3QV1A

Crystal structure of the binary complex of photosyntetic a4 glyceraldehyde 3-phosphate dehydrogenase (gapdh) with cp12-2, both from arabidopsis thaliana.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
337
structure length
337
Chain Sequence
AKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic
publication title Conformational Selection and Folding-upon-binding of Intrinsically Disordered Protein CP12 Regulate Photosynthetic Enzymes Assembly.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase/protein binding
total genus 116
structure length 337
sequence length 337
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.2.1.13: Glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating).
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qv1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qv1A01
3LLSA 2V6GA 3QSGA 4B8ZA 3DWFA 1O9BA 2E6UX 4AJPA 1I30A 4LN1A 5JYDA 2PH3A 5TF4A 3OECA 3DZHA 3C8MA 1GTMA 3PYXA 4LVUA 5BSHA 3PQEA 1JKFA 3GT0A 3C1AA 3GDOA 1NTOA 2QYTA 2X23A 3H3FA 2PY6A 3KSUA 2AQ8A 1HDRA 2OP0A 2WEKA 3CMMA 3U0BA 2Q2WA 4LMPA 4OL9A 3KZVA 4XYGA 1O8CA 3WG9A 1K6XA 2X5KO 4R5MA 2P4QA 3MJSA 3MTGA 1FMCA 2DBRA 4Z9XA 4BMVA 1C14A 3JYOA 2VUTA 2WMDA 4UEJA 1AHIA 2FSVA 4HNHA 3H5NA 4BKOA 1GQYA 4BMSA 3NEPX 1D1TA 1HDCA 2QZZA 3QVWA 5FFFA 2BMAA 2O3JA 4E21A 3GVXA 1AGNA 4LISA 1VC2A 1DIBA 4EGFA 3RBVA 3BMCA 1O6ZA 1ZKMA 3DFZA 3EZLA 4ZQHA 1KYQA 2VOJA 2YV1A 4E13A 3WMWA 3V2GA 2OUIA 2VWQA 4MIOA 2Q1WA 5KJ6A 5ER6A 4K6FA 5T8KA 4FDAA 4CV2A 5JPIA 4R9SA 2CD9A 4BNTA 3UICA 4QO8A 3ROPA 3ZNPA 1C1DA 1HF3A 1KVSA 4W7IA 3WGZA 3D3WB 2DKNA 3JQAA 4WOJA 4FC7A 2B36A 5JAIA 3JQ7B 3NJ4A 1XCBA 4ZGWA 2RHRA 3KETA 2UV8A 3MWDB 1X14A 1HTBA 4CR6A 2YFQA 1XHLA 3WBBA 2RIRA 5HBRA 2ZTLA 4G65A 2O3UA 4PN3A 1H9BA 4URFA 1E77A 1XDWA 3WMXA 2TMGA 4PRLA 4IDFA 5A9TA 1ENZA 1GZ3A 1VJ0A 4BNLA 1LRKA 3PGXA 3VDQA 3OJFA 3ZHBA 2NVUA 3GHHA 1GZ6A 3PPIA 1PX0A 3DQPA 3GRKA 3O4RA 3U9LA 4NI5A 5TT1A 4FPXA 5DN9A 1NYTA 3ICCA 3QIVA 1ZK4A 2EP5A 4R4JA 2P9GA 4LGVA 2POQX 3W8DA 4CLRB 5K6AA 3G3EA 3GK3A 4KQWA 3UCFA 2EKLA 4D44A 3QVOA 1XG5A 4MVJP 3DZKA 3GG2A 4WCDA 4CMIB 2C5EA 3F5QA 1PR9A 3VTZA 4B4UA 5BSEA 3INGA 4RVGA 3ZW8A 2V6FA 4BO1A 2OORA 3GZNA 1WXDA 4EJ0A 1EUCA 1O94A 1PJ2A 3SC4A 1DRWA 3L4BA 2JCYA 4PG6A 1PWXA 3TZHA 2O50A 4BO6A 1GZ4A 4AJJA 3WGGA 2ZB8A 5JCJD 3ORFA 5KVVA 2I3GA 3QLJA 4IQ0A 1H2BA 3ZWMA 4EEZA 2H9IA 2J5KA 4CODB 2FPPA 5F21A 1X13A 4D43A 1DIAA 5CDUA 2P91A 3FF4A 3LF2A 3RU7A 4ND4A 3GNQA 5HS4A 5G0TA 4ND3A 2FMUA 2X22A 1O0SA 2HUNA 3NGXA 4BHTA 4CM3A 5G0WA 1MGOA 4WUVA 4Y98A 3D64A 4Q3DA 5L4LA 2ZIZA 3E6AA 1U4SA 1YRLA 2HMUA 4CQLA 3WGTA 1BXGA 4IDDA 2NV6A 1C0PA 3UCEA 3ZV5A 4II3A 3UUWA 8LDHA 3PIIA 1JAYA 2RH8A 1LLDA 2BFAA 2EWMA 3OSUA 1C0IA 2GLXA 4KUHA 1ZMOA 1CRWG 1PGJA 4E2XA 5I7SA 2EV9A 1YXMA 3DBRB 4B7XA 1JW9B 4CM9D 1ADCA 1Y8RA 3JYNA 3KM0A 1Q2XA 2TMDA 3EMKA 4KQXA 5CHEA 4BQPA 4HY3A 2GDZA 1T2CA 1XGKA 2D5AA 1HDOA 4BB5A 1X0XA 3KEQA 4NJMA 2HMWA 1SO8A 1ZJZA 1AHHA 1NFFA 1VJ1A 3VZSA 3JQFC 2O3SA 4I9HA 4NBVA 2CVZA 4TZKA 1NFQA 2ZKLA 4BQRA 4NK4A 1TT5B 3C7DB 5KIAA 3D0OA 5KVSA 4YQZA 5JE8A 5JY6A 3RFXA 1KEVA 1VSUA 1WPQA 1Y9AA 1ZZEA 5B12A 2RHCA 2ZJ1A 3BTSA 1AN9A 1N1GA 2PKQO 1OBFO 1SBYA 4J9UE 3GGGA 3E5MA 1B26A 4IIUA 4E5MA 2NACA 2GO1A 3OJ0A 5F1KA 4ZQBA 2Y1OA 4HWKA 4J90A 3H9UA 1JTVA 4JJGA 4RQTA 4IM7A 1GQQA 1DJQA 1LSJA 5G0UA 3PFFA 1N9GB 3AUTA 3CH6A 3KVOA 4TVBA 4CMBA 1DPGA 5GY7A 5EJ2A 2GZ1A 3VDRA 1ADFA 3ST7A 3S2GA 4Z0HO 3COSA 3DOJA 3VPXA 4JGBA 5JDIC 1G6KA 3PWZA 3I4FA 1J49A 3MZ0A 3KEOA 3ZWOA 2X9GA 1QG6A 3F47A 2HU2A 1KOLA 2JKVA 3FHLA 4DIBA 3RFVA 5L7WA 3KYDB 5HRUA 2X58A 3JYPA 1TVEA 3DBHB 1GPJA 4GQAA 1T1RA 3D3WA 4YEDA 5L9AA 1B16A 4CMEC 5JYEA 3JQ7A 4P4NA 4AVYA 1ONPA 2D1YA 3FN4A 2EEZA 2IODA 1MX3A 3FCOA 2IRWA 4OIMA 1XU7A 3LC1O 1OC4A 2GPTA 1PEDA 4YR9A 4QQRA 1ARZA 3HUDA 3KLMX 2OOSA 1UP4A 3P19A 3C3XA 4WPGA 2J8ZA 3DZGA 3S2EA 5DP1A 3T4XA 1IHYA 1W4ZA 4TKLA 4CQMB 1E7RA 1I2CA 3JQBC 3F6YA 3O03A 1WMAA 2O3TA 4R01A 4YQYA 1QLJA 2HDHA 1T2EA 3OA0A 5TJ9A 5ILGA 5KVQA 2J3KA 3L9WA 1E3JA 4ALLA 2RCYA 5F5NA 4UVIA 1LA2A 5A4DA 3NDRA 3O38A 3W4JA 1JVBA 1FJHA 1R15A 3ZN2A 1PZEA 2IXBA 4CMJA 3FR8A 3RBZA 1D7OA 2CDAA 4YRAA 3ZWAA 1R0KA 3IKVA 4CLRA 3LT1A 2ZTUA 1KVRA 4GKVA 4NBWA 4J1TA 1MV8A 4PZCA 2OZPA 2XXJA 4PLZA 3DFUA 4CMIA 5C37A 3WQRA 3FBTA 2VUUA 2EKQA 3ETDA 3MWEB 3ONFA 3R3SA 2X6TA 1VI2A 2JFGA 3I9OA 4PRKA 3AFNA 1UDAA 4JJIA 2VHYA 2ZCUA 5U9CA 1T26A 3DTYA 1E3WB 3FPLA 2W8ZA 1QMGA 2WWRA 4DUPA 2BHLA 3RC2A 4BKUA 2FWMX 1KC3A 1ZK3A 4ZHSA 4R69A 1VKNA 5MDHA 3WGQA 2GN4A 2Q50A 5AXDA 3UOGA 3I3OA 2A92A 3EHEA 4Q3CA 3H4VA 3QY9A 4B8WA 1VLLA 3GEDA 4K9DA 1QSGA 1SNYA 2PGDA 1RWBA 3DOCA 5JCJA 3GZ4A 3RUFA 3F46A 4QFDA 1GUFA 3AK4A 3F4LA 4KTTE 2AW5A 3B6ZA 3IKTA 2ZK7A 3EW7A 1MXFA 3FNEA 3WNVA 3P7MA 1CDOA 1EMDA 1T4DA 1EZ4A 1P1FA 1VL6A 2J5QA 2AE1A 3TZ6A 3KV3O 1E7WA 4YRBA 5JLAA 1R4NB 1TXGA 1RM3A 3LC2O 3ITDA 4FN4A 1DFIA 2C29D 3AOEA 3GH3A 1UXJA 3E48A 3H2ZA 4BNUA 3HE3A 4WOKA 1I01A 2YFHA 2CDCA 2AQKA 1JKJA 2BI8A 1K6IA 1M2WA 2PZMA 1ONOA 3OIGA 5HA5A 4IXTA 1EK6A 4OM8A 3P2OA 2OP1A 1SEPA 1F17A 2X0IA 2D59A 3HADA 1EDZA 4A5OA 3QE3A 4E5PA 3DBRA 5BNTA 4W9NC 3CKYA 2WYWA 1Y6JA 4HX5A 3UCXA 3QHAA 1C0KA 3B1KA 1Q0QA 1LQUA 1WAMA 2A9FA 2YJZA 3DEYX 4RPKA 5DBIA 5IF3A 3DXFA 1MG0A 1N7HA 4Z9FA 2AEJA 4CM9A 2DC1A 4ZD6A 1B14A 1X1EA 4KWIA 3WYBA 5I8WA 2DPGA 2HJRA 3RJ5A 4ALMA 4PLGA 4HP8A 3AUSA 4BO0A 3DC2A 1IZ9A 6ADHA 1VSVA 4NU6A 1XELA 4Q3EA 4XRRA 1H2HA 3TJRA 1TT5A 5TRTA 1MP0A 1Z82A 1ZSNA 2JD2A 4XJTA 4WGGA 5DBGA 5FF9A 4CLOB 3QVXA 4PZDA 2FY8A 2PKQP 3ON5A 3JQ9A 4FFLA 2W2KB 3FWZA 1U3WA 5BSGA 3QJ5A 3ZDFA 1EBFA 5EQFA 3FTNA 4E12A 2IZ1A 3TOXA 4S1VA 3BYZA 5L7TA 1I36A 1F06A 1A27A 2CDBA 2FZEA 4J49A 1LEHA 4A03A 9LDTA 4PG7A 3PJEA 5T5QA 1PWZA 4PG4A 3PHLA 3SLKA 4CMGA 2VWPA 1SMKA 4BNVA 1LLCA 1LRLA 5AXCA 1EE9A 3PQDA 2CNBA 3VPHA 1N9GA 1MXHA 1P1KA 1HEUA 1UZNA 1X7DA 2NVBA 4E4YA 1LC3A 1NFRA 2I76A 4WLVA 3KO8A 4ZRNA 1KEPA 4MVJG 1UZMA 4ZQFA 4XB1A 4BO4A 2X86A 1I5RA 4IDAA 3ZU5A 1R0LA 1GEGA 2C2YA 2NLOA 4CV3A 1RYDA 1ZO8A 3VVCA 5J23A 3AI1A 3HN7A 4U6QA 4BKRA 5IZCA 3JV7A 4B79A 2O48X 4BO8A 1BDMA 4BO2A 4MKRA 3PJDA 3KYDA 3TOZA 4YJDA 1A7KA 1N92A 2B5VA 3GVIA 4DPKA 3DBHA 1HLDA 3C1OA 1OZAA 4TWRA 5DOZA 2PGJA 4A0SA 1JN0A 1DIGA 4HUJA 4CM6A 2Q22A 3AFMA 4Q9NA 4IXWA 1YVEI 5H81A 4XYLA 4D0RA 1KBZA 1ZK0A 3DZIA 1WDKA 3SBOA 1GY8A 1DEHA 3RI3A 5DT9A 4RGBA 2VHWA 4YRDA 5FI5A 2JL1A 1P9LA 3DB2A 4CQMA 1GCUA 1AXEA 5LCXA 3NUGA 4BL5A 3OM9A 4WEQA 4AJIA 4IZHA 1LNQA 1A7AA 1GFSA 4GLOA 3RIHA 1GUYA 3LSYA 1E92A 3NRCA 4E0BA 3QWBA 1E7MA 3V2UA 1SOVA 4XR9A 3D4NA 4OH1A 4GSLA 2OXIA 4FW8A 1HE2A 4LW8A 2CF5A 2OBNA 3BA1A 2OFPA 2Y1FA 1ZFNA 5IZ4A 4RPGA 1DSSG 3PLNA 3GAZA 4N5NA 1T4BA 4FBGA 4JN6B 2DU8A 2Y0CA 3RUCA 3L6DA 1A72A 2YZ7A 4A27A 1V6AA 2B4TO 4EI2A 5L4SA 1O95A 2X0RA 3FTPA 3U4HA 3V1YA 1VRWA 1QXSA 1OC2A 2HRBA 3IQDB 3I1JA 4XIYA 3TZKA 3IL2A 1GU7A 4NFYA 1S7CA 3FD8A 4IDBA 4B4VA 5EERA 5EMHA 2PV7A 4C7JA 3SVTA 1QORA 3O8QB 1EUDA 5K0ZA 2VT2A 5A5FA 3I83A 3Q11A 4NMHA 1HYHA 1G1AA 3JCZA 4OQZA 4ITUA 1YBVA 4Y6PA 2DUUA 4ID9A 3AI2A 2Y0EA 1NAIA 4XYBA 4WE3A 4YT2A 1IPEA 1E5LA 1BW9A 3KB6A 4GBJA 4YAKA 1WW8A 4QEDA 5JAMA 4YT5A 4RDHA 1R4NA 3GQVA 2ZYDA 1LX6A 3HFSA 1N1EA 1YL5A 5AVOA 2NUAA 3W6UA 3RUAA 4BS9A 2NU6A 3H9EO 2Y93A 1YDEA 2B5WA 4RPHA 2P9CA 4J1QA 4KWHA 1U8XX 3HB5X 2NU9A 1Y5MA 5EQDA 5JNLA 3KHUA 4XCVA 1SB8A 3RCBA 3ZZNA 5T73A 5DCUA 2JJYA 3UN1A 4Q3BA 4N7RA 3DTTA 4R41A 3HDJA 2VNAA 4RO0A 1U8FO 4AL4A 5JAZA 4ZRMA 1P77A 4II2A 2J3IA 1ORRA 4GI2A 3NX4A 3WQQA 5AXAA 1P0CA 1P45A 1E0DA 4K28A 4Z6KA 4CLHA 4Q39A 5A05A 1A71A 2CUKA 3K8ZA 3GEMA 4ALNA 4PG8A 2HQ1A 5ER9A 4R3NA 4BNXA 3PDJA 2HRZA 4QECA 5TJHA 1V8BA 1E1LA 4CLOA 1NBOA 2PKRA 2PFGA 5ITWA 3Q9UA 2IZ0A 3DZFA 2YV3A 4FJ2A 3H7AA 4GKBA 2W2KA 4IJVA 2YDXA 1YDWA 1YOVB 3EVTA 5GZ1A 4TKMA 1KEWA 1BMDA 5KWEA 3WS7A 2DBVO 2DTEA 3GUCA 4D42A 3VZRA 3C7AA 4RVSA 3N58A 4IDCA 2FHSA 5T64A 1P33A 4XGNA 4DYDA 3L9XA 3MOIA 5DCYA 4QT0A 2R00A 3A9WA 1FK8A 1U28A 2X0NA 5KJFA 2VCYA 2CFCA 5JMPA 4J2OA 1H6BA 1EE2A 2O3RA 4A26A 3BHMA 4DIFA 5ICMA 1DO8A 1HYGA 1PR3A 1K6JA 1PJSA 3H3JA 2IEBA 1U7TA 1P1RA 2NADA 4ALIA 4BKPA 3E03A 5AQ1A 1E7QA 1WVGA 4XJSA 2QQ5A 2DBQA 2C20A 1PGPA 5JXWA 1T2AA 1JU9A 3R6DA 4FOSA 4BOYA 2HMSA 3T7CA 4NPCA 1GL3A 3VTFA 1HDGO 2CVOA 4J43A 4XGIA 2X9VA 3R3JA 1HE3A 2PTGA 4GVXA 3NKLA 1JQBA 4RVFA 1R37A 4L73A 3G1UA 4DQUA 3BTVA 5ICSA 3CMCO 2EG9A 3GOHA 3E9NA 5EN4A 1B3BA 3DDNA 1Z73A 5JDCC 4FFNA 3IP3A 2VT3A 4QSMA 4O1MA 4BNNA 3BTUA 4J6FA 4N18A 4IMRA 1SOWA 1GPDG 1B15A 4R1NA 4WLEA 4B3JA 5A04A 4BGIA 3SLGA 1LDEA 1YO6A 3DZBA 1LUAA 4M49A 4ALKA 2F00A 3ONDA 1HSZA 1I3MA 2JCVA 2A4KA 1NXQA 2LDBA 3DZJA 4OXYA 5IXYA 5LC1A 2ZQZA 1CQIA 4J91A 5KJCA 3ADPA 4J4BA 4XRGA 2C5AA 2AA3A 2G0TA 1LSOA 5EPOA 1IHXA 3ZCXA 1YQDA 3RFTA 1T1SA 1YJQA 4E30A 4YPOA 3PJGA 2VRCD 5F1OA 1Q1NA 4FFRA 2VZ9A 1PZFA 4UUNA 1C0LA 4EYEA 4RQUA 4CUJA 4BO3A 3WJAA 1DXYA 3OA2A 4XIJA 3I5MA 2AE2A 3WX0A 4CUZA 1LJ8A 3W1VA 5ITVA 5CDTA 2I65A 4NNJA 5G0VA 5THQA 3PFWO 2PK3A 2A35A 3A06A 5EIOA 2HK9A 1U3UA 4UVEA 4MP8A 1YJ8A 3PI7A 5K9ZA 4XQGA 3D5TA 1B2LA 1UP7A 3O8QA 5G4KB 4JROA 4UVDA 2VWHA 4DYVA 3ASVA 2I3AA 1UUFA 1DRUA 2WE7A 2WJPA 3N7UA 4DLBA 5TT0A 4I08A 2C7GA 1EUZA 3FBGA 1YQXA 3D5QA 2I5PO 5EL0A 4M8SA 1I3KA 1PJQA 2PLAA 3Q3CA 4W6ZA 3TFOA 2SCUA 4D46A 4KUEA 3R0IA 2PZJA 1YH3A 1KEUA 1ULSA 1ZIDA 3C24A 3AI3A 4CMAA 2BFMA 3LLVA 1EBUA 3FPCA 4GVLA 4HADA 3AM5A 1T2FA 3K30A 4YCAA 1LQTA 4MVJE 2NTJA 1OOEA 3I52A 1Y81A 1E3EA 2WDZA 2FPIA 4BUCA 2XOXA 3V8BA 4MVJH 2ILTA 3CUKA 1R4MB 4GWKA 1DFGA 1LSUA 2VHZA 1P1JA 5I9NA 3G17A 5JYAA 2Q49A 4DBZA 1UAYA 3A4VA 2VQ3A 3OQBA 4WCFB 4BGEA 1B3RA 2HMTA 2PD4A 3IUSA 4IDGA 2JFFA 4PLCA 1ZSYA 2UUPA 1E6WA 1F12A 2HK7A 1C3VA 3JD4A 2WD7B 1XQ6A 1LDBA 1QYWA 3U3XA 1BWSA 3KRTA 4J7UA 3PYLA 3VPGA 2GN6A 1SPXA 4PGFA 3ZNQA 3HG7A 1X15A 2VWGA 2P4HX 4FOOA 4J0EA 3X2EA 2IYPA 2YQ4A 3W6ZA 1QYDA 5FEUA 3TL3A 4GAEA 1IPFA 1YWGO 1OI7A 4P4GA 4B7CA 3RBXA 4FFMA 2YQ5A 3GAFA 3ICPA 4HNGA 2Z1NA 3LT0A 1L1FA 4PZEA 3TWOA 1PL6A 3Q6IA 1HSOA 4AJOA 3WR5A 4DC0A 1F8FA 1KVTA 4E6PA 2C0CA 2Z95A 3W8FA 1PZGA 1YOVA 4IGFA 2NVWA 3MOGA 4EEXA 1DRVA 3OICA 5G4LA 1PS9A 4PIVA 5L51A 1XQ1A 2W2LD 4NBUA 1BG6A 2EGHA 5KKCA 2Q45A 3NDJA 3ITKA 1ML3A 3GGOA 1IY8A 4R1UA 5A9SB 4WNCA 1B7GO 2GYYA 5F3RA 2CSUA 2X5OA 4RDIA 2XXBA 3VKVA 3VPSA 3MTJA 3RAJA 2CMDA 4MVJI 4OHUA 2X8LA 4TZTA 4EUFA 1U5AA 1ZMTA 2JCXA 3WYEA 4U8GA 1IOLA 3NTQA 4YWJA 1ZK1A 4EUEA 3HSKA 5C7IO 3D1LA 1EQ2A 4UAGA 4YAGA 3OJOA 3ZNOA 3UW3A 1Q0HA 1TT7A 5F5LA 5CDYA 2O4UX 2B69A 5IDXA 2NTNA 3H8VA 3IMFA 3IDSA 3GDGA 2VZ0A 4FSHA 3ZHYA 1WZIA 3CEAA 1R0SA 3ENNA 2GN8A 1U4OA 4U5QA 3TZQA 4D3DA 4DXHA 1CQJA 2VNSA 3W8EA 3M6IA 5L40A 4OSPA 3UHAA 1J4AA 3B1JA 1PQWA 3ZHZA 3QVTA 5ENVA 3DO5A 4UEKA 1GD1O 2C54A 3INRA 1PS8A 3WWYA 2Y1EA 2J3HA 3PLRA 2Y05A 4CMEA 3OQ1A 2A94A 1BXZA 3OQ6A 1I2ZA 3E9QA 4CM8B 1EVIA 1PGNA 2AEFA 2UDPA 1ENPA 3JSAA 3PRJA 1I3LA 4Z3KA 3VC7A 2OO5A 2C2XA 2FZWA 5GZ6A 5TLSA 1Z7BA 2HAEA 3DHNA 5DZSA 4CQMD 1LDGA 4GL4A 4FC6A 1H6AA 3JQBA 2YDYA 2VRCA 1GDHA 2YUTA 4BB6A 5JMWA 3ONEA 2GNAA 1L7DA 3E1KA 1N2SA 2X9NA 4RL6A 4R51A 4OSOA 5C3MA 4YJGB 1RJWA 4R3WA 1NVTA 3GG9A 4I8XA 1DC5A 5A3JA 1MG5A 4FGWA 4ND1A 1P3DA 3MJCA 4JXKA 1YONA 4N5MA 5JCXA 5JC1A 2AG5A 3E18A 3LDHA 1Q0LA 3CZRA 1GQ2A 4M87A 3EYWA 5G4KA 4OQYA 3JD2A 3U5TA 5B4VA 1I3NA 2DUWA 5LDGA 3DAGA 5IN5A 3NAQA 4D3SA 4BNIA 3TSCA 1PSDA 2PZLA 1R16A 1LXCA 5DCWA 3ZWYA 4IMPA 3WYCA 2GASA 3DL2A 4W99A 1HZJA 5AYVA 1Z45A 1M6WA 4DPLA 1Y8QB 5KCZA 1B8VA 1HXHA 2VTEA 4OXKA 1QYCA 4W82A 4ZU3A 1U2DA 3ZWXA 5B1YA 2Y1GA 2RBEA 4GX2A 2GGSA 1UXIA 4YDRA 4RVDA 4DWVA 1FDTA 4PLTA 3UVEA 4GLLA 1N5DA 3F9IA 1R4MA 1NAHA 2AEMA 3OEYA 3WLEA 4XX0A 2QX7A 4XWYA 1BTOA 4A10A 1Y5RA 4WCFA 1BVRA 3C7CB 4JK3A 1VL8A 4FCCA 2ZB7A 1X1TA 3AJRA 4CM1A 1PQUA 1NHGA 4ZVVA 1BW9B 2WD7A 4WJZA 4BNFA 1FDUA 2PWZA 1CERA 4JX8A 4QTZA 5COAA 1XYGA 4IQ8A 3GR6A 1LLQA 4IDEA 1EDOA 1P74A 3AY6A 4N5LA 4CJXA 5DBFA 9LDBA 1QV7A 1NVGA 2FSSA 3BZUA 1A9ZA 1T25A 4XYEA 4DMMA 2YV2A 1JWBB 5I8ZA 5F1PA 2NU7A 2B4QA 2NWQA 3OIFA 4PLFA 4MO2A 5A9RA 3FSRA 2YHIB 1GV1A 1BDBA 1KS9A 4J2HA 3FNHA 3TN7A 1Y1PA 3EC7A 1DC4A 1J0XO 3TRIA 4C7KA 2H6EA 4AJLA 3VVBA 4J0FA 4NFHA 3TF5A 1DLJA 3PHJA 3WTCA 4BNHA 3GPDG 1JLLA 3MJTA 1V3VA 3PJFA 2LDXA 4XQ9A 1VM6A 1UH5A 5A9SA 4Z0PA 7ADHA 4LMRA 1GAEO 2XF8A 5JFOA 2W2LA 4DBVO 4IPTA 3WIDA 1T2DA 4L4RA 4XDZA 3FRJA 2C07A 4G2NA 3QW2A 3GMSA 4I9NA 5AXBA 3QP9A 1QLHA 4U0JA 3WGIA 2WD8A 2QZ9A 3ANLA 3W4IA 2YHUA 4EW6A 3VZQA 3JQ8B 4E2YA 3GDFA 2DPHA 3VZPA 1R6DA 4Z3DA 1NP3A 1DBVO 2Y99A 4WASA 1JWAB 3RASA 2WTBA 2X4GA 1CF2O 3B20A 1NQAO 3NTOA 3GFGA 1TEHA 4YB8A 2EJVA 3OP4A 5HTOA 3AUUA 3H5AA 4WLFA 5L4NA 4JCOA 3RQSA 4DLAA 5C7OO 1JA9A 3U4DA 4Y67A 4XKJA 1KERA 1G0OA 4GX1A 1LU9A 1M66A 3ZW9A 4CM4B 4GSKA 3WIEA 3T7EA 1ZH8A 1RYEA 2NQ8A 3H9JA 3JQ9C 4EJMA 1XWFA 3H2SA 3A1NA 3TZCA 1HDXA 1V0JA 4CV1A 4IGEA 5BNFA 1T24A 4RF2A 3HDYA 4I1IA 1HDZA 2OGUA 4JLWA 4PFJA 4M54A 3PWSA 1E1KA 3GMDA 4DIOA 2DVMA 3BMNB 4CM8A 4INAA 2IZZA 2GCGA 1P44A 3GVHA 4HBGA 3MJ4A 4ND5A 4YJHB 1HKUA 4FGSA 4X54A 1P31A 4HKTA 4XZ3A 3M2TA 4MVJD 2AMFA 4M86A 2V6MA 2BD0A 4MP6A 4DLLA 1GYQA 4KOAA 4KZPA 5U1PA 1YL7A 3TQHA 4LCEA 3JQGB 1H6CA 1PL8A 1V35A 2CVQA 5GMOA 3QA9A 5IAAA 2D2IA 3DMTC 4HFNA 4YJGA 1K0UA 4IUYA 4AJ1A 3QQPA 3WDSA 4TRRA 4UVGA 1YB1A 3WTBA 1E5QA 4E5NA 4AFNA 8ADHA 2Q1SA 2X0JA 2J5RA 2PZKA 3NJ8A 3AWDA 3EY4A 5T67A 2Y1DA 1ISIA 1HE4A 3OEWA 4UUOA 3JQCA 3I9JA 4AJHA 2Y66A 1I24A 4PVCA 3GRPA 3VPFA 3F3SA 1NWCA 5A03A 4QUKA 1UXKA 3D7LA 3PQFA 1PJLA 4O0LA 4GX5A 4E2WA 1ENOA 1PGQA 5M6DA 3Q2IA 1KY4A 1UXGA 4BMNA 3K92A 1DLIA 1IYZA 1ZJYA 5IG2A 4N54A 2HK8A 3KYBA 4DC1A 3F4BA 5I9LA 1YBAA 5THKA 3I9LA 3I6IA 3GY0A 4YTEA 3LYLA 3DR3A 1Y8QA 4PVDA 3PZBA 4TRJA 3NT5A 1JVSA 3K2EA 4Z9YA 3TL2A 4RLSA 3SX2A 4IJKA 3EAGA 2QIOA 1IULA 1PIWA 3LC7O 5CFZA 4TRNA 5LDHA 4WECA 3OBBA 4WLUA 2QRJA 3I4CA 3L6OO 4EDFA 2GR9A 4K6CA 4U7WA 4MJLA 1YB5A 3ABIA 4JBGA 5TSDA 4E3ZA 4IBOA 4BV8A 5IXSA 4JP2A 3W4KA 3SJUA 1UDCA 4M89A 5CP8A 4NJOA 4CL8A 1E1MA 1P1IA 4I9UA 1ADBA 4EITA 1GCOA 3GVCA 3UGKA 1D4FA 2O7SA 4D0SA 2JAPA 1ZW1A 5A5EA 2H5LA 3U09A 2YY7A 4IZIA 5IFLA 4KDFA 3RUHA 4Z0TA 2YHIA 2GF2A 1R12A 3X2FA 2DFDA 1YB4A 5CPFA 4AJKA 2VUSA 3L4SO 4C4OA 3BMQB 3K9QO 4NFSA 4I5DA 2EHDA 3L0DA 2I99A 3NDIA 4JQCA 4ROSA 4BV9A 2I66A 3JD0A 4NU5A 3IIEA 4XGKA 3TDKA 3GLQA 3P5SA 5CDGA 3PWKA 2AQHA 3D4OA 3K5PA 3RJ9A 3G49A 1HWYA 2Q46A 2EP7A 4CM7A 5CG2A 5JO0A 2QHXA 2Z1MA 4BIIA 3WICA 1XEAA 3LZ6A 4OYRA 3ZGYA 3MEQA 4EBFA 4DQVA 4TSKA 5CAEA 4I5GA 2ZCVA 4R1TA 4MKZA 4LRSB 2Q2QA 5JSFA 3JQ8A 4UREA 3ZU4A 4AJEA 3D4PA 1GADO 2Q99A 3F1LA 4F6CA 3GPIA 4L74A 3H5RA 2VZ8A 3HJAA 3EZYA 1U3TA 1PTJA 2HCTA 4BNYA 4WNIA 2BGLA 3ASUA 3GA0A 1RM4A 4JJFA 3WSWA 5B4UA 1EVZA 2CZCA 3RUIA 3ZV6A 5A02A 1A4UA 1SEVA 1VKOA 1LLUA 2BF7A 2G1UA 3OFSA 3GVPA 4CM4A 4O59O 4TQGA 5CDSA 1DHRA 2IDZA 4GGOA 1ISMA 2PA3A 3WGOA 3KSZO 3AU9A 2P68A 4UUPA 3HB4X 1IUKA 1KVQA 3H6KA 2AG8A 2BI7A 3BMNA 2X1HA 4U6SA 2R00C 2WYUA 3ETGA 1PU2A 1I32A 2V7PA 2Y68A 3S55A 4YJHA 2AXQA 5JDCA 3OF2A 4PLYA 3NT2A 4K26A 2JHGA 4RCVA 1K3TA 2D4AA 1CJCA 2XPCA 3BMOB 4WEOA 4YJFB 1RM5A 3TNLA 3VH1A 2QYSA 1ZUD1 4MVJA 1A4IA 1NQTA 1P0FA 1P1HA 3RVDA 3JQGA 3UKOA 4P22A 3QV1A 4YVFA 1FDWA 2Q2VA 5H82A 1GV0A 1BXKA 1GUZA 3AU8A 1K5HA 3LVFO 1QP8A 1LRJA 5TNXA 3HZZA 3CE6A 2R6JA 3OIDA 5KNLA 4KP7A 3ZV3A 5A1TA 2DM6A 1HDYA 1GR0A 5TX7A 3PHHA 4L4XA 1ISGA 4IJWA 4DMLA 1TB4A 4AJ2A 4BNMA 4RV9A 2ZQYA 4H3VA 3DBLB 3PDUA 3GNTA 4F46A 3JTMA 1H5QA 2BGKA 3F5SA 3KTDA 5JW6A 4H15A 5T8KC 3ZU2A 3WLFA 1JAXA 1HZZA 3U4CA 4DA9A 5U4QA 2GN9A 1XR3A 1O5IA 3WJ7A 2E49A 5B37A 4TVOA 3ZV4A 4WKGA 4IQGA 1V9LA 3RSHA 1SCUA 4PCVA 3HQ4O 3HHPA 1E3LA 2CY0A 4OOEA 1ZBQA 4J4TA 5L3ZA 5FYDA 3ZWBA 3E9MA 1IZ0A 5DNAA 2P9EA 2PD6A 1EVJA 1ZK2A 3QWFA 4U0KA 1FDVA 1KC1A 2X5JO 3E82A 2EW2A 2V6BA 2ZJ0A 2H1SA 5I7EA 1MFZA 3IOYA 3M1AA 1E3SA 4D41A 3CIFA 5T6BA 4WLOA 1UR5A 4GGPA 4YAEA 1U3VA 4CM5A 4NDNE 5G2OA 4NBTA 3EK2A 4CL3A 3ROQA 3NTRA 2C82A 3FR7A 4E33A 2Q1TA 4HFMA 2QRKA 3FWNA 5A06A 3LU1A 3RUDA 1HRDA 4NR0A 3DAFA 5K6AC 4KTVE 4ZA2A 4EJ6A 3WQSB 3ZWCA 1H9AA 1C1XB 3PHIA 2BFPA 3OETA 2PD3A 2EIHA 5I7FA 4BVAA 1H93A 4J1SA 4KMSA 1CEQA 3GC6A 4A73A 1F0YA 4FS3A 4E5YA 1F8GA 1BSVA 2NM0A 3ROMA 4NHEA 3IC5A 1MC4A 1PGOA 1PL7A 3V1TC 3C85A 4I5FA 4LRTB 1O89A 4A7PA 3L4BC 3BMQA 1QRRA 1UP6A 1ZSVA 1NHWA 4JBHA 4XA8A 5IDYA 4D45A 5L53A 1ZEJA 5H83A 1W8DA 2Q1UA 1M75A 3GN2A 4BNJA 2D8AA 3K31A 3KUXA 1CIVA 3ZWVA 5FWNA 1JKIA 2G17A 4B7UA 5JBIA 5MGBA 4KUGA 3U49A 4ESOA 2V65A 3JD1A 4I5EA 4UULA 5ES3A 1D3AA 4AJ4A 1ISHA 4TROA 2GUGA 4XQCA 3AM4A 1V3TA 2OBYA 3UFXA 3QWAA 1ZNQO 1EVYA 3ADOA 5GZ3A 4UEOA 2GD1O 4EZBA 4ZJUA 1NQ5A 2ZATA 3I6QA 4RF3A 1UAGA 3AY3A 3Q2KA 3JQFA 3CINA 3AY7A 3VH2A 2DT5A 3RC9A 2ZTVA 2Y0DA 2FP4A 2JD0A 2EKPA 3WOHA 2GRAA 1U7HA 3EVNA 2G76A 3GUYA 4AJNA 2WSBA 1U1IA 1DC6A 1ONNA 3BAZA 4CR7A 4OKNA 4DTIA 5EINA 3G0OA 2HKIA 5JY1A 1PJ3A 3QWHA 2OMEA 3MCVA 3H9GA 1K2WA 4NBRA 5BR7A 4GWGA 1I8TA 5I7VA 1ID1A 1B8UA 4ONEA 1QYXA 4RF5A 2J3JA 3VHRA 4RVUA 2I9PA 1E6EA 3RKRA 3HDHA 4L4SA 1DIHA 1MB4A 1YL6A 2O2SA 3KOUA 3ZH2A 1PQPA 3KBOA 2OHXA 3BIOA 1TA4A 4Y6RA 3IUPA 4NG5A 1DDOA 4J3FA 5C5IA 1KIFA 1YBMA 4J9VA 3V5NA 1LSSA 3DHEA 3LT2A 4RJTA 1I2BA 5BT9A 4G81A 1U9JA 4FB5A 3T4EA 2VYVD 3RC1A 5JDIA 2W98A 5TS3A 1RM0A 1VPDA 4YT8A 3BMOA 3RROA 2QG4A 4YJFA 5G0SA 3GN1A 1CWUA 2JFHA 3BHJA 4OJNA 5L95A 4D7AA 5AOVA 1LC0A 4RPLA 3M1LA 4MIYA 3H9QA 4J4HA 4IJUA 3G1TA 1YKFA 1IL0A 4PLWA 2I67A 1MUUA 2JAHA 2VYND 4L75A 4OOFA 1Y7TA 4GMGA 4LSWA 5JO9A 2IEDA 1B8PA 4IY1A 3LT4A 1TLTA 2F1KA 3AW9A 3PVZA 3WWZA 1ADGA 2BGMA 3ZWNA 3DBLA 1HYEA 5IDWA 2PH5A 4MOWA 2JD1A 1Q7CA 5I9MA 3OMLA 2VHXA 2UUOA 3GF4A 3ZI0A 1IE3A 2B83A 4OGWA 2BELA 3PIDA 2AHRA 3PZRA 4XEHA 3NYWA 4YXFA 2I6TA 1NWHA 2AQIA 1MA0A 4G5HA 4ZQGA 4BO9A 3S1LA 2HO5A 1EFLA 4MP3A 4CPDA 2VN8A 5HS6A 2O23A 4CLXA 4IS3A 3OHSX 3EDMA 4JNKA 3E5RA 4HV4A 4P8RA 4B3HA 3BXXA 5EESA 4PG5A 3HWRA 1VE9A 3AOGA 3O26A 3WGYA 1LTHR 4ILKA 2XAAA 4FFPA 2NNLD 3IJRA 4IIVA 4GH5A 3TFQA 1Q7GA 1X7GA 1LI4A 1F14A 1FXSA 2FPGA 5L7YA 3ZNNA 2PGLA 5FI3A 3G79A 4ALJA 2C59A 4DQXA 1V3UA 5IJZA 4L8VA 3V1UA 2UYYA 4BO7A 2EJWA 4FFOA 4LCJA 2Y1CA 4J1NA 4RVHA 4WLNA 3WFIA 1I33A 3VAZA 4K1LA 1MLDA 1DAPA 4KDEA 2VRBA 3PHGA 4CLDA 1BRMA 1AUPA 3L77A 4QFCA 6LDHA 1NQOA 4P4LA 4JP3A 3Q9NA 4RZIA 2HLPA 4MKXA 1CYDA 2YW9A 3DONA 1H94A 4R68A 4FJ1A 4YACA 4TRMA 2E48A 1C1XA 1WMBA 1W6UA 1ZXBA 2W4QA 1ZCJA 1S6YA 3ETEA 3E8XA 5BSFA 5HM8A 1M76A 4AG3A 2VOEA 4CUKA 1GYRA 4IINA 4XQEA 2D0IA 4B4OA 3I9NA 3FNGA 2EERA 4O5OA 2G82A 1DB3A 3D3EA 4E31A 3N74A 4LVCA 2NTVA 4GPD1 3ROKA 2EXXA 1NM5A 3U4IA 4DGSA 3I23A 4EUHA 1DOHA 1N7GA 4FJ0A 4QX6A 1XU9A 3AUAA 3L6EA 1E1NA 3RUEA 2B4RO 2NU8A 2O4CA 4FD3A 5CEJA 4XDYA 3CXRA 3QRWA 1QYVA 3NV9A 3S2IA 1DC3A 2QW8A 4W9NA 5KTKA 4DVJA 4CLEA 2ZB3A 4XR4A 1NR7A 4WCFC 1BGVA 3NT4A 1HL3A 5COQA 3ULKA 3IAHA 4BNKA 2O7QA 1LDMA 4BGVA 1D8AA 4XYMA 4FQ8A 4Q3AA 3A28A 1I0ZA 2ET6A 1GEEA 2ZTMA 3GHYA 3AOEC 3JQ6A 4B3IA 2E82A 1JDJA 2EGGA 3LK7A 3DHYA 4RPJA 3WSVA 2ZYAA 2O3QA 3ANMA 3JD3A 5TGDA 4BNGA 1EK5A 2DAPA 3GEGA 1NNUA 1OMOA 1Z6ZA 1DAOA 3SEFA 1ZEMA 3KYCB 1QV6A 2EF1A 1VJTA 4DREA 1EEHA 1YE3A 4CR8A 4Y6SA 5TIIA 2PNFA 1ISFA 1U5CA 4PLVA 4UVHA 3WFJA 1PJCA 4OMUA 2HJSA 2H63A 1SB9A 4D79A 4ZN6A 3KSDO 4OKIA 3HNPA 4R9RA 1UJMA 1X0VA 1UDBA 4J16A 2W90A 4MPDA 5DDIP 3RC7A 4S3MA 4JBIA 2WM3A 5KJEA 2DBZA 1E3IA 4YAJA 1PJBA 2GERA 4BO5A 4J7XA 4TMFA 4M55A 3GGPA 2DTXA 4CV0A 1KETA 1N8KA 3KLPX 4E32A 4CMCA 5TQVA 2NQTA 3CZMA 3ZU3A 1H6DA 4NZ9A 3QWIA 1NR1A 3PTZA 4AICA 4YBZA 3PK0A 1I10A 3PXXA 3WXBA 5DOVA 1Z75A 5L45A 2VYVA 1EFKA 1UZLA 1ENYA 5J9GA 4QXMA 2Z5LA 3IP1A 4RORA 1WDMA 5C7LO 5COBA 1A5ZA 2BH9A 2VHVA 4CMKA 3ENKA 7MDHA 2BKAA 2IE0A 5JYFA 2D5CA 3JYLA 4YT4A 3Q0EA 1NPYA 3DOOA 4FR5A 1WWKA 2HSDA 1B0AA 3B70A 4L76A 4ND2A 4NH4A 4BGUA 3U62A 3WB9A 1K89A 2BRUA 2UAGA 4OXNA 1BHSA 1M67A 2E4AA 2FRDA 4CMHA 4YA6A 3STHA 4O63O 2VYNA 1XKQA 2WE8A 1YQGA 4XD2A 1FDSA 4W4TA 3UF0A 1MFPA 5CEFA 4JIGA 1SZJG 1FF9A 3MJVA 1RPNA 3O9ZA 4YAIA 4M1QA 5IZCC 3DMTA 2EW8A 3I9KA 5BNIA 3M2PA 2R2GA 2P2SA 3PP8A 2BFOA 4MINA 2B35A 3BTOA 1H0KA 1HETA 3S2FA 4MIEA 4WK6A 1XLTA 3R1IA 4HFRA 1XSEA 3JYQA 3BMCB 3GNSA 3QVSA 1VL0A 3DAPA 5DP2A 3EUWA 4BNWA 2E37A 4BKQA 3LF1A 2FR1A 3EGOA 1PJ4A 3PYMA 1WP4A 2ZB4A 5HWSA 1KVUA 1J6UA 3CSDA 4Y8VA 3RKUA 3JQAD 3I9MA 1ULUA 2B37A 2RH4A 3GFBA 5TC4A 1Z74A 1C1DB 5KOIA 5A3VA 2D3TA 4HFJA 3JQAB 4MVJF 3VOSA 3UAGA 5JC8A 1OFGA 3VH3A 3H65A 3OH8A 1BVUA 3KXDA 1G0NA 2RAFA 2O2YA 1YGYA 2BLLA 3AM3A 1AE1A 3DBVO 1HT0A 1DFHA 3HDQA 4R16A 3WNQA 1XA0A 2NSDA 4IS2A 4L0QA 3NGLA 1TI7A 1QR6A 4LK3A 2Q3EA 3SJ7A 3BHIA 1E6UA 1L7EA 1U2GA 4R1SA 2Q4EA 3WGHA 4H7PA 1GYPA 2ZYGA 1WNTA 3MJEA 4DPMA 4W7HA 3UXYA 2NVUB 3FI9A 4MDHA 3LQFA 1E3WA 4Q3NA 2J6IA 4NIMA 3ZHXA 3B1FA 1NVMB 5DF1A 4E5KA 3HFGA 1PZHA 2PR2A 1PJTA 2IXAA 1R66A 2Q4BA 1ZVMA 4E2ZA 1WDLA 2C7VA 3K2BA 3IJPA 1M6HA 5BQFA 1D1SA 2P5YA 1EQUA 3VH4A 3OJEA 3C1TA 1QKIA 1LDNA 2FOIA 4P38A 4PLPA 5CEEA 3Q1LA 3K96A 5ILOA 1ISJA 2DLDA 3P2YA 1W73A 5KVCA 4HXYA 1Z7EA 4MVJM 3CPSA 4F3YA 1XIVA 3ANNA 4RLHA 3UH1A 1W0CA 1LDYA 1KY5A 1SC6A 2GSDA 3GZNB 3ZWPA 4OAQA 1RKXA 1IB6A 3JQEA 4F6LA 1WZEA 1NASA 1LBEA 3INTA 3L07A 4GMFA 1DJNA 3VKUA 5CPBA 2P5UA 1HE5A 4QO7A 3SXPA 2DFVA 3ZWWA 4RF4A 5KJ1A 4O6VA 2HMVA 5DULA 3OJLA 3K73O 4F45A 2GZ2A 4B4WA 2B0JA 4FIZA 3K6JA 1DIRA 5CG1A 3PEFA 2Y67A 2UVDA 4ZICA 2QRLA 2DTDA 4Y9DA 1WLYA 1X7HA 1NPDA 2DQ4A 1J5PA 3JQDA 3DMYA 4NK5A 2IYOA 4NQZA 1Q7BA 2FR8A 3KYCA 5ADHA 3V2HA 3A14A 1DHTA 5IDQA 4J7CA 5KKAA 1OAAA 4H16A 4YYZA 4PLHA 5JS6A 4BNZA 3RU9A 3S8MA 5B4TA 4A2CA 1E7YA 4L9RA 2FR0A 2JHFA 3FNFA 1A9YA 3PGJA 2OL4A 3HN2A 2G5CA 1NPTO 4DRYA 4CQLB 4D3FA 4R5HA 1BXGB 1MC5A 3TPCA 1HLPA 5IN4A 3F1KA 3SC6A 1PS0A 4GX0A 4XB2A 1E7SA 1UXHA 4DL9A 3RWBA 2GZ3A 1CETA 2WYVA 1Y8RB 2VTDA 2X7HA 5ENDA 1AXGA 1NX6A 1ZXLA 5T57A 2CF6A 1YS4A 3IS3A 3CTMA 2YYYA 1SAYA 5JAQA 4OO3A 3WBFA 4ZQEA 1Y9EA 2FN7A 4NJMB 4RZHA 3RD5A 4R54A 4UUMA 4LSMA
chains in the Genus database with same CATH superfamily
3G5AA 1RNLA 4B8ZA 5BPFA 5M2QA 1P8JA 2HSEA 2BLNA 2E6UX 4E51A 5FNVF 3KSAC 2J48A 4HEA1 4ZYTA 3IILA 5EJ8A 2J31A 3DPSA 1PTJC 3BN3A 4PQYA 2QLNA 4GF5A 2ID4A 1W44A 3HWWA 3HU2A 4LVUA 1BD4A 2XQKA 1JZTA 3PQEA 1U1DA 3HA7A 2LE0A 3GT0A 3GDOA 2Y76A 3H3FA 2QYTA 4RV4A 3HXMA 2VF8A 3ACBA 3GWZA 1ZIPA 3KALA 4LMPA 3DT9A 1WKBA 2MYPA 1TJ4A 3BIFA 5DVZA 4C7MA 1DZ3A 1S8FA 5BXQC 1OYVA 3MS4A 4XYGA 1EPUA 2GB4A 2Z98A 3WG9A 1K6XA 1SUSA 4R5MA 5FDFA 3GIWA 2JAUA 2DBRA 3ANXA 3CISA 4Z9XA 1L5QA 5EPEA 3UQYS 4D02A 4CL0A 2HQOA 3JYOA 1BCSA 2C00A 1UIMA 4UEJA 4RULA 2VSNA 1ELOA 9ABPA 3AKDA 3ABRB 1M1UA 3D6AA 2BSXA 3HVUA 2FSVA 1PBTA 2AWOA 1T0PA 4BKOA 1SY7A 1KZ4A 2XYGA 4CZ2A 1ZCFA 1BNCA 3NOXA 3LUKA 2W0MA 4BVGA 4ER6A 3NEPX 2J4CA 5ALVA 2DPMA 2MMCA 5KOYA 1WXHA 3DYBA 1XNJA 3ZHCA 5I45A 5IMSA 3GVXA 3IAFA 3Q85A 1KA9H 1IXZA 5KAPA 4XVQA 1GAQA 5AVKA 3DFZA 3TUTA 3EZLA 3TJZA 2PGAA 2YV1A 3LD9A 2UUBB 3T9CA 4UOZA 1KI3A 2GD0A 3KP1A 5KNDA 1IEQA 1RXSA 4MQLA 3IHTA 5ER6A 3RTAA 1NI3A 3QFFA 2FLVA 4K6FA 2ATEA 4CV2A 2P3SA 2W6ID 2OBBA 2XBUA 3VX4A 2CD9A 2DWCA 4JC8A 3VPAA 2QVBA 1NUQA 4MJ7A 1JG2A 3ROPA 2G0AA 2IH2A 3UT5A 1C1DA 1PNOA 4DCCA 3D3WB 4WOJA 3JRNA 4CN8A 5JAIA 1OI3A 1T1IA 2XA1A 3AIOA 3NJ4A 1XCBA 3LX6A 3U7EB 3ZKWA 1RRCA 4ZGWA 3FTFA 4D80A 1WDTA 3B9QA 5E2IA 3MWDB 5J2TB 3NO4A 4MV9A 1XHLA 4BFCA 4JJ6A 1WU7A 2VXCA 5JXJA 2O3UA 1GA6A 1U3CA 1A9SA 1XP5A 2JI6A 3HGMA 3K0BA 1QMIA 5T41A 3RSCA 1E77A 3SG0A 3DCYA 4A2WA 4YHHB 1XDWA 1BOFA 3BE5A 2JANA 4IDFA 5IYZF 1W5TA 1H3EA 2VF5X 1BH6A 1GZ3A 4MUXA 3AKCA 1VJ0A 1TO1E 4EJFA 3FCXA 1NUAA 3EW9A 3Q0IA 4NU8X 1TPZA 2WIBA 4DMUB 1T5LA 2AC7A 5HNKA 2FW6A 2ODBA 1G55A 4FHGA 2HA5A 4L85A 4W9MC 1RWQA 4GPIB 3P52A 4WN3A 3GRKA 1C9MA 4DDTA 1YULA 3H13A 2JDIA 2K4MA 3FJYA 1E5XA 3WZMA 5K0SA 4ZZ1A 5I4CA 4R84A 3CONA 5TT1A 3GP5A 1FEZA 2BONA 4R4JA 1L4EA 2ZSFA 4DCGA 2K2WA 2E55A 2PPVA 3W8DA 3LBIA 5K6AA 3GK3A 3KTFA 3R7DA 2ZBDA 4RGYA 4IUCS 4P4UA 4F4HA 4ZOLB 3T5PA 2XE6A 4JI1B 4CF7A 1HR0B 4MVJP 3GG2A 2I91A 2AKEA 3CVXA 3UA3A 4TV9F 3INGA 1WUHS 1HC7A 3AEUB 1MN6A 1K7YA 2YJ3A 4PWYA 5A0TA 3K8QA 3KKQA 4RVGA 3VO2A 2FTKE 1Q1GA 3HP7A 1HLFA 5LZ9A 3C3WA 4G4JA 2MJLA 5EHXA 2AN9A 4WGFA 4KIUA 2FN4A 1EUCA 2GPYA 3WRYC 3SC4A 4CRWB 4EJ0A 4HVCA 2AVDA 5C8ZA 3L8FA 1T5DX 3L4BA 3QF7A 4OHBA 5JXGA 3W5AA 2WTAA 4G36A 1O7JA 1EXNA 5AESA 1EGVB 2QD2A 4PG6A 3NBFA 3TZHA 2O50A 4DY4A 1GZ4A 2X7JA 3GJZA 1GPMA 4BDTA 2I3GA 1E62A 4IQ0A 4NBKA 1AT1A 3KV1A 1H2BA 3G02A 3ZWMA 3AP2A 2FPPA 3V4ZA 5CB6A 3EBOA 5KTOA 3F5FA 3TIVA 4V2UA 1W25A 3N2ZB 2IXEA 3PE6A 3BQMB 4QJIA 1U0OC 4MVXA 4X20A 5CDUA 3LIPA 5FOUA 3FF4A 3RU7A 4CDNA 1ZHFA 4QYTA 1P7VA 4NCHA 3IAAA 5BV1A 1HYQA 4IEIA 2GZMA 4DMRA 1T0HB 2IY8A 5K3DA 2HUNA 2Y9MB 4KKXB 4MQUA 1EWRA 3QEKA 3ZY6A 1DBQA 3H2HA 5FLXA 3BERA 5K03A 2X42A 4Q4DA 3ICVA 3SYLA 3CF4G 1MGOA 3NHJA 3TLXA 1EXVA 4WUVA 1AGRA 2FX5A 4S0ZA 3EF3A 3V4OA 3WZLA 5L4LA 4WNAA 1K8QA 1DVRA 1RZ3A 4F71A 4CWAA 1XPOA 5B64A 1U4SA 3CRNA 3HZRA 2WM8A 4CQLA 3AF6A 1XDSA 1BXGA 4IDDA 4KW7A 1JG4A 3DPIA 4MTCA 4E7OA 1F2TB 3PIIA 4P36A 4ER3A 4NFLA 2RH8A 1LLDA 2EWMA 2VDMB 3W04A 2GLXA 1GZUA 1CRWG 4QDZA 5HZKA 2AYYA 2HMAA 3I92A 2ONZA 5CR9A 2NSLA 2PKEA 5CHEA 2I6UA 3V8EA 1AQLA 4HY3A 2VJAA 2AJ8A 2GDZA 4OBXA 3VSCA 3WLSA 1POWA 1E4OA 1HDOA 4BB5A 5FP0A 4LCBA 3UB3A 2DHEA 1L4LA 5GM1A 3ZHSA 1SO8A 3F3MA 4WZAA 1A9RA 1IOVA 2FQ1A 1MJHA 3WXMA 2XVMA 1TQ6A 4KB5A 1SWWA 4I9HA 2O3SA 4NBVA 3GUVA 1QYRA 2CVZA 4TV8F 3DUWA 5D6OA 1LKZA 4JKIA 2G40A 3RTEA 2XEXA 3IV7A 1L1EA 3UYKA 1E1QD 1LPBB 1DMRA 1W47A 3SFTA 4BLVA 5IHXA 5KIAA 1P3JA 4YJ3F 1ZGBA 5LKAA 1Y9AA 4CXMA 1T4CA 4RANA 2AD1A 2ZJ1A 1AN9A 1K3UB 4PYIA 3QX7A 1VHLA 1DAEA 3EZXA 2YIJA 5GONF 1W4RA 2F2TA 3LXXA 4J9UE 1XQVA 3GGGA 4KIWA 1CXZA 3E5MA 3QKWA 1KR5A 4E5MA 2NACA 3KOYA 4I66A 2HWUA 1NONA 1FXUA 1TMYA 1GTL1 1GQQA 3T6KA 1PG2A 1DJQA 2XUHA 4A8HA 1Z4IA 3K0EA 3PFIA 4FU0A 2RGAA 3IQIX 3KVOA 4P81A 2WWHA 4TVBA 4F4JA 1G41A 5M04A 2GRJA 4QIHA 5KSOA 2H3HA 2LR0A 2UZ1B 4RY8A 5J4LA 3KD3A 5MF6A 3FNQA 1P2VA 2J6CA 3GXBA 4MGHA 1G98A 3ST7A 2CEAA 4IQFA 5K99A 1BCRA 3DOJA 4KLRA 5FWYA 1G6KA 3MAAC 1N1DA 5JDIC 1GQFA 3EQ8A 5H80A 4KE8A 4X3CA 1GL9B 1DBWA 3MZ0A 2JGFA 1NMXA 3KEOA 3NWPA 4JT2A 4MGYR 4PZLA 2YWXA 4H35A 3VU8A 4MCIA 2CNWA 2P6OA 4HNAB 1H69A 3CKLA 2I8CA 1W75A 2AFIE 3I05A 3FHLA 2Z2YA 2XBMA 5L7WA 2XZTA 2XE4A 1FA9A 2YMQA 5HRUA 2GJ4A 3AR4A 3LA8A 1UC8A 2OCBA 2FUKA 2OKCA 2JIZD 3LHKA 2BN4A 4JQSA 3WMEA 4CDRA 1ACMA 2CNKA 2P9BA 4OFBA 5J47A 1ONPA 2PIDA 4BCBA 1MX3A 1H2AS 3FCOA 4TMTA 1VDMA 2H07A 2Q7DA 1PEDA 2YYZA 3SSMA 3VPDA 3KQWA 2H5EA 3I04A 5BP7A 5LD2B 4U3JB 1KTVA 3C3XA 2DGDA 1EFVB 2HT6A 2NV0A 4KLCA 4RXUA 5JNUA 2ZIXB 4HDKB 2OILA 4DVGA 6REQA 5EIXA 2Q5IA 3AUKA 3W90A 1NDUA 1PWYE 3O03A 4I4TF 3EG9A 3UGQA 4DR7B 1WMAA 1YKGA 3B12A 3D59A 4PQGA 1USUA 1QLJA 1VI6A 2QJRA 1YZGA 2HDHA 4YQYA 3UHFA 4LC0A 1P4RA 3KJNA 1T2EA 1I1NA 4KXXA 4YV2A 2CV2A 3MHPA 4EPVA 5AVVA 2YJNA 1HG1A 3LCRA 3LRXA 5ALGA 4S1NA 1Z33A 4UVIA 3BF7A 5A4DA 5JATA 3LO5A 5CFOA 1WKCA 3BGIA 3QX9A 4HH4A 1UKEA 2Q3DA 2IXBA 3SYTA 3V55A 3FR8A 1UEJA 2JZCA 2I7DA 5JQWA 2ZTUA 5LYJA 1M2EA 1P9WA 1MV8A 2X6QA 1OA1A 3B3FA 1NW7A 4JT8A 4O8JA 1O95D 3DFUA 3E8MA 3VC2A 4CMIA 2O7NA 2EKQA 3ETDA 3MWEB 3ONFA 4ABYA 1KZ9A 3PXBA 4ZAGA 3L01A 4WOCA 2DG2A 3OQPA 4KX3A 3EGVA 2C7BA 4QWWA 3ZQUA 4HGRA 1UDAA 4PPYA 4AXBA 2ZCUA 3QEBZ 2IBTA 1T26A 2GVNA 4E22A 2HEIA 3CN7A 3DTYA 4ZVUA 1UM9A 4IVNA 1DWQA 4GUDA 2ADMA 5CIYA 4OJYA 2RH5A 3C5EA 4UFNA 3HBJA 3EAFA 4BKUA 3LY7A 1KC3A 3E5NA 4ZHSA 3E23A 1XTQA 4CI9A 2C2GA 3LCUA 4B6OA 3OLZA 1Y5IA 2X5XA 3A2KA 2CZQA 5AXDA 4QBKA 1TD1A 2O59A 4LF6B 4QFMA 3DA8A 2REOA 3G5TA 3I3OA 4DW8A 1E6LA 1DCMA 1CS0A 2F8SA 3GZ4A 4HLCA 5LA6B 3CRMA 4RH0A 5ALNA 1OBVA 4KO8A 3AK4A 4KTTE 2WKPA 2WM2A 3A4TA 3MMXA 3PQ4A 3B6ZA 3X0DA 3EYAA 5EJEA 4S1OA 2ZK7A 2GPWA 3EW7A 1MXFA 1M5UA 3NS7A 3FX2A 3P8ZA 5EUQB 2YXEA 1CDOA 1R8XA 4B71A 4F3NA 4KE7A 2UYOA 1TJ5A 4FXPA 3ITEA 1VL6A 2CUZA 4V03A 3SOZA 2AE1A 3DTVD 3WLQA 4RTQA 4YRBA 4EKIA 3IERA 1SQ5A 1QTQA 5B7PA 3I73A 4UKDA 2XCQA 2FDRA 3W7BA 1DFIA 3LCJA 1A1SA 4QBTA 1UXJA 1O6GA 3A70A 3I2JA 4HAXA 1XT6A 1GP2A 2GEKA 2ZBQA 4ANFA 2PUVA 1AF4A 1TYCA 7ABPA 2C7PA 4UZSA 5JJBA 2NU6B 3A3YA 4FIDA 4FMDB 3WA7A 5IARA 1K6IA 4RE6A 4C7OA 5IK2A 4EKDA 1ZD4A 1ONOA 3KQYA 1QX4A 1EK6A 4PEVA 2C99A 1TYZA 2YOGA 3KSBC 1SEPA 1N2GA 2X0IA 3MMSA 4E5PA 4A5OA 3K0KA 5LKRA 3DBRA 4G8CA 3UCXA 4RA9A 5DW3A 2WZBA 1S02A 3B1KA 1Q0QA 2XT6A 1LQUA 1B00A 3DEYX 5BVHA 1XP8A 1EX9A 1URPA 3N8KA 3QGMA 1Y4ZA 2AEJA 3Q3GE 2C61A 4ZD6A 3NVAA 1J33A 1H05A 4R3UC 1B14A 5D00A 3WYBA 2CHFA 2QOEA 4XWAA 2HJRA 2D6FA 2B7CA 5C1IA 3DC2A 4S1PA 3S4YA 1YZQA 3N3AC 3HKEA 1IZ9A 4X95A 1Z2DA 2P2LA 5LLDA 3CVUA 1USKA 3MGGA 2OBLA 4MUMA 1MJNA 2PBZA 2J0UB 3WB1A 1TT5A 1KK0A 3PA6A 5HS4A 1D2HA 2O7VA 2JGMA 4OSEA 5IC4A 1MP0A 2JD2A 1KEKA 3GP8A 1G8PA 5DBGA 3MRVA 3QVXA 5CDFA 3P9ZA 3P4UA 3SHOA 2YWRA 1SJ9A 4TL8A 4MUHA 2R6AA 3MRTA 4ACAA 2PKQP 1SCJA 4M99A 2VAXA 4ZREA 2NP6A 4DZRA 3FWZA 3MOSA 1PP4A 3MMPA 4HB3A 4LF7B 1EBFA 4KIJA 4S1VA 2QYOA 3N2KA 5BN4A 1A27A 2HRCA 2IKQA 2QI9F 1LEHA 3SHFA 3ZW7A 3D8BA 1QHYA 2E85A 5F7XA 4N48A 1JG3A 2CHEA 1NBIA 3IQGX 5AKYA 3PHLA 1FBTA 3RVPA 1B6RA 2VWPA 4GOXA 2H06A 4J16C 3SLKA 4BNVA 5EQJB 4C4AA 4C0BA 3CW9A 3WHPA 2VLIA 3PQDA 2CNBA 2C8KA 4GP7A 3ZNOA 2NZUG 3OEHA 1HEUA 1G4HA 1X7DA 2NVBA 3UA4A 5TR9A 3DKPA 3T7SA 4MW9A 1E60A 1PEAA 1KEPA 3ONWA 2CC2A 2BH2A 2I1VB 3NTXA 4ZQFA 2F9MA 1U7PA 3NTUA 3OJWA 4TXJA 1ZCBA 2CJWB 1PZMA 5GP1A 3UMFA 3DFMA 1KH3A 2W2OA 2FCAA 3GJ8A 1SVLA 1UQUA 1XN4A 2EJUA 3GROA 1RYDA 3V4PB 4O89A 1ZO8A 3W3AH 3MELA 4ZOCA 3MWJA 4JP1A 3JV7A 4LOKA 4B79A 4EY8A 2Q5FA 2X1VA 4BO2A 1H22A 3H6GA 3PJDA 3NWEA 3E7PA 4ZTUB 1A7KA 1UWKA 3GVIA 1LK7A 2A9KA 1HLDA 2O0HA 1ZAKA 1OZAA 1R6BX 3OG9A 1II8B 2DBYA 1ISPA 1S96A 2PGJA 1UMKA 1ZN9A 2MOKA 2V7UA 1DIGA 4QQNA 3ZCPA 5KYXA 2BTQA 3SM3A 2I3ZA 3BQ9A 4Q9NA 4QOGA 2AN5A 2OWEA 1JEQA 4D0RA 3NETA 4RIGA 1GSAA 3DNFA 1ETUA 3V7UA 4F1WA 3DZIA 2FAXA 3SBOA 1P2BA 1RAEA 5DT9A 1H4VB 2HBYA 3M6FA 4BFYA 4YRDA 3TOVA 4AZ3B 1JDBC 5K0NA 3VKHA 1AXEA 1ZUIA 5GJWC 2B4YA 1DAFA 4TOIA 2OM6A 5IEJA 3H75A 2I4TA 1CUFA 1DV2A 1A7AA 4W9RA 4EP1A 3NEJA 4LJSA 1CULC 1GUYA 3VISA 1O0CA 4MDFA 1E92A 3DO6A 4V0RA 1CRQA 2YXNA 1E7MA 1HRKA 1W4CA 1JR3E 2XNHA 3L93A 3D4NA 3PHCA 2A1TR 2XTJA 3N86A 3OTQA 4LYGA 2OXIA 4POAA 1SGWA 4DJEC 3SHQA 3SMVA 4XSGA 2CF5A 5C1DA 3SY8A 2OFPA 4LG1A 2QTNA 3K6SB 4NOMA 2VJOA 3GGJA 4CHTA 1ACLA 5IZ4A 1DSSG 3CF0A 1NVVR 4QUGA 3ER6A 2KJQA 3GAZA 3QF4B 1QIDA 4FBGA 2GK7A 2WTEA 4G0MA 2Y0CA 1X8LA 1YC5A 4PGHA 4S35A 2QG9A 3QKTA 1KOJA 4YMUA 5KYWA 2B4TO 4B3MB 3OU6A 1AB5A 4Y2GA 1INLA 1KJ8A 5C32A 2M6RA 4AWXA 3DL7A 1JUDA 5JV5A 1FMLA 2HFKA 3OUUA 4Q82A 1OC2A 3SYMA 5CRIA 3IQDB 4GRIA 4FWTA 3I1JA 3VQTA 4BAGA 2BEWB 5LZ2A 4JP8A 2BYTA 3TZKA 5F73A 1GU7A 3IL2A 2GXQA 1S7CA 4IDBA 4C30A 4B4VA 5K6TA 2XOEA 5BSWA 2PV7A 4C7JA 2AZTA 3WGUA 3SVTA 3VHXB 1JU4A 3OX1A 3ROFA 4CNQA 1BWRA 3IDOA 3IUYA 4RJJA 4AX8A 2FH5B 2BJHA 2NV2B 3CSSA 4HGNA 4M38A 4BUJA 4YCDA 3KQUA 2G5PA 4GKKB 3E0QA 1LV7A 4LGMA 5MN4A 3AJEA 3KR2A 4IP0A 4UUBA 3IWDB 1HYHA 3L8DA 1V39A 4NMHA 5T4BA 4QXPA 5BW6B 4NCJA 3JCZA 3FVWA 5BY2A 1SRQA 2I1WA 3NZEA 4Y18A 4FI3C 1T9KA 3BMXA 3HK2A 1YC2A 4PBSA 3LBHA 5B3AA 2V7QA 2HDWA 5G41A 2ECFA 1E5LA 3DDCA 3D3NA 4GBJA 3WGVA 3EQ6A 3VR2D 5C18A 2R8ZA 1TZMA 4RDHA 1LWNA 2Y27A 4TUYB 1QVZA 3BAFA 2WDPA 2ZOSA 3REQA 4Z4HA 1I4EB 1GGHA 2X1LA 4PYOA 5AVOA 4M4SA 5H3HA 2CL0X 4UUQA 4FM9A 3RUAA 5L6LB 4BS9A 3TV1A 1ZMXA 1DBRA 1VE3A 3M8KA 4RTJA 3FVVA 4YHBA 4GPZA 5IXJA 3DOFA 1FFAA 2WY2D 2FKNA 3MK31 3P0HA 2D3WA 3RS5A 4BMPB 3D31A 2IHYA 4JR2A 3WLHA 3THYA 5ALJA 5EQDA 1QHNA 4QUIA 4QRIA 1SB8A 1BS9A 2IHUA 3B2EA 5LZ4A 3TW3A 1Q84A 3DDWA 2ZI5A 3ZZNA 1GR1A 1VZ3A 2JFVA 3EXG2 3K0FB 2CK3A 4Q3BA 3PFKA 5G1NA 3DTTA 1J24A 1HX7A 1GPLA 1VGVA 1XZAA 2AMVA 3G8YA 1G3MA 4O4LB 1U8FO 3E81A 4F7WA 1BKYA 1FYXA 4II2A 4D97A 1NW6A 2PJUA 4JOSA 4K28A 4L15A 2E5FA 4CLHA 1BC5A 5EE9A 2EIXA 2AFIB 1DELA 4MULA 1BWQA 4AXXA 2C7QA 1NJGA 5SZIA 4ALNA 1SBIA 3UM9A 1CUEA 5ER9A 2YVLA 3OZEA 1C8KA 3PDJA 4QL3A 1BX0A 3O92A 2WZCA 3L6CA 4JUCA 4LTMA 3IOBA 1V8BA 4AUNA 4YPVA 4G0UA 2CXSA 4MWOA 1NBOA 4QOEA 1LX7A 2IZ0A 4JB0A 4L6AA 6NULA 3DZFA 3F98A 5CTAA 2YV3A 3H7AA 1RMQA 2H16A 1AUOA 1CZUA 4AIRA 3HXQA 4LJ7A 5AUOB 3UJ9A 2DQSA 3V4RA 1YDWA 1O57A 4EYGA 1ZOLA 4TKMA 1L8AA 1EGAA 5D3ZA 2Q5JA 2OEPA 4GIBA 5EYPB 4I0WB 5HF8A 4ZC8A 3V00A 3WS7A 3VZRA 3ZXSA 4RVSA 3IUMA 4JAVC 5FOVA 1JQLB 3N58A 4IDCA 4QDOA 2FHSA 2I03A 4RDXA 1JHRA 4KFUA 5DCYA 1MV5A 3TTSA 4CKEA 5LOVA 5D5PA 4EJSC 1ZD8A 3TAUA 5KQGA 2F62A 1IXYA 2PGNA 3PL5A 1R5BA 2A5YB 4FE7A 4LYFA 5JMPA 4OQFA 1EE2A 3MSCA 2FSFA 2O3RA 1IRIA 3BHMA 3LNTA 5I9SA 3BXGA 3PQVA 3BE8A 4FT4A 5ICMA 4IV8A 4GOND 1BXRA 1CK4A 2DERA 4CTNA 3LFTA 2BFFB 4Z9AA 1PJSA 4KRYA 2ZJAA 3DBIA 2C31A 1G20A 1JE0A 2NO7A 2FHPA 1DKPA 1WDWB 2OXTA 4JA0A 2DBQA 2C20A 1PGPA 2BI4A 1UADA 5E6SB 3LVRE 2WIAA 1JVNA 4RD6A 3OZ7A 2EFEB 3U7QA 2V1UA 4NPCA 4F11A 3VTFA 1R2QA 3BRWA 4Q4AB 2CXQA 4J43A 1J0DA 2X9VA 1JXAA 3VZDA 2PTGA 5I7OA 1JQBA 4HDAA 1WMDA 4KQ6A 4D4KA 3G1UA 3WAGA 1JI0A 2N3ZA 3HXPA 3KOZA 3BTVA 3A1SA 5K09A 5BSTA 5ICSA 5HF6A 2Q6VA 3GOHA 5EN4A 1F3LA 1B3BA 2EBFX 1BCRB 1I6KA 2VJMA 3DLTA 1Z73A 3R7WB 2IHKA 3IP3A 4G1UC 1P0PA 4KQJA 1DGQA 4O1MA 4BNNA 2WHYA 4EGJA 4J6FA 2VH5R 1DX9A 5E0OA 4F4UA 5K0BA 4IMRA 4KAAA 3CW8X 5D3QA 3WK9A 1NE2A 4R1NA 4WLEA 2O8DB 4B3JA 2DSNA 5JNTA 3DZBA 4P0TA 2IV3A 1R6TA 1D03A 4UHCA 3PX7A 3GJTA 3ONDA 4I50B 4JR1A 2A4KA 2LDBA 2Y8EA 1E3DA 3O95A 4M1OA 1C41A 2OHVA 4OXYA 5LC1A 1FPQA 1OQAA 3WLMA 3MCAA 3WAKA 3R7NA 3ADPA 4TYYA 2VT6A 3CG0A 4ER5A 2XTNA 3BB1A 3GGDA 1MOSA 1LSOA 1KH2A 2E18A 3BIXA 4IGIA 2E4XA 5I7AA 5TQ2B 1YJQA 3AR3A 3FIUA 3K9NA 3VR5H 3GJSA 5F1OA 4UUNA 1C0LA 3DE3X 3BD7A 3EXFA 2DE0X 4IXDA 4OREX 1PFGA 2XECA 3QNWA 2AR9A 4HEJA 2HA7A 4EUNA 3WJAA 4FQ7A 2OLJA 4MV4A 2XYRA 4LXXA 4O4JF 4B46A 4RTKA 1KYYA 2WFMA 3PNPA 3W1VA 2JIQA 3ZGLA 1KAGA 4M8IA 5CDTA 4L6IA 5G0VA 1UOQA 4HAWA 4WDQA 4REOA 5M3BA 3WYDA 5LJLA 2QPOA 2JLYA 3W79A 5HXAA 3T12A 4YCLA 4UD6A 1K8YB 2COEA 4D9GA 3PRKE 3CZ9A 3QUAA 1SUIA 4RSHA 4XQGA 3E61A 4LDAA 4WINA 3HKDA 3WLNA 1UP7A 1NNEA 3O8QA 2GTPA 1Q92A 4JROA 1WY7A 3CN9A 1P3Y1 1TIBA 3ASVA 4U2CA 2WJPA 2RG1A 4DLBA 1VJGA 2PSEA 3C3KA 5TT0A 4D2IA 3FE2A 2A30A 1VLVA 3T0FA 4AK1A 4F3RA 1YQXA 2DY0A 3B38A 3D5QA 3E22B 4W8GA 5AI6A 3VYWA 3FWYA 5FUYA 1CUAA 2BUBA 2O5RA 5JWOA 3NDBB 3Q3CA 4HAZA 4YMWA 5FL7A 5JZ9A 3TSZA 2QTBA 3VNUA 1F7UA 4AN1A 1OSNA 1H2YA 1C3JA 3RVKA 1PWEA 2FF7A 3KVNA 1ZIDA 3LUPA 3C24A 4QRDA 3AI3A 4NENB 2BFMA 1TUBA 3ZZMA 4CMAA 1YCHA 4U8HA 5CH5A 2RHGB 5EJIA 4DCVA 4E4RA 3R4VA 4QVKA 1G8GA 2BHRA 4OQNA 521PA 1Y81A 2CHQA 2LPMA 3OTOB 1L5OA 1BA2A 4DJ5X 3LZCA 2Z8YA 1Z0AA 5CHYA 1VKHA 2WWGA 5KVAA 2JAQA 4LY0A 2ILTA 5CA0B 1N9ZA 5F7ZA 1YZKA 1ZCZA 3DKRA 4M1EA 5I9NA 1P1JA 5IT9A 3RLFA 5HJ7A 3G17A 4XX0B 5JYAA 4IV5A 2P3QA 1UAYA 3V34A 4COOA 1SUEA 3DDUA 3GCXA 4YYEA 4WCFB 4Z54A 4DLWA 3L2OB 1OXXK 2HMTA 3H0VB 4CGYA 5EIEA 2X40A 2AN1A 3IKLA 4IHJB 1WBDA 2EEPA 5IM4F 2AF3C 2NZXA 3JD4A 1HMPA 4G09A 2H2AA 4KMOA 3ZXIA 1BWSA 3I8XA 1R9GA 1L4MA 3VPGA 5F51A 4YRIA 2B8NA 2GYUA 1M6EX 2V4ZA 1FQWA 1P1CA 1XTRA 3L7CA 4GRDA 3OZRA 1X15A 4O4IA 1UK8A 3LQYA 5J1TB 5CB4F 3RSZA 4KLAA 4EI9A 2JLVA 3WK5A 3EUEA 2YQ4A 2QU7A 3HBFA 5FPHA 1F2UA 5FEUA 2B7LA 4B7CA 2R8RA 3LECA 3SSAA 4AX4A 1NQUA 1M1NB 2D0PB 2NU7B 4BVHA 3IDFA 1CU1A 4UJ5A 1X7XA 4HNGA 1EEXB 3S68A 1L1FA 2G9NA 1OZ0A 2CMHA 1PL6A 3Q6IA 4HOYA 5M5BA 4IH1A 1YZFA 2HWYA 4I4CA 2E4VA 3UG6A 3ZJTA 4JVNA 4WOBA 5ICCA 3IRVA 3U4QA 1V1RB 2A6PA 4P93A 2V8OA 3ZHQA 3RU2A 1R0ZA 4CCAA 5HQJA 5F64A 2HCBA 1Z8FA 3TW8A 1Z88A 3KQHA 1PI3A 2D2VA 2FOLA 4K9QA 1UJ5A 4H1HA 2B98A 1QKJA 2M6KA 3WHIA 2EGHA 2W4MA 3NALA 1CCWA 4MIKA 5K4GA 3AH8A 1FJGB 4LZPA 3GGOA 4Z1MA 1QJ4A 4PAQA 4BZXA 1FNCA 3CR7A 1E2BA 3EOAI 3TMKA 4RDIA 2H18A 3DEIA 2ZYWX 3VKVA 3OF3A 1RWNA 3FMVA 4ARAA 2ZWIA 2QG6A 2QTCA 1FSFA 1NULA 3D2LA 3ZUGA 2FZGA 3NFRA 2Q21A 3ASYA 4ZCRA 4OHUA 3C4QA 5LL6P 4ZPJA 4PICA 4Q9HA 2QV0A 1RRVA 2C5LA 2HWXA 1IC6A 4TZTA 1HH4A 5JD3A 4O3FA 3N05A 1AA9A 4AU1A 2AC2A 1JR6A 1GTSA 1VYVA 5ESWA 2CW5A 3G85A 3TEMA 5C7IO 5BURA 1G16A 3OCUA 4N3CA 1TA9A 2ZRNA 3NEYA 5EE1A 5JG7A 1T5IA 2KWIA 4PF1A 2OFOA 3BGWA 1TK9A 1YKSA 5F5LA 5C35A 5KS2A 1QP0A 1SKYB 3BVPA 4NYMR 3VTAA 4QPCA 4IZ6A 5BYBA 1E2LA 3UPDA 4FEEA 4TMXA 4CEHB 4EK9A 4MGIR 4I2NA 1WULS 1YR8A 2PH1A 4BJ1A 3NDPA 3C3PA 4E7PA 3DZ7B 1Z4QA 1RHRA 2I3BA 2PZGA 5C34B 3T5GA 3CEAA 1R0SA 1U4OA 2YWEA 4DXDA 2IWHA 1UMDB 1CQJA 4F60A 2JPDA 2ATIA 2VNSA 2JASA 4PHTA 1VJ5A 1KPGA 2P78A 3AR7A 4HUQB 1ULHA 3MGBA 1J4AA 4B33A 3B1JA 4KV9A 1KQ3A 5ENVA 3RK0A 3U3JA 1I9CA 4MRNA 5IBPA 4TYNA 4DDMA 4MLDA 1FLNA 3PLRA 3IQWA 3E3OA 4TN1A 4ZYVA 4HQOA 2A88A 2A94A 5C1BA 1NQXA 5JVDF 1JLHA 1EVIA 3AB8A 2PJDA 1OBCA 1E3QA 3PRJA 2WTXA 3EVDA 3SXUA 5EG5A 3PGLA 4ZI2A 2OO5A 4WD3A 3WFJA 4WK0B 4I9GA 4K87A 1YQWA 1Z35A 2R7LA 4HTAA 2IUUA 3DHNA 2C8VA 1P39A 2H17A 3CBQA 1H6AA 3GL9A 2YUTA 1GDHA 2ZBUA 4JMPA 3G9QA 2M1ZA 5A71A 4AN0A 2WFLB 3MN1A 4ABTA 2IUYA 2J3DA 2VH2A 3BE6A 3E1KA 3INNA 4ID3A 3NH9A 3WLKX 4OSOA 3MFYA 1F5NA 3GLFB 4QBGB 3PFNA 3UPTA 4R3WA 5IJ9B 5TVKA 3GFRA 1DC5A 2I6XA 2ZIEA 4BVBA 2AFVA 2LIPA 2P62A 2J07A 4DG8A 3MJCA 1VKZA 3ITNA 5E6UB 1G18A 2AG5A 3K05A 4RFSA 4M0CA 3LDHA 4BDSA 3RU3A 4BN5A 4IDOA 3CZRA 2K6GA 4M87A 5G4KA 1IBCA 1TM7E 5FBRB 4MJXA 1TK3A 2XSZA 1H1LA 2FRXA 1NP7A 5FA6A 1VCMA 4BFSA 1N77A 1P5RA 1Q5PA 1CUWA 1F4VA 3DAGA 3F8WA 3ZLUA 4Q9DA 4BNIA 2PZLA 2J9RA 3UWOA 1Q0UA 1G5HA 5AICA 3KGDA 2YVKA 5DNWA 5BRAA 3WYCA 1PSZA 1QE5A 4CIYA 2GASA 1VKRA 3DL2A 1Z45A 3VJRA 1ODLA 2FZ4A 3DE7X 5D51S 3U4MA 1Y8QB 4QG3A 2OAGA 1BHJA 3GMTA 4C07A 1U0RA 1B8VA 1A2OA 2OLKA 4OXKA 1G8JA 1H65A 1XI2A 1U2DA 2LD4A 2Y1GA 4GX2A 1TZJA 2GGSA 2V0CA 4DWVA 1COWA 4DUYB 2YASA 4HATA 1X1DA 2ZZKA 4XGQA 2F3RA 2QX7A 2RMKA 4XWYA 1BTOA 3HCWA 5HPYB 3PUZA 4A10A 2IY9A 1DTEA 2WSIA 3AERB 3FPGA 2PUAA 4FCCA 4H7DA 2XOKA 2ZB7A 4X64B 4RIHA 3U44B 3AC0A 4LQDA 2JG3A 3NVKI 2RHDA 3TVYA 2B1GA 4IVPA 4ZVVA 1AO0A 1W4AA 2RKWA 2WD7A 4WJZA 4I55B 1KEEA 4JX8A 1NVEA 3L05A 2VYQA 1OFIA 2NYUA 3IDAA 3IEIA 3NJRA 2YC4C 5K0TA 2QR5A 3GR6A 4DLUA 2HLHA 4N5LA 4Y2RA 4G1VA 1QV7A 3AR8A 3BSWA 3FW1A 2ANCA 4OGKA 5EZYF 2FSSA 4UFPA 3BZUA 4M2LA 4XYEA 5K3FB 5SZJA 4F4CA 2PUDA 2YZNA 4QUJA 1OTXA 2WIFA 1JWBB 3NVMB 2OO3A 1P2FA 5F1PA 3TI9A 3TINA 4ES6A 1NVWQ 2B4QA 3P9RA 2HHCA 4UBOA 5D3MA 3I8OA 3Q7IA 3P96A 3DVQX 4HZUA 4MO2A 4TSRA 2GF0A 4H60A 4YRLA 4ZI5A 1HG0A 1GV1A 1M74A 5JIBA 2P27A 4M88A 2W70A 2HU8A 3FNHA 2R97A 1MDBA 2ZUCA 1DC4A 1YZHA 2BKUA 4TTJA 4LXYA 1QPZA 4G0WA 2H57A 2H5IA 3ODGA 1IQ0A 2IPMA 1U2PA 4PX5A 4YUWA 3ZGZA 2MDTA 3KR0A 2WVJA 4L1KA 2XCRB 2JLBA 3HXLA 2H4WA 3S99A 1RLMA 5LYYA 4NFHA 2H4JA 1YJBA 2PTHA 4QE3A 3EEIA 3PHJA 1UKAA 3RTGA 1XX6A 1JLLA 1R64A 1EFAA 4D5EA 1IZZA 4JY7A 2LDXA 2VF2A 1UH5A 2G9ZA 2I2BA 1RQRA 3EXHA 3B6IA 2XF8A 3N5KA 3QYJA 3WLLA 2W2LA 5JFOA 2D0DA 1EFPB 2XV1A 3HM2A 2HYDA 2VDNB 1L2TA 3QW2A 2YXLA 3GMSA 3EWIA 7AT1A 5EJ6A 1CTQA 4NTZA 4RJLA 4V3BA 1QLHA 1UKCA 2C94A 3B3QA 4JBLA 5AMXA 3IIJA 1JXMA 2DPLA 5CAEB 1RI2A 3U4GA 2DEUA 3WGIA 2WD8A 4QM7A 1PKEA 4I3GA 4HF7A 1U81A 1PNTA 1O9GA 4AM8A 2XMBA 1RKUA 2VJPA 1NP3A 2Y99A 4BKMA 4WASA 1JWAB 4E1AA 2IKSA 4KO1S 3H1EA 2XLCA 1YZ3A 1SUAA 2WYIA 1TEHA 4I4LA 3UJPA 2X76A 4K9OA 5HP4A 1E4EB 1PNQA 2XUZA 4PM4A 2DR0A 2Q1XA 3AUUA 2C4TA 2YINC 3H5AA 5ALLA 4PZ9A 1WZCA 4ZI7F 2AMYA 1GZ5A 3U4DA 1O03A 3NIDB 3V6LA 4XKJA 3B7GA 3H1PA 3RGWS 1FU8A 4YASA 4ZYWA 1LU9A 4IH4A 2ST1A 4CM4B 4GSKA 5DTQA 1K98A 3BCRA 3EPAB 5CUQA 3Q7EA 5I5EA 1FW6A 4JI0B 2SICE 2NQ8A 3H9JA 1XMQB 1G5PA 1XRNA 3ME5A 4NMWA 1CZOA 3A1NA 3EFOB 2B0CA 5ERYA 2D7JA 4U2GA 2H1LA 3UK1A 2PV0A 5HDBB 3RSLA 2J3LA 4JKYA 1F0KA 3CPHA 1V71A 1BOOA 2VUIB 4JLWA 5AW1A 5BQ5A 1NTRA 2DVMA 3G2IA 4KSBA 5JFTA 2GEFA 4P7BA 2G5TA 3GW8A 4A8JB 5CA1F 3M4XA 4MCJA 4CM8A 2E4UA 1IXKA 1Z9BA 3WRXA 1Y3AA 5BN3B 4O2LA 1P44A 3ONNA 1WM1A 3IV9A 2SBTA 2QLLA 4YJHB 3BDVA 4HKTA 1V16A 4PNPA 3LM8A 4XZ3A 3VVLA 3TNYA 4D57A 4MVJD 2AMFA 2BRUC 3BL8A 2BD0A 4PCAA 2ZQ5A 4Q9KA 4KOAA 2JGDA 4KZPA 4N7JA 5AW7A 3R3UA 5J4HA 2XMGA 2IUFA 3DJYA 4LCEA 5IH7A 2AJDA 5BYJA 5IVDA 1H6CA 1EGMB 1TJPB 1XA3A 2QSZA 4EKEA 3ONVA 4AZVA 3T5AA 4AF7A 4BVJA 4INZA 4CT4B 1HE8B 5GMOA 5KU1A 4TL9A 5IAAA 4FCTA 3DYVA 3MJFA 3A7DA 4D8XA 2O5EA 2Y2UA 3DCIA 3QQPA 4P34A 1DTWA 4D9NA 4HPXB 1Y80A 4OYLA 2C3OA 1DKRA 1I5OA 3L4JA 3U56A 4JI5B 1E5QA 3QKSB 4AFNA 1N78A 8ADHA 2Q1SA 2X0JA 1FTGA 1QHXA 3QBTA 4U00A 1RQ7A 2PZKA 4UC0A 5INTA 3EP9B 2F90A 4K8OA 4TWIA 1ISIA 2RHTA 3K4HA 1M2GA 3VR6H 5CM8B 4KPFC 1KJYA 4MVYA 2FPLA 1ND5A 3I9JA 3JWIA 4AJHA 2ZRIA 3G7UA 1E5DA 5FORA 3UZUA 1KFKB 5JSZA 5H3CA 4L3VA 1NWCA 4C4TA 4YCMA 3FVRA 3TYXA 1FNMA 2QW0X 4Z51A 4LYAA 3MTEA 3D7LA 4QRHA 3PQFA 3UMBA 2OG2A 1PJRA 1U7OA 2D4HA 1ENOA 1PGQA 3B13B 4A0RA 4BMNA 4A92A 1DLIA 5J58A 2HK8A 3KYBA 2DR2A 4JV5B 3TK1A 3F4BA 5I9LA 1FNNA 4FYWA 5THKA 3PXGA 4IIBA 3H0WB 1JZSA 1SD5A 2Q41A 4OI4A 1JQKA 5ECGC 4DJJA 4W5RA 4KL8S 4TRJA 1SXPA 4ZZIA 2G80A 3MSXA 1N2CA 2PO5A 3DLCA 3EVEA 4UM7A 3L6UA 5H70A 1UL1X 4RTNA 1V4BA 1OFTA 3AYZB 1YR2A 3HYLA 2QIOA 4Q3LA 1PIWA 3LAWA 2OAQ1 3FLEA 5AI8A 3LBYA 4NAHA 4ED9A 4RK5A 1KDRA 4H3KB 3JR3A 2N9UA 2MR5A 4LDQA 1U2GC 2O19A 1BJTA 1N57A 3TLGB 4PQFA 2GR9A 2GVDC 1EXWA 2HIHA 2PS0A 3BRSA 3LMKA 4RKWA 4U7WA 4W1QA 4YY3B 3E53A 4GL2A 5JJIA 1Z6YA 5JD5A 3S70A 5JZMA 2IQIA 5IXSA 5AO9A 1OFVA 4B32A 3HBAA 3D7NA 3UV7A 5JT1A 2MMGA 5K3OA 4M89A 1OLOA 1IUNA 1TQ8A 4V24