0XL 2F58H 4OB5L 1W8NA 1GOHA 4KAQH 5D7IA 4JFFE 3PNWB 2VB5A 4M6MH 3OKKA 3ZDZE 3V6OE 5D1ZD 2ZOKB 3I75B 1U92A 1NBZB 2AV1B 2Z8VC 5JNYA 1JL8A 3EDJA 2A9MH 1DQLH 1S7SB 5HHQA 5ITFA 3C08H 5DQ9B 1IKNC 3QH3A 4MDJB 3IDJA 3O3DB 5BW7A 1A6UL 4N8CH 1IEHA 5I8OH 2UWEA 5ESAA 1CT8A 2GAZB 3SQBA 3EOAA 1XF1A 2AJVH 4UB0L 1BIHA 2NY7L 4J6RH 4MAUH 1CG9B 3HC0B 1JHKH 4Y2DB 4KKBD 5ISZD 1RULL 3CH8A 4UV7H 3CVHB 2BNRE 5IFJB 5C71A 3BP5B 3TYGH 4GRLD 5KSAD 3DX9A 1VFBA 2V5SA 2EKSA 4NQVA 5HYSG 35C8L 4F58H 2FIKA 4U6HB 2R0KL 1EEYB 2DMKA 3HRZA 4P4RA 5ID0B 3E3QE 4Z7OE 4XNUH 2WM0A 3GUTA 5CEXA 4Z7VB 3WLWC 3QUYD 4KFZC 3ARTA 3FHAA 4O2CB 1P9MA 1T1XA 2PXYB 3KYOA 3EYOA 3W9DB 2CJUH 1A5FH 12E8L 3TJEH 3QO1A 4PJIA 5F7DA 4KJYB 4N0YH 1Z9OA 5F6HI 3A67L 1N6QH 3UTOA 3MNWA 2X70B 3TNMB 5GGTA 3TO4C 3MRRA 2EDKA 1MAKA 3H7BB 4PJ8D 4M5ZL 4ZFFA 3S36X 1MIEH 3U0PA 5K33A 1E27A 4P59L 4YR6A 4RMVA 5DQDH 4DW2H 2I26N 2ICCA 3VXNB 1BQSA 5L6YH 1IGJB 2FJGA 1YMHB 2VC2L 1UZ8B 4FQQA 3SGDH 1E6JL 5IJVB 1AO7A 4IIQC 5F3HB 3X11A 2EYRB 2HKHH 5D7JB 1A3RH 1HN1A 3NACH 4PJ9C 5L88H 4PRPA 4QHUB 4OZFG 4AIOA 4CMMB 2HAZA 5ESQB 5IMKB 3CD4A 3OXRA 4XNZC 32C2A 3O2VH 4PG9B 3CFCL 3B3IA 1H3GA 3FONA 1E6OH 2VDQL 5J3HC 2KL6A 4L8BB 1ZT4A 3LKSA 2R2HB 3NN8A 2IAMC 1NCTA 5MEOB 1DBAH 4WDIB 2VZVA 1RZKC 1XF4B 5EU4A 4P23C 3RGHA 3DX8B 4ELKA 5T3XE 4QRPA 3LKRB 3MRCA 4LSTH 4X4ZA 2FSEB 3N9GH 3K74B 3FB8A 4JPVH 2F19H 3GSOA 2VE6B 1QPXA 4OF6A 2GSIA 4ZNEA 4HWBA 5HI5C 2VXVL 2GEEA 5B38B 2VERN 4ZOBA 1OPGL 4R4ND 4JRXB 3ZKXC 1T5WA 3IDNB 4KK8D 4NJAH 4U0QB 3CFJB 1NAMB 4QRUB 3S4SG 3DECA 1YEJH 3C8KA 2AK1H 3SE3C 3P4LA 4HUWA 5ICXB 2XY2A 3K46A 4MCZA 2HP4A 5EZIL 3LQZA 1GH7A 5F7NC 5D7KE 1CF8L 4F9PC 3KS0H 3D87B 3WNOA 1JK8A 1RMFH 5F89B 1HINL 2CKBL 3W2DL 5KVFH 2L7UA 5TDOB 4XRCB 3OSKA 3CMGA 2KZ1B 2YD1A 3NA4A 2IADA 1NH6A 4DUWA 4BH8A 2WP3T 3PQYB 2EH7H 3G6JF 4Y5XA 1E4WL 2APBA 2COQA 3LPWA 3THML 3ARUA 3I02B 3IGAB 3X13A 3UJIH 1BFVH 4XXCC 1UXWA 1OTUC 2OL3B 3ILQC 2JK5A 3CXHK 1DP0A 5F6IB 4XHJD 3BO8A 1A21A 4LP5A 3WO4C 2X4PB 4M03A 3QO0A 4LBEB 4X7SL 4Z7WA 4KDVA 5GS0C 4WV1B 2X9WA 4L29B 5GIRA 4X4ME 1PW3A 5TH2A 4MS8C 2CXGA 5C2UB 1PJ9A 1YEEH 4RAVB 5I30L 3OF6A 1NL0L 5L2JA 4NZUH 4LCWE 4LU5H 3TBSA 4XPHL 5BVJA 4J12A 1ZT7A 4HPYH 5LGKA 5FYJH 3NZ8B 5F8QC 4P3DB 3P4OB 4GKOA 1SBBA 1D9KA 3MR9B 3CX5J 5E6IB 5AWNH 4P9HL 3C2SA 4ZS6D 2HKFL 3EW3B 4XHQA 4QO1A 2X05A 3DGCR 4I0KA 1MLBB 1DBMH 4WTWA 3BWUC 5I17B 2OZ4H 1P84J 4JVUA 5DJ2A 3AM8C 3KVQA 4X6FA 5CBAA 2WBKA 1U3JA 4D0CB 1FNSH 1KBGL 3V0VB 4X5LA 4M48H 5FA4A 3O3EA 3I9GH 5IP4A 1V3LA 2O26U 4KK9D 2BSTA 4M00A 3U4EB 2NNAA 3MA7B 4JFPB 1FG2A 3GMQB 4PJBA 3QULA 1ORSA 1VKXB 2Y06H 4E5XB 3B9KD 4ODBD 1NC2B 2CDFB 3IDIA 1QACA 4PJDF 1K3ZA 4V1DA 4N0CD 1ETZB 3VFUA 1GRWA 2PO6B 4G7VL 3QQ4B 1ZS8B 4HJJH 2N56A 5GS3A 1QLRA 3DV4B 5GJTH 3T3PE 3T1WA 1J1OH 1WUNT 4L3EE 5EOTA 1S3KH 3IS0X 1KELL 4JRXD 1UM5H 2ZUXA 1WICA 3BEWA 3PWPE 2R0LL 3L3IA 3ARFB 1KC5L 1HQRB 2QKIA 3CMOH 1OCWH 4JDVB 4J3SA 2EDBA 4IDJL 5ICYB 3FQWB 1IGCL 1DTUA 5HGGS 5C09D 4KK6D 2X41A 3CSBA 4L8CA 2ICEA 5L2KE 3KNBA 2UVFA 4IRJD 3ETBF 3T0XA 3IFOA 4PJGB 4JB9L 1CLCA 8FABB 2APXA 1TIUA 4GLRI 5SX4H 1CXHA 4JANB 3PQYD 3SDDC 4HIJA 3RWDB 1J86A 4G5ZL 2OTUB 4P2QB 4TVPD 2P5EB 3WYRA 3U4BL 1WIUA 4LGPB 3B9AA 3VFNA 1MCKA 3K80A 3T3ME 3F65A 1R3LB 1W8OA 4NUGL 1ZVYA 3BZDA 3SCMC 4NC2B 3K4DA 1NBYB 5D1XC 3DV6B 5F6HJ 5GGTL 2GJJA 3B9VA 1X5AA 4MA8H 4PLKD 3DUUA 3LN5A 1SJHA 1PLGL 4XVTL 4UQ2A 5T1LB 4IBLT 1PSKL 5CEZL 1FNHA 3IETA 4HDIB 5ADPH 4JO3H 5I16B 1YPZB 3VGDA 5DTFB 4CL7A 2QSCH 1ZSDB 5J6HB 1MI5A 1UEYA 4JFHD 4I0CC 3CSYB 3MRQA 4LVNC 2J8OA 3PNWA 5CJOH 5E6ID 1T7YA 4WEUD 2NXZC 3GM8A 3I75A 2B4CL 3SDXA 1G6VK 1NBZA 2AV1A 2Q3ZA 2BP3A 4N5UA 5K9OA 2AJZB 4DQOL 1BFOB 1S7SA 4MA7H 2EC8A 4KUCF 5B22A 2RCSH 1DBJL 3SKOB 1YJDL 3ULVL 3X3FH 2GAZA 1H15B 5I6XC 1PQZB 4M4RA 4UT6L 3HC0A 4Y2DA 4C56D 3BGMA 1S78D 2QHRL 2WIMA 4M43H 2FECI 4HGMA 3CVHA 4M93B 1LWRA 4KRMB 2XZCL 2PO6D 3BP5A 2G60H 5SX5H 1AFVL 3IDMB 4N9GB 3ARGC 1I1AC 3V6OC 3QG7L 3QI9B 4U6HA 3F7PC 5ACZA 4JM2F 4XVSH 1BPVA 1EEYA 4KVNH 1KTLB 3QEHB 2HJLA 5ID0A 3ARFD 1N4XH 5DHVH 5B3NA 4PP2B 1UWEH 3D69B 3TA3B 4ZTPH 4K3EH 4Z7VA 5HHXL 3FT4B 4O2CA 2PXYA 4JY4B 2H6PB 4MQTB 4FXGB 5L8LB 5FYLD 3TNMA 3FTGB 4CN4A 3W0WB 4C83B 2NY3C 5KANI 4WGVB 5C07A 3ZHDA 3T8XB 1B90A 1FL3B 4G6MH 4AIZA 4H0GA 3QP3A 3QNZA 3BP6B 3VXNA 1IGJA 2XI9A 4NJ9H 5GRVK 5E5MB 1CGYA 1DN0B 3DJ9A 3ZYIA 5DSCB 1UZ8A 3G6AB 4Y8DC 4NSKB 4W6XB 2W91A 5F3HA 2EYRA 5D7JA 4PP1D 4RWYL 4LAQH 1YEFH 3E3QC 1MELA 1QSFB 3FT2B 1M7IA 1OSZB 4QHUA 1RIHH 4J1UA 1ZXQA 4XNXL 1U6AL 4L1HA 4MD0B 1QBAA 1Y6MR 2PYFA 2YMXH 5ESQA 5IMKA 2D7TL 3HI6L 4PG9A 3VXME 1JGEB 4KKCD 5FKPA 2FHCA 4L4TA 5BZWB 5TE4L 1NFKA 2Z31A 1INQA 2XZQH 4A6YH 1RHHB 4ODSH 4L8BA 2MHAB 4F2MB 3BPLC 3REVB 4APQB 5MEOA 2AJXL 1MNUL 4K3DL 3N1FC 5FGBA 2R8SH 1XF4A 3DX8A 3K4ZA 3L5WB 5BMFL 1PY9A 3KJ4C 1K6QL 4J3VA 2VE6A 2ZJSH 3MJ7A 3QEQB 5EC1B 3H9HB 4G8GB 1R6VA 5EUOF 5I1CL 4XGZA 1TZGL 3JTTB 3QISA 5IBTL 1OP5K 5M94B 2F5AL 4YC2C 3IDNA 3O0RH 1KLUB 3CFJA 3ZLQC 4YBLB 3L3OA 1NAMA 3EDFA 4QRUA 4YH6A 4YFEA 1V3KA 3SE9L 5ICXA 1X7QB 5FOBB 4X9FA 3QDME 4PD4J 1HH9A 2P8PB 1VEMA 3QEGH 1CXLA 2CDGB 4Z95L 5DS8A 4I4WA 4Z0BL 4S2SB 5F89A 1OGTA 3JV0A 5TDOA 1JIBA 2R2CA 2Q76A 4JR9L 3TNNB 2OP4L 5I74C 1MF2H 4L3CB 4RFNC 4OT1L 4G9DB 1WAAA 1TPXC 3TA3D 2D03L 3I02A 3C6LD 1LD9B 3HRPA 3N1GC 2EH8L 2OL3A 4JRYD 3ET9F 4NO0B 3P0YH 3K8LA 2UZYB 1T22B 2R0WH 1RUKH 4QNPF 2X4PA 1CDHA 1Q9LB 5FGCB 4LBEA 4P23A 5F7EH 4L29A 4R7NB 1A1OB 1ZTXL 3KHQA 1K8IB 5DDHA 5B4MC 5GRWA 4PRHD 4ZFGL 4XCFH 3C09C 3MXVH 1OAKL 5ICZB 4YQXH 4LCYB 1IM3B 1MFDL 4ELME 4IRZL 4C57C 2YPLD 1J8HA 4P3DA 5AAMA 5GS1B 3P4OA 5I1DB 3MR9A 1F5WA 3CZJA 4OCXL 5F9OL 3RTQB 5I17A 2DYPD 1MCCA 2MPAH 4FQ2L 3E6HB 4D0CA 1HKLH 3V0VA 1RZKH 2JCCE 2XT1B 3U30C 4C4KT 4OGYL 1F11A 3O41B 4BFGA 2X5PA 4NQSB 2X9XA 4XI5C 3RX5A 2VZTA 4POUB 4NC1E 5DQJB 3CLFL 2JELH 4I77H 3U4EA 4Y4HC 3RGVB 4APQD 1GGTA 4KPHL 4JFPA 4M5YH 5DI8A 3GMQA 1YNKH 4MNHB 4E5XA 3VXRB 1NC2A 3PGDA 4JY5H 4LVOB 3DROB 4WW2B 1ETZA 4O58H 3QQ4A 3S34L 2O5ZL 4B0MM 2DLGA 3DV4A 4NRYB 3QG6A 4G8GD 2APTA 2DMCA 4HBCL 3BJLA 2ZKHH 4KDWA 4MZ3A 4UTAH 3BAEL 4LRIC 3GK8L 3ALWA 3ZE1F 2WK2A 1NKRA 1I7RB 1NCUA 3JVGC 4ZAKD 2EC9T 4GKNB 4PYHA 3S96B 2ICWB 4U0RB 5F7UA 1HQRA 4MGXA 3FZUD 1S9WB 4Z8FH 2QJDA 3FQWA 4Q9BA 3L3KB 4S11A 4WO4D 3IDGA 1SYVA 5DVLA 1K4CA 3SGEI 4GMSH 3CVHL 3FOMA 3KLAB 5GS2H 3BH9A 4R26H 1MEXH 1FVEB 8FABA 3AVEA 1TJGL 3RWGB 4POZC 3O9WC 3U79A 3S88H 1FGVH 3B4NA 1VADB 1UZ6F 4JANA 4X6BA 5C7XH 3RWDA 2X42A 4LLAA 4EI5C 4LK4A 1H3VA 4P2QA 4HG4K 2P5EA 4WFEE 4XMLH 1A7QH 1MJ7H 1AH1A 5JW3H 2P45B 4X99B 1PX3A 1MRFH 4WENB 4XP6L 5IG7B 9CGTA 2BHZA 4Z7NE 1NBYA 4IHOB 2DI7A 3IXAA 2HT2C 2I9TB 1M4KA 5T1LA 1SY6H 4HF5L 3HZYB 2AXFA 1YMME 3WDIA 4YO0B 2Z9TA 4AMKH 3QRGH 4XPGH 4HDIA 2K7PA 5DTFA 4RWHA 3JWOL 4TTDD 1C5CL 2A74B 2E8YA 1VA9A 3CSYA 2VXUL 3C8HA 4JDTH 4GXVH 3TBTB 1N59B 3ROOB 3VXQB 1QR1A 2CMRL 3RTQD 1DSFH 5E0QA 5IQ7L 4GAJH 1JGUH 2WMPA 5IBUG 4FQIH 3QXTA 4PLJD 2AJZA 1WITA 2ZZUT 1BFOA 4JHBA 2W38A 4LGSB 1NFDF 4LCCB 3BYYA 4LLQA 1WTGT 3MJ6A 2GI7A 3UC0L 1U3ZA 3LMJL 1AKJD 1BFSA 1S8DB 5C9JA 1PQZA 2ZPKL 3HNTL 4ONOA 1I9RH 4WFHE 3O6KH 3VXRD 4GBXC 5JIPA 4Y5YC 1EBAA 3I3EA 1UADC 3BMWA 1JN6B 4H0HB 2YA0A 3JZ7A 3LB6C 5ALBL 4U1IA 2CXKA 1OARH 3D25B 5DFVC 3UCRA 4HFWB 4HC1A 1BBDH 2HN7B 4FXLA 4NQCA 5D2LB 2QSTA 4PIRF 3S3JA 2O5YL 4MJIE 3IDMA 3PDGA 1ZWIA 4UBDD 3VFVB 5FB8B 1RZIB 3QI9A 5JLZB 1BECA 5D5MB 4LSDA 5JHDB 3KR3H 4LFHG 3CNKA 3QEHA 4FFVC 4LDEB 2VZ3A 2IANB 3PWUB 3KAAA 3ULUD 1NAML 4PP2A 2V7NA 1F4YH 3B6SA 5IHLB 1U8JB 3MUY1 3D18A 3AREB 3VD9A 1LGVA 4JY4A 3DYOA 2XZZA 3HZMB 3PXJA 4FXGA 5IEKA 4A2MA 1DQDH 2J8HA 4NWTH 4JFYA 4RAUA 5DZOA 5TQ0L 1YNLH 4Q6IC 2A6DB 1DVFD 3FTGA 3D9AH 1FBIL 3W0WA 4C83A 5D7SH 2FJFB 5KSBE 2EC9U 3T8XA 1TMCB 4H26B 4XZUB 3MGTB 4FQJL 5D7IF 1FORH 1HHHA 3BD4A 4ODXA 3ZKMD 3LSOB 1IRAY 3UBXI 2M8XA 4Q58C 3KLHC 4U6YB 4X5XB 3NABL 4NKIH 4KUZH 5E5MA 5DSCA 5CLTA 4YNYB 2CDEB 2OL3L 5E7FA 5CSGA 4N1CA 5GRUL 1KEGH 5JZ7D 3TGXA 4D94A 4ODTL 1YN6B 3QPXL 1J05B 1QSFA 3FT2A 2L4OA 3WIHH 4EDXB 3MRFA 5E08H 2XG5A 3O2DA 2UWEF 3HUJB 3K2MC 2ATKB 4OCWH 5DJAB 5BS0E 7FABH 4NZRL 1U93B 5HI3D 4OZGB 4Q9QL 3IDUA 5CD3B 1D5BA 3HNSL 3MV9E 1JGEA 4Y19B 5J9PB 1JTPA 2E3VA 3IKCB 1V5JA 3QXWA 4FQPA 4MNQE 4HPOH 5DUMH 1GAFH 3EO1B 2AQ2A 4M8QB 4F2MA 3REVA 3NCEB 1NCAH 3SO5A 3IFLL 4KDTC 1GC1H 5LJYH 2VDNH 1HK6A 4L8DB 5TFSL 5HPMB 5GGVL 1D6VL 4F37F 4Y5VB 5KS9E 4Z76A 3QWQB 3A0OA 4PG2C 5DK0A 5E9DD 5E4EB 1YNTB 2EO9A 5DD1L 3QEQA 3H9HA 1WZ1H 5FM5M 4YBHA 3MLVL 4K55A 3U7AA 3CFBB 5JA8B 4NT6B 4DVRH 3NIDF 3FQTB 3MGAA 1IAKB 3HPJB 4PJIF 4FP8L 3VMPA 1F4XH 2R23B 5FOBA 2FRGP 3OAZK 1I7ZB 5EULV 5TDPA 4WU7B 5M95B 3DO7B 2P8PA 4G8IB 3LS4H 1NLDH 3RNQB 2AK4D 2XACC 3HS0B 5LVEA 3WS3B 2CDGA 4DGIL 1SQ2N 3VGFA 4KJQD 1CR9H 4R2GB 4WHCA 2NR6D 1AC6A 3O4LE 5CJ8A 4LLDB 3T1FB 5IHUL 4QGYA 3ILPB 4L3CA 3G6DL 4BQ9A 4ZUSB 1CDCA 2IAND 4AT6B 3S36L 5EOQH 4MXWL 1DANU 2FIRT 2BXYA 1N5AB 4H8WH 1LD9A 1F90L 4PJCB 4KMTL 1OP5H 5DXWA 4NO0A 3EYSL 5C0FA 3F8UB 2WBJA 4K8RC 1JP5A 1UC6A 4OSUH 3P4MA 4XMPL 4I48B 1Q9LA 5EZLB 1UQSB 4R7NA 1A1OA 3ULVF 1K8IA 2V9RA 2ZUWA 3VG9C 3BKJL 1G7MA 4K71B 4UT7H 2R29H 5ICZA 1LK2B 2I24N 3T08A 4LCYA 2DL9A 1MWAA 3QRFM 4XP5L 1M6OB 4M1DH 2OX5A 1GPOH 2IPTL 2CUHA 5HVHB 5I1DA 3L9RB 1LO5A 3WIIL 2Y72A 1R24A 2FX8H 3QDGB 5EIIB 2QSVA 3RKDC 1HILA 3MLYL 4D3CH 4R4FL 2FECL 3DVFA 4P4KB 1T83A 1DL7H 4WI7A 3E6HA 4JFDA 4S1RH 3A6BL 5FM4A 3LV3B 1LEKA 4NNYA 3O41A 2HH0H 1EERB 2YC1B 4NQSA 5I0DA 3N1PC 4YUEH 5DQJA 4YHZH 4NZTH 3RGVA 1O0VA 2Y1VA 2PKDA 5DD3H 3OAUL 4IOFD 2VL4A 4NN7C 1LDSA 2X4QB 4LLWA 4DVBB 3P2TA 2X1WL 2WUCL 2BZDA 2D2OA 1CICB 4YHOH 1C5BH 3RWIA 3HA0A 4NRYA 3BEVB 2A38A 1MREH 1MQKL 1Q9OB 5GJSL 4RMWA 4QXWA 3RHWK 1I7RA 4JO4H 3PP3H 1L9MA 2HTLD 3S96A 1S9WA 4Z7WF 3D2UD 4YE4L 3UTQA 3OGCB 4KTDL 4MJ5B 1UJ3B 3L3KA 4ZQKA 3EO0A 4OF7A 1OHQA 4NC1C 5DMGD 1F3DH 4HIXH 1FNFA 3ARZA 3R1GL 1QNZH 4MQXC 1A1MB 1WK0A 1G9NH 3A6CL 3H7LA 1XCTB 2QQNH 4Z7UE 3GSVA 5MERA 3SDYH 1VADA 5E8NB 1TETH 1JBJA 3HE7B 5DMIL 1KV3A 5F72S 2CLVB 5EA0H 5I18H 1CE1L 1J0IA 4KJWC 4TQEH 3IXTB 4ZUVB 1KCVL 1QFWH 4X98B 4X99A 1MPAL 4HKXB 1Z3GL 2RIKA 1HCVA 4J4PD 5CIPH 1N7MH 1DUYB 1UB5B 3O8XC 4JZJA 5FYJD 4FQCH 1H0DB 4YXKL 1P4IL 5I2IB 1T89C 1NJ9B 5C0AB 4IHOA 3VGAB 4Q2ZB 1OB1A 4EN3C 4JFEB 2I9TA 4F7EA 1YEHH 3C60B 4K94C 4UU9B 3Q1SL 4G3YL 4I0PC 3HZYA 4XT1C 4LSSH 1BFTA 4PJBF 4YO0A 3OKEB 4Y4FC 5INCB 1WFTA 3LEVH 2A74A 2FB4L 3JV4B 5JPMA 2Z8WC 4FTVD 4JG1H 1XGYH 1U3HB 1VFAB 2DMBA 3ZDYE 5J6GA 2F53D 1N59A 3ROOA 2QQKL 2EDFA 1JHTB 2G9HA 3LKPB 5FECB 2AABH 4P4KD 3O2DL 1VB9A 4QF1B 2CO7B 1JTTA 1XT5A 5KOMC 1GGBH 1FLRH 4LCCA 2HMIC 2J2ZA 2YS4A 4BJLA 2EZ0D 3RX8A 5D6CB 1U8LB 4K2UH 3PG2A 3SGJC 3UBXA 1S8DA 4ODVL 1IGTA 4PUBH 2MQ3A 3OR7B 1BX2A 4BZ1L 3KHOA 4L3EA 4P3CH 5DHVB 1SYSB 5F9JB 3D25A 3TWCL 4HFWA 2HRPL 2HN7A 4P5KB 4KZEL 5D2LA 3ZYZA 1CDYA 1OAUL 4XH2B 1EMTH 4XWOC 3VFVA 1FVDA 3B2VH 4RGOH 5IBLC 4F7TB 1RZIA 2WUBH 3B8YA 5D5MA 5JHDA 1VFMA 2FD6L 2XWJB 2ZSWB 3BQUB 3BE1L 2IANA 2NY6C 3PWUA 3KYKH