3QUZC

Structure of the mouse cd1d-nu-alpha-galcer-inkt tcr complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
203
structure length
203
Chain Sequence
TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 45
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quzC02
1Y6KR 3ARBB 3DVNA 2NR6D 2FZ3A 4JM4L 4HS6B 2HP4A 3P0YH 2YD5A 5BJTB 1JZ5A 2NW2A 4ZFZB 4ODXA 4N5ED 5C7XH 1HSAB 3C5ZD 1MVUA 1XH3A 3NVQA 4LP4A 1WIOA 1R3IH 3T4AA 1TNNA 1ZLWH 1O5DT 3ILPB 3KPNB 3ZO0A 3ARRA 2EICA 1MJUL 3I2CL 5J06A 2VDOH 4H0IA 1FO0B 4WWKB 2BNUB 3IDNB 4AIXA 5E7FA 4ZAKB 1O7VA 2DYPA 1I8KA 1SMOA 2EKSA 1MRFL 2VDPL 5C0DA 4PJXE 5GGVH 3S4SB 3DGGA 2X4RA 4XNYH 4Z0BH 5KSBB 4YHZH 2W38A 2NZ9C 5E8PB 3T0VA 5DC9B 1U8HB 2CGRH 2ICWA 3FT4A 5K9JL 4U1IA 3FFDA 4MQ7A 3VGFA 1X5HA 3L7FB 2AJ3B 3LMJL 1E6OH 3HZMB 1NL0L 4B53A 1FZKA 1TDQA 5TF1L 3LKNA 1XCQB 4K8RC 2C4FU 1MHCB 5L2KA 1KJ2B 4FQXD 5EIIA 1EUTA 4AEHH 2D3VA 3DRQB 4OZGA 1JZ6A 1YMMB 3QQ3B 4HS8H 2FO4A 2KQMA 1YDPA 3TVMB 1NKRA 4XMKH 3QIWC 5IVXB 4KKCD 2C1OA 3DUUA 3I6KA 1S7WA 5H37H 2J5LB 2EYRB 3FQXA 4OIBA 4DVBA 1XIWB 4Y5VB 5CMAB 5DJ2A 5T1DL 5I8KL 2AEPL 4HAGA 3BE1L 5DVLA 4HUVB 3QQ4A 1TFHA 1OD7A 3QPQD 4NIKB 2CIIB 2VDRH 4LLDB 4D0BB 2QQLL 3QIUC 4W4OC 5DGQA 3ULUD 4EOWH 2HN7A 2YPLE 5ANME 3V6OC 3TIEA 3VFGH 2I9TA 5BRZD 1KPUA 1KLGB 3T65B 1F58H 2FD6H 4LKXB 4XZUA 4EBQH 1J1OL 3D39E 1PGRB 2OK0L 5SWZB 1B4RA 1AGBA 3FN3A 2VLRE 4WUKL 5ICYB 4GMTH 3OR6A 3QZWA 5ACMA 4Y5YC 2P44B 1BREA 2WINA 1KCRH 4G8IA 1AQKL 1EFXD 3GMOA 3W81A 2WBJB 3B9KB 3U48A 2ARJA 4U7KA 2FJGB 4U49A 5CEXB 2FEDD 2C3VB 4ODWB 3WMSA 4IOIA 1YZZA 5HXMA 5FYLE 3CLEH 3UPAA 4X7SH 1LNUB 3U36B 4ZFGL 2R1WB 2ZUYA 2CKNA 5A3ID 4UU9A 2IGFH 3MRDA 4HH9A 1FFNA 4QXUH 5LGJB 2P43B 5C0ND 3IU4H 1KB9J 3K8LA 5E94A 3E3QC 5KVFH 1OGAB 2EDHA 1FYHB 1IAOA 4JN2A 4IMLA 3O2VH 1D9KA 4HEPG 3FFCE 3VFOA 4K9EH 3IXAB 3EGSB 4X8XA 4WW2C 5E24E 4JQIL 3CDFA 1GZPA 5HI4D 1DL7H 4MAUH 1BFSA 4HK3J 1OTTC 4HKXB 4OCSH 3LS4L 4DZ8A 5HI3D 5CSBA 5FYKL 1IL1B 4JCLA 1FNGA 3MJ9H 4ZTOH 1RUAH 4JFXB 2XTJC 5C0BA 1ZSDA 1QBAA 5C0FB 1U8PB 3VRJB 4O9HH 3ZKND 4YH6A 2DQJH 2DQTL 4IIQA 1IKFL 4S0SD 3CZFA 3K1KC 2VDMH 4WUUE 3S3JA 3UTZB 5HYSA 3WLWD 5ESQB 3D18A 2V7HB 3IJSB 4PRDB 3HZYB 4ISVB 4WW1B 3DPBA 1MCCA 2I25N 3MJ8B 4JPWL 3OGOE 1L0YA 5I74B 3JV4A 3RJQB 4MJ5A 1T7XA 3LRSB 3OXRA 4OF3A 4P48A 3TBYB 4M02A 4HUWB 3SE4A 2X7LB 1CLZH 1OARL 1DTUA 1U95B 3GBNL 4MD4A 2OL3A 1KIUA 2Z91A 5I1DB 1YN6A 5C0RL 1YUHB 1N6VA 1IM9B 4PJHA 2Q7YA 1OD9A 3WS6C 1LO4L 2XQYG 3EHBC 3FN0H 5GJTL 5GS2D 5LAXB 3ZTJG 1GHFL 1HSBA 2P5WA 5H94A 3HN3A 2PXYA 3C2AH 4KJPC 3GHBH 2FLBT 5FO7A 3GJFB 1A7NH 3T1WA 4OAWA 3H7BB 4NRYB 3EYOB 4M6OH 1DSFH 4LGSB 4FOMA 2YD9A 3RUGF 3NZ8A 3BJLA 4Y1AA 4PUBL 4WV1A 5IT2L 1SEQH 2XTLA 5HVWA 4D9RE 3WFDL 2X4SB 4JG0H 3VG9B 1QFOA 1XCTB 1FHGA 4G8EB 3MJ6A 3WLBB 1IMHC 4KMTH 3EYSH 2VISA 1HNGA 1TTGA 2AJVH 1JNLL 5AUMA 1NFDB 4BH8A 1NANH 5JHDE 3DV6A 5LKNA 2Q7NA 3WIFB 4XPFH 3BX7C 4NO2A 5F9OH 1T21A 3MCKA 5EC2B 4JPKL 4YPGA 4YX2L 3NOIA 2ED7A 4M7JL 1UZ8A 4RZCB 5CEZL 1FVCB 3H3PL 3W39B 4MNHB 4MXVF 3ILQC 3VD9A 3BDYL 5A43C 5FYKD 3F12B 4IRZH 2X40A 1FFQA 4KMQA 5H37G 5JO5B 3MFFA 3PGDB 1DQLL 3S5LG 1MIEH 1ZMYA 3KPLA 3WKML 3GIZL 5HSFA 4XHQA 4L9LC 1FJ1B 3GIVA 4XNUH 4LIQL 5INDA 1G84A 3GSUA 3HCVA 3SDDA 4L4VA 1WCBB 3RU8H 3VWKD 1B3JA 2HFGH 3O8XA 2XACC 4QTHA 5TQ2L 1IAKA 5EZJA 5LWYH 1VEMA 5FOBA 5T33L 1I1AC 2ZUUA 3L5WB 5ID1B 4ZNCD 5I1GH 5C0AD 4U05A 4P2QE 4PLKD 2ICCA 3RWIA 5MEQB 4FFZL 1BQHG 4GBXA 5BVJB 1I8IA 3SE8L 4E0RB 4K3HA 1RZ8A 2GSIA 1S9WB 2VUOA 1JJUA 1OQXA 3IJYB 4YE4L 2FIRT 1FYTB 5ELIA 3GKWH 1Q0XH 3D39D 4G8FB 5K93A 2A6IA 4PJAB 1AO7A 1UA6H 1QTYT 4GS7C 4C56E 1NANI 5DK3A 3MROA 12E8H 1RPQA 4WI3A 1NMBH 1JPGB 1CXHA 4U1LB 1ORQA 4PRPE 3SKJH 2VAAA 4IRSB 1A6VH 2VL5A 4ZYKA 5IMLA 1DBKL 4LCWA 2A77L 4FFWD 2YKLL 5BS0D 4EKXA 1PY4A 5FYLD 1SJEA 5D7LD 2HFEB 1GRWA 2IF7A 3SDCA 5KVDH 1GOFA 4NWTH 5KSUA 5CD3A 4N9GB 3BVNB 3U0PA 4GJTB 1JIBA 4U6HB 3MOBL 4JFDB 4R6UA 1A14L 3STBA 3EFFA 4HJJL 1MJJA 4U1NB 3BQUB 1S9KC 1AXTL 2DTML 5I8OH 4Z77A 3SO3C 5IG7A 3B83A 3VMOA 4PB0H 1A6PA 3U9PL 4DVRH 4MMXC 4NOFA 4PJBE 4ETQA 1U8LB 4ELKB 3QI9C 3RI5K 4OGYL 4S1DD 3WUWA 5C2UB 3QIWB 1TVBA 4X6CB 2RJMA 3RDTA 5FKAB 1QBMH 4M5YL 4NCDA 2Z93B 4NRXA 1F4XH 1WAAA 1OSZB 1XF4B 4K94C 4Z7UB 4I4WA 3ELAT 4ODHH 1Q9OB 3ET9F 2GSGB 1A02N 1M7IA 1EHLL 2VR5A 3B4NA 3RVWD 4U1KB 1G6VK 3ARFA 2C3GA 4Z7VB 1ORSA 4YXHL 5F7HA 5JDSA 5DD6B 2H32B 1MNUH 3D87B 3I75A 4UTAH 4H25B 3M07A 2FBJL 1T4KA 4HIXL 3RL1A 1C5CL 4Y5YB 5DDHA 4PJ5D 1G7MB 2ED9A 4JFFA 3ZDYE 2RCSH 2R23A 4LLUA 3PQYA 1J05B 1JMZA 2DWDB 4M1GL 5KSBE 3EBAA 1DBJH 4UILL 3ULVE 1YPZB 1MY7A 5JPMB 5DI8B 4NZJA 3DURB 3TCXA 5GGQH 2X1OA 4XPTL 4LHUB 3KLHD 3LCYA 4I48B 3DROA 4LHJB 4JE4B 3MC0A 3X13B 3LZFH 4MJ4A 3GM8A 5GGVY 1G7QB 5FUZL 1JWSB 1WBYB 4OF0A 4JPIA 1YJDH 5HY9A 4QT5A 3WDIA 5TPWL 2H9GA 5IW6A 4A6YB 4CVZA 4KV5F 2Z0BA 2HT2C 3OHXB 2DQUH 1YMME 3U7WL 1T1ZA 3O3DA 3PGFH 2HRPL 3D25A 1Z0NA 5FM4A 4FQCH 3G6JB 4HG4J 4XC1L 3DBXB 4XWOC 5I1LA 4WW2B 2D9CA 1JPTL 5IVXE 2NX5B 3LS5L 1IGYB 5GRYA 3L3HA 5EUOA 3VI4F 5DMKB 2VIRA 5D5MB 2C3XA 1D5ZA 3VJ6A 3DIFB 5F7UA 1A7OH 1TJHH 3F7YA 4U1JA 5GSRA 1MAKA 4Z7NF 2DQEH 2E7CA 2QL1A 2VN7A 5IK3A 2XZAL 4HWBH 4QRRD 4D0DA 5JHDD 4PRAA 1HHKB 4ODSL 5JPNA 2UUDH 3KPTA 3O2WL 1AXSA 4OT1L 3U7YL 3FJTA 2VO5A 4Y7MA 2AW2A 2H6PB 2JJUA 2NTFB 5SWZE 2IPKA 2NW3B 2W0FA 2NLJB 4FFVD 1PZ5B 4Y16D 5D8JL 1CD9B 3RHWK 4JDTL 1R5IB 3FCTA 1D9KC 1UYWL 1R3LA 4KK9D 1MHEB 2G75A 2VR9A 2ZSWB 2W0LA 1ZAGA 2HT4C 1J0YA 4QHKI 5IM7B 2IH1A 5DURB 1WUNT 2CMRL 3SGEH 1SJHA 4WTXA 3W9DA 3EYUL 1G6RA 4NNPH 3CDCA 1NLBL 2EC9T 3SHSA 4WO4D 2YRZA 5MI0C 4N0RA 4MA3B 4MA1B 1BJMA 5AZEL 3VXRA 1V5JA 1KFAH 3QIBA 5H2BA 3MNZB 4AQ1B 4IIQC 5SWQA 1A6ZB 1A6UL 1NGQL 2JJVA 4HS3A 4IS6A 1C12A 4R0LA 3S6CA 5FOJA 1OGAE 2JCCA 2XG5A 1EIBA 1TZIA 5JIKA 2Q8BH 5D7IB 2ZG3A 5C6PB 1EEZA 4JVPA 3N0PB 4LPUA 4XAWH 5D7JB 1A7RH 1CDCA 1CD1B 4RRPG 5CEYA 4QY8A 2B1AL 1JUFA 5GSVB 1DANT 4GSDL 4QTIH 3TT1L 5LBSH 3SE4C 3U6RA 3R8BB 5JHLH 5HGHA 5HGBA 4CVXB 1IQDB 3HI1A 4U6TA 5IHZA 3FHQA 1MQKL 5I1CH 3O41B 4JRYD 1QR1B 2X05A 3DO7B 2ATPB 1A6AB 3QWOA 4PRPD 2DIAA 3IAQA 5I8CA 4TUJA 2OP4H 4YHPB 4APQA 5EUKA 3HMXL 4M7LL 1NMCC 4XBPB 2PXYC 1W72B 4LKCB 5DYOB 4NWUL 3LHPL 2F58H 4P9MH 3Q48A 1MIML 3IB4A 3SE3C 1YEFH 2MCPL 2OTWB 5LQBH 3BW9A 2BJML 1QNZL 4BQ6A 3BXNA 5AEAA 3O6FA 5KOVC 3TO4A 3GJEA 5DRXB 4O4YL 3E2HC 1NBYB 1UJ3B 3R8QA 2KH2B 5GJSH 4N8CL 1ZHBA 4HUXA 2YS4A 2JK5A 2CKBA 3SGEI 4PYHA 2NXYD 1T3FA 1I8LA 2R56H 5CJQL 2CUMA 5HHXH 1CFBA 3T3ME 1P84K 3VFWB 2VLKA 1M7DB 1FIGL 4L9LB 4GRLD 4M1CD 1D5IH 5DUML 3HG1A 43CAA 3B43A 3DUSA 3PHQA 3V5HB 5AWNL 3ARDC 2J3SA 2YHGA 4JM2F 3MRIB 3K4AA 3WNLA 3FOLA 2I60H 3QFJB 4UT7H 4OQTL 2GIYA 1OAXL 1I1AB 3BKYL 2AJUL 1F2XK 2K7QA 2AXFB 4ZO7A 2BVPA 5L6YH 1EO7A 3RVVD 3UTTA 4Z78B 5E08H 1JHKH 2B8OT 1JWMA 4Z7WA 2BNQD 3FAWA 1WZKA 2XZCL 2NY5L 3S5LB 3M8OL 2KPNA 4PRBB 3S8WA 2DICA 3G6DH 4XXDA 3L3GA 4Y4HB 3KPSB 1A2YB 5IB4B 1AY1L 1IT9H 3WNOA 4IOSD 1N5AA 5ICXB 4GS7B 2XXMB 4U6XB 1P5VA 2EDFA 3BT2L 5EO9A 3H0TA 3EZJB 5GGSB 1NFDE 4X98A 5DK0B 5FHBL 1FDLL 3TNMB 2AK4A 4TUKH 4HIEB 3B5GA 4F3FA 4YXLL 1IEAB 3SDDC 1DR9A 3IDYC 2GITB 2PO6A 5HHMD 3O8XC 4QNPE 1GC1H 4I77L 4FQHB 1I9RL 1DVFB 4PJ8A 3MV7B 1NCNA 3GHEH 4KK5C 2Y36H 1DBMH 4Z8FH 1PFCA 4YBLC 3KNBA 2RFXB 5B4MD 5IFHL 2EZ0D 4GBXC 5EH1A 4ODXB 5C0JA 5C0CA 2EC8A 5L0QC 1MVUB 1F4WL 5BOZG 3IGAB 1XH3B 4HWEL 4KJQC 1C5BH 5FKPB 1S7TA 1YMMD 3SO3B 3T4AB 2VB5A 1F00I 3TVMD 4EVNA 3EYVA 1Z9SA 2DD8H 1CDIA 5FA3B 1INEL 1UXSB 1HXYB 2G9HA 3QI9B 3F7PC 5DUPH 3UZVB 1KJMA 3F7QA 1XIWD 3OGCB 2DYPB 1I8KB 4JFHE 5C0DB 4L29A 3QDHA 3N50A 4KHXH 1QSFD 4NO5A 4W4NA 5I1AB 3BKMH 1CDUA 2Y07L 3PDDA 1CXEA 4GQPH 4P46D 5F8RC 3SDCC 2ICWB 3FT4B 3FFDB 1OM3L 2LFGA 1FYTE 4WU7B 2APFA 5IB1B 4P9HC 3MODL 3K3QA 4PJXF 3HPJB 4FQPA 3GK8L 4PJAE 1KYOK 5DTFB 1KG0A 3ARQA 3BAEH 1QOKA 1XGRA 5EIIB 1KENH 4EI5A 4KMLB 2IG2H 4R96A 1UFUA 4H8WC 5MERB 5E6IA 3J7HA 4AL8L 4WEMB 3RP1A 3QCTL 4NQCA 4OM0H 4FXGA 3UYOD 1KN4H 1DBBH 3JTSA 3RDTC 3DUUB 3VFVA 4F8TA 5A2LH 1A3RL 5SWSA 1QFHA 2ICES 3SDXA 5DJ2B 1OAKL 1CDBA 4AMKL 2FJHB 4R97C 3QQ4B 4JFDE 5F9JA 3QNXB 25C8L 5CGTA 5FUOH 2ADGA 5DRNB 2D31A 4E41B 2DM7A 1FFOB 1UVQB 2A6JA 3ABZA 1JZ4A 1BBDL 1NAMA 3HI6L 4KUZH 3FOMA 4U6YB 1V7MH 2H1PL 5IBTH 3O3BB 4K55A 5L9DL 1AGBB 2F53B 2VZ1A 2DQIH 1QLRA 2YSSB 1T7VA 2IAMB 3OR6B 3QZWB 4NBYB 5AYQA 1QVOB 1F4AA 1NH6A 4G8IB 5KANG 3GMOB 5CP3H 2ARJB 4BSVA 3LKQA 4Z7UE 2AEQL 3BJ91 1WFUA 6CGTA 3HRZB 3FB7A 5DMGC 5J0BA 4JG1H 3IFOA 2NY3C 3IDXL 3MBED 4TUOA 3V6OE 1AI1H 4Z7VE 3L9RB 4LDOB 4UU9B 4F7MA 1FCCA 3MRDB 3DX9A 3MMEB 1E27B 3DI3B 3MLRH 3RVUC 4FQ1H 5CJXA 5DFWH 1HINH 3QUXB 4WHYG 5E94B 1A6WL 3IVKB 1RK0A 1IAOB 4JN2B 4IMLB 1D9KB 1S7QA 4XPBL 5EN2A 5J3HC 3REVB 4UOW0 5C09A 4FNLH 1MHHA 2OCFD 4KY1H 2HWZL 2OJZL 4HQQH 2UZIL 1YPZE 4G5ZL 1IM9D 5FECA 3QHFH 5AG9A 4EUPA 4O2CA 4EIGB 4QKXB 4HXAL 1FNGB 1BD2B 4RMSA 5GS0H 4MJIE 1HKFA 4G3YL 1J12A 4M6NL 5DRZA 1CGUA 3VXTB 3RWEA 3VW3H 2QQNH 1P7QA 3PWUB 4IIQB 4PLJC 5CLTA 5L2JA 3CZFB 3RJDA 3E3QE 2ZWLT 4JO4H 2F19H 4ESKA 4LVOB 4RMWA 1T1XA 4RDQF 4S2SA 1YYMH 3D18B 3G6JE 4OD2B 2NX5E 1JYXA 3CDYA 3EO9L 3VXMB 4JFPA 2JB5L 4MJ5B 3K8KA 4MJ6B 1IAMA 3RTQD 3OXRB 3ZYIA 1N5YH 5D5ME 4YHLH 1BVZA 4TTGA 3AS1A 2VLJB 3QHZL 4XVJL 1QEWB 4MD4B 1R3JA 2OL3B 3MV8A 5DEZA 1WQVT 4NZRH 1U8MB 2OMBA 3W82A 2IFFL 5DR5L 3P11H 4PJHB 3PWLA 4ZPVB 3GSNH 1IGJA 1S78D 1SY6H 4RSVA 5KSAC 1OF2B 1EAJA 1HSBB 1YC7A 4LSPH 2DIBA 4MCZA 5FYJE 1NMCB 3NFPB 3QIBC 1F6AA 4UDTA 3OAUL 4Y4KA 4LSRL 3MRMA 5FO7B 3GDBA 4R0LC 1EGJH 1BFVL 4NNXA 3LOWA 2EDRA 1CCZA 2PKDA 5FGCB 4ORZC 3DLQR 3P9LB 5I8EB 2P47B 2G5RA 2VZSA 3PP4H 5D7KD 3E2HB 4GKNB 2HKHH 3SKNB 2B0SL 1V7NL 3NZ8B 1TCRA 4Y1AB 3HAEH 1NGYA 4N90E 3SY0A 5MEPA 5DQ9A 2DQHH 3PJSA 2ZNWA 4WEBH 3OB8A 2VISB 3NAAH 3ZT6A 3T0EA 4JO2L 4NHCL 4P3CH 3ARDB 5AUMB 1NFIB 2AXHA 5EU6E 4BH8B 3RGVD 3DV6B 4FA8A 4HXBL 4APQC 1RURH 1KCUH 1F4HA 4NO2B 3K4DA 2YMXL 1LE5A 4LSVH 3MCKB 5D7IE 1I1YB 1B2WH 1N64L 1GCFA 3FMGH 4P4RA 1XGTA 2EYSA 2DQFA 5T3XH 1FYTD 2DOCA 3PL6A 3O6FC 1VEPA 5M94B 3TO4C 5I9QC 5DUBA 4WJ5A 3UTPD 3MXVL 1T2JA 1GGIH 4W6YB 2BXZA 1S9VA 3ARED 3MRKA 3ARGA 3C5SB 4F57H 1IM3B 1WGOA 5CZXD 4IRJA 3W2DH 5IIEA 3LEYL 3JWDL 3ZYJA 3C5JA 4LVEA 3CFBB 3C08H 3MFFB 2A73A 4JAMA 1AR1D 1MHPH 4L4TB 3MRGA 1I9JL 2IH3B 5HD8C 1GZQB 2IBGA 4IRSD 4KK8C 4XI5D 2H26A 3VWJA 2WW8A 3W9EA 1J8HA 1QSVA 3HCVB 3EO1A 3RWFA 1JMXA 3L3OA 4UT9L 4DN3L 3O8XB 4M61A 5EZJB 1UKTA 5FOBB 2GAZA 2WMPA 1DCLA 3WHXB 4QO1A 2NXZB 3WIHL 3BQUD 4YBLB 4C59B 1I8MB 3RWIB 3KJ6H 4GKSA 1FL3A 2UYLB 4PY7B 3Q6FA 2GSIB 4TVPE 4NKIH 3JWOC 2P8PA 1YNLH 4Y4FD 4Q2ZA 2MFNA 1R5WB 4QHLB 3X3FH 2VABA 2XPGB 4OCRH 4HBQA 4F7TB 3HNSH 2F54A 3ZE1E 2H2SD 1AD9B 3MO1A 2A6IB 5IGXL 4CKVX 2YC1B 5IMOB 4J6RH 2EDWA 4R7DA 3MROB 3GSVA 3FQNA 2FR4A 4QLRA 1MCFA 3ZTNL 2JIXD 4LGRB 1ORQB 3QFJE 1R5VB 1XT5A 2AI0H 3NPSC 5ALCH 5BZWB 4X4YB 1KB5A 2VAAB 1U8OA 5GGTH 2VL5B 2EIBA 4ZYKB 5JXAL 3HS0B 4HHAA 3VFNA 3PDGA 5IMLB 2PO6C 3QDJD 5F7YC 5I2IA 1SJEB 1MFBL 5E9DA 4M9PA 5E2TH 3TT3H 4PJ8C 4HKBA 3CVHA 2B20A 4KROC 1B0GA 4S10A 3RIFF 5JIIA 1CFTB 3UJJL 1RUKL 4HKZB 3EFFB 2GTWB 1QYGL 1ZLSH 4YR6B 4TOYL 5I75C 2JE8A 4GMSH 4G7YL 1T5XA 3H9ZA 5TFSL 4OGXH 1IGCH 3LH2H 5EC1A 1FNFA 3BHBA 3QDGD 3A6OA 4IEFB 1KN2H 3C60D 2M26A 1NC2A 3P0YL 4U1SA 4RGMC 2Y5EA 2HJFA 2ZOKA 1INDL 4ZPTB 2BRRL 4PRIB 1OAYH 2ZG1A 3SDYL 3H9SB 3MV7E 5HYEA 4PRHA 5I76B 5CGMA 3RVXD 1PQZB 4KTEH 1B90A 2MHAB 4PIRF 1J9CT 5IP4A 4PJBF 4R97B 4I4WB 2VDOL 1M7IB 3E6FA 3M17A 2X1XR 4W6XB 1GOGA 3MRHA 1IC7H 4LBEB 2GQHA 3TA3D 5GGVL 4G8GA 5HGDB 1ZVSB 1TTUA 3B5HA 2NX5D 4P49A 3I75B 1U8IA 2NQCA 4ZNEE 4KKBD 4J3VA 4PRNB 1U9KA 2EH8L 3SCMB 5DDHB 5B3JE 2CGRL 4JFFB 5E6IC 2AXGB 1MUJB 4WI4A 5B8CA 2J6EH 1E6OL 4UI2A 3UX9B 5F9DC 3TZVD 1ZT1A 1ZHNA 1BOYA 1HHIB 1MRDL 4TSBH 3P40A 2CRMA 4J3OC 1JP5A 4LAQL 4TNWF 4TSAH 2VZOA 3WFBH 2ZKHH 2FH6A 3DROB 1F3JA 2EDOA 3LKRB 3ZYOA 4XCNA 4N8VG 2AAVA 5D71H 4QYOB 3TBVB 4XMKL 4MA7L 5KSBF 1JTPA 3DX6A 5MP6H 3ULVF 4V2BA 3OKEA 1I3GH 3AU1B 1T1ZB 3D25B 4LLWA 3FB5A 4CAGA 5ESAA 4URTB 1TMCB 1JGLH 3P30H 2NTSP 2XWTB 5DURD 4Z6AT 4GAJL 1YN7A 3FAXA 2J8UF 1D5MB 3L3HB 1Q0YL 1TPXC 1OCWH 4N90D 2B5IB 4K94H 2VIRB 1IC4L 4OCNC 1D5ZB 3F7YB 4U1JB 5GSRB 2XWBB 1YEHH 5FM8A 4J3SA 3L3DA 2OI9C 3PXHA 2Q86A 5JPNB 3CUPB 2WZPD 2DQGH 1AXSB 3P73A 3G5VB 3T1FA 4XRCB 5CIPH 5D7JD 5EB9A 5CJXC 2IPKB 3QRGH 2F53E 2W0FB 1FL5B 2XIDA 1DUYB 5GZOD 4N0YH 3GNMH 1R3LB 2GK2A 3CLEL 3QXWA 4OCLC 2G75B 5EOTB 1SM3H 4R8WL 4LSSH 4JZNA 1S3KL 5FAAA 2AJSL 1EMTL 5K9KA 4KGJA 3LKSB 4QXUL 1KEGL 1IEBA 3MGOB 4RCAA 4R4BA 3V4UL 1SJHB 4C58B 4UV7H 3GSXB 2XN9B 5BV7L 3ZMRA 5D6CA 1LO0L 5KSAB 3O2VL 3QHTC 3O9WA 3JV0A 3QA3B 4NFDA 4B50A 5D1XD 1NCCH 5H2BB 1N26A 1EERB 4KK6C 3RZCA 4MAUL 5SWQB 4K2UH 4IS6B 4R0LB 2BXYA 1TZIB 2XOTA 4J1UA 4OZHA 43C9A 4BUHA 3V52L 1YEJH 5LCVL 4TVPD 1CR9H 1OTUD 4H88L 4RGOL 1EEZB 3T0WA 5CEYB 3WSQL 3Q0HA 3TBWA 4NKDA 4O9HL 4DW2L 1NCTA 1BX2A 1LDPL 1P6FA 2DQJL 3V4PL 2W1NA 3CSBA 4L3ED 3C5ZA 5F8QC 1BD2E 5HGHB 2EXYC 3S9DB 1IEHA 5CHNB 2XRAL 2BMKB 5BO1H 3WIIL 1EEUA 3QFJD 5AYUH 2AABH 3GUTA 2R39A 4HH8A 4FZ8H 1A64A 2L0DA 1C1EL 5I8CB 3ZDZE 1RJLB 4APQB 3AMKA 4R2GB 4QXWA 4WTZA 5JA9A 1P7HL 4YNYA 4PGDA 3FZUC 4OI9A 4L9DA 4CN6A 4F80A 4Y4KC 5FB8A 4LNVA 3R06A 2VDKH 3GMMA 4J8RA 4AG4H 1QFUH 4PGZA 4Y4HD 3KPSD 5I9QB 1NCDH 4NM4H 5F88B 3EOAA 4RFEA 1RUMH 2EXWC 4I18A 1FNEA 1M71A 1IGIL 2WUCH 1P7KA 2JK5B 4YAQA 2CKBB 2VLJE 1FGNH 3RKDC 3O4LD 3FO9B 1LEIA 4X5XB 1T3FB 2VE6B 4Q9QL 4NKMB 1AJ7H 1UWGH 2WQ8A 4OF5A 3SE9L 4NN5C 4PJHE 5SV3A 5D9SA 4Q0XH 2IBBA 4XMPH 2VLKB 4FQXA 1OWWA 3HG1B 5KW9L 4M6OL 1DSFL 3T0EC 1J5OL 4WRLA 1DVFD 1TVHA 2JB6A 4NUGH 1OSPL 1T5WA 3FOLB 3QEQB 3S98A 2QQQA 1SEQL 3BN9C 3D85B 3K7UA 1T03L 2BY3A 5JOFA 5FGCE 5KTEH 1KLUB 4JG0L 4LOUC 1PW3A 4PREA 4WVRA 1CFSA 3N1MC 3T3MF 1JWMB 4RMQA 5GGRY 1AKJD 1N4XL 2D4DA 4KMTL 2ICEA 3CMGA 3PL6C 4Y1AE 1VADB 1U8NA 1HHHA 4PJCF 4NQSB 2IQ9L 3BKCL 4XXDB 4NQXB 3MLVL 1UM5L 3ARGC 3QI9D 3L3GB 3IF1A 3C6SA 4IRJC 1N5AB 1S9XA 2ZZUT 3A6BL 5I0DA 2OR9L 3CVIL 5BRZA 3DWTA 1ZK9A 4LLQB 1KIPA 3H0TB 5EO9B 1VFAA 4U1MB 1JZ3A 3TP4A 3VD4A 3K2UL 1CLOH 3VWJC 4F3FB 5BMFL 1MLCB 3V8CA 3CMOL 4JZJA 4OGZA 5E95B 1LK3H 5JORB 3FO2A 4JY5H 1JNHA 1EFXA 2PO6B 1WIPA 3NA9H 4XHJC 3D3VB 3B8YA 3SDAD 3LN9A 2Y6SC 4XAKD 5EZIH 4PJ8B 5IBLC 1GPOH 2GEEA 5JR1H 1NFDF 1U6AL 3KYOA 2X89D 2YBRA 5F6HJ 3GSWA 5C0JB 4PJGB 4PJIA 1ZTXH 3HUJB 4JGJA 5KOMC 5I75B 4XBEL 3RU8L 1XF3A 2HFGL 3MACH 2KUTA 3V7MA 2CPCA 4KI5D 1G9EA 5I1GL 4M5ZL 2CLZB 5EZLA 2P7TA 4HPYH 2UV3A 4OUUA 4X6EB 3E1F1 4BFIA 1PSKL 4TNWK 2HTKD 2K1MA 4NO5B 1KT2B 3G5ZB 3GKWL 1Q0XL 1D5XA 2IC2A 4IMKA 1A0QH 2V7NA 3TO2A 2YUVA 3BIKA 1GAFH 4E41D 1XMWA 3U4AA 1KXTB 12E8L 4H5SB 2X4OB 1N3NA 4E5XA 4CNIA 1N8ZA 2YD1A 3G04A 2JKXA 4EEEA 4JRXD 3H2WA 3B9AA 2IAMD 3QH3A 4FZEL 4JR9H 1A6VL 4KJYB 4RISL 3VE0A 5J1TC 3SQOH 1E28A 2UUDK 1CDJA 3EO0B 4OB5H 4FTVD 1JPFB 5E6IB 4NWTL 1WBXB 4IOFC 1JE6A 2F5BH 3O3UN 1X6NA 4FXGB 5ICZA 1HKLH 1RZKH 4ELMB 3L5XH 1YQ2A 5FGSA 4X5WB 5GRJH 1LD9A 5SWSB 5I8OL 5JNYA 2VUYA 2IPTH 1VACA 4DVRL 4I2XA 4FXKA 2ZPKH 1FBIL 2DKMA 3QUXD 1NCAH 2ADGB 1U2HA 4YQXH 2GY7B 1QFWH 4AIZA 2A6DA 4X7DC 1VGKA 2YA2A 2ERJC 1VFOA 2VDNL 3VGGA 4I0PB 5A2KH 1NAMB 5T1MB 2BP3A 3NIGE 3MRLB 2PYED 3PNWB 1ETZB 3QUML 1DBAL 1VEOA 5F1NA 3KS0J 3PABA 4FG6D 3ECBB 1IGTA 1QLRB 3O6KL 4G7VH 1QFPA 2DN7A 1JN6A 3KYNA 1EO5A 1BD2D 4KQ4L 3W5NA 4PRIE 3FTGA 5JZ7C 1QRKA 3H9SE 4F7EB 3MV01 5B8CC 4BSVB 1K4CA 3LKQB 4ZS6C 4JM4H 1JPSH 4N8VB 3Q3GA 2ZUXA 4R7NA 1NGWB 3UTOA 3BP5B 1ROWA 2RGSA 1MNUL 4NO0D 2OI9B 3IFOB 5EU4A 4UTAL 3TYGH 4TUOB 4TQEL 4P9HH 3GMLB 3X3GL 3P4NA 4YHKL 1Q94B 4MB4A 5E4EB 4F7MB 2IADB 1WBZA 2NZIA 4MSWB 1MJUH 3IFLH 1I7RA 4F33A 4Z7UF 2FATL 4PY8J 3TN0B 3VXMD 5CKAA 4LP5A 4HZAA 1ZA3A 1RK0B 4JFFE 2VDPH 5GGQL 4YBQC 4CGTA 2V5YA 2M2DA 4DN4L 2HH0L 1KV3A 5C09B 4Z7VF 2VLJD 5FGBA 4GOSA 3TJEH 3LKOB 4MAYC 4HBCL 1MHHB 4XCFH 4ZO9A 4EIZC 1FVEB 3NTCL 5FECB 1XF1A 5LGKA 3EOBB 4I3RL 4EUPB 2A6KB 5K9JH 4L8SA 1P1ZB 3RPIA 5JXED 3LMJH 1FO0L 2DF3A 1NL0H 3PGFL 1SEBA 1QFWI 1DN0A 5TF1H 3LB6C 3RWEB 2F74A 5FDWA 1PKQB 3O3AB 1MAML 1MLBB 1P7QB 2BFVH 1PDKA 1FRGL 1WITA 5L2JB 2XWJA 4QOKB 1YPZF 2ARWA 3WXWL 1IQWL 3VWKA 5DA0B 2R2EA 3S88H 1BAFH 1MOEA 3ULVL 2X1QA 4WCYH 1YYLH 2C1PB 2P5EB 5GRVK 4GUPA 3OX8A 3RVTC 4NDMA 5K9OB 1Z5LA 2CR6A 1PG7W 5SX5H 4CADA 1RJZB 2AEPH 2J7LA 3BE1H 2BHYA 3GRWL 5J9PB 3GGWA 1MCQA 1X5LA 5IKCB 1BQLH 3D39A 5DZLA 1MRCL 1T1WB 5HDBE 2QQLH 4QXTA 5D4QA 4XNXH 4WW2F 3PWLB 1IGJB 4M1DL 3HI5H 5D93B 1UB6A 3O9WC 4YHML 1PD6A 5D5MF 4N0UA 1S5IL 1J1OH 5DZOA 4UDTB 4NPYB 4Y4KB 2QTEA 4WUKH 2WIIB 4YHYB 1EEYA 2UY7A 2MJWA 3OKLA 3QUKA 2BCKB 2YN3A 3BH8B 3TJHD 5BS0A 1AQKH 2DI7A 5CBAA 4NNPL 5D7LA 1WWAX 2NR6C 3JV6B 4CMMA 1TCRB 2BSTA 4L4TD 1J7VR 2JTDA 4HIJA 5MEND 3ARWA 4N5EC 5EIQA 1IJ9A 3VFSB 3C5ZC 3SY0B 1MH5A 2PN5A 2XN9E 3DVGB 4G6MH 1T04A 4ZFGH 3VXRE 4LPTA 5E1AB 3FFCA 3T0EB 4YJZL 5IEHB 4HUUB 3DYOA 3ULSB 5C70A 2E6PA 2NXZD 4QTIL 1XGPA 3WCYA 2DBJA 2XXCB 3KDMA 1S5HA 5LBSL 1MREH 2IAND 1H0DA 2CUHA 4JQIH 2DQFB 1KULA 4QRUA 3PL6B 5I1CL 3QO0B 5CJ5A 1Y18A 1EVTC 5DUBB 4FMKA 4RQQB 5ACLA 2F5AL 2OP4L 3ARGB 3QUZD 3STZB 3REWB 4NQED 5IIEB 3J8F7 4LF3A 2WK2A 5D7IF 5IFJB 2KZ1B 1CLYL 4JAMB 2B4CL 4KTYA 1PG7X 4NQUA 4P9ML 3TH3T 1ZXQA 3MRGB 1YEFL 3QDAA 3DETD 4HDIA 4FQXC 3TV3H 5LQBL 3W0WD 1IKFH 1AC6A 3KG5A 4LK4A 4PJ5A 1F13A 3L3OB 5EIVA 5J1AA 5I18L 1ND0A 4YHNA 5GJSL 5E00B 4JGUA 5DFTA 2OXHA 4JPWH 4XC3L 3VXPA 4MQTB 1CFQA 4KKCC 3O2DA 9CGTA 5M95B 4GRMB 2D4FA 1YQVH 2LU3A 1S7XB 5EFIA 3KLAA 4NT6A 3QG6A 1FL3B 1OARH 4QHUA 1U91B 3GBNH 2EDKA 3OKKA 5LXGH 4Q2ZB 4Q6IA 5CCKH 2VABB 4S11A 5D1ZB 3QPQC 5F9WC 2I60L 2EH7L 3ULUC 2VLKE 5D2LA 1LO4H 5C92A 5GJTH 3G5XA 3HG1E 1GHFH 3MYJA 5L6YL 1JHKL 2ITCA 3QFDA 2OJEB 3GSVB 1QLFA 4PRID 5DVMA 1XF2B 2SEBA 5C2BH 3QEQE 5KS9F 2KDGA 4JZJC 1H8OA 1CXIA 1T7YA 4CMHC 1AGCA 4HHAB 3VFNB 4RAVA 5F1KC 5EU5A 3ZE1F 3G9AB 1BOGA 1DQJA 2FEDC 5E9DB 4P23A 4KPHL 4QHMA 4PUBH 1BWMA 1DUZA 1LK2B 5IT2H 4ACPA 3WFDH 5JHDA 5HHQB 3DSFL 4TUKL 3QULA 1I75A 1CDGA 1F90L 1T7WA 2QHRH 3KPOB 1H8NA 1F97A 1WC7A 4NCC2 3SCMD 5A3IC 3OKDA 1RULH 1JNLH 1MFDL 2G2RA 5CIPB 5I19L 4N0CD 5EC1B 1ITCA 3GHEL 2E9BA 1R3HA 1DBML 3AFLA 4Y16A 5C0NC 4Z8FL 3V8OA 1CBVH 1EO8H 1NC2B 4WU5A 2Y9RT 4U1SB 3JTTA 4YX2H 1FN4A 2CIKA 2I24N 3TPKA 3TPUA 5CEZH 1M1SA 5HI4C 4PRHB 2Q1EA 4HD9A 5T1KB 1KTLA 2PETA 4OZFH 4IMKC 2DD8L 1F11A 1IAIM 1HH6A 5HI3C 3UROR 4PJGE 2V2XA 8FABB 3M45A 3HUJE 3DV4B 2VJXA 3E6FB 1DQQA 4WO4A 5DUPL 3IDJA 3M17B 3D2UD 3MRHB 2W59A 2ERJB 4LCUA 3WKMH 3GIZH 4X0KA 3ZKNC 1U8JA 4KHXL 4YLQT 3V5DA 4XP9H 2D7QA 4LIQH 1ZS8A 5CBEB 1U8IB 4P2QA 4XH2B 4KRMB 1MWAA 4ZUWA 2HVKA 3WLWC 3N06B 2BY1A 1Z3GL 5TQ2H 5T33H 1JYNA 4U2ZA 1BJ8A 4UOJA 4XVUD 4JQVA 1ZT1B 4FFZH 3NABH 3MRCA 3SE8H 3R1GH 1VFBA 3CH8A 3O6MH 5F7DA 4M6MH 4YE4H 2YWYA 2CK2A 5B3JF 3C09C 4JRYA 1ERNA 4DKEH 2AEWA 4MB3A 4WFGE 4OM0L 4PRPA 4XTRD 1DBBL 1X6LA 3IJHA 5EDXA 4PP2B 3KYMA 3VFRB 3CFJA 4O5LL 3F7RA 1FV1A 3IU3A 1KELL 2VXQL 4LLWB 5ESAB 3VXNA 4ELME 4MAYB 4MDIA 5F3HA 1UEMA 2V9QA 2A77H 2YKLH 5FK9A 3T0BA 1HQ4A 5FUOL 1FORL 3E6HA 3OAYH 5CUSH 5SWSE 5IV2A 4GRWH 3FRUA 2XN9D 1DJSA 1AHWA 3QEUB 2CDFB 3MJ7A 3QRFM 4OZGF 3SKMA 1CGYA 2HAZA 5I6XC 1A14H 3L3DB 3UJTH 2G60H 4EQ3A 4HJJH 4R90L 1AXTH 3QUYA 2DTMH 3EDDA 2Q86B 1Z0MA 2DQDL 4GRLA 5ETUA 3IFPA 3WO4C 4K23L 3LV3B 3U9PH 3BPCA 3UP1A 3T1FB 5JIHA 4TRPH 1BHGA 4UV4L 2BX5A 5ENWA 4OGYH 5CWSA 1L6XA 1RZJH 1XR9B 4ZFZA 1H3XA 4JANB 1HSAA 1T6WA 4M5YH 5IJKA 2BNQA 1AI1L 1N0XL 3P3YA 3VD5A 4FABL 3ILPA 3KPNA 3HNTH 4K8RL 4CVWA 2EDNA 1KXQE 4NBZB 5DK2A 4UNTA 1KGCE 1XFPA 5K9KB 5KN5A 2CRIA 4BSWA 4QWWD 2AJYL 3BIBX 4BQ8A 4L8SC 4R4BB 2BNUA 4R2GD 4AYFA 5EU3A 3IDNA 4ZAKA 1CTOA 4YXHH 4UINL 3O9WB 3V0VA 3GB7A 5JOPD 4FNLL 3S4SA 5EU7C 4N68A 4G9DB 2FBJH 3PIQA 1K3IA 3UTQA 4HIXH 4Z9KB 1EHNA 2MMXA 3QHFL 4NGHH 3VWKC 43C9B 4HGKC 5C09E 3S7GA 3L7FA 2AJ3A 1CFNB 1ZLVH 5GS0L 4G6KH 3OB0H 1FPTL 3WXVH 4PLKC 3BYYA 1KB9K 1XCQA 1KPRB 1MHCA 1KJ2A 2QQNL 3VFTB 3DI2B 5I16B 4XPTH 3DRQA 3D0VA 4JO4L 1YMMA 5HPOA 3BMVA 5DJAB 2XKSA 5IROA 3TVMA 2YPKB 1PKQE 3QEQD 5TPWH 4Z76B 3D85D 5IVXA 3K2MC 3VFUB 4QOKE 2J8HA 2Q3ZA 2PF6A 4YNYB 1XIWA 4PGDB 4Y5VA 5M7QA 1N5YL 2HRPH 4HJGA 4YHLL 2Y72A 3FN9A 2ZSVB 1NGXA 3FO0L 4NN6B 4DUWA 2P5EE 4HUVA 2FGZA 3R06B 4B0MM 4J8RB 3LS5H 4X6DB 4FFWC 3ZKXC 4LLDA 5F1OB 3EYQD 3GSNL 1T83A 4P46A 4RFEB 1FNEB 2I9LA 1TLKA 1KLGA 4LSPL 2HVJB 4U3CA 4A6YL 1BP3B 4LKXA 4XP5H 5SWZA 4CN1A 3V79C 3MRRA 3T4YB 1F3DJ 4OZFG 3O2WH 5D9SB 4FQXB 3U7YH 5JW4M 3KJ4C 4NKOB 5IBUG 3B3IB 5CFHA 2WBJA 5DSCB 1T1YB 5IB2B 3D3VD 1UWXH 2OR8A 5CEXA 3QEHA 1J8KA 2C3VA 1QG3A 2JB6B 4ODWA 4X4ZA 4S1DC 4DFHA 3VRIA 1UYWH 4PREB 1M7XA 4OIIL 4PJHF 3MUGA 3WDHA 5I71C 4FQQB 5HYQB 1GGCL 1NQBA 2DQHL 4QRPD 3U36A 2R1WA 2ICEB 2OZ4A 2YA0A 1CGXA 1CTNA 5FYJL 3EYUH 4P2RD 3RVWC 3C6SB 4YFLF 1MFCL 1OGAA 3U0WL 4LSVL 5AZEH 1B2WL 1WF5A 5A2JH 5BRZB 1BPVA 3T0EE 1KIPB 4MNQD 5T3ZE 2OSLA 3FMGL 4P5TD 4RGND 5T3XL 1YEIH 3DVIA 3PG2A 2V5RA 4EZMA 3GSOB 4JZJB 4CMHB 2X4UB 1GGIL 3FO2B 4F57L 1IL1A 1MCLA 1CQKA 4GG6B 3TWCH 2VKWA 4JFXA 5GS0D 4JREC 5C0FA 4HLJA 1U8PA 2B1AH 3VRJA 1ADQA 2VKXA 4GSDH 3I6LE 3P4OA 1KEMH 3MJGX 4RIRA 3ZDXE 2FX7H 4YHOH 1FNSH 3GSWB 2R1XB 3KLHC 1IVLA 4PJIB 1A1MA 4UBDD 3K81A 1FNHA 2C3WA 4DAGH 3UTZA 4M9OA 4OTXH 2WQRA 5DD3H 1MQKH 4Q6IC 1KCSL 2GW5A 3IJSA 1B6DA 3HZYA 2R8SL 3DTXA 4UT6H 3SJVD 3W11D 4D3CL 1F42A 4KVCL 3ZYZA 4G6JL 4JPVH 3HMXH 4M7LH 3TBYA 4ZUTA 1RSFA 3V0AC 4HUWA 3KJ6L 4NWUH 3LHPH 1TJGL 2GJ6B 3MCLH 4I1NB 4U0RB 4U33A 4BFIB 2MCPH 1YNLL 4P57A 5I1DA 5BZDB 1YUHA 2H2PD 1IM9A 5IB5A 5GHWH 3HNSL 3D69B 5DHVA 3MUZ1 3TO2B 3BIKB 3ESUF 4N8CH 4RFNC 4I0PD 3FT3A 5IHBA 1N3NB 1S7SA 3NIFE 3U46B 1FH5L 1N8ZB 1F4YL 4OZIB 3G04B 1W72L 3GJFA 5E2WL 1PVHA 5ALCL 1FIGH 1RUQL 3VE0B 4HC1L 3H7BA 5DUMH 4L5FL 5EORL 3BGMB 5DQJA 5AWNH 3OTTA 5FGRA 4U2YA 4OLYL 4I13B 3DYMA 5E2TL 3TT3L 4OQTH 4FFVC 4WI7A 4Y16C 4IHOB 1HOCA 2LAGB 2QR0A 3BKYH 2AJUH 1MCRA 1A7PL 2D03H 2MQ3A 1XCTA 1E4KC 4G8EA 3RTQA 4KK9C 5HVFB 2NNAB 3KPRD 2EYTB 2Z35B 1ZLSL 5E9DE 2XZCH 5JNYB 1NCBH 1A5FL 2NCMA 1CXKA 5HI5D 4OGXL 3C09B 3LH2L 1W8NA 3WIFA 2IJ0C 3T2NH 3TN0D 1KN2L 2OXGA 4OLXL 3KYAA 4WNQA 4WO4C 4GAFB 4AIZB 1KIQB 1VGKB 3RKPA 5FHBH 2DJSA 5T3XD 5KVGL 1FVCA 1U8KB 2X6MA 5E8OB 3W39A 5F1NB 5HHOD 1IGTB 5DWUL 2W9DH 4NP4H 1IZJA 3F12A 4PR5A 3WKNA 3C2SA 3LEXA 4AENA 3H6JA 3KYNB 4I77H 5JO5A 4KZEL 3FTGB 4XVTL 4UOW1 5DVNA 2W92A 4JZOB 4PRHE 5A16B 4HJ0D 4EDWL 3WE6A 4JQVC 3OKOA 5IFHH 3EJZD 3NIGF 1TQBC 3H42L 4U31A 3CVHH 4GAYA 5EU4B 2Z92B 1F4WH 4QOKD 4HWEH 1ZEAL 1WCBA 3WO4B 2FYYB 5IB3B 5ALBL 2VXVL 3IDMB 4KWUA 3X12A 1WBZB 2P5ED 2C4XA 4PJDA 3RGVA 3L5WA 1WAAF 2J6EL 3UBXI 1QA9B 2R0LL 4F33B 5MEQA 4X83A 4Z95H 2Z31B 2MOVA 2VC2L 5BVJA 4E0RA 1CIUA 4Z0XB 3DX8A 1S9WA 4TSAL 1KTRL 3IJYA 1I7UB 1CD8A 1FYTA 4H1LH 3RWHA 1L6ZA 2X09A 1MI5B 2FECI 3MV9D 1T66C 5F3BA 5I30L 3MREA 4I8DA 4KXZH 4PJAA 5D71L 5HGAA 2BSSB 1AHWC 3AS2A 1OM3H 1N6QL 2NXYC 1JPGA 3LQAC 4NO3B 4U7SA 3DMMC 1SEBB 2WSKA 1DN0B 2YWZA 1IC5L 1A4JB 2ZUSA 4GW1A 3H9YA 2F74B 3VI3F 4IRSA 3KPQB 4GRLC 4M1CC 4HUKB 1OP5H 3LPGA 4WI5A 3U30B 3LY6A 4GXVL 1OCWL 1FG9C 4K94L 4AL8H 2VZUA 3BVNA 3HFML 4B5EA 5EO1A 4LPYA 4U6HA 5DD1H 1GSMA 5E03A 5C0AB 5D2NB 3OX8B 3RVVC 3HE7B 5IJKC 1A3RH 3BQUA 4LLMA 1P4BL 2W0PA 1PG7L 4LNRB 4KUCD 5LVEA 4CADB 1ZHLB 4Q9BA 4AMKH 1R24B 4Y4FA 4HG4K 3VXQA 3GGWB 1U8LA 4ELKA 5C0GB 3KLSA 25C8H 3U1SL 1JV5B 4ORGA 4QXTB 4MQXD 4X6CA 2E8ZA 4UUJA 5FKAA 5EUOF 5DJYA 1MAJA 2Z93A 4ZUVA 3HI6H 4HW6A 4M43L 2H1PH 4N0UB 1XF4A 4WFFE 4LSSL 5L9DH 1Q9OA 4WDIB 5EULV 3QDJA 1A1OB 2HRLA 5HDBF 3ZKXB 4U1KA 4W4OA 5CBAB 3MOQA 4UV7L 5D7LB 3CFKB 4KXZI 3P9WB 1U3HD 1IGFL 2X2YA 1MCDA 5FIEA 5B4MC 5DD6A 2WNGA 2EZ0C 3ZKSD 1SBBA 3IDXH 1MH5B 5JW4Q 2PTUA 1KACB 2F15A 4Y5YA 5F6HI 1G7MA 5IROC 1J0KA 4QHNA 3X11B 3TVMC 1YEJL 4JKLA 1J05A 2PW1B 3QDGA 4ZXBD 4MMZC 3QQ9D 2BSED 3C60A 4V1DD 2J5LC 3VXSB 2BNRB 1A6WH 1XGPB 4ZQKA 4F58L 1JGVL 1XIWC 2V9RA 3DURA 4Y5VC 4PV8B 5I71B 3UBXG 3X14B 2RAMA 3X13A 3B8SA 5BO1L 1G7QA 2HWZH 5FXCH 3NCCB 3ZZ1A 1TZGL 1JWSA 5D1ZD 5A2FA 4G5ZH 5AYUL 2AABL 1KIRB 1FC2D 4P46C 1ZGLM 1T83C 4FZ8L 3BZ4A 5IBUB 3OHXA 1WEJL 2JCCF 5DFVD 4LF3B 3GEWB 1DQDH 3TA3A 3UJIH 3G6JA 5C9KA 3DBXA 5IR1A 1W0VB 1EBPA 2NX5A 4Y19B 4HDIB 1LP9A 2VWEE 5F44A 5HVHB 4J2XA 3OKNB 5DMKA 1JF5A 1QFUL 4ONFH 1BZ7A 1NCDL 1ONQA 3JZ7A 3VDAA 1RUML 2Y25A 2XFXA 2WUCL 1ZGLB 2O5ZL 4X6DE 1G0XA 1UWGL 3NIDE 2VMFA 1VGEL 1HHKA 2RB8A 3TZVA 2KQNA 4YFEA 4TNVK 3NFNA 3G08A 4QHUB 3QHZH 2V9TA 4UIMA 5HDQL 4Q6IB 5F9AC 2NTFA 1OGTA 2NW3A 2NLJA 3IS0X 4NUGL 3F6IA 5CZKA 2EIDA 1HQRB 1X5XA 1U58A 5D2LB 3QXAB 2RBLA 1MHEA 2ITCB 2ZSWA 4LSRH 1AC0A 4R4ND 5T1KD 5I17B 5IM7A 4GLRH 1BFVH 5ABDE 2RR3A 4LCIL 4RAVB 3NA4A 4M48H 2BDNH 1RK1B 4GRWB 2OL3L 2N7BA 3RX5A 1DQJB 1ZV5A 2B0SH 1V7NH 4RFNB 5D72H 4F7PB 2APVA 4XNMB 4GXUM 4H1LG 5DT1H 4HCRA 4CJ0A 1MCEA 4NC2B 4QRRB 4N8PA 2MSPA 3MBEC 1OP3H 3ULUE 4P2OD 1LK3L 2WP3O 4OLVH 5BRZE 4JY5L 1RVFL 4OD3L 3DX7A 3NA9L 2CXGA 1UENA 4HV8A 4NHCH 4XP6H 1F02I 4Z7WF 4LCCA 5IW3A 5D7JA 1CD1A 4ZS6D 4HXBH 5GSVA 1LEKA 4WU5B 4PY8I 4GG6E 2H3NA 1N64H 1ZTXL 4CVXA 1IQDA 4YO0A 1OAQH 3K1DA 4LMQE 3GO1L 1QR1A 4NFBA 3DO7A 2ATPA 1A6AA 3MACL 1M05B 3TBSB 1KTLB 1OAUL 1F11B 3TFKD 4YHPA 1F3RB 2V2XB 1MCHA 4PJIE 4WGVB 4XBPA 3LEYH 3JWDH 4YC2C 1DQQB 4LKCA 1G9NH 5DC4B 2EDEA 2X1WL 2GYSA 4PGBA 4LCUB 4X0KB 2OTWA 1U8JB 5DO2D 4MAYD 1A7BA 3V5DB 3QWRD 5DRXA 1A0QL 1NBYA 1UJ3A 4GLRI 4WY7L 2GJ6E 2AP2A 2FB4H 1CT8A 2YD7A 4BKLB 4WHCA 2D2OA 3VG9C 4WFHE 3RTQC 5C0BD 2P42B 1TQBB 4JR9L 3S34L 5IF0B 1EJOH 1DFBL 2UY6A 3V5HA 1A47A 2A74B 5SX5K 3LQZA 3WL9A 4OB5L 3JBG7 4HIIA 4WFFD 2AJXH 3QFJA 3WJLA 3B9DA 4PGJA 2F5BL 4RMRA 3ROLB 1I1AA 5EPMA 1MCWM 1S78C 2AXFA 1HN1A 5CJBA 3U0TA 5T1LD 1WLHA 4JFYB 5GRJL 5ITBH 3CFJB 3FQWA 1L7IH 1EEQA 3IU3B 3S5LA 4PRBA 2FNBA 2CK0L 3OF6D 3VXNB 3PHOA 5JTWA 3MLTA 3ALXA 5D1QB 5JXAH 4Y4HA 3KPSA 5IB4A 1RZ7H 1UH2A 2WBWB 5L7XL 3E6HB 3OKYA 2BHUA 3FRUB 4YQXL 1MFBH 1QFWL 5AD0A 1V05A 4U6XA 1QSZA 3ALPA 4UQ2B 3O4LA 5GGSA 2FX9L 4X6BA 3TNMA 3Q2CA 3UJJH 1RUKH 3DMMB 4HIEA 1IEAA 1QYGH 1BQHA 4TOYH 2PR4H 3IFPB 2GITA 4G7YH 3ARYA 3PWNB 5TFSH 1FAIH 4IBLT 5D96C 3STLB 4FQHA 2B1HH 3SDXF 3RGVC 1DVFA 4MQSB 4YGVB 3MV7A 3RY6A 1JPSL 5ENWB 2RFXA 1D5BB 2EDTA 5CWSB 5DC0A 3MQIA 4DUVA 3L5HA 1CE1L 3IGAA 1INDH 3TYGL 1AKJA 2BNQB 2BRRH 5FKPA 4HLZH 4P9HL 1BFOA 3SDYH 1LO2L 5DK2B 3UYPA 2DJUA 5FA3A 1VCAA 5DJ0A 1UXSA 1HXYA 5MEOB 5KN5B 3AREC 3PXJA 3PDOB 3IFLL 3QI9A 4BSWB 4WI8A 2BRQA 3BRGC 5CZXC 4M93B 3RL2A 2PW2A 4ZNEA 3AS0A 4H8WL 1EJ6A 5EU3B 5DJZB 3OGCA 1HIML 1NCWH 1AR1C 6FABL 3V0VB 1EHAA 3GB7B 1BJ1J 4ZD3L 3TJEL 4BM7A 4IRSC 4XI5C 2D0HA 4NM8H 4XCFL 3VU2A 5I1AA 3DGCR 4OI8A 1H3UA 3PIQB 3N1FC 3UTQB 2EH8H 1EZVY 1XZ0A 4NZDA 5HHMB 1K9TA 4PTUA 1WZ1H 3MJ9A 3SDAA 4WU7A 3O4OC 1INQA 1MI5E 5IB1A 1NLDL 4KU1A 4QF1A 1NBVH 3HPJA 3BQUC 2A38A 3QDMD 1MRDH 2X89A 5DTFA 3DSNA 2KZWA 5FYKE 2EO9A 3Q5OA 2BFVL 4LAQH 1MCKA 4HK0A 3D0VB 3MSPA 4Y4FC 1LE9A 5MERA 4XGZB 5HYJD 4EN3B 2E9JA 3S88L 1BAFL 3BDXA 4WCYL 1YYLL 2H2SC 5EU7E 4K3DH 3H7LA 4MA7H 1HHGB 5AZ2L 4XBGB 3I6GB 2LTQB 5AAMA 4PG9B 2EEBA 3U7AA 2RIKA 4OKVB 1Q9KA 2NY0D 4OCYH 4HJGB 2DI9A 1CS6A 1NGXB 2NPLX 2FJHA 4PP1D 4KVNL 3EOTH 1QSFB 5IMMB 2AQ2A 5C0AE 3SGJA 4GAJH 3VFMA 3QNXA 5D2NE 1BQLL 1Q0YH 1TQCB 5EBMB 5DRNA 4XNXL 4P46B 1IC4H 4E41A 3HI5L 1KCLA 2V6HA 3BN3B 2I9LB 2VQUA 1FFOA 1I1CA 1MCOH 1UVQA 4QRSB 1C5DA 3BPNB 4U6YA 3O3BA 2EEDA 3GMRA 4QCIB 4JRXA 2F53A 3O45B 4BQ9A 2YSSA 3MRRB 4Y5XA 2IAMA 1JF6A 1QVOA 5DQDL 4PV9B 1W2KT 3VXUB 4LARL 3UBXB 4FTVA 1S7UA 4N0UE 1LO5A 3QEHB 4LCWD 3SN6N 4A2LA 2IALB 3C60C 5KVEL 3HRZA 1SQ2N 2DQCL 1Q9LB 3VRIB 4LEXL 1PAMA 5BS0E 1WCQA 5I66A 5D7LE 3MUGB 4KJWD 3L9RA 4G6ML 15C8L 2YXFA 4R8WH 2P48B 1S3KH 3RVXC 2AJSH 3A0OA 1EMTH 2QEJA 3MMEA 1E27A 3V5KB 1KEGH 1KC5H 3RUGB 3C6LB 3V4UH 3N1QC 3CGTA 1LWRA 3QUXA 4DKFL 5BV7H 2R4SL 3T2OA 3IVKA 1LO0H 2J12B 3OKMA 3O81A 2GJ6D 1MREL 3REVA 3TA3C 1LEGA 1D6VH 3QO1B 5TDNB 5BQ7B 5IVOA 2OSLB 2PYEA 3ZL4L 1AGEB 5C1MB 3THMH 3HC3H 1IGML 1VPOL 2O26U 4KKBC 2BNRE 4WFHD 3GBML 2E27H 4FQLL 4YDJA 3V52H 1BD2A 5LCVH 4H88H 4RGOH 1DZBA 3WSQH 1B4JL 1G6RL 3VXTA 1SYSA 3TZVC 3ARFD 4DW2H 5I1IL 1LDPH 3P4OB 3V4PH 3B6SA 4RIRB 3HR6A 4NO0A 3PWUA 4UTBH 3TV3L 3FB8B 4UNUA 3MBEB 2DDQL 1A1MB 1VSCA 3AUVA 4R3SB 2XRAH 3MBXL 5ERWB 5GS3A 3WIIH 2FIKB 4LFHG 4OD2A 3DTXB 4Q6YA 3RZWA 4Y19E 4JDZB 1C1EH 4LIQE 3UAJD 3VXMA 4MJ6A 1YQVL 4PJ5E 4RNRA 4ZUTB 3ZDXF 2VN4A 2A9MH 2VLJA 1QEWA 4P57B 4H1LB 5TF0A 5LXGL 4F37F 5CCKL 2ESVB 2X4QB 1U8MA 4L8DA 1PBYA 3QNYB 5IB5B 4ZPVA 5DHVB 5IEKA 1OF2A 4MA1C 1IGIH 4DQOH 3IAPA 3OAYK 4ENED 4MWFA 3MRFB 4YC2B 2A83A 3NFPA 4CL7A 3CH1A 4RRPA 3FT3B 4Q9QH 5C2BL 1S7SB 2RHEA 4RX4D 3SE9H 3SE3A 4AZ8A 5D2LE 4M6AA 5DEGA 4HGWA 5KW9H 3P9LA 1NBZB 5I8EA 1DDHA 5DQJB 4G42B 1J5OH 4GKNA 4MNGB 4LCCC 5H8DA 3SKNA 1BGXL 3AC0A 5D7JC 1FLTX 1OSPH 1BLNA 4HT1L 1BBJB 1MCNA 1HOCB 2FRGP 4UB0L 1JRHL 1T03H 1GXEA 2QR0B 5GZOC 1T80A 3NIFF 2CKBL 4PPTA 3RTQB 4GRWE 3QB7C 2QHRL 1I4FA 1N4XH 1HYSD 3MRJB 1KPVB 3H9HA 1RULL 3OQ3B 5F7KC 3ARDA 1NFIA 2IQ9H 3BKCH 2VQTA 4QRRE 5F6IC 1UM5H 3MLVH 5DJXB 1KSRA 2YZ8A 2Z9TA 2Z31D 3A6BH 1CBVL 2O61B 3EJJX 2OR9H 1EO8L 1UM6H 2DAVA 4WNQB 5IESL 1P69B 1I1YA 3CVIH 2A0LD 2CDEB 4CRPA 1EVUA 5D1XC 1WFNA 3K2UH 4UDUA 1F3DH 1R3KA 4CU8A 1MI5D 5BMFH 1AGFB 1ULVA 3I3BA 3CMOH 3UCRA 3V2AR 3KXFD 3KVQA 2ENYA 2VDQL 1UJ3C 3C5SA 1IM3A 3JWOL 4PR5B 1FE8H 3LEXB 4AENB 2CO6B 1OTUC 3CFBA 3ME0A 2ZCLH 2VZ3A 4L4TA 1A1NB 4DOHB 1ZLVK 3OB0K 1U6AH 2IH3A 3WE6B 5MENA 3OKOB 1GZQA 3NCJH 4XP9L 2QKIB 1IZKA 2KBGA 2XG4A 4GAYB 4EXKA 4M03A 3VXOB 3PWPD 5CS7A 4XBEH 2DLTA 1FZOB 5D96B 3WJLC 4Y2DD 4UQ3B 2VSCA 3NACL 3X12B 2BVTA 4PJDB 4H26B 3WHXA 3RGVB 3PWVB 4M5ZH 1EXUB 3HE7D 1I8MA 2ICWJ 3NABL 5TJWK 5IWLA 3R1GL 2UYLA 4PY7A 5F7EH 3DX8B 4HWNA 3O6ML 1PSKH 2IANA 1AD0B 1I9EA 4M6ML 3MTRA 3RWJB 1R5WA 4QHLA 3RWHB 2XPGA 2C7UA 4Y4HC 4F7TA 4DKEL 1ZANH 4JFED 1AD9A 1JTOA 5F3BB 3MREB 2YC1A 5IMOA 1MFAL 3AREB 5HGAB 3D48R 4OCXL 4NQEA 5E7BA 1N7MH 4JRYE 4YGAB 1R5VA 3HA0A 4DZBB 3BPOC 3DRTB 5BZWA 4X4YA 1K6QL 4U6VL 4GW1B 1BM3L 4FZEH 4RISH 5ISZB 3HS0A 1G7LA 2D7NA 2J1KA 3CU7A 4AEIH 3P9MB 2ZNXA 1DEDA 5CUSL 3RWDA 1KTDA 3WHE0 1DVFC 1MWAH 1UWXK 1CWVA 3RY6C 5EO1B 1RFDL 3O4OB 3S36X 3UZQA 1CFTA 2R15A 3IETB 4HKZA 4HWBA 3RGHA 3WV0A 5IMKB 1P6AB 3UJTL 2G60L 1EFQA 2GTWA 4LLMB 3AMLA 4YR6A 4X4MA 3H3BC 3G9VA 3NH7H 4Y4FB 1UQSB 3AROA 3VXQB 4NQVA 1E0OB 3KLDA 4ONOA 4TRPL 1JTTA 4KGLA 1FBIH 3VXSD 1RZJL 4ORGB 2BNRD 2BVUA 1IE5A 4UUJB 4X7FC 4RBPH 5DJYB 2YD2A 3PV6B 4ZPTA 2VDNH 4K9EC 2DWEB 4P4KB 4ZUVB 4PRIA 3H9SA 2JIXB 3IRZA 3QUMH 5CEZD 3UTTD 1S7VA 1DBAH 5I76A 3HNTL 4HX1B 1PQZA 2QV2A 2QSTA 2MHAA 2VOTA 3O6KH 2FLRT 1VERA 4HPOH 3CSGA 3QDJB 4KQ4H 2BNQE 1FP5A 3SDAC 1G7HA 4LSTL 4LBEA 3B2VL 3CLFL 5C0EA 5HGDA 1CL7L 2W9EL 1ZVSA 4PG2A 4CU6A 4Y19D 4RDQG 5DHYB 4PRNA 4TQEH 3RWCA 3SCMA 2A1WL 3X3GH 4NGHL 4YHKH 2AXGA 5TQ0L 1CXLA 1MFNA 4QHNB 1MUJA 4WIQA 3LD8C 4KI5C 5JW4R 4G6KL 2HTLD 3QDGB 4DGYL 2FATH 5D70H 3C60B 4YDIL 1QACA 3WXVL 1HHIA 1AIFB 4XCYB 2B2XL 4ZQKB 5HHME 3T04D 3CSPA 2HH0H 4DN4H 3EDKA 4DGIL 4G43B 2HTKC 4TVSa 1YY8B 4HBCH 4Y2OA 3SGJC 3MRQB 2K9UA 3LKRA 3MUJA 1A3LL 3NTCH 3C8DA 4HEME 4QYOA 3TBVA 1YY9D 3ZLQC 4XNZB 4I3RH 1Y6NR 3MLYL 2V2TB 3BZ4B 1WFTA 5HDLA 1FO0H 3AU1A 3D2UA 4OZHF 4WFED 2IBZY 3SEPA 2UZYB 1JF1A 3TA3B 4DWHA 4Y5XC 2IAMC 5IR1B 1MAMH 4N0FA 2XWTA 1X4ZA 1V3LA 2EDJA 1D5MA 1LP9B 3OJVC 1JHLL 1FRGH 5HPMB 2EDYA 1BZ7B 3WXWH 1QR4A 1IQWH 3E8UH 2QHLA 4GW4B 1ONQB 1P2CA 4KRPB 2VLLB 2WP3T 3ULVH 2XFXB 3CCHB 2XWBA 3RX7A 5DS8A 1QSFE 4HKJB 3P4LA 3RAJH 4YK4B 4XP5L 1NUGA 2IEPA 3TZVB 5F7NC 3CUPA 1I85C 5DGRA 2YRLA 3CJJA 4BH7A 2VYRE 3NFNB 2F8OA 3G08B 3GRWH 1KJ2H 3OG6B 3G5VA 4HMEA 3NN8A 4XRCA 4GH7B 4UIMB 4JJHA 4CW1B 4F7CB 1OGTB 2X9YA 1QSEB 4EI5D 1MRCH 1FL5A 3QUXC 1DUYA 1U58B 2COQA 4M1DH 4KAQL 1MJ7H 3NIDF 4YHMH 4NQCD 4QRQB 5DEFA 3VXUE 3BSZL 4LVHC 2R0KH 1CZ8L 5B21A 5EOTA 5IVZB 2EIZB 1S5IH 5GGUA 1BF2A 1X44A 5ACZB 4U3HA 4XPHH 4FG6C 1E4JA 4JQXA 4YIQB 2OQJB 4W70A 1SJVA 3LKSA 5C9JA 1FG2B 3MGOA 1BVKB 4HULB 2HKFL 1H3GA 5GISL 1K8IA 3GSXA 2XN9A 3CK0H 1MFEL 4GG8B 5KSAA 2C3HA 2AK1H 5B38A 3QA3A 1WT5A 3RUGE 2E9WA 1YEIL 5KBNC 5J4MA 4ZG1A 2NY2D 4ZFOA 4KDWA 1FFRA 3OZ9L 1X7QB 4LVOC 1DE4B 3DX7B 4LLVB 4HV8B 4NJAL 3TWCL 1NEZA 4LCCB 1OPGL 4HWUA 3BFOA 4DGVL 1LEKB 4Z7QE 1KEML 2FX7L 4YHOL 1FNSL 3MNVA 2H3NB 1CF8L 4YO0B 5CHNA 5FHAH 4M7KH 4JO3H 4DAGL 2BMKA 4OTXL 4WHDA 2MWCA 5DD3L 2ZCHH 2VR4A 3L1OL 2XYCA 4UT6L 1X5JA 2FDBP 2OZ4H 1UB5B 5F6IB 4ODVL 2F5AH 1RJLA 4PJ9D 4MXVE 4U4BA 3F5WB 4JPVL 4I3SL 4D0CB 2ITDA 3GMPB 4HIHB 5JXEC 1CLYH 1RY7B 1XF5B 2B4CH 3MCLL 3PUCA 4PGBB 5D1XB 3QEGL 5D1QD 3GSRB 4QHKJ 3MR9A 1KJVB 2E8YA 4KHTL 5F71A 1A9EA 1T66D 5GHWL 5F88A 2O5XL 4P3DB 4Q74A 5I18H 4KQ3H 5KJRL 4PJIF 1BIHA 1CT8B 4AM0B 2XQBH 3FO9A 4X5XA 2VE6A 4XC3H 4OM1L 4NKMA 3WEXA 3DMMD 2EE6A 2X4NA 3BEWB 3T3PE 5FV1L 3LKPA 4L3EB 1KNOA 3QXUA 4GKOA 4U1GC 3VFPB 3LQZB 3WL9B 3DXAD 3MXWL 1C16A 4HIIB 3QEQA 2GK0B 2EH7H 5HVGB 3D85A 1H8SA 2VITA 5EPMB 2NY6D 5GS1B 1KLUA 2XKUA 2D03L 3CFEA 1TZHB 1T20A 1EV2E 2P4AB 3U0TB 4MNGE 3BP4B 5INCB 2LV4A 3FQWB 2FECL 1NCBL 4O02L 2LU4A 4XT1C 1VADA 3FQTA 1JWUB 1BEYL 1K2DA 4NQSA 3QPXL 1OL0A 1ACYL 1BIIA 1FC1A 3PHOB 3MLTB 4NQXA 3TJHC 2CLVB 1UWEH 4FFYL 3T2NL 5DJDA 2YUXA 5ILTH 2QQKL 1UXWA 5AD0B 1X3DA 4MZ2A 4OFYD 4KPHH 5C71A 4LLQA 4U1MA 3O4LB 4WENB 4X6BB 5DVOA 2DM3A 5DZNA 5K59F 3DSFH 3BPOB 1MLCA 1F90H 5FEBA 3CXHJ 4MGXA 1NDGA 4HAFA 1BQHB 4MVBD 3SPVA 2YK1H 5JORA 5JW4N 4LDLB 2W9DL 4NP4L 3W5MA 4R4FL 5E8EB 3GJFH 1MFDH 3D3VA 1KB5L 5J56B 2ADFL 5I19H 1I3RA 4X9FA 4E9LA 2NXZC 3UTSB 1FLRL 5IWLC 1HNFA 3HRPA 4PJGA 3CVHL 1GGBH 1QLEH 5D7KE 3HUJA 3R0NA 4M8QB 1AKJB 4QRPA 1P9MA 1BFOB 2VL4A 4EN3D 1HCFX 1P5UA 1CFVL 4DOHE 2W60A 1YJDC 4YDKL 5DJ0B 4D8PB 3QUZC 1E6JL 4P2RA 2CLZA 3OJ2C 1FFPA 4OCWH 4XP1L 4P3WA 4YPJA 3RL2B 2PW2B 4Z95L 5BV7B 4EXPX 5HDOA 3RNQB 4X6EA 4MNQA 4NJ9H 4EI6B 1NAKL 4PJDE 2P49B 4P5TA 3DETC 4POZD 1KT2A 3G5ZA 1XZ0B 4GQ9H 1Z3GH 4ODUA 4PTUB 4H5SA 1PX3A 2X4OA 2V2WB 2AV1B 2VRAA 3SDAB 4QXGL 1INQB 1UEYA 3TYFB 4QF1B 3UTPE 4K71B 1EAPB 1E4WH 4KJYA 4G9FB 3IT8D 2Q76A 4HK0B 4LL9A 4MXWL 3VXUD 5FO8B 1HXMA 3EO0A 1LE9B 1C8PA 1HZHH 1JPFA 1WBXA 4BUGA 3S37X 3BD3A 1J8HD 3O11B 3LD8B 4H20L 3SJVA 1F6LL 5ISZE 1H15B 3FQRB 1ZT7A 1LO3L 4ELMA 5DD1L 1YEEH 1ES0B 5KZCB 1IARB 1PKOA 5JA8B 2D7MA 1VKXB 4X5WA 1J11A 3P0VH 3LQMA 2LE9A 4LGPB 4O5LH 1Q9KB 1KELH 2VXQH 1KJ3H 4HFUL 1G7PB 5E99L 5FYJU 3C6LD 3VFMB 1FORH 2XY2A 1F6FB 3GSNA 2J4WL 1SY6A 3VI4E 3GBLA 4K3JH 2F54D 5CAYB 3DJ9A 1QKZH 1FVDB 4I0PA 1C5DB 5T1MA 3MRLA 3PNWA 1ETZA 4PG2C 2R2BB 4R90H 3GMRB 3ECBA 3F8UB 4JRXB 5F96L 1EGJA 4Y5XB 2DQDH 4X6CE 4K23H 3SCMC 1OP3K 1JZ2A 4OLEA 2CRYA 4F7EA 4FTVB 1S7UB 3ZKQD 4N0CC 5DMIL 1LO5B 1J1XL 4UV4H 1QQDB 4N8VA 1NGWA 3HAEA 3BP5A 1NEUA 3QJHB 4PGCA 4X99A 2KL6A 2ZCKL 3QDJE 3I85A 1JPST 2JELL 5DRWB 5I66B 1OB1B 1PY9A 1N0XH 1T7ZA 1CVRA 4FABH 3GMLA 4K8RH 1Q94A 2IADA 4MSWA 3UEZA 5FCSH 5B39G 3EIFA 2AJYH 4YBHA 3FB6B 3TN0A 5I1HH 1GGYA 2FCBA 1RZIB 1GL4B 3OKMB 4UINH 4LVHB 3HZVA 1LEGB 3UXFA 2VTFA 2V5SA 4GKZB 1U3ZA 2NY4D 3LKOA 2PYEB 4DUXA 3QDGE 2ESVD 5J6GA 5HHOA 1FVEA 5D7SL 2B5IC 3EOBA 1T2QL 2A6KA 1P1ZA 4YDJB 1EUUA 3VH8A 4JDVA 1A4KA 4TTDD 1DQDL 1FPTH 3F7VA 4XVUC 3UJIL 1SYSB 1PKQA 3OBAA 3O3AA 3MUY1 1QRNB 1MLBA 4KKAD 3B6SB 4NO0B 4TSCL 4XXCA 3OV6A 4PJFA 4YXKH 4QOKA 2I27N 2BY2A 4ZTPL 4ONFL 2H32H 4NQDB 5FV2A 1BZ9B 3MLPA 3WFEH 3BUYB 2N56A 2J8OA 4U0QB 4MS8D 5B38G 1CG9B 2R2CA 4OI7A 2C1PA 2P5EA 3P0GB 4XTRC 1LP9E 4P5KA 5K9OA 2APBA 3WS3A 3PV7A 4RNRB 1RJZA 1BJ1H 3HC0A 4HWZB 2FL5B 3FO0H 2XZQL 3MFGB 5J9PA 4JQXC 1NEZG 2FJFB 5IKCA 4OF7A 3N9GL 5KSVA 1T1WA 3MV9A 4L8DB 2RQ8A 5J6HA 1FCGA 2NYYD 5IEKB 1GGTA 5SV4A 3CD4A 2DMKA 4MWFB 1AFVL 4MZ3A 2A83B 4OF8A 4A6YH 1WT5C 3CH1B 1QSEE 4I9WD 2LVEA 4NPYA 2GJZA 2WIIA 1JCKA 5SX4H 2BCKA 5GGTA 3BH8A 5DEGB 4HGWB 1ITBB 2EDDA 2XZZA 1GC1C 1DDHB 4M48L 5E8DL 1J10A 2BDNL 4K3EL 1BVLA 5F7MC 5J8OA 3JV6A 5D72L 2CSPA 1BLNB 3LRHA 1P53A 3HNVL 5DT1L 4CVUA 2DKUA 3HE6B 3VFSA 5IOPB 4OIIH 3B2UD 4ODTH 3DVGA 5D2LF 1GGCH 4OLVL 3ARXA 1I4FB 1RHFA 3TEUA 5E1AA 4U1GB 3JSSA 3H9HB 5IEHA 5GXBB 3QJFA 1XEDA 4XP6L 1ZLWK 3VDCA 4HUUA 1T0NB 3ULSA 4QWWC 5FYJH 4Q9RL 3TNNB 4R2GC 4K7PH 1MFCH 3NZHH 3L95A 2PTTA 3KR3L 5E2VL 3U0WH 5C8JB 2UVFA 3BWAB 3S36L 1CGVA 1QO3A 1OAQL 3RQ3A 4UDUB 3UO1L 4JHZA 1R3KB 2HLFD 4F9PA 3QO0A 4IM8A 2BERA 3ISWA 1PYWB 4RQQA 1Q72L 1ZE3C 5I1KL 3STZA 1MCBA 3REWA 2W65B 1NFKA 5IFJA 4S0TD 1G9NL 1U3HA 5MENB 5ISZD 1X4XA 2EEAA 5EOQL 2BVOB 4NN7B 1P4LA 3TGXA 5IUSA 2ZUQC 3I3EA 3RZCD 1KCSH 5SX4I 5FUCC 5E00A 4X6FA 1AP2A 3KYKH 2FB4L 1J0HA 5C07D 2R8SH 4LASH 1HI6A 3CDGA 5DVKA 4D3CH 4BQCA 4KVCH 4NCC1 2PTVA 1ZWIB 4G6JH 4LU5L 3SOBH 4GRMA 4JKMA 4ODBD 4M62H 5F1SA 3L3KB 1S7XA 1TJGH 1EJOL 1U91A 2IANB 2G5BB 5JQ6L 3I9GL 1TJIL 3ZTJH 3MZGB 4S1RL 5D1ZA 5E6ZA 1QBLH 2AJXL 2C7UB 1MEXL 3GSQB 3EYQC 4L3EE 3QUZB 3OMZA 4LRIA 3CX5J 4NQEB 2OJEA 4P4KD 1WIUA 1XF2A 3V6ZB 4F2MB 1A7QL 1X5FA 5ITBL 1VESA 1L7IL 1FH5H 1F4YH 4MA8H 1W72H 5E2WH 3VMNA 1J1PL 2DBLL 1KCKA 1RUQH 4HC1H 3W0WB 4L5FH 5EORH 4AT6B 1G7LB 2A9NL 5H35A 3G6AA 4BA8A 2KKQA 1RZ7L 5C6TL 2HFFB 5BW7A 3BGAA 4OLYH 1I1FB 3T0AA 2GFBB 4LCYA 3RWDB 1KTDB 5CGYD 2D0FA 1JI2A 1LK2A 3QAZC 5HHQA 1A7PH 4Z5RA 4TVPH 4MYWB 4KKLD 3KPSE 4YUEL 3KPOA 4RA0C 1P9MC 2PR4L 1L7TH 2J8UB 3CFDA 1A5FH 5J12B 1FAIL 5E8NB 3O4LE 2B1HL 1TIUA 5CIPA 2CJUH 4DEPC 4UNVA 4NQVB 2DLEA 4OLXH 5T5NF 4L8BB 5CD5D 4BK5A 3SKOB 2HG5B 1G9MC 2R69H 1SJXA 1B6UA 4RFOL 2HMID 3MLUL 3HC4L 4P5TC 4RGNC 5CLWA 4FQIL 5KVGH 5C6WH 1S7VB 5T1KA 3UTSE 5DWUH 8FABA 3OXSA 4I0CC 2YOCA 3DV4A 4YDVB 1V3MA 4KZEH 4XVTH 5GS0C 1O7SA 1G7HB 2Z8WC 1NCWL 4GXUN 4EDWH 1LDSA 3T0DA 5C0EB 2F8XC 3H42H 5FA4B 4LHUG 2DI8A 4NM8L 5CBEA 4XH2A 4UBDC 1ZEAH 4P2OA 3RWCB 5ALBH 4KRPD 2VXVH 2DKSA 2GTZB 5EWIH 1WZ1L 1CGTA 5F1IA 3VGDA 3W11C 1NGPH 2BVYA 4JHBA 4YWGH 3D1MC 2R0LH 1NBVL 4JEGB 4PS4L 3RI5F 2VC2H 3V4VL 1HHJB 2VZTA 4MCYB 3EOYG 4XAKE 5EBLA 3ZDYF 1A9BA 1OTSD 2H2PC 1QSED 3UPRA 5I30H 1R0AH 1OP9A 3HAEG 4G9FE 5GRXG 4XP4L 4K3DL 3V9FA 3BZFB 1V3KA 4PP2A 3VFRA 1N6QH 3I02A 5DD5L 4I0PC 1T0MA 4OCYL 3D2UB 1C08A 4KI5E 1ED3B 1IC5H 1A3QA 4KZDL 1JF1B 1YNTA 4BFEA 3EOTL 2UWEA 4MAYA 4NRZB 2ADIB 4JM2D 3MLSH 4K7FA 4N0FB 3QWRA 4GXVH 4TULH 3VCLB 2Q6WB 4GW5B 2YXMA 3QEUA 1P2CB 2CDFA 1RIVL 2AKRA 3HFMH 1MCOL 3I50H 4LFHD 1MJ8L 1ZT4B 5DS8B 2DIJA 5B39B 3K4ZA 3UYRL 1XGQB 1YMHB 1NC4D 4P5MA 1N59A 1YECH 1P4BH 1RUPH 1PG7H 2F9BT 4OBSA 5IVXF 4E41E 2FEEL 4XNQB 3LV3A 4BH7B 5CZVH 5E4EC 3VH8G 5HI5C 3NN8B 1VA9A 2NY7L 3MRNA 4JFOB 3NMEA 1WSST 2VXTL 4JRXE 3TN0C 2FWOA 5DLML 3U1SH 4LSDA 1JYWA 1XR9A 3AXLA 1RIUH 4JANA 5T1LA 3IDIB 5DEFB 1I1RA 1YEDA 4FTVE 1K8DB 4M43H 2PCPB 1CN4A 4OLZH 5GGUB 4I0KA 1HEZA 2DL9A 3OF6A 5GIRA 5C9JB 1KXVC 1KC5L 3MRPA 4MX7B 2I07B 1K8IB 1ACZA 3S35H 4PJ7A 4BSJA 1FIEA 4C4KO 1OAZL 1IGFH 5B38B 4HJ0C 1D6VL 3EJZC 3RWGB 1JGDA 4B7LA 4G9DA 3QNZB 2XNAB 2K3TA 3THML 3HC3L 4XXCC 5E1HB 1F45A 2DL2A 2IQAB 4PJCB 1ZGLP 5KG9A 4ZFOB 5F7LB 3PWJA 4PYGA 2E27L 1CFNA 1NEZB 2PYEE 3O3EA 3L6FB 1B0RB 5FYLL 1KPRA 4F58H 3FO1B 3VFTA 1JGVH 4NZUL 5C86A 3RHWF 5I16A 4UTBL 2ICWI 3MNVB 2V17L 3WFHB 5DJAA 1BFTA 1TZGH 5T5FL 2YPKA 4GFTB 4HMCA 1QRNE 4Z76A 1F8TL 4Z7OE 3IDGB 4BFGA 3VFUA 3B9VA 2E3VA 2Y7QA 3EYFA 5D93C 1WEJH 4NQDE 1MSPA 5IW1B 2ADJB 2EE9A 2ITDB 4Z7QF 2B7DT 2ZSVA 5HYIA 3LAFA 2A9ML 1OLLA 3DO3A 4YHYC 3FQUB 4X6DA 1NKOA 2CLRB 3VXME 3MR9B 1H3PH 1JHTA 1A9EB 1IILE 4DQOL 5TH2A 2HVJA 4OJFL 3WBDA 2O5ZH 1ZHKB 5FO9B 1AQDB 3WEXB 2CDGB 2X4NB 1VGEH 3QDMA 3T4YA 1CICC 1I7ZB 1UH4A 1HILA 3LKPB 4NKOA 3P77B 1KNOB 3B3IA 5TDOA 5DSCA 1T1YA 5IB2A 4PD4J 2ZUQB 5HYJA 5HDQH 2Y1VA 1C16B 3WN5A 4JO1H 3UTSD 4MQXC 2VITB 3RIFK 3HLAB 4HZLB 3CFEB 3T3PF 2Z8VC 1I7TB 4LLYB 1T20B 4FQQA 5HYQA 4RBPK 3O2DL 2VH5L 4JY4B 4F9PC 3FRPG 3FQTB 1K2DB 2YPLD 1BIIB 4RWYL 1OT2A 1U8QA 3GI8L 3LN4B 3D0LB 4LCIH 4OCMC 1TTFA 2C9AA 4P59L 4FHBD 5DJDB 3S37L 4FRWA 2OL3H 3MLWH 1J18A 1UM6L 1UXWB 1U3HC 2WWKO 2Z4QB 4AJ0A 3WNPA 2VLRD 2AEIT 2BY0A 4XVSL 1JGEA 1YEKL 4MXQD 2B39A 3GSOA 3OL2A 5IHLB 1NDGB 3SPVB 1EA9C 2X4UA 3T0XA 4PTTA 1G1CA 1RVFH 4OD3H 4GG6A 1FE8L 4G6FD 4G80A 1J87A 3UPCA 3BUTA 3V0WH 4ZXBC 1I3RB 2ZCLL 3QQ9C 3IS1X 3DHMA 2C5DC 2E9IA 2QBWA 3DUHA 1HH9B 2WLYA 5ADOH 3QAZB 1XAUA 2OX5A 1U92A 3NCJL 4LQFL 4G9FD 3TF7C 3RRQA 4MJ2A 2R1XA 4K7PY 5FM5M 2LABA 3NCFB 4QRPB 1UKQA 5E5RB 3GO1H 4L4TE 3AVEA 4QNPF 5D1ZC 4ZUSA 2W60B 5EZOL 5MENE 1OAUH 5KAQF 4DEPB 3MCG1 3FFCD 5KZCD 2FBOJ 4P2RB 1FFPB 4LRIC 3T77B 4ZDHB 5DFVC 5AG8A 5DJCB 4O2EB 4XMLH 2GJ6A 3L3IB 4L3AA 5F7EL 4M7LT 5HHNB 4MNQB 4OGAD 4P5TB 4RGNB 5F89A 2Y06L 2GJJA 4LEOB 5HYFA 2XA8L 4I3GA 1ZANL 3D69A 4JVUA 5CILH 5BW7C 4FP8L 1BQSA 4WY7H 2ZUWA 4C83A 2CXKA 3MGAA 2IANE 4ODUB 3BYTA 3VMPA 1N7ML 2J88H 2MQCA 3U46A 4DJMA 2ORBL 3QIUB 4OZIA 2ATKA