3QV1A

Crystal structure of the binary complex of photosyntetic a4 glyceraldehyde 3-phosphate dehydrogenase (gapdh) with cp12-2, both from arabidopsis thaliana.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
337
structure length
337
Chain Sequence
AKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Selection and Folding-upon-binding of Intrinsically Disordered Protein CP12 Regulate Photosynthetic Enzymes Assembly.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase/protein binding
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic
total genus 116
structure length 337
sequence length 337
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.2.1.13: Glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating).
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qv1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qv1A01
1BXKA 3INRA 3JD4A 1Y9AA 1Q7BA 4BMNA 4NIMA 3WB9A 5IXSA 5IAAA 2EKLA 5I9NA 4OXNA 2HMSA 3KETA 2FSSA 3CMCO 3W4KA 3ZWNA 1M67A 4MVJE 3IMFA 4JJFA 4BKRA 4FW8A 3WLFA 5BSEA 4W4TA 3CMMA 1CQIA 4W99A 4OXYA 1A9ZA 3EUWA 3F47A 1NXQA 3HWRA 3OA0A 4O1MA 4NBVA 1DAOA 4R01A 3F1LA 3KO8A 5KCZA 2IE0A 3RFVA 1ADFA 2QG4A 3DL2A 4N7RA 5TX7A 2VUUA 2EEZA 2JFHA 3I1JA 3INTA 4AJHA 3CPSA 5TF4A 3ANNA 1RM4A 1K5HA 3N74A 4IGEA 4ESOA 1HZZA 4WCFA 1QV6A 4ZVVA 4M89A 4B7CA 1DXYA 1CEQA 3LLSA 5ILOA 2D3TA 1GDHA 3A4VA 3JQEA 4A2CA 2B4QA 4CLOA 4GLOA 4MVJF 5T73A 1UAYA 2W2KB 1I3LA 4G5HA 4OSPA 1EEHA 2O3UA 2V6FA 5BSHA 3HJAA 2VHXA 2EIHA 5AOVA 5G4KB 2A9FA 4I9UA 3PHHA 1I32A 2AQHA 5A1TA 1G0OA 1N2SA 4R5MA 4FFPA 4BV9A 1WAMA 2UVDA 1KIFA 1PJBA 4HV4A 4IMPA 4DA9A 3C7AA 4QQRA 3Q9NA 5KKCA 5CDUA 3FNHA 2CDCA 1BXGB 2Q22A 2AG5A 2Y0CA 2DUWA 4J91A 3D4PA 2X6TA 4PIVA 2IXAA 4MOWA 4IZIA 2HUNA 1DRWA 2C20A 2ZQYA 3UCFA 4M1QA 4BIIA 5EQFA 2I5PO 4D79A 2BELA 4GSKA 1LI4A 4BO5A 2BFAA 4ZGWA 3GN1A 4E3ZA 1PGPA 2G76A 1R4MB 4Q3NA 1Y81A 2IZZA 3TZCA 4TZKA 2EG9A 1NFRA 3GDOA 1NYTA 2DBRA 3DTTA 5L4NA 2HU2A 2E4AA 1LDYA 2GN8A 1PGOA 3PJEA 1PJ4A 4I9HA 1SOWA 3OA2A 3HZZA 2B4RO 1CRWG 1V3TA 3FR7A 5I7FA 1JLLA 2HRBA 3C85A 4MPDA 2HDHA 5AXBA 1DLIA 3DDNA 2IZ0A 3C1AA 4UUOA 3W6UA 1U2GA 3GR6A 1YL6A 3JQ9C 4OKIA 2O3JA 2ZTMA 3QY9A 3JCZA 2CUKA 3PHJA 3UCXA 1R66A 1HSZA 4YJFA 5I7EA 1I10A 1PJCA 1HL3A 2CVZA 1R12A 5A5FA 1QORA 3K31A 4IDDA 4C7KA 2JJYA 3AI1A 3WYCA 4TRMA 2FR1A 1IOLA 4D0RA 3GAFA 4HNHA 4N5MA 2JHFA 5CEEA 4GI2A 1VLLA 3MOIA 2B83A 2IYPA 4D3DA 1GUZA 2CFCA 4GKBA 3H9JA 3RUFA 4PLTA 1ZEMA 3NDRA 1DHTA 3MWEB 2VYVA 5G2OA 6LDHA 4E2WA 4IMRA 3UH1A 2BHLA 1N92A 1LNQA 2JAHA 2OO5A 1HYGA 1U3VA 5JC8A 3D4NA 3PP8A 1Y8RB 1O8CA 3E5RA 4KOAA 3D3WB 1NPDA 3OJLA 1A9YA 1JW9B 2AEJA 5ENDA 3EW7A 2FR8A 4L8VA 1UAGA 1DFGA 1K6XA 3A1NA 3CSDA 4N5NA 4GKVA 3JTMA 4BO6A 1NAIA 1VL8A 4J7CA 4A0SA 4IQ0A 2Q45A 3PQFA 4EZBA 3DWFA 4HWKA 3TWOA 1MLDA 1IHYA 2I76A 3WTBA 1X14A 4IDFA 4O6VA 4ALIA 1Q2XA 1B26A 3WMXA 5JYEA 2ZCUA 4J4BA 3V1YA 2JCVA 2VRCD 1DRVA 1AE1A 4XKJA 4DBZA 3JQFA 5C7OO 2O23A 1J6UA 4GPD1 4CMIB 4PG8A 2NNLD 1FMCA 3QE3A 5COBA 5TIIA 2NTNA 2EGHA 4ND3A 1R16A 3OIDA 3DFUA 4MIEA 2WD8A 4BNZA 4OSOA 3L0DA 2O7QA 2DKNA 1X7GA 2ZYGA 2FR0A 3NJ4A 1GYRA 2V7PA 3LYLA 3LF2A 1GEGA 2Q1UA 4IS2A 2GNAA 5DBIA 3VDRA 2DU8A 3TF5A 4B3JA 2NVWA 1WVGA 1PGNA 1E3IA 3GY0A 3IKVA 5B12A 4EBFA 1NR1A 2Q99A 1PR9A 4IIUA 1BHSA 7MDHA 2GZ1A 5EESA 1E3LA 1V35A 3OM9A 2CNBA 4DIFA 4ZJUA 2B35A 4WE3A 5IN5A 3AM5A 2BF7A 3VAZA 4R16A 3ZWOA 5JYDA 2Y67A 1GTMA 2PA3A 3WSWA 1J5PA 2FPGA 5ITVA 3WFJA 4E12A 1K6JA 3JQFC 2ZB3A 1SEVA 3AOEA 1XU9A 5DCYA 3L4BC 3B1JA 1I24A 2GRAA 3QRWA 5B4VA 4YBZA 2WYWA 4CMIA 1TA4A 3JQ8B 2CF6A 1HRDA 3RC2A 1PX0A 3QW2A 3C24A 4IDGA 4YEDA 1F06A 4II2A 2XF8A 2NU9A 5IN4A 2ZTUA 1M76A 1NASA 4M49A 5KVQA 1B16A 2HK7A 3DBHB 3K2BA 5EQDA 3PFWO 5DF1A 3QIVA 2XOXA 3R6DA 5ES3A 3ZHBA 5F3RA 1DIRA 4F45A 1IZ0A 4G81A 5G0UA 5IDYA 5ADHA 3PYMA 1TVEA 3E6AA 1ZXBA 3DMTC 2IEDA 2RH8A 3KYCA 4XD2A 4PLHA 1KC3A 1P77A 1E5QA 1SOVA 4HFJA 3N58A 4BNGA 4Z0TA 1ISIA 3VPXA 2UAGA 1OC4A 4KZPA 1DIHA 4RZIA 4CJXA 1T2FA 3BIOA 3GUCA 4RPKA 1NWCA 3IDSA 4NBWA 4XR9A 4J2OA 2F1KA 4IY1A 3QV1A 2VNSA 4Z9FA 5F1KA 4J43A 4AG3A 3CEAA 5KKAA 1YL5A 5TQVA 5B1YA 3VOSA 1FDSA 4XDZA 4Z9YA 5HS4A 3NTOA 5AXAA 3ITDA 1L7DA 2PGDA 2XXBA 2Z1MA 2X22A 3H9EO 4RVSA 4DLLA 4B4OA 5LDHA 5J9GA 4ALMA 4O63O 5EINA 2PGLA 5HS6A 5EPOA 1I2ZA 3DZBA 4PLYA 4U0JA 3DZHA 2X5OA 3PDUA 3S1LA 2C2YA 1C0KA 3D4OA 1FDVA 3C1OA 4J0EA 1QYCA 3IUPA 2IODA 3OMLA 3D5TA 3I23A 3MJSA 4LSWA 1HDRA 3F5QA 3Q0EA 2EF1A 3ZNNA 1AN9A 3F4LA 2DTEA 3GVCA 4AJKA 3WGHA 4PN3A 3DOOA 1DDOA 4XJTA 3DBRA 1O94A 4CUKA 3PZBA 3IP3A 1MUUA 1LLQA 3KM0A 4HFMA 1GAEO 1JN0A 3OHSX 4AJ2A 2GCGA 1R4MA 2OP0A 4C7JA 4D7AA 1MG0A 4Q39A 2O2YA 2OFPA 3EAGA 2NU8A 2J3HA 2VUSA 4CM6A 1KY4A 4H16A 1C1DA 1KVQA 3EYWA 3TN7A 1RJWA 2AMFA 2EERA 1B14A 2LDBA 1E1NA 4D43A 2B5WA 5FWNA 1GPDG 1Z7EA 3PHIA 4WJZA 2V65A 4DC0A 3WGIA 1I30A 3MEQA 5DZSA 5TT1A 4D44A 4JBIA 5ICMA 3L6EA 4RPLA 3RU7A 5KTKA 4RF3A 4CV3A 3JQ8A 4LCJA 2CDBA 3VH2A 1KETA 4QT0A 2ZJ1A 3WTCA 2YJZA 1MV8A 3K5PA 3BYZA 1HDCA 3IS3A 2X9VA 1IY8A 1EQUA 1YJQA 3NV9A 4E21A 5JY6A 3Q1LA 2XAAA 2D2IA 5DCWA 2P68A 3CKYA 3V1TC 4ILKA 4U5QA 3OJ0A 2AE1A 2BFMA 4BL5A 4RGBA 4J1NA 3OFSA 3UVEA 1LDGA 3HDHA 1EBUA 4XCVA 2ZATA 1VJ1A 2PH3A 4ZU3A 5FFFA 3BZUA 2P9EA 1VL0A 4RPGA 4BQRA 5BR7A 4CV2A 2H1SA 4KTTE 5KJ6A 3KYBA 1Q0LA 2ZCVA 1RM3A 3VC7A 1Q7GA 1EUDA 3D64A 4EITA 1VKOA 2WSBA 4FFLA 4N18A 5A04A 1P31A 2FOIA 4ND1A 3KYDA 1HF3A 2HKIA 2GN6A 2R00C 3KLMX 2YV3A 5FF9A 3BTUA 3ZN2A 3SLGA 2QRKA 1PJ2A 2AE2A 4AJJA 4IGFA 4NU6A 1E5LA 1IB6A 2J3JA 3SBOA 3TZHA 1KVSA 3KTDA 5THQA 4GVLA 1EBFA 2EHDA 1UZMA 4YR9A 1WDMA 3GC6A 4FCCA 5HM8A 1P1IA 2F00A 4Z3KA 2I99A 3WWYA 3OQ1A 4ZHSA 3W4IA 3X2EA 4CMHA 1B3RA 4DMLA 3CINA 3DBLA 2P9CA 5CDTA 3HG7A 4UVIA 5JXWA 1BWSA 5HWSA 2OBNA 3P7MA 1TI7A 4OAQA 5T64A 2OUIA 3PQEA 2FN7A 4JCOA 1E7MA 2X0RA 2Y1DA 3JQAA 1VE9A 1GFSA 3F4BA 3I9KA 5L95A 2I65A 2VWPA 1NP3A 2E6UX 2GGSA 4BO2A 1U5AA 3IKTA 1R0LA 3LC1O 2HQ1A 2X9GA 5T6BA 4MVJH 3FWNA 4UEKA 4P4NA 1NQOA 4E32A 4KUEA 4ZQFA 3WMWA 1SAYA 2HAEA 3ANMA 2W90A 2HJRA 3KHUA 4NJOA 3ZHYA 2BRUA 2VOJA 3O03A 1PJSA 3QSGA 4CM8A 4CR8A 3GEDA 1TXGA 1ISHA 5TS3A 1KOLA 3ASUA 4B7UA 4NH4A 3L77A 5IZCA 3ONDA 2NLOA 4LN1A 4HFNA 5H81A 1L7EA 3QLJA 4QFDA 1QRRA 4FIZA 2O3QA 1GZ3A 2C07A 2WTBA 5AXDA 3F6YA 2P9GA 3DOJA 4W6ZA 3RROA 4PLCA 4ZQHA 4A73A 3LZ6A 5T5QA 1EVZA 5CDSA 1EFLA 4EGFA 3U5TA 4XGIA 4UULA 1K2WA 1QYDA 2OBYA 3V5NA 1BXZA 4EJ0A 4J49A 4DWVA 1E1MA 2NU7A 4JXKA 3NT2A 3PHLA 2YUTA 3VPSA 3BAZA 3O4RA 3RD5A 1YB4A 3U4CA 3KEOA 1N5DA 3G49A 5JFOA 3ZZNA 3T7CA 1B0AA 4WOJA 3WIEA 3KSZO 3NJ8A 3WX0A 5DNAA 3PWZA 2YQ5A 4F3YA 1E3WA 4IXTA 1P44A 4IIVA 4W9NA 4A03A 4CM8B 1DIBA 1TT5B 1RM0A 5C37A 2VHWA 1PZGA 4Y9DA 2EKPA 3FBTA 4HNGA 4UAGA 4MJLA 3TOXA 1AXEA 2Q1WA 1X7DA 4CMEA 2YHIA 1D1SA 1D1TA 1FF9A 4FB5A 2XPCA 3H2SA 2AHRA 3U62A 2YDXA 5EN4A 4PZCA 1ZK2A 4INAA 3I9MA 3MJVA 1TT7A 3PEFA 2X0IA 5U9CA 1ZKMA 3BMQB 5KVVA 5U4QA 3RUHA 3LC7O 5K6AA 1HXHA 4WCFB 3NYWA 2NQ8A 4UUMA 4WEQA 1CDOA 4HY3A 2DT5A 1YONA 2Q2VA 1UZNA 2IXBA 4AFNA 3DZJA 2QYSA 4NJMA 2W2KA 4NFYA 1KYQA 2A4KA 3E48A 3W8DA 1IHXA 2J5RA 4ZQEA 3RUCA 5G4KA 5JE8A 2JAPA 1R0SA 1H2HA 1RPNA 4K6FA 5F1PA 3VKVA 1Z7BA 3AY7A 3FF4A 3GLQA 3C1TA 1LRLA 5J23A 3LF1A 5A9SB 1ULSA 1LEHA 2XXJA 4URFA 3ETDA 4DQXA 5TGDA 3DBRB 1LDEA 1LLCA 3WGGA 1AXGA 1Z73A 5DP1A 3DFZA 3SLKA 4A27A 1SB8A 1I36A 3GNTA 3DBLB 1KEUA 1EUZA 2WM3A 3W1VA 2JKVA 3K92A 1G6KA 1P1KA 1EZ4A 4BNNA 4ND2A 3W8FA 1LU9A 1IYZA 4P22A 5TNXA 1DB3A 4BMSA 1F17A 4JBHA 1E7WA 4AL4A 3B20A 2EP7A 1WLYA 1ISGA 5F1OA 1NVMB 3ZHXA 2E49A 4ND4A 4Z6KA 2EP5A 2GSDA 3VH3A 3SVTA 2VYNA 2IZ1A 3GN2A 2D5AA 2WE8A 1X1TA 3ENKA 3FPLA 3WLEA 5BT9A 4CL3A 4ZD6A 4MVJA 3PJFA 1A27A 2J5KA 4FS3A 1ARZA 2FHSA 2OGUA 4D3SA 1Z45A 4GQAA 2FPPA 3EZLA 2ET6A 2EW2A 1JA9A 3ZWWA 5FYDA 5CAEA 4IZHA 5EIOA 4PG4A 2EXXA 4R1TA 1KEVA 3OEWA 2C7GA 5KNLA 1KVUA 4BNLA 4QFCA 4TRNA 1PWZA 1QLJA 1YQXA 2I67A 1HETA 1W4ZA 3RC9A 1U28A 1V6AA 4JGBA 4M87A 1DHRA 3WSVA 5KIAA 3ABIA 3MWDB 5CEFA 3H8VA 4GH5A 2OZPA 4TQGA 4YAKA 5K9ZA 3IAHA 4ND5A 2PZKA 1E0DA 2VYND 1EDZA 3GQVA 3R3JA 4KDEA 4KUHA 3AI2A 3PIDA 3S8MA 2P5YA 5B4UA 4MIYA 1O6ZA 2DUUA 2ZYAA 1Q7CA 3DHNA 4CODB 4LRSB 1ORRA 1KC1A 4FOSA 1W73A 5T57A 2UDPA 4P4GA 3ZV4A 1GV0A 1Y8RA 3D3WA 4G2NA 3S2EA 4BNIA 4CLRB 4CM1A 3BMOA 5B4TA 2Y99A 1H93A 1T1SA 1DO8A 1ZSYA 5A06A 3I4FA 2POQX 1ADGA 3AY6A 1GY8A 1ZXLA 4ZQBA 3JQGB 4BNVA 1GD1O 2PZJA 4CUJA 4RF5A 2Z5LA 5DT9A 1XG5A 2VQ3A 4JK3A 4XYMA 4CL8A 4MP6A 1ZMOA 4BNWA 1PZFA 5CHEA 4OQYA 4DTIA 3FBGA 4WASA 3ZWVA 1FDUA 4YXFA 2CZCA 1U2DA 1H6BA 3OEYA 3ZWMA 3GDGA 2DQ4A 4KUGA 2NVUA 3W4JA 4NI5A 3GA0A 3SC4A 3L4SO 3WYEA 4CM7A 3GNQA 1LDBA 4GWKA 1HZJA 7ADHA 1WPQA 4ZICA 1K89A 3NEPX 4XWYA 3NGXA 4R68A 1N9GA 4RDHA 3UOGA 4BGUA 3EK2A 1F0YA 1N7GA 3H5NA 2VRCA 4AJOA 3E9NA 3C7CB 2PY6A 4UUNA 1BVUA 1ENYA 4KWIA 2PZLA 3OETA 3FNFA 2Y1CA 4YDRA 1NAHA 3SJ7A 5JDCC 1BSVA 1P0CA 1Y6JA 5CEJA 3EHEA 3WGQA 1I5RA 4PGFA 1S6YA 3KSDO 1PIWA 1PS0A 2RHRA 1JDJA 2PKQO 3K96A 4GBJA 3VH4A 1QR6A 2DM6A 1UR5A 2ZB7A 1YOVB 2HJSA 4DREA 4H7PA 5JAIA 1LSSA 1ZH8A 4WEOA 5CPBA 3OF2A 1OZAA 3HB4X 4FC6A 2VCYA 1CQJA 4U6SA 3A14A 4Y6PA 5BQFA 3U4HA 1E6WA 4J6FA 4FC7A 1EE2A 4FFOA 5C7IO 3JQBC 1CERA 1JKFA 1NX6A 3E5MA 4OHUA 4MKZA 5IF3A 1E7QA 3CZMA 4YYZA 2IRWA 3EZYA 5CG1A 1NPTO 1AUPA 2DAPA 4K9DA 1K6IA 4OL9A 2X4GA 3TL2A 2VYVD 4J2HA 1R0KA 4FD3A 2EW8A 4OMUA 4XB1A 3MZ0A 1SO8A 3IUSA 4WLEA 3E8XA 4OJNA 3QWIA 1IPFA 4B8WA 2A94A 3R3SA 3LT4A 1MFZA 1DLJA 4FFMA 1DJNA 4M55A 4PCVA 4GGPA 1GCUA 4QECA 4EW6A 4PLGA 3KVOA 4GAEA 5IJZA 4J9UE 1D7OA 1CIVA 2X86A 1ZJZA 4OM8A 1NVGA 5AXCA 3GH3A 1NR7A 2AEMA 4CR7A 3ADPA 4MIOA 4CQMA 5JLAA 2BFPA 4Y6RA 3ANLA 3DZGA 4YB8A 4YAIA 3IJRA 4XB2A 3ZCXA 3NT4A 3G0OA 2VUTA 3B70A 1BG6A 3DEYX 1NFFA 2J8ZA 2P5UA 2PD3A 3OP4A 5L45A 1OOEA 4LK3A 1T4BA 5M6DA 1LQTA 3ZV5A 5T67A 4LGVA 1C0IA 3JYOA 1X15A 4E5MA 3U0BA 4JP3A 5KJ1A 1PL7A 4FR5A 1UZLA 1D8AA 3AM4A 3PLRA 4I9NA 2OL4A 4YT5A 5JMPA 5U1PA 1I3MA 1U1IA 3I9OA 1FJHA 4DPLA 2IDZA 4ZN6A 4K26A 3WQQA 1ISJA 4P8RA 3ZWYA 4YWJA 1CYDA 1NQTA 4L76A 1UXGA 4YT4A 1ZUD1 3DHEA 1N7HA 1WNTA 4FPXA 3JQ7A 3AFNA 5IZCC 3H9UA 4TWRA 3UAGA 2FY8A 4Y98A 3GVHA 1KY5A 1U8FO 1ZVMA 3W8EA 3ST7A 1YL7A 4QSMA 2PZMA 5CG2A 2AG8A 1QYXA 1UXJA 1MXHA 1UJMA 1WWKA 2G82A 4BUCA 2CY0A 4RVHA 3UHAA 2Y1OA 2E48A 1E3SA 3C7DB 4XYGA 5TSDA 5EL0A 1XCBA 2GLXA 1QLHA 4IJVA 3GZNA 5THKA 4TKLA 4BNXA 3BMOB 5IDQA 3O8QB 1P9LA 3O38A 8LDHA 5JY1A 5I7VA 3GMDA 3QVTA 1HDYA 5K6AC 1VPDA 1C1DB 1EMDA 2WD7A 4AJEA 3G79A 3GDFA 4KQXA 4MKRA 1SNYA 4M54A 3AI3A 3UN1A 3K9QO 4TZTA 2FP4A 3QVXA 3K73O 3BMNB 4CLEA 4OH1A 2VWQA 3D5QA 3R1IA 1O89A 4XYBA 1R4NB 1A7KA 3AOGA 3H65A 4RV9A 1ZFNA 2Q46A 1YXMA 1ISFA 3ZW8A 5G4LA 3WS7A 4E13A 1LA2A 3NRCA 2O48X 4TVBA 4ZRNA 3GRPA 2RAFA 3ZGYA 2TMGA 5JO0A 5TJHA 4D42A 2JCXA 3WBFA 4MVJP 5L7TA 5ILGA 1GU7A 2FZWA 5IG2A 1DC3A 2X5JO 1PS9A 4S1VA 1LC3A 3I83A 1O5IA 4Y67A 1YB1A 3JQDA 5HBRA 1LLDA 3ROKA 1P1RA 1U9JA 2P2SA 1E6EA 3RAJA 1PJLA 4XGNA 1B8VA 1HYHA 3JV7A 5AQ1A 2I6TA 1MX3A 2VZ8A 4LVCA 4TRJA 3LC2O 3OSUA 1JU9A 3D0OA 1A71A 4C4OA 4CMAA 3ZWAA 4BNFA 3L4BA 5JYFA 3AJRA 2DTDA 4IJWA 4OGWA 1LQUA 4PRKA 4W82A 2YFQA 4BO9A 1ZK0A 3FD8A 1DPGA 3JQBA 2FMUA 4AJ1A 2GZ2A 3B1KA 1H2BA 3BA1A 4EEXA 3NT5A 4L4XA 2AA3A 2AEFA 5BSFA 1XEAA 2Y05A 5HA5A 5KWEA 3GAZA 4IJUA 3ZI0A 2R6JA 4MDHA 1CETA 1ONPA 1YOVA 1UXKA 4W7HA 5KJFA 1X0VA 2D8AA 3EMKA 1YRLA 5H82A 4EEZA 1C0LA 3DQPA 2ZIZA 5JCXA 5JCJA 1YO6A 4FFRA 3RJ5A 5G0TA 2IEBA 1LDMA 2Z1NA 4R1SA 2FZEA 1XELA 1YQDA 4DPKA 2GO1A 4DYDA 1H94A 2PFGA 2JD0A 3PRJA 4J16A 4TKMA 1HE3A 4NPCA 3JQAB 4E5PA 5L9AA 2O4UX 3VHRA 2VNAA 3DOCA 2HLPA 3IIEA 2VZ9A 9LDTA 2OHXA 1J49A 2GF2A 3ICPA 5L4LA 1PJ3A 4Q3BA 2Z95A 2JL1A 1NHWA 4FOOA 4BNYA 4DUPA 3IL2A 3VPFA 3V1UA 3WWZA 2J3IA 4IM7A 3DAPA 3WOHA 3GEGA 2G17A 3ULKA 4EI2A 3BTSA 1WDKA 2PD6A 2E37A 1QYVA 3TFOA 1ENOA 3Q11A 1MA0A 4E33A 3GG2A 2D0IA 4J7XA 5IXYA 2W98A 3B6ZA 1ISMA 2PKQP 1ID1A 4Q9NA 4DIOA 1BDBA 1QG6A 4CV1A 4E5YA 1PJTA 2CSUA 2QZ9A 4QX6A 1M75A 1IE3A 3SXPA 3S2GA 1DC4A 4HKTA 4J1TA 4YJDA 4Z3DA 2GYYA 2Q1SA 2G5CA 3F5SA 4DC1A 3GRKA 2UV8A 3E1KA 1HDXA 1RWBA 1UP6A 3R0IA 4HFRA 5KOIA 5L7WA 3PHGA 3LT2A 3SC6A 2PR2A 3G1TA 3H6KA 4E2YA 4AVYA 1HE2A 4DLAA 3Q3CA 4NDNE 4UVHA 3HUDA 2QX7A 5LDGA 3H5AA 4BKPA 4CM4B 3ZNPA 3PFFA 2BKAA 1ZCJA 1PQUA 4MVJG 2X0JA 1U7HA 2WD7B 1GQYA 1MFPA 3RSHA 5AVOA 4JLWA 5FI5A 3S55A 4FQ8A 2JD1A 5K0ZA 4CLDA 3UUWA 3E9MA 1TT5A 3BMQA 3I9LA 4JNKA 4CPDA 3FNEA 1YBMA 1T2AA 3UFXA 3JQAD 2SCUA 3P2YA 5A9TA 3GVIA 3WDSA 1KERA 2NV6A 4R3NA 1LSJA 3K6JA 1E7YA 4J4HA 1WMBA 4OO3A 1UDAA 1YBAA 1U3UA 4WPGA 4RQUA 1RM5A 1QYWA 4XRRA 1YB5A 3GEMA 3M1AA 1DFHA 2FWMX 3WQRA 1A4IA 2OORA 2PH5A 1LSOA 4P38A 5A3VA 4A5OA 1NHGA 2WJPA 5JW6A 3GFBA 4ZA2A 5JAZA 2YYYA 1GZ4A 1HSOA 1I01A 1VJTA 3A9WA 4K6CA 4O5OA 1V8BA 4ALNA 4R41A 1VRWA 4XQGA 1T1RA 1IUKA 1P1FA 1RKXA 1YBVA 2ZQZA 5TT0A 2AQKA 1I3KA 3VVCA 5A05A 3L9WA 3N7UA 4R4JA 1LXCA 1N8KA 1B15A 4B8ZA 5ITWA 4YACA 3TPCA 4BGVA 2UYYA 3BHIA 3OH8A 2ZB4A 3PWSA 2QRLA 4WOKA 2IYOA 1GADO 4MP3A 4CLHA 3U9LA 4MO2A 5GMOA 2FSVA 4YA6A 5EJ2A 1Q1NA 4FJ2A 4A26A 3TFQA 3I9NA 1IZ9A 3I9JA 4EUEA 5A4DA 1V9LA 2NTJA 4KWHA 1ENPA 2E82A 1K0UA 1YGYA 3TSCA 3GHYA 3RC1A 1P45A 4CM5A 1VSUA 4BQPA 1MP0A 2GN4A 4U8GA 3COSA 5IZ4A 1GCOA 4A10A 2WWRA 4OIMA 1UUFA 2A35A 3MJ4A 1GL3A 1LX6A 4YAEA 3HNPA 3TZQA 3ZU4A 1VJ0A 4CLOB 1OBFO 5JBIA 2WYVA 3HDJA 3NDJA 3L6OO 2I3AA 4PVCA 3CXRA 3JD3A 5C3MA 2Q50A 3KUXA 1WZEA 3EGOA 3KLPX 3RI3A 3AY3A 1T2DA 1MB4A 4CMEC 3JQ6A 1E3JA 2YDYA 4NHEA 3JD0A 2PD4A 1SB9A 3AUUA 4IUYA 4NJMB 1IPEA 2H9IA 3ZU2A 3W6ZA 5FI3A 4EUHA 4BO4A 3VDQA 2A92A 3BTVA 2QQ5A 1KVRA 3DHYA 1HLPA 1XSEA 3RC7A 3V2UA 4G65A 2BGLA 1E3WB 1H6CA 1ZZEA 4Z9XA 3VZQA 2DBZA 3Q2IA 3VPHA 4BKOA 2JFFA 4GVXA 2WDZA 3ZV3A 4ONEA 3HFSA 4PRLA 3PZRA 3RCBA 2W4QA 5I8ZA 3ETEA 4NK4A 4CQLA 4IQGA 1H9BA 5DBFA 3TQHA 3I3OA 4U0KA 3AWDA 1YWGO 2YHIB 2NSDA 1EUCA 2J3KA 3ONEA 5EERA 1GV1A 4O59O 2O3RA 1U8XX 4XJSA 3KSUA 1NQAO 1A5ZA 4XIYA 4DXHA 1OFGA 2P4QA 4IS3A 5CDGA 1YH3A 4ZQGA 2X58A 1X1EA 3GGOA 3M6IA 3RJ9A 1T24A 3HN7A 3K30A 1ZSNA 4BNMA 2Q2WA 3GGPA 4YAJA 1A7AA 3MJEA 2HMVA 4B4WA 4PG7A 4YRBA 4QO7A 2Q4BA 2C59A 4P4LA 2I3GA 3EDMA 5EMHA 1GYPA 2YHUA 4CM9D 2VHVA 3LU1A 4FDAA 1E6UA 2B69A 3RUEA 1NQ5A 2UUPA 3H9GA 3KOUA 4Q3EA 4AJ4A 3M1LA 3ZDFA 4E2ZA 4UEJA 1HKUA 3DAFA 5G0VA 3MTJA 4YJHA 5I7SA 3RIHA 1T2CA 3MCVA 4TRRA 3FHLA 4S3MA 3HE3A 3MJCA 3I52A 4LW8A 2B0JA 4PZEA 1SZJG 2Q2QA 2BLLA 4ITUA 2O3SA 4NU5A 3QVOA 4II3A 3JD1A 4JQCA 4YRDA 3M2PA 3SX2A 1U3WA 1WXDA 1WP4A 1XLTA 4Q3DA 5DDIP 1WMAA 3NX4A 3ZH2A 4WCFC 4IJKA 4F6LA 2CD9A 1Z75A 5COAA 4CM4A 4DRYA 1P1HA 4W7IA 2C2XA 3IC5A 3DZKA 3KZVA 4LSMA 4RORA 1E3EA 3GPDG 4Q3CA 1ZW1A 3MTGA 3U4IA 5BNFA 2WMDA 4WK6A 4YQZA 3WGZA 2NTVA 3D7LA 4WLVA 5ER9A 3LQFA 2PLAA 2X7HA 2AW5A 2P91A 3DTYA 3UW3A 3G17A 1BTOA 4CLXA 1V0JA 2NADA 3KBOA 1QMGA 1PWXA 1H6AA 1U3TA 1XWFA 4UEOA 1WW8A 4XYEA 2DVMA 1QKIA 3CIFA 1F12A 1HTBA 1GEEA 3FRJA 4B4VA 3Q2KA 2HSDA 1J0XO 2V6MA 4FGSA 4HUJA 4R54A 1NWHA 2NU6A 1LC0A 2HMUA 3KB6A 4I5GA 3RQSA 1CF2O 4CMGA 5AYVA 1I0ZA 2FRDA 1JKJA 1ADCA 4UVEA 1NM5A 3ZWCA 2VN8A 2R2GA 1A72A 2O3TA 2ZB8A 1NNUA 5JYAA 2J5QA 3ITKA 3VPGA 1EVYA 1W6UA 2GASA 4PLWA 3LVFO 2AXQA 4E5KA 3ZW9A 2CF5A 4L75A 3K8ZA 4WLUA 2B5VA 4J1QA 1NTOA 1WZIA 4WLOA 1HWYA 3I5MA 3AUSA 3WGTA 4RLHA 3WFIA 4DYVA 3B1FA 1JVBA 3GG9A 4WNIA 2HK8A 3QWBA 5DN9A 4F6CA 1XA0A 2PK3A 1GQQA 2VRBA 3GK3A 3RKRA 5DULA 3C8MA 3DZIA 2BI7A 3A28A 4RF2A 4J3FA 2GDZA 2GD1O 3DO5A 4B7XA 5JDCA 1KEWA 4YCAA 5B37A 4LMPA 1PS8A 3QQPA 4YJHB 2W8ZA 5I9LA 2Y68A 3FR8A 3GUYA 2QIOA 5TLSA 3C3XA 4IDCA 1SBYA 4GSLA 3PJDA 4XRGA 3EVNA 2I66A 4IDAA 1JWBB 4AJPA 4E30A 3I6QA 1T2EA 2D59A 2NUAA 5IFLA 4MP8A 1ZNQO 4OQZA 3WXBA 3ZWBA 2BI8A 4QUKA 3T4XA 2G0TA 1NFQA 2DPHA 4I1IA 3OJOA 1U4SA 2O50A 1PL6A 4KP7A 1T25A 1JAXA 3OBBA 1R15A 1M66A 3DZFA 3PVZA 4GGOA 4KDFA 2VT2A 1M6HA 4NFSA 3CUKA 3ICCA 3X2FA 3HQ4O 1MGOA 1LLUA 5JMWA 2NVBA 5JPIA 5JDIC 1IULA 3WGYA 2NACA 3GPIA 3ZNOA 1C14A 2D5CA 4WCDA 4CMJA 1ZK1A 1XQ1A 1B2LA 2QW8A 4LVUA 2Y1EA 2R00A 3A06A 3QP9A 4HBGA 1H0KA 4WUVA 3JYNA 4QXMA 3DAGA 1R4NA 4KQWA 2HO5A 1EK6A 2BMAA 4XGKA 1EQ2A 4XYLA 1F14A 3GZ4A 4PG5A 3IJPA 4CQMB 4NG5A 4EJ6A 1JVSA 1XHLA 3ZHZA 1BW9A 3IP1A 1X13A 5KJEA 1FDTA 4BO0A 4UREA 3MOGA 2NM0A 1XU7A 5CDYA 1ULUA 3WG9A 1P3DA 5TRTA 3DC2A 1ML3A 1Z6ZA 1P1JA 1Y8QB 4K1LA 3ZU3A 1SC6A 3GT0A 5GZ3A 4PLPA 5JDIA 3PYLA 4ALLA 2QRJA 3RBVA 3RUAA 3S2FA 4CMKA 1I33A 5JAMA 1OI7A 2ZKLA 3VVBA 5BNIA 1DJQA 5DOZA 4R9RA 4BMVA 1HE4A 3GMSA 2Y93A 3IQDB 5CPFA 1ADBA 2BD0A 2C82A 1GUYA 3D3EA 1KEPA 1BDMA 2GN9A 2X5KO 3PK0A 1UH5A 2W2LD 5L4SA 1H6DA 1SMKA 3F46A 3NUGA 4XZ3A 1N1GA 1B7GO 3WYBA 4WLFA 4MINA 1LTHR 4IDBA 3WJ7A 1RYDA 3WBBA 2VTDA 3DBVO 3DR3A 3T7EA 1PQWA 3KXDA 3H2ZA 4BKQA 5GZ1A 4JP2A 3DB2A 3AM3A 4NFHA 1AHHA 4MVJI 3HHPA 3VTFA 1EVIA 4WLNA 2DBVO 1UP4A 2TMDA 4U6QA 1TEHA 4IBOA 4J1SA 4R3WA 2DFDA 3WGOA 2QYTA 4NBUA 4D45A 2Y0EA 3TDKA 4DMMA 1HEUA 1MC4A 3OIGA 4D3FA 3DMTA 1WDLA 3RUDA 4E0BA 4R5HA 3FPCA 1PU2A 1I2BA 1V3UA 2H63A 3H5RA 2ZTVA 1PQPA 4NR0A 5BNTA 3CZRA 5MDHA 1C3VA 4R1NA 4NNJA 1CJCA 1GZ6A 3AW9A 3F9IA 5GZ6A 4ALKA 4TMFA 5I8WA 4RZHA 1LUAA 4YQYA 4DL9A 4RF4A 3UCEA 3FTPA 3BMCA 4BGIA 2OP1A 2WEKA 4FFNA 3PJGA 3K2EA 1HLDA 1B8UA 1H5QA 3HFGA 3WNQA 2EGGA 2DFVA 3MJTA 1VKNA 4BKUA 1GUFA 1PZEA 2Q49A 1Y9EA 5DCUA 4PG6A 4N5LA 1XIVA 3LDHA 3SJUA 1CWUA 5KVCA 3NDIA 4B3HA 3PPIA 5ER6A 3UGKA 1NBOA 1P33A 2VZ0A 1PTJA 5TJ9A 3H3JA 5FEUA 2GZ3A 4RCVA 4X54A 4R1UA 4RVUA 4RPHA 4BNHA 4DVJA 4ID9A 3L07A 1U5CA 1G1AA 3HDQA 3BHJA 3FTNA 1QXSA 2X9NA 5F5LA 3V2HA 4B79A 1Y8QA 4J90A 2G1UA 1LBEA 2EKQA 3OECA 3JQ9A 4F46A 3TOZA 3GFGA 4GWGA 4I5DA 3RUIA 1EE9A 3I6IA 4PLFA 4D0SA 1XGKA 1BVRA 4XQCA 3VKUA 4AICA 1Z82A 1NPYA 1ONNA 1KVTA 3L6DA 4RVFA 5L3ZA 1JAYA 3S2IA 4IPTA 3IOYA 5JCJD 3NAQA 1E7RA 1SPXA 4AJNA 5I9MA 1F8FA 2PNFA 3P5SA 2JHGA 3UF0A 3STHA 1Q0QA 3SEFA 1D4FA 4WECA 1EVJA 4XQEA 4E31A 4YVFA 2DTXA 1LRJA 2GPTA 4Y6SA 2ZJ0A 4H15A 3ZNQA 4TVOA 4BGEA 2CMDA 1B3BA 4RDIA 3JD2A 4OOFA 4WKGA 4MVJM 4L4SA 1VM6A 2YZ7A 2DPGA 4RVGA 3ADOA 4RLSA 1XYGA 1YDEA 3GHHA 4PLZA 5LCXA 2HK9A 4EUFA 2GR9A 2O2SA 4N54A 5HTOA 1NVTA 1T4DA 5IDWA 4YJGB 3PLNA 4RL6A 2B36A 2VOEA 1FDWA 3FWZA 4KMSA 5T8KC 4BO7A 3P19A 4E4YA 4IXWA 4UUPA 4E5NA 4BVAA 3ROPA 1PGJA 1O0SA 5JO9A 3ROMA 1R37A 1VL6A 3ZWXA 3VZRA 4J7UA 3E18A 4XA8A 2Y1GA 5IDXA 2VWGA 4GMFA 2EJWA 2B37A 3CH6A 4I8XA 2OXIA 3FNGA 1HDGO 3DMYA 3WR5A 3HDYA 1LJ8A 4UVGA 1SCUA 2Y66A 4XQ9A 1M2WA 2FPIA 3DONA 3PGXA 4FGWA 3TJRA 4I5EA 3CE6A 1DC5A 2V6BA 3AK4A 4BNKA 3ROQA 2PGJA 4OXKA 4ZRMA 1PZHA 1D3AA 2AQIA 3DBHA 3F1KA 3G1UA 1UDBA 5C5IA 3NTQA 4IDEA 9LDBA 4A7PA 1I2CA 1GYQA 1UP7A 2Y0DA 3WNVA 1GR0A 5T8KA 4RPJA 4BS9A 3PYXA 4B3IA 4W9NC 2YQ4A 3GF4A 3GVXA 1W8DA 4JX8A 4HADA 3WIDA 1YKFA 1PSDA 4FJ0A 4AJIA 1BRMA 2X1HA 3OQ6A 4FBGA 1BW9B 1LSUA 3LSYA 5DP2A 4BO8A 4M8SA 3GVPA 4YT2A 5CFZA 1VC2A 4TSKA 2RHCA 3H4VA 2C5EA 5A3JA 2NQTA 2EJVA 3PXXA 3KRTA 1FK8A 4EYEA 4GX2A 3HSKA 3LT0A 3PWKA 5G0WA 3KV3O 3QWHA 4E2XA 2NVUB 2OOSA 2W2LA 1ZBQA 2UUOA 1O9BA 4ALJA 5KJCA 4BOYA 4U7WA 1HT0A 1UXHA 3FI9A 3H9QA 5G0SA 1E7SA 1J4AA 1I3NA 1FXSA 1A4UA 3HN2A 4DIBA 1F8GA 1N1EA 4GLLA 4DQVA 4LRTB 3RWBA 4NMHA 2ZYDA 3OQBA 3EVTA 4CMBA 4DGSA 3ORFA 1JKIA 1YJ8A 1DBVO 5H83A 1ZEJA 2EWMA 2YW9A 4AJLA 4RJTA 3GOHA 4JN6B 1AHIA 4QO8A 1UDCA 2CVOA 2VWHA 2YV2A 3ZWPA 2D1YA 1XQ6A 4KTVE 1DSSG 3TNLA 4XEHA 1P0FA 4CQLB 3T4EA 1U4OA 1VSVA 2CDAA 3Q9UA 4L9RA 3QWAA 3HB5X 1G0NA 3TL3A 4PVDA 2BGKA 3I4CA 4BNJA 3QJ5A 3M2TA 3JSAA 2HCTA 4DLBA 4IINA 4J9VA 4JIGA 5F5NA 3KYCB 3UICA 2Q4EA 2JD2A 4NK5A 3JYPA 4NBRA 2DC1A 5JAQA 1DC6A 3RBXA 3AUAA 3FN4A 1DIAA 1QP8A 3BMCB 5CP8A 3VTZA 1OC2A 3AU8A 3GNSA 5L53A 2Q1TA 3QWFA 2BFOA 2H6EA 4BNTA 4HXYA 1ZMTA 2I9PA 3AU9A 3BHMA 2C54A 2RH4A 3GZNB 3O26A 4D41A 2YY7A 3TZKA 5HRUA 4DPMA 1X0XA 1L1FA 3RBZA 1VI2A 1TB4A 3PGJA 3DXFA 3OICA 1BGVA 1Z74A 1S7CA 2HMTA 1ZJYA 3ZU5A 2LDXA 1U7TA 4GX1A 4YJGA 4NQZA 3BTOA 1YS4A 1ZSVA 1ZK4A 3RU9A 4EDFA 2DLDA 4L0QA 4YTEA 1N9GB 3WJAA 4BO1A 2ZK7A 2X23A 1SEPA 1XKQA 1ZIDA 1C1XB 4Z0HO 2J6IA 5A5EA 4EJMA 4NBTA 2BH9A 5F21A 4BO3A 3PTZA 3ASVA 4J4TA 3OJFA 1W0CA 4GX5A 8ADHA 3OIFA 1HDZA 4MVJD 4R69A 4BB6A 6ADHA 1ZO8A 4XX0A 2X0NA 4MKXA 4GMGA 2WYUA 3U3XA 3LK7A 2C7VA 3OJEA 2VT3A 2DBQA 3VH1A 5DBGA 3BMNA 1KS9A 2PWZA 4YRAA 2YFHA 3JYQA 4BHTA 1B8PA 4CV0A 4CM3A 1Y7TA 5A03A 1E1KA 3QVSA 1BMDA 2ZTLA 1ONOA 2CVQA 3GGGA 2PTGA 3ON5A 3UKOA 2OMEA 4RQTA 1PR3A 2ILTA 1K3TA 2QHXA 1GPJA 3RFTA 1ZK3A 1IL0A 5KVSA 3FCOA 1EK5A 2RIRA 3L9XA 1DOHA 2AQ8A 4XIJA 3O8QA 3U09A 4M86A 3NGLA 1KBZA 1OAAA 1PGQA 5LC1A 4CM9A 4FJ1A 4YAGA 2PV7A 4PFJA 3PIIA 4JJIA 4J0FA 2NWQA 3PI7A 5L7YA 4K28A 4HP8A 4LISA 2H5LA 4CUZA 3VZPA 1DFIA 5A9SA 1Y5RA 4LCEA 4ROSA 3QA9A 4TROA 1EDOA 1DIGA 3JQ7B 5JSFA 3RASA 4LMRA 3E03A 5ICSA 1H9AA 2O4CA 4QTZA 3TRIA 4YT8A 1HE5A 4L4RA 4Z0PA 1YE3A 1EFKA 1LDNA 3AUTA 4L74A 4JROA 4I08A 4IQ8A 2VHYA 4O0LA 3QVWA 1HDOA 2P4HX 4JJGA 4YJFB 4RVDA 1DRUA 4I5FA 2VHZA 1PL8A 2JFGA 4HX5A 3F3SA 5L40A 3PDJA 3H7AA 1MC5A 3INGA 3JYLA 4OYRA 2C0CA 2HRZA 3KYDB 3LT1A 1PEDA 3WQSB 1PJQA 1MG5A 3NTRA 3LLVA 2C29D 1E77A 3JQCA 5ENVA 2Q3EA 4GX0A 4QEDA 1DAPA 5DOVA 2C5AA 4UVDA 4Y8VA 2HMWA 3V2GA 3WICA 1Y5MA 4GL4A 1X7HA 3TZ6A 3RVDA 1UXIA 3ETGA 3G3EA 1DEHA 3KEQA 4DQUA 4XDYA 1HYEA 2WE7A 2GUGA 4PLVA 1RYEA 2VTEA 4D46A 1P74A 4E6PA 5BSGA 4R51A 5C7LO 1E92A 2RBEA 1C0PA 3E9QA 4CQMD 4FN4A 1Q0HA 4R9SA 1M6WA 1OMOA 3U4DA 1Y1PA 3E82A 4NZ9A 4PZDA 4WNCA 1AGNA 2BGMA 5JNLA 1YDWA 2QZZA 5COQA 4BB5A 2X8LA 5GY7A 3P2OA 1I8TA 3PQDA 2O7SA 1C1XA 1YQGA 3FSRA 3ENNA 5JS6A 3HADA 3ZV6A 1BXGA 1V3VA 5A9RA 3ONFA 4RO0A 2RCYA 3VZSA 5L51A 5A02A 3D1LA 4FSHA 3JQGA 1QSGA 4L73A 1XR3A 2GERA 2V6GA 4JBGA 3EC7A 3UXYA 1MXFA 3H3FA 2EV9A 4H3VA 1ENZA 3NKLA 3Q6IA 1YVEI 4BNUA 2B4TO 3O9ZA 1T26A 4CLRA 1GQ2A 1O95A 1R6DA 1JTVA 3AOEC 4OOEA 5MGBA 1TLTA 2Y1FA 2D4AA 2YV1A 3AFMA 3U49A 4YPOA 4Q3AA 1JQBA 3RFXA 4BV8A 3CTMA 4WGGA 4XR4A 1E1LA 3QHAA 4OKNA 3RKUA 1XDWA 4DBVO 4B4UA 5TC4A 1JWAB 3EY4A 5JC1A 4CR6A 3V8BA 1LRKA 4CMCA 2JCYA 2PKRA 3BXXA 1QV7A
chains in the Genus database with same CATH superfamily
5CW1A 3HM2A 3ZGXA 5IHXA 5IM5A 2QUIA 4BMNA 4NIMA 1PAUA 1QF7A 5B6IA 1CY4A 1UBLS 1XF1A 2HMSA 3L01A 2E3JA 2FSSA 3GCGA 2IZ5A 3N59A 3T9DA 4TSFD 1M67A 3BL6A 3O1IC 1YU6A 5F77A 4BKRA 3IT0A 3BXOA 1KKMA 4FW8A 4D25A 3U19A 3VM6A 5EC8A 4N0MA 4W99A 1OV6A 3IAXA 3HYRA 1Z35A 5GONA 1N33B 3DZ5B 1U90A 4ZYYA 3EUWA 2A30A 1FX0B 1SRRA 2PMCA 3KFXA 1NYLA 1GSOA 4KMRA 2PSSA 3GWGA 4XSVA 2YRWA 3B36A 5DNDA 4HR7A 4L07A 3USCS 3L7IA 3CVOA 3H86A 2CMFA 4RW0A 5JROA 3N8KA 2IE0A 1KHTA 4O4LA 4R1QA 3RFVA 3V7WA 3DL2A 4BWVA 4IHAA 2BGJA 5B5SA 2TYSB 2VHEA 3N8IA 4N7RA 5K4GA 2JFHA 3I1JA 3INTA 1UBOS 4AIIA 2E4VA 1C8KA 4CBVA 1R64A 1SXJD 4AJHA 4I1PA 4GGMX 2AJLI 3DKKA 3HZOA 1RM4A 1SXJC 3FUTA 3N74A 2YWEA 1T3ZA 2IXGA 4WCFA 5EHIA 4EG4A 2XRMA 4QUBA 2H51A 1DXYA 1MEOA 1GT6A 1JQKA 3LLSA 5FPHA 4MWSA 3ZJ5A 3MW8A 4JGGA 3ACBA 3JQEA 2WKRA 2WFZA 2BGNA 2QRQA 1A4RA 2G5PA 4A2CA 4GLOA 2HHAA 5H68A 4CQNA 1S89A 1OI2A 1BCSA 1RAEA 1A7UA 1I3LA 1N3BA 2IU6A 2VPYA 4KSCA 3ZTYA 2V6FA 1KP3A 4BCCA 3PVCA 3HJAA 1B6TA 2EIHA 3GLIE 3G59A 4D4MA 5AP9A 4I9UA 3PHHA 1O4WA 1XZNA 1FQJA 3CBQA 4GECA 1WP9A 4IJ6A 4NJEB 1CJUC 4QGHA 1YCGA 2UKDA 4FFPA 4BV9A 4TTJA 1JSZA 4I1VA 2X19A 4G8JA 4GZ6A 4L15A 3MINB 4DA9A 3UA3A 1LVGA 4QQRA 1U1GA 3OQIB 3FNHA 5CDFE 4ZQCB 4CDGA 5LZ7A 2Y0CA 4A5SA 4RTLA 2DUWA 9GPBA 5JJCA 3D4PA 3DG9A 2W9XA 2X6TA 3E81A 4PIVA 3ENVA 5LU8A 4WTOA 5KPDA 1VG1A 2H92A 2JFZA 3V8MA 1DRWA 3UK7A 2J9ZB 2WU8A 1SHTX 5K3AA 3T41A 4YMVA 2Q5FA 4BP3A 5LQJA 4YONB 4O4JF 2BELA 1JQAA 1TZMA 3MIZA 4BO5A 4CKBB 5C9ZA 3KSMA 1L7VC 4L5IA 2GF0A 5FTMA 1INLA 1XRMA 2OR3A 1Y7PA 4KXWA 3DYVA 5KTPA 3G9QA 1Y81A 2ID7A 2IXEA 3UIEA 3W06A 4LYJA 3VNSA 4CKYA 3BQ9A 4EK9A 1LBSA 3OJCA 1TX4B 1XPOA 2GFIA 3BKWA 4O1IA 2EG9A 3R7LA 1CUIA 5BRNA 3SKYA 1J2RA 2QJRA 1FP2A 4IQ4A 2WINI 2ZJ6A 3CZPA 2R1UA 2GN8A 3T54A 10MHA 1SOWA 4B3MB 3OA2A 1NBHA 3HZZA 2H5EA 3MERA 8ABPA 2B4RO 1CRWG 4UJ5A 1P19A 4D5GA 1JLLA 5I7FA 3ZOKA 2JZNA 2YFYA 1JI0A 3VZCA 3FPAA 4QGFA 4UUOA 3IT1A 2XRFA 2QM8A 5AJTA 1NJGA 3PC7A 2ONZA 3WLRA 1YL6A 1BA3A 1MBZA 1R8YA 1DG1G 1X94A 3JQ9C 3QY9A 1QWOA 2BISA 2BJWA 1JHUA 2CSXA 1F2UB 1XYVA 1B42A 3JAKB 1TUGA 3EJWA 4X7PA 5AVTA 5A4AA 1GP2A 1WF6A 1CR2A 3G6KA 3NS7A 4RJJA 2CVZA 3UWDA 4G0YA 5IYZF 4P5PA 3U6KA 1QORA 2Z3ZA 4DR6B 3TW3A 1IOLA 2BH2A 4ZAGA 5KS2A 4MDYA 5DT2A 3GAFA 2BSXA 4H2DA 4RJIA 4Y2RA 2VNJA 3SD7A 1U9IC 3Q1KA 1NUUA 1CHNA 3VR5H 2B83A 2IYPA 2ZS8A 2W2OA 1PE0A 1J9EA 2F1RA 3PT5A 4M8KA 3RUFA 3TCNA 3K1TA 2W0SA 4NV3A 2PGAA 2IC5A 4BC0A 4F92B 5G2OA 3MWEB 5JMOA 3UJ8A 4E2WA 1EP2B 3ZX4A 1EGHA 1N92A 1QS0A 1YGPA 2JAHA 3M6AA 3JQQA 4MV4A 2IWRA 1U3VA 3A9CA 3GJ8A 3PP8A 1Y8RB 1V5FA 3D3WB 3ZUPA 2R62A 2RI0A 1XI2A 3TB6A 1RXWA 1JW9B 2C5GA 3VR1A 2XYQA 5JLJA 4QAJA 1UZAA 2HU5A 1BH6A 3DD5A 1BD3A 5BRAA 4QBFA 3C97A 2XT0A 1PD0A 4QPCA 5LOVA 1K6XA 4N5NA 3QGMA 4L4YA 4QDUA 4X6UA 3JTMA 1QCCA 1L5RA 4H17A 5I01A 1RCFA 4UBKA 1K7SN 3PQFA 4DCNA 3NEYA 4HWKA 3PDCA 2WG0A 2BHNA 2XQJA 3TWOA 1IHYA 2I76A 5E2BA 3WTBA 3SYMA 1BEEA 3I76A 3IAAA 1L4HA 3WMXA 1A5AB 1ECJA 1I9CA 4ENRA 3V1YA 2JCVA 1JJFA 2VRCD 1DRVA 3FFTA 2WF6A 4BQEA 4XKJA 1B8NA 1T9AA 3FTCA 1IVNA 3OKPA 1PWHA 1J6UA 1MVOA 4IZOA 4GPD1 2NNLD 3HCPA 4FXOA 4YP5A 2NUPA 4IEEA 3WIVA 3QE3A 2EFJA 5TIIA 1KFBB 1ZN2A 5KQMA 3N6VA 4KEAA 1PDVA 5JS8A 3B9QA 1OVGA 2FV8A 2ENWA 4G4SP 3IWCB 2QJWA 3TSWA 2ZYGA 2PQMA 2WVJA 2NAPA 2V7PA 2ZE6A 3EG9A 4EB0A 3T0FA 4BWYA 3DUFB 2XNHA 4ZZ2A 5DE3A 2B8JA 4V0ME 4IQFA 3VDRA 2E4WA 3TF5A 2NVWA 1FP7A 1WVGA 3JR3A 5TARA 4E5UA 1DC8A 3C4VA 4LHEA 5F98A 1YQTA 4MR8B 3PNLA 4BX3A 5B57C 1BVHA 2KLBA 4IIUA 1BHSA 5LZ4A 2GZ1A 3OQMA 2AOUA 8MHTA 3OM9A 3I04M 1LNZA 2VH1A 2B35A 3D2CA 3MIIA 2BF7A 4ZJPA 2Z08A 4HVTA 1N2BA 2Y67A 4MPPA 2PA3A 3WSWA 2YWRA 1VPWA 5FAKA 3WJ2A 4JZYA 1QQ5A 4WVFA 5HR5A 1EX9A 5IC4A 2XUHA 4E12A 1PT8A 2ZB3A 3EIXA 4CFZA 4X7MA 5DCYA 2JH3A 2ODPA 3QU4A 1QG2A 4MGIR 4Y1EA 1OIVA 3TDMA 3Q12A 2BM8A 4YBZA 2GHRA 2WYWA 4RC9A 4ZOCA 4CMIA 3JQ8B 2BM9A 2Q0XA 1ZGBA 5FL3A 1RHMA 4YRMA 3BJRA 3PDHA 1PX0A 2A5LA 2VJLA 3QW2A 1B6RA 2B3DA 4IDGA 1MW9X 2JANA 4YQFA 1GNLA 4II2A 1AF7A 3MHPA 4Q37A 3VU9A 1XMXA 5CXUA 4YN3A 4FNMA 2F4VB 1M76A 1NASA 4M49A 1EFAA 5KVQA 1WSDA 1FTGA 4YV2A 1KNQA 2EKDA 2HK7A 4RJLA 4Y2UA 4UE6A 2P6UA 4QQFA 3PFWO 5CM2Z 2VSNA 3LKVA 3R6DA 3AVWA 1N2XA 1OBOA 1OTXA 4HATA 2WJZB 2FW0A 2OZKA 3CVUA 2WPDD 1X8XA 4G81A 2OD9A 2YBEA 4IOKA 5IDYA 1TVEA 2FJUA 1GPKA 5DSZA 2IEDA 3FTQA 3KYCA 4DIKA 4PLHA 4BNGA 3FNIA 1COWD 3CPEA 4HFJA 1QX3A 3FAKA 5HJ7A 1NSFA 2UAGA 4KZPA 5IVKA 1WPRA 3MK31 4DDMA 4RPKA 4D96A 1NWCA 2E1RA 6CHYA 5LJIA 4GXRA 1CDZA 3ENQA 4FE7A 2PH7A 4QUGA 4NG4A 4HVLA 1R4AA 4Q5IA 2QY6A 3VYUB 3SWWA 5A4FS 2NSLA 1GUBA 5TQVA 5CVVA 1IEQA 1TA9A 2V3VA 4B6RA 5CM9C 2H8KA 4C7XA 3NTOA 1HM5A 3QF4A 3D6HA 5AXAA 3WHKA 3NC1C 4ZI7A 4IRUB 1B73A 4EO7A 3U60B 1N3YA 5KMGB 3T5AA 1CJMA 4DLLA 1GL9B 2Q62A 2JI6A 5FUQA 3FOBA 4DBLE 3UKJA 5DO9A 2XJ9A 3FPFA 3UMFA 1NBAA 5J9GA 1S2IA 2PUTA 3N2YA 3NETA 2WYOA 4O63O 4G24A 4J8PA 1X3LA 3FCAA 5AO9A 3RVNA 3VOBA 1NVVQ 1K92A 4PLYA 2Q9AA 2GPWA 2QMUA 3DZHA 2ZJ5A 2X5OA 3PDUA 4GI3A 4IO0A 4S2EA 4DJTA 2G5GX 2V3CC 1JEYA 3OFKA 4NLLA 2CD7A 3AERA 4D0NA 3MM4A 4LJ5A 2WZCA 2Z3VA 3B38A 3VU1A 1QYCA 3W5HA 3ESQA 4EX7A 3OMLA 1T5BA 4XD7A 3I23A 1IC6A 3A1VA 4UMEA 2PSJA 3KP1A 3Q0EA 1GPH1 1O3YA 3F4LA 1DRKA 3CRQA 1GNPA 3WGHA 4AJKA 1IZYA 3DOOA 2HRQA 1Z7WA 2AC2A 4O8JA 5DXJA 1JEQA 3IP3A 2EZTA 2O8VA 1MUUA 4R3UC 5DTMA 2O06A 1TM3E 2JG3A 3KM0A 4ZCIA 1GAEO 3K0KA 3LJKA 1JN0A 3GT4A 3RYCA 4AJ2A 1R4MA 2OP0A 4Q39A 2O2ZA 3EAGA 4Y0AA 4V0KA 1E98A 1LZKA 1ZM2A 3URMA 3PEYA 2JFQA 1C1DA 3CV3A 5K8UA 2ESRA 3LP8A 1RJWA 5JCOA 4GKJB 1Z7EA 3FX2A 3PHIA 2PKXA 2V65A 3GLTA 4OF4A 1KDVA 1J7JA 1I30A 4KVAA 2R11A 1Z7GA 1LVHA 4D44A 5IC6A 1NV9A 3L6EA 4RPLA 1KJ8A 3BOSA 1SUIA 4J29A 1ZGJA 3JQ8A 4ML3A 5CBPA 4JKIA 2WF7A 4BVFA 3NBMA 3P9KA 4TSRA 2YJZA 2Q3FA 3TH5A 5FRDA 2AIRA 5FBHA 3PC8A 3IS3A 3EN0A 1ZHFA 1OWOA 4ILEA 4TVSA 1IWOA 1IY8A 1EQUA 1YJQA 3BGWA 4G0VA 1RFLA 5JY6A 2DG2A 3N2LA 1IJFA 2X7JA 1ZJ6A 3S70A 2QPAA 3CKYA 5AM3A 1YZYA 2FFQA 2Q9UA 1KFKB 2ETXA 2I6XA 3EUAA 3RVSA 4J7AA 2FMFA 1RHQA 1M5RA 3RIMA 3OFSA 1MPXA 5TMEA 5MF6A 9ABPA 1LDGA 2GM5A 3DP9A 3HDHA 3CN7A 1CIJA 1EBUA 3ZWKA 2YJ6A 1WSBA 1LJUA 5EZ5A 1UQUA 1ODJA 5FFFA 4AZTA 1VL0A 4C07A 5BR7A 1FVOA 1T36A 3BWXA 3DGEC 1PJRA 1Z9BA 1Q0LA 2VXYA 2RHGB 2HHHB 1N5IA 4B3GA 1RM3A 1O87A 2GM9A 1Q7GA 4GOJA 5HE9A 1Y4ZA 4Y2TA 4WOCA 4DE5A 1VKOA 1XVIA 2IW3A 3GPCA 2JGKA 2VJDA 4FFLA 1LNSA 5A04A 4FEEA 4N18A 4NE7A 4XFDA 1JJ7A 3SFVA 4PZLA 1XZMA 4D4JA 4DLUA 3KYDA 1IVYA 2HKIA 2R00C 1HF3A 1XTQA 3T5GA 3BTUA 3SLGA 1KIAA 1JHYA 2CCKA 3ANYB 3NAGA 4EYKA 2OK7A 3LRPA 1G8SA 2WILA 2XUKA 4QDZA 2LW7A 5AKLA 1MO5A 4ZZ0A 4MHSA 2OO3A 4MWTA 4QU0A 4TLAA 1XL1A 1A5TA 2EBFX 3TZBA 2EHDA 2NGRA 3T1OA 2E2WA 4MQ6A 5AHKA 2QDXA 3KJHA 1DBIA 5ALUA 2I99A 1W75A 3DXXA 3WWYA 2GARA 2XOKD 3JWEA 4QLOA 2BEUA 4D57A 4QODA 4CMHA 5LOVB 4Q4HA 4X65B 1B3RA 1H0SA 1ADYA 1YJAA 3U1VA 4DMLA 3J7TA 4RZQA 4JI5B 5CDTA 3J81A 2FQXA 4PPQA 4UVIA 3HJFA 1BWSA 4L2IA 2OBNA 3P7MA 2VHCA 4OAQA 4HDOB 5T64A 3ZGZA 2FSIA 3ZLUA 3GLKA 2FN7A 3T3EA 4EG1A 4N6OA 1C3EA 2VCEA 2VIIA 3ELWA 4G1CA 1E7MA 1LWOA 4BFZA 3FJ1A 4IVPA 2LP4Y 2VQEB 1GFSA 1SIOA 3ZW7A 3M83A 4MHOA 2IIVA 4B46A 5L95A 1KS2A 3BB1A 4PGGA 4LXHA 4DV5B 2E6UX 3BK1A 3IKTA 2ZBFA 2IYYA 4FWIB 3LC1O 2X9GA 1PEKE 2IHBA 3JWIA 1KKUA 2Q0QA 4UEKA 4P4NA 5IM4F 3LHIA 4AUNA 4DV1B 3RC8A 1AVTA 4KQ6A 3A27A 3WMWA 1SAYA 2HAEA 2FSFA 1XK6A 3IVMA 3NOXA 3DPSA 5E7MA 9MHTA 1AUXA 2Q4DA 2ZBVA 4NJOA 4EGAA 5DJ5A 1PEYA 4CM8A 4B4KA 3G2JA 4QDOA 2PDAA 4UOQA 2V5AA 3ZD8A 1OYYA 1KOLA 3ASUA 3L77A 1BO6A 3BE6A 3ONDA 5IZCA 4HFNA 5K0TA 1L5SA 5LU9A 4PHCA 2R87A 2BJHA 2JEOA 5AXDA 4Y2HA 4YFVA 4MB0A 3OKAA 1ZVVA 4IKEA 2FOLA 1R0RE 3DOJA 4LHVA 2HCRA 4WADA 1K4MA 4N01A 4W6ZA 5GQSA 3RROA 3THOA 3LZ6A 3J7AC 3OZXA 4WAUA 3SVLA 1II0A 1Q1AA 2W8BA 3O8NA 3DNPA 4UULA 1K2WA 1QYDA 2OBYA 2YWGA 3SZMA 3U5TA 3V5NA 1JXMA 1KQPA 3TTXA 4EJ0A 1TU4A 3R4VA 4KKVA 3FOFC 4JXKA 3AI7A 3PHLA 5ADHA 4RHTA 3H0KA 1YB4A 2A9PA 3RD5A 4FN5A 4KJXA 3KEOA 1ECGA 2YC2C 1ZL2A 5J2TF 3ZZNA 5JFOA 1B0AA 3WX0A 2HH9A 4EJSC 3QBEA 4BFXA 2V55B 3PWZA 1W85B 4B31A 2I4RA 2DR2A 4IXTA 3OVMA 3QG1A 4HYQA 4IIVA 1V4BA 4PSVA 3S3TA 1UAAA 4A03A 4CM8B 4Z7QB 1LPOA 2BFBB 3HUUA 5C37A 2AVNA 1M7HA 3JX9A 3OTIA 4TUYF 4EW1A 2OYSA 3AT1A 3FSGA 4MJLA 1T9DA 5ALZA 3D0QA 4CMEA 1FSFA 2X77A 2V74B 2V7QA 3BEOA 2AHRA 2X1MA 3BD9A 1L4EA 1P5FA 4LY6A 4WHMA 3U62A 1ADJA 3STWA 4PZCA 1ZK2A 2RONA 2BGRA 3EDCA 3FWPA 5I7WA 4IIXA 5CA0F 4FHFA 2X0IA 3MSXA 1MC8A 1SRQA 4JQSA 5HMMA 5KYYB 3U7EB 2NUTB 2XNKA 1ZKMA 2FWNA 1QQAA 5U4QA 2ZYHA 3L1IA 3O93A 3AHHA 3RUHA 1XDSA 5C4MA 4RSMA 2O0LA 5I7HA 1VKRA 3FGNA 3V3KA 4HY3A 1B23P 1C9YA 2HR1A 2BEUB 2ZRNA 4MI1A 4X97A 3U2QA 4AFNA 3A3YA 5AK6A 1NIJA 4JU9A 3TR6A 2W2KA 2AR9A 4NFYA 2HLHA 1JBQA 2PQ6A 2A4KA 3E48A 3W8DA 5IT0A 1JIQA 4HNRA 4JAVC 4LYDA 5K8IA 2J5RA 1VMAA 5I9BA 4ZQEA 2Y4NA 1R0SA 4K6FA 5DWQA 2WIBA 3AY7A 3FF4A 1RRFA 4RD3A 3TINA 1G2IA 3VRHA 5IJ9A 1X8KA 4MB2A 1ZESA 1ULSA 1MO4A 4XI9A 4URFA 5EIAA 3ETDA 4KFRA 3UHPA 3ZJVA 4K9NA 3RTDA 1LLCA 2A5FA 3DVQX 4RIIA 1G21E 2QD4A 3RS7A 1AXGA 3RV4A 1WTAA 2XYRA 4E5VA 3NDPA 5HDBB 1KDPA 4TT3D 1I36A 1MTZA 4GI1A 1RPTA 1XA4A 1EUZA 1ABFA 1ZCBA 4HN2A 3W1VA 3EIQA 4KO4S 4KPUA 5EHQA 2R6AA 3FDZA 4FM9A 2E87A 2ODBA 1EK2A 1VBKA 2FDXA 2W2MA 3JZAA 3K35A 4IIYA 3KKZA 5K3DA 1DB3A 1KTIA 3DTVD 1FNDA 5GONB 4AL4A 1DQPA 3B20A 3EIOA 1AKUA 3CZAA 3DMGA 3OSZA 1HPLA 1QOZA 5HKAA 3ZHXA 5A5GA 2E49A 4Z6KA 2FRXA 1HTTA 2JJ2A 3HKBB 2VYNA 3S6JA 4L5YA 4C7OA 1OBCA 4R8VA 5JZSA 4QGAA 1KAGA 2CXNA 3FPLA 3WLEA 3BICA 4AN4A 4KR9A 1KFCB 2OCBA 2ZIUB 1EK1A 3PJFA 4XWWA 4KXNA 3WBKA 1VSQA 2JFNA 1ARZA 3W3ZB 1AGPA 4TX1A 4BWGA 4D3SA 5JRDS 5DNEA 5JBQA 2C3MA 1SUSA 3ROTA 1L2TA 3B3AA 5JI2E 5GV7A 4AY4A 2B8TA 2P40A 4IZHA 4A15A 2B34A 2FEXA 4R1TA 1SD1A 2W6MA 2DHDA 2C5FA 5LQRA 4HGNA 3TPZA 4BNLA 3KKOA 4TRNA 2BE9A 3TCXB 1YQXA 2BYTA 2WICA 4JGBA 4H77A 1U28A 4M87A 5AW9A 4AULA 3R7NA 1WL8A 4JI1B 3MWDB 4J1TC 2Q5LA 2VA9A 2X4LA 3ANXA 4ZT4A 2H1RA 4TQGA 5K8VA 4OLBA 4L1KA 2OLEA 3KXKA 4EJSA 1N2CB 2PZKA 1YZFA 2KMLA 4M9UA 3VAAA 4BE9A 3S8MA 1W8IA 4X00A 4G3XA 5B4UA 3PIDA 1W9MA 2P5YA 5BNZA 4MIYA 4ZGGA 3SZRA 1FNMA 3DHNA 2H54A 1Q7CA 2I7DA 2XADA 3HH8A 1E2FA 4LRSB 1ORRA 5KYKA 2NYVA 4FOSA 1W73A 3IELA 4P4GA 1HURA 5LP6C 5T57A 3ZV4A 1EXNA 4CLRB 3BEDA 4AKSA 1Q11A 2UZ0A 2Y99A 1H93A 1MOPA 4RSRA 5KQSA 5E6UB 2WWXA 4D4HA 1WXHA 2IDJA 2O1WA 5HOQA 1M6NA 1U3GA 2BM0A 2C5LA 2DX7A 3K0AA 4WESA 5GJVC 1ZXLA 4ASUA 1IQRA 1VG0B 3FRHA 2I34A 3OX4A 5JJKA 2Z5LA 3FHOA 3QI2A 4W9MC 4HNAB 2OHIA 5AKYA 1QVAA 2PLNA 4XYMA 4CL8A 3EXHA 1AHNA 3GDHA 1P0PA 1QIGA 4QUDA 2YN4A 2PAFA 3IKMB 4JP5A 3G8YA 3SP1A 4DTIA 2CZQA 1FDUA 1K5DA 2OE2A 3D6FA 3K05A 4FMCB 4IIJA 4RGYA 1RI4A 1R6BX 1KMQA 1U2DA 3F78A 3KWMA 4O4HA 1YRAA 4CEJA 4OP3A 1IN8A 1I7PA 2F1JA 3PBKA 2VJPA 4GC5A 1ZGZA 2OXCA 5HBGA 4LGYA 4L4ZA 4H18A 1KSHA 3QQ5A 1Z2PX 5EZSA 5M5BA 3RK0A 3GNQA 4MV3A 4ZV7A 1K7CA 4EG3A 1HEYA 3DOHA 5BN3B 1XZQA 5EIXA 2JHCA 1LI7A 4R68A 1HUQA 2GI4A 4Q00A 3AF4A 2L17A 1N7GA 1SKBA 3A9TA 3TQSA 4D9MA 2FPUA 3G8AA 2Y6UA 1K5PA 1SURA 3W5CA 5KAMA 3RKSA 2VRCA 1P2BA 5DNYB 4DV3B 1VPLA 2J07A 3E9NA 1NUAA 1TAUA 3TLCA 1RRPA 4TSFA 3DWGA 4O3FA 1ENYA 4KAJA 4DSOA 4H4DA 3JZFA 2Y1CA 3HCNA 1CC1S 1BSVA 2HTFA 3QIAA 4WNAB 4DLPA 4EGSA 3CVWA 5F9FA 3UK0A 3QITA 3AHDA 3DZ7B 1E2HA 2QRMA 4R98A 3IH5A 4LYFA 3TM4A 2DY0A 4A82A 3K96A 1JDJA 3S1SA 2CT8A 1GQOA 1DQNA 1ZPDA 1QR6A 2DM6A 5L3QA 4I81A 2JJ1A 3ILVA 3E9RA 4H7IA 4NBSA 4DDTA 2HJSA 2EJUA 1OHHD 1MVLA 1SVNA 3E7WA 4I1SA 3FLEA 4MGHA 3WLAA 1KQNA 1ZH8A 4B2IA 4H31A 4YXWD 4ZDKA 5BQFA 4U6SA 3A14A 4INOA 2XCLA 2ZJBA 1EE2A 2BMDA 3G9UA 3QVLA 2YC4C 3B85A 5B1EA 3AJEA 2QBYB 5C7IO 3E5MA 1JKFA 1NX6A 1SCKA 4UXIA 1X7YB 4X60A 4NMMA 4OHUA 4MKZA 2EFGA 4P35A 1H9CA 7AT1A 5LZ5A 3VR6A 1LCIA 1SELA 1TM5E 2H2WA 4YYZA 4LDRA 3UAZA 3QUTA 3R7AA 3A0UA 3ASZA 3NAMA 3VI4B 4D3XA 5KOYA 1SG0A 1P29A 4UCQA 2I6QA 3EY9A 1HDEA 4MMYB 1VSBA 1XLWA 3ASYA 5THXA 4EKEA 4MUIA 5JD5A 3DXYA 1U65A 4ERNA 2BSAA 1OIXA 3WA7A 1MENA 3BIFA 1R10A 3MN1A 1TRKA 3KGDA 1T5LA 4HJRA 5K0SA 3IVAA 4CG3A 4B8WA 1MO6A 2DQKA 2A94A 2MMCA 3KJQA 3KJZA 1ICIA 2R4TA 4FFVA 4ZT3A 2FPGB 3OOHA 3SY8A 4JI7B 3QPCA 5LP6B 3G2NA 4FFMA 1N6IA 1NN1A 1IY1A 2C3PA 3RVLA 4MYRA 4DG9A 4I46A 4ERXA 2H2DA 2HB6A 3U7QA 5ADUS 3RF6A 1VJCA 3NBYC 4CCWA 4RBNA 1CIVA 2RDMA 4OM8A 4F5DA 5CCXA 1OZHA 2HD4A 4UEWA 1LKZA 4TWAA 5JLAA 1RYYA 2ONCA 3K0HA 3NORA 3ZZUA 2QI9C 2REQA 1MORA 2IS6A 1PHRA 1QTRA 4OJYA 2Q3DA 1XOIA 3CPHA 3WWCA 4HUQB 1F5SA 3MA0A 3NT4A 1TAHA 2VT6A 3MT0A 1FU4A 3RIYA 1T4CB 4B6EA 3PKJA 4JBNA 2P5UA 2PD3A 3OP4A 1T4BA 2DSTA 3JWHA 3ZV5A 5LQMA 4A6XA 2R8EA 1WY5A 2Y27A 1BN7A 1FNNA 2AN3A 2XW6A 4TL6A 4ND8B 4PHGA 4JSYA 1PL7A 1TCBA 2PLFA 2QTVA 3ROZA 1ZUWA 5KJ1A 4CW7A 3PLRA 1GLGA 3HWWA 1L0BA 1XLTC 2QVXX 1D2MA 3M4YA 4I9NA 3KJFA 2I6FA 5U1PA 3WLSA 5DNUA 4P4TA 4Q1EA 2BKUA 1O97D 2OV2A 1JF8A 3O0TA 1YZHA 3WQQA 1SHKA 1XRNA 3PGA1 2GH1A 4WCVA 4Q03A 5E9JA 3GP5A 4CEHA 3KKNA 1ZH0A 3FZGA 4M1KA 5FQOA 4K6HA 1QDLB 2F59A 2QSYA 1N7HA 5FTNA 5BMVA 3JQ7A 4KH1A 2I3DA 5IZCC 3EZ7A 5JUWA 3RWOA 3HKEB 3UXMA 1NOJA 5DBEX 3UAGA 5E2AA 4KLNA 3E22B 1TGYA 3HVUA 3TGPA 1N0UA 1LFAA 5CLJA 2PZMA 2WRZA 121PA 3OEHA 3MYYA 3R3UA 4JHLA 3VSDA 1J70A 1X2EA 1MXHA 1RFGE 3OOEA 1WWKA 4KHPB 2AH5A 5SYMA 3HJNA 3LBFA 1U8YA 1XCBA 2GLXA 3ABSB 4DQDA 3GZNA 5IARA 3W5SA 4BNXA 1FP1D 2OPHA 1JL3A 3O8QB 1G20A 1BQEA 8LDHA 4MA5A 1DQYA 1HDYA 4G5OA 2OSVA 1XK7A 4DHWA 4ER6A 4CEIB 1WCYA 2OAGA 2WD7A 4TWBA 1BEUB 1G3RA 4MJXA 2I4NA 4MYUA 4CT5A 2I22A 2ZUFA 3GV0A 2HU7A 4M54A 1CJVC 1MB0A 2ZI9A 2IWHA 2A58A 1WV0A 1I1HA 2GWHA 4ZFNA 5K3BA 3ZJUA 3K9QO 1V4VA 3GBVA 5ALLA 1FRZA 2FP4A 4ZMSA 5IW8A 2RSLA 3EARA 3O7WA 2VWQA 2Z2YA 1E8NA 2PANA 3CRZA 3D5QA 3EWAA 5IJXA 2DECA 2ONYA 4F71A 1O89A 2CLHB 2PS1A 2WOJA 3PGLA 4EVSA 4FQ7A 1E89A 4B35A 1QIHA 3AOGA 4MZDA 5FIUA 4PS1A 2OCKA 4KRFA 3D43A 1QHHA 3H65A 4C87A 1S2LA 2F9LA 5ECGC 5FBRB 3DVSX 3O4FA 1P0IA 2NO4A 3PC2A 2GCNA 2AFIB 4V1CB 1V6SA 2AMYA 4HDNB 3TUZC 4TVBA 3NRCA 3AV0B 3PCRB 5FDFA 4XOIA 1WBDA 3RT9A 2TMGA 3U48A 1WPXA 4D42A 4ER7A 4MVJP 1QQBA 3NHMA 2FZWA 5LMNB 3NAZA 3A7DA 4L85A 4YBRA 5E6UA 1O5IA 1PT7A 2B6NA 3MTAA 4FYPA 3TJMA 1A9QA 2H1CA 2VF5X 4JDUA 1XZGA 3ROKA 4C88A 3NVKI 2P2SA 2W48A 4IWYA 1X9HA 3RSOA 4XGNA 3RC3A 3AEQB 3GRVA 4FTWA 3TG2A 2D00A 1MX3A 2AT1A 3L0BA 3MUNA 3T9AA 6REQA 4NRDA 2QE7D 4LVCA 2X0FA 3LC2O 3EEIA 4C4OA 1JU9A 2OLJA 2QAIA 4WACA 2JC3A 4MYTA 1L7RA 1Z8DA 2PZ8A 2O1XA 3F2VA 3KHTA 4H7EA 3D2LA 3HSYA 4OGWA 3UPTA 2ZDGA 4NCBA 1U94A 3NQ41 4DIEA 4Q05A 2XYGA 3L4KA 1JS1X 1VCNA 5B55A 3VOAA 2FE4A 5JASA 3FD8A 1N3IA 1V45E 1HH4A 3I2HA 4F12A 4BP1A 3KJGA 2QP4A 1IONA 4K05A 1H2BA 3DWIA 3AVPA 3EA0A 4RMIA 5KSZA 5KYTA 2FUKA 5H1YA 4WZ6A 3R0ZA 2Y05A 5HA5A 4Y3UA 2QX9A 3GAZA 4LJRA 2PMDA 3LGXA 1PWEA 4K86A 2D8AA 2MSKA 2QUAA 2FZLA 3EMKA 3KR1A 4UKDA 3DVAA 3FYTA 3RVRA 1J90A 2ZIZA 3N8NA 1W581 1T2NA 2X5NA 4KLAA 1YO6A 2YY5A 1TF2A 2IEBA 1L5LA 2IEYA 1JG7A 5HUJA 5CXQA 1C4OA 5LR6A 2DJ5A 2GO1A 1TJPB 2HSWA 4TMYA 4BFTA 4DYDA 5JCOC 3FVTA 3PRJA 3IQIX 1OLOA 1EGQA 1Y6RA 4H6XA 4M4SA 4NPCA 4WXEA 3JQAB 4OMFG 4AF6A 4ZT6A 3W3AD 4RWEA 3N0XA 3DOCA 2HLPA 2C7RA 2VZ9A 3PUXA 3T1QA 2OXRA 3KSRA 1GPMA 9LDTA 5K45A 2JGFA 2OHXA 4BE7B 1J49A 1TIPA 1Y9ZA 2GF2A 3ICPA 1OXSC 2DQYA 3JALB 1UDWA 4Q3BA 2Z95A 5IAJA 1P4SA 5K3FA 1MJNA 2ZRPA 4L5CA 4O4LB 4DUPA 4M0EA 5MN4A 1VOTA 3V1UA 1TEVA 1YE5A 1RYMA 1WXXA 3WWZA 1R88A 5AJWA 3LQKA 1KK3A 4IM7A 1AMNA 1DWOA 1OPXA 3FNQA 2O5CA 2G17A 5CCBA 3A26A 1T91A 3IYLW 4C3ZA 3BTSA 3WNDA 5E2IA 3ELBA 2ODAA 5EMKA 4KQEA 3M4NA 1II8A 1JAIA 4NDZA 4PCLA 2DLNA 1ZRNA 3GG2A 4L8LA 4J7XA 1DU4A 4BLVA 4WJLA 2Y8EA 1FA9A 4ZU1X 1CUUA 5B1IA 5IXYA 2PKEA 1M2OB 2W98A 2NT3A 3LO5A 4G6ZA 1ID1A 2DULA 4DIOA 4EVRA 2YXEA 4HMOA 4YRIA 2CSUA 2QZ9A 3HXLA 4ZOLF 2I7CA 3R76A 4F4FA 3TIXB 1R2QA 1JUDA 3EWNA 5H59A 3CE9A 2VRNA 1JAZA 3SXPA 3PJRA 4PIPA 1ZY2A 2ZYVX 1M8PA 4HKTA 3OE7A 1TUEA 2F43A 3KZXA 3V80A 5HIMA 2Q1SA 2QZ4A 1QWSA 2XDAA 3FWKA 3PPYA 4PONA 4EPYA 3HYTA 2H07A 1RMQA 2ZIAA 2UV8A 4LKRA 1TZBA 4RH1A 1OFTA 5TVOB 1M6EX 2A7XA 3NPAA 4FSXA 1SU8A 1Y1KE 2NU6B 4EZEA 3G1TA 4A0RA 2EZ4A 4IVQA 1HE2A 4A8HA 4LFAB 5EWMB 3QEAZ 5CLHA 2QT0A 1V9SA 1EXMA 3C48A 2BPOA 2P3SA 2C00A 1L5YA 1R27A 1PQUA 4MVJG 2C4TA 1RPAA 1ZCJA 3INNA 2X6QA 1GQYA 1MFPA 1NKVA 1ZIYA 2NO5A 3L6CA 1L9XA 5DMHA 1W4BA 4YQEA 4YMWA 4FQ8A 2FK8A 1K7FB 3CF0A 4AB1A 3ILSA 3N3AC 1YDHA 1NT4A 2COEA 4OB7A 3WHLA 4AIRA 3GBPA 3KSAC 2Y2VA 4EQ6A 4UPEA 2EF0A 2ETVA 1JTFA 1B76A 4CPDA 3ED1A 3FNEA 1A2QA 3DMRA 2DKFA 2XNSA 1EM6A 2SCUA 1H23A 3JQAD 3P2YA 4RD2A 3TNYA 3WDSA 4P7FA 3X1JA 4EW2A 2OBBA 3TW0A 4DSTA 3K6JA 4J4HA 1WMBA 1UDAA 1G42A 1YBAA 3FYUB 1A95A 3PF8A 1T3SA 5G53C 5FADA 3P0HA 3W9BA 3WMGA 4OU4A 1WA5A 2B4KA 3M1AA 2FWMX 6PFKA 4NESA 1A4IA 4BBZA 2A57A 4ZOBA 2OORA 3PGVA 1GHTA 3UAYA 2AN9A 2YVAA 4I36A 4PRYA 5A3VA 1SXQA 4OHFA 3RM3A 2SKCA 2BEVB 4ZA2A 5JAZA 4OJTA 1GZ4A 1XTPA 3R5TA 3FMIA 4JBWA 1A2BA 2AFIE 3V48A 2B3TA 1FS4A 1VRWA 2IPLA 2APJA 4XQGA 1YQQA 2RH9B 3KFLA 4XWGA 4Z4IA 1P1FA 4JI0B 1R9JA 5CB4F 3BERA 4YRRA 2QUKA 5FBVB 1NBME 2GAOA 3WL8A 2VVTA 521PA 1N8KA 4KXMA 1S3IA 2Q5OA 1Y9DA 4M36A 5ITWA 3PCTA 2D1TA 2UYYA 4NICA 4M1ZA 3BHIA 5AQEA 3CCFA 3V33A 5ALWA 2VAPA 2CGEA 2E1PA 1KKLA 1YAJA 2CNOA 2DPYA 4WY8A 1GADO 1QUFA 4MO2A 5DCLA 2G7MC 1EU1A 4CI9A 2HDNB 5HKBA 1Q1NA 5HKKA 3TFQA 4I3FA 3FYUA 3I9NA 4KK3A 5HPYB 3I9JA 4IIDA 4RJKA 2BKXA 2GHIA 4UW9A 3KX2A 4B5KA 5JALA 2HJWA 3A6EA 3DEJA 5G1NA 3VMMA 1ENPA 4YECA 1MH1A 4ZIRB 2JVJA 1YGYA 1R0XA 4GF5A 4R2LA 2CLFB 4RCZA 1A88A 1P45A 5GADl 2I80A 2AFIA 4FSDA 4BQPA 2Q5JA 2C4UA 2XMPA 3IAUA 4LC9A 5AJZA 5DASA 4A2WA 3SJBA 2XBUA 1QMPA 4DRXB 4B44A 1GCOA 3FYHA 4GSYA 3ZS8A 4AX4A 4A10A 4NOLA 1UUFA 1FS6A 1C30A 5EJIA 4FZRA 1C4KA 1XZAA 3ZU4A 2ST1A 4B74A 4ER5A 2WYVA 4N6NA 1OJLA 4AJ9A 5EHNA 4OYHA 3TV1A 3JD3A 5C3MA 3BK7A 2VBGA 1TM7E 3E9ZA 1JXQA 2Q8NA 1USWA 3NM4A 4NBLA 4RHCA 5GPBA 3TSZA 1VLJA 3WMFA 3AVXA 4LHWA 5TF0A 1MB4A 4W8HA 3QU2A 2X1VA 1TLFA 3PCXA 2C5HA 3OU6A 3RFFA 3JD0A 3RFCA 4IUYA 3ICVA 4NAHA 3EPKA 2EL7A 2VK2A 4LE1A 3CZ9A 4F11A 2H9IA 4LJ6A 3PR3A 3K0BA 4B40A 2ZITA 3UWKA 4UCWA 1FQOA 3B13B 3W6ZA 4ENVA 4KG7A 1I7BB 4EUHA 4JYMA 1J42A 2DLCX 1GPLA 3BTVA 1ISPA 1KVRA 3RBAA 3D6AA 3SGLA 1DZIA 1UINA 2JBAA 5DYNA 1XSEA 3V2UA 4G65A 5BXYA 4Z9XA 4HGZA 2LCIA 2DBZA 2O2GA 3VPHA 3VZQA 4BKOA 2JFFA 3GD7A 5BUQA 4PRLA 1GG8A 5I8ZA 1S8OA 3OC0A 4NK4A 1XZJA 4IQGA 3K0SA 3ROGA 1L4UA 3I3OA 4C0HA 1VLVA 1TK9A 2YHIB 2NSDA 3K4QA 5DIFA 2J3KA 4KB5A 4GT1A 2JFYA 2GWRA 1XJCA 4PTLA 5KBYA 1RQGA 3SJCA 5TY0A 2J08A 4JLJA 4H08A 3PX2A 4YJ3B 1XEXB 4HEQA 1YQUA 2P4QA 2WUGA 1K66A 1VHQA 3LCCA 4HWPA 3WDMA 1QBGA 2IS1A 4EY3A 4W5NA 1YH3A 1Z26A 4RFSA 5AVUA 1MJ5A 4KO1S 4IIEA 4G4IA 3FJOA 3R0QA 1FQKA 4EUSA 4Z4QA 4L0CA 3ISTA 1V39A 1NE2A 2AYZA 5BUCA 3GGPA 1AKTA 1A7AA 3KOYA 4MCAA 2V5UA 4PG7A 1C8LA 1M2HA 1BDIA 2A5GA 2JIRA 2Q4BA 4MI6A 3UWOA 3ZDQA 1DJMA 1UKZA 2I3GA 1VXRA 3KOXA 1MIHA 3WP0A 5EMHA 4R1OA 2YHUA 1MDFA 2GZSA 2WSIA 4MB6A 4KWEA 2FMTA 2UUPA 3QPVA 1MCZA 3KOUA 1QHHB 2QZSA 1SBNE 1ULZA 3BH6A 5JAHA 3M1LA 3V8RA 4JNCA 1HKUA 3DAFA 5G0VA 4EY6A 3MTJA 4YJHA 1RQLA 2XCIA 4RTRA 2VYCA 4FX5A 4PWZA 3T0IA 3PF9A 3RPEA 3LBNA 5DM0A 4U7DA 3HDVA 3MJCA 3U7HB 3UJ7A 4PHHA 3H5IA 1RHUA 4KBGA 3S40A 2B0JA 3WY9A 2X0DA 3RH0A 4EPTA 3M82A 4ZYLA 1EINA 4UOZA 1EX6A 3AG5A 1F6DA 2O3SA 5HK8A 1SA0B 1E4OA 3OFVA 4NU5A 5EKTA 3KQYA 4DARA 4M0LA