3QV1A

Crystal structure of the binary complex of photosyntetic a4 glyceraldehyde 3-phosphate dehydrogenase (gapdh) with cp12-2, both from arabidopsis thaliana.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
337
structure length
337
Chain Sequence
AKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Selection and Folding-upon-binding of Intrinsically Disordered Protein CP12 Regulate Photosynthetic Enzymes Assembly.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase/protein binding
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic
total genus 116
structure length 337
sequence length 337
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.2.1.13: Glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating).
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qv1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qv1A01
2WD7A 5DBGA 4M86A 2W2KA 3LU1A 4AJ1A 5L53A 4RPLA 1BXGA 3JYOA 4JCOA 4ZRNA 1AN9A 1P1IA 4CMIA 4OKNA 4J9VA 1GV0A 1P0FA 1ENOA 4DUPA 3K8ZA 2H5LA 3O4RA 3X2EA 3LZ6A 1RKXA 3B1JA 2FPGA 4P4GA 4OM8A 3IIEA 4QQRA 1UAGA 1SEPA 4GLLA 2VUSA 1DB3A 3C7CB 5L7YA 4PGFA 4JBIA 4TVBA 4YJHB 3GMSA 5G0UA 4ND4A 4C4OA 1GYPA 5H81A 1F12A 1PL6A 3WJ7A 3L9XA 4YJGA 3DZKA 4WOKA 5DOVA 1KOLA 4OYRA 2V65A 4A73A 3GNQA 2RH8A 2EGHA 4UUPA 4XWYA 1GPDG 4NU5A 3WMWA 3A06A 3D3WB 3NEPX 3RUCA 3GF4A 4DYDA 4KTTE 3SC4A 5LDGA 3TSCA 3ZDFA 4FFPA 3JYPA 4PZCA 1T2AA 2BD0A 4JX8A 4AL4A 5T64A 2J3JA 5G4LA 3S1LA 1LC3A 1HEUA 1U5CA 2YFQA 4ID9A 2GO1A 1DRVA 4JIGA 2Q46A 1X0VA 3AM3A 2FZEA 3EAGA 3HDJA 3QW2A 4OSOA 4MOWA 1A71A 4BNZA 3DBLA 4MO2A 1V8BA 2DTXA 1MGOA 1EBUA 5EPOA 3ITKA 1VSUA 3KUXA 3U9LA 4J4TA 3I9NA 3VKVA 1B7GO 4ZICA 1MC4A 5JYEA 2C7GA 4HFMA 5ES3A 3QP9A 4L0QA 1E92A 4XGKA 2WYWA 5B4UA 4C7KA 1DOHA 1Z7BA 1KVTA 3ANLA 3NT4A 5TF4A 2FSSA 2QRJA 4L74A 3WJAA 4AJNA 1HWYA 5IXSA 1KVQA 4JROA 1KS9A 1GEEA 2W4QA 3NKLA 3ITDA 3TWOA 1CETA 4OAQA 4W4TA 1I01A 2EGGA 4A5OA 2BH9A 3S2FA 1NAIA 1ZNQO 1KEWA 4IY1A 1OZAA 4IJWA 5FF9A 3RIHA 4HV4A 4NK4A 4IDGA 5MGBA 1XGKA 3ROPA 2ZJ0A 3JYLA 4LRSB 3D7LA 3GZNB 3GZ4A 5G0SA 1R6DA 4AJEA 3ZH2A 2E6UX 3GNSA 2ZYAA 1E3EA 3CINA 4XEHA 1CIVA 4YT5A 4MDHA 3MJEA 1RM5A 4QXMA 3K31A 1JU9A 1DHTA 2YYYA 3ON5A 2VRCA 3K96A 3TZQA 3ZNPA 3C24A 1OBFO 1HZZA 4L75A 3ZU3A 2BELA 2F00A 1JTVA 2FPIA 1ZCJA 3GFGA 4ZVVA 3SEFA 2AHRA 5TC4A 5KJ6A 3Q2IA 1YVEI 1ZK0A 2AEFA 3VVCA 4UUOA 4A10A 1Q7CA 4FCCA 5F1KA 2B83A 3GRKA 1EE9A 3GUYA 3HB4X 2C2XA 2BFMA 2ZB7A 2DLDA 3CEAA 1N5DA 1YB4A 3RC9A 1HZJA 1LSOA 4G81A 1T4BA 1I30A 3MOGA 4A7PA 1O0SA 1OMOA 1PS9A 4TRRA 4RORA 5JW6A 3PHHA 2RHRA 2JL1A 3U0BA 5C3MA 3AW9A 3IL2A 1NASA 2UUPA 2Q1WA 1YBAA 1Q7BA 4QTZA 4CR8A 2NU8A 1EK6A 1FDTA 4CMHA 2PLAA 5ENVA 4GSKA 3NGLA 3WGHA 2VHZA 3H3JA 1GQ2A 3FWZA 5JE8A 4RZHA 3NTQA 1PJ4A 3AI1A 1EFKA 1X1TA 1IE3A 1FK8A 2DUWA 3RCBA 3QIVA 4BKUA 3FNEA 5B37A 1DFGA 1I10A 3IP3A 4MKRA 2NTJA 3BMCA 4NU6A 3I9KA 2X9GA 4CLXA 3DBRB 5HRUA 4E31A 3WQRA 1GAEO 4D45A 2DFVA 3Q9NA 3DHYA 4OIMA 1H94A 1ZK4A 2B5WA 1I3LA 3GVHA 2D2IA 1GADO 3PGXA 1JWAB 4PG4A 4B3JA 2BGMA 3D3WA 1FDVA 3K73O 3K2BA 3H6KA 3HUDA 1FMCA 2HU2A 2Q99A 3OECA 2YJZA 3NJ4A 2O7QA 4U7WA 4MVJF 1HDZA 3GLQA 2ZTVA 4JLWA 3W8FA 3C3XA 3N74A 4PRKA 1E7SA 2Z1NA 4G65A 2DBVO 1PEDA 3C1OA 4XQCA 1HE2A 1QP8A 3JCZA 1IYZA 4U5QA 1KVUA 3JQEA 1M2WA 3OJLA 5F1OA 3BTSA 1HTBA 3EZLA 2EV9A 2HJSA 3DBLB 4K9DA 1V0JA 1VC2A 2CDCA 1QSGA 3HDHA 4AJHA 1KVRA 4FOOA 2Q2WA 3FWNA 1SPXA 1ZK1A 1NFFA 3IUSA 5L4NA 5A5EA 1ADCA 3TRIA 4CM1A 3PLNA 2CDAA 4HFRA 1I3NA 3FBGA 2HRZA 5AXDA 4DVJA 4J90A 3MEQA 3DR3A 4WPGA 1DPGA 2NM0A 4TWRA 1EQ2A 5CG2A 5AQ1A 2XOXA 4PFJA 4BOYA 5IAAA 1CQIA 3GC6A 4YBZA 2WM3A 3VPHA 4ZU3A 1O94A 4PZDA 1XQ1A 4YRAA 3MWDB 3VKUA 4Q3AA 4ILKA 5C37A 3SXPA 4CMIB 4I1IA 4Z0HO 1J49A 2D5CA 3I52A 4M8SA 3AY7A 1PU2A 4GX0A 1LSJA 1UDAA 3S2IA 4CPDA 4WNIA 2ZQZA 4PLHA 4BV9A 3JTMA 2DAPA 5L7TA 4D0RA 3H3FA 3L9WA 5I8ZA 1FDUA 4J3FA 1GPJA 3C1AA 5DP1A 3CE6A 4WLOA 3X2FA 1K6JA 2LDXA 2AQHA 3D4OA 4XZ3A 3WG9A 2B4QA 4BIIA 5A9RA 5A02A 4PLYA 5I7SA 4BKPA 3UW3A 2YV2A 4CM8B 4O59O 3Q2KA 3ZWVA 4MVJE 1BDMA 3I6IA 3DQPA 3O8QB 1O5IA 2GZ1A 2R2GA 2ZB8A 5CDGA 2FR1A 3U62A 3ZHZA 2RH4A 1I33A 2V6MA 2H6EA 1JKJA 1XKQA 3R0IA 3WQQA 4BO8A 4AJKA 3ROKA 5K9ZA 3JQDA 4MP3A 4IQ0A 1B8VA 3AI2A 1ZSNA 4JP3A 5L3ZA 3P5SA 4RQTA 5COQA 1P9LA 4UULA 4IXTA 2DPHA 2G82A 4XB2A 3WGGA 4J7CA 5EESA 2XF8A 2VT2A 4UEJA 4KUEA 2OHXA 3CH6A 4GPD1 4HADA 1LXCA 1X13A 3RKUA 2CVOA 2Y0DA 3GN1A 3QRWA 1W8DA 5EQDA 3C1TA 3WB9A 3K5PA 4YJGB 1DC4A 4J0FA 5BQFA 3DZJA 3PIIA 2IXAA 3PWSA 1YOVB 1SZJG 1ULUA 4AJJA 4BS9A 3M1LA 3OQ1A 2X23A 4XRGA 2HRBA 5A9SB 5KVQA 1P0CA 1T1RA 5B4VA 2RIRA 1XU9A 1HDRA 1GV1A 2J3HA 2PGLA 5COBA 4WOJA 1R4MB 3LDHA 3GR6A 5IDYA 5IG2A 4K28A 2X9NA 5TS3A 1HDYA 1RM0A 2OO5A 5CDSA 1Z45A 1BXGB 3LVFO 5FI5A 3LT2A 3JD3A 2QHXA 2G17A 1OI7A 4RVFA 3TFOA 5TT0A 3WMXA 3OETA 4CLEA 1DO8A 5T8KA 1PJQA 3QVOA 3IAHA 4JBHA 2ZK7A 3KYDB 3NTRA 3ZNNA 3NRCA 4XYGA 4Z9XA 2EJVA 2WJPA 1ZMTA 1U7HA 2R00C 4HFJA 4OO3A 3K6JA 4AJIA 1ML3A 1R37A 3RJ9A 2DUUA 4FGWA 4R69A 5TJ9A 5THQA 1RWBA 1T1SA 3ANNA 3SBOA 2WE7A 5ER9A 3E5RA 4P22A 1BRMA 3ZGYA 4CM7A 1FDWA 1PZHA 5F21A 3L4SO 3DBHB 1HT0A 2POQX 1RYEA 4FFMA 4RF2A 3ZZNA 3FPLA 2Y68A 9LDTA 1WMAA 3VDRA 1WLYA 3DOCA 5I9LA 3VTFA 5HS4A 4GAEA 3FR7A 1NYTA 1X7GA 2Q1SA 3ETGA 1B26A 4DIFA 1R66A 2HMWA 2V6BA 2GSDA 3FTNA 1F17A 2O23A 4R3WA 1LDBA 4YYZA 4XDYA 1EFLA 4LISA 1MUUA 1R15A 2EEZA 2P68A 4GL4A 5TLSA 2DC1A 1WXDA 3CUKA 1H0KA 3N7UA 1QKIA 4K6CA 4I5EA 2HSDA 3W4IA 1C1XA 2Q45A 2IODA 3JQGB 2J5RA 1WP4A 1E3LA 4XJTA 2B4TO 4HNHA 1W6UA 3AUUA 3DWFA 3QSGA 4IIUA 1EVZA 3QWBA 5A1TA 4MVJI 3BMQB 3QWHA 4FOSA 1Q2XA 4A2CA 3DMTC 1QMGA 3GPIA 1P1FA 1PWXA 2WTBA 3R1IA 2IDZA 2FN7A 3W8DA 3H2ZA 2W8ZA 4LMRA 4YTEA 4BNVA 2RCYA 5B4TA 5DNAA 1HSZA 2FHSA 4W6ZA 1DIBA 4YR9A 3WYBA 2HMSA 3H2SA 4KDFA 4BO7A 4BNXA 3GOHA 3SX2A 3Q9UA 3AU9A 4Z3DA 2P4HX 1AHHA 4YT2A 1NPTO 3GGGA 3RU7A 1GYRA 1Y1PA 1C3VA 3GQVA 4ZD6A 1YGYA 5JBIA 5IZCC 2EIHA 2PZLA 2ZJ1A 5DBFA 5EL0A 1EE2A 1PZFA 3DO5A 3CMCO 1ZMOA 3DTTA 3OEYA 2OFPA 2JCYA 4CM6A 2BI8A 4MIEA 4R1TA 5TRTA 2UDPA 4AFNA 1XYGA 1OFGA 4JNKA 1DHRA 2CY0A 2ZYDA 1M6HA 1EMDA 5A3VA 1R0SA 4J16A 3E82A 4DPMA 2JCXA 4XRRA 1KEPA 2R6JA 3BMNA 1R16A 4FIZA 1M76A 1UZLA 2PGDA 3H7AA 2O3QA 4MP8A 5TQVA 4BMVA 2D59A 4IQ8A 3D64A 4FD3A 2DBZA 4NK5A 3H9JA 4OXYA 4TZTA 1JKIA 5EQFA 3OF2A 4LGVA 4RL6A 1HLDA 5MDHA 2ZTUA 5A9TA 4EJMA 3WGTA 3IQDB 4R9SA 3ZWCA 1ZKMA 4L4SA 3WQSB 3UCXA 4DMLA 5L4LA 3CTMA 1UUFA 4DLBA 4XB1A 3SJ7A 3AOEC 1QV6A 5JY6A 4TQGA 1TB4A 4UEOA 4E5YA 1NTOA 2GZ2A 1W0CA 3PJGA 3WSWA 1UP4A 3OSUA 4R54A 1XQ6A 1E7MA 4BNKA 1LX6A 1SC6A 4HY3A 4CM8A 4JQCA 3RASA 3GH3A 3GK3A 3VH3A 3RBXA 4MVJH 5L40A 3C7AA 1J6UA 4PRLA 5CHEA 4MKXA 1PGPA 3B1FA 1C0IA 2BFAA 1UP7A 2BHLA 5AXCA 2HK8A 1D7OA 2I9PA 3BZUA 1L1FA 1WWKA 4RVGA 5CDUA 4I08A 2TMDA 4XDZA 4FFLA 3ANMA 2B0JA 1D1TA 2IZ1A 4TRNA 2OP1A 2G76A 4KQWA 5U4QA 4PLZA 4OQYA 4GWKA 1JDJA 4IGEA 4W9NA 2ZATA 3IMFA 3PIDA 3FD8A 2P2SA 1X7HA 2VYNA 1KIFA 3ZW9A 1BSVA 3I4CA 3M6IA 3E48A 1ARZA 1PJCA 4NJMA 7ADHA 2XAAA 1L7DA 2IEDA 3I9JA 3PPIA 5ITVA 2Q49A 2VQ3A 2PKQO 3D0OA 4B79A 3LT0A 1Y8QB 3GNTA 1DRWA 4R5HA 4KQXA 5FEUA 4CMBA 2C20A 3EHEA 3TZHA 2Y67A 3FRJA 4BMNA 2JFFA 1N2SA 1N1EA 3A1NA 4WLUA 2P9CA 4HNGA 1IPEA 1PGJA 4D43A 2VHWA 3PQFA 1KEUA 4CODB 4BGEA 2VWGA 1AUPA 2VRCD 1LU9A 1NHGA 3PQDA 3S2GA 1ZFNA 4FC7A 3EUWA 4J9UE 4PG7A 2DKNA 2OL4A 2UUOA 3LT4A 2D1YA 3KSDO 1CEQA 2VYVD 3UHAA 2IYOA 5ER6A 2X58A 3OJOA 3DAFA 1VJ0A 2RAFA 1J4AA 3VPFA 4QO8A 3DAPA 2NQ8A 1E0DA 1HDXA 3RAJA 4E21A 2BGKA 3ENKA 3ICCA 4XYBA 3KRTA 1ULSA 1NP3A 4YEDA 3H4VA 1NVGA 4IPTA 3V2GA 5A4DA 4MVJM 1JVBA 2AQ8A 3BHJA 1E7YA 4IS3A 5JNLA 3TFQA 4GKBA 3H5RA 2I3GA 2PR2A 1HF3A 4WLNA 1GD1O 1GYQA 3G1TA 4JXKA 1HYHA 3ZWOA 3IJPA 3PWKA 5EERA 2FMUA 2IE0A 3TZKA 1YL7A 1X0XA 3AI3A 3B20A 3BXXA 1TXGA 3RUDA 4DA9A 2B37A 3I9LA 3DDNA 4PG6A 4RVHA 3LLVA 1YXMA 3VOSA 4NBWA 2X7HA 4LSMA 3ROQA 5KVCA 2AMFA 1K6XA 3Q3CA 3L77A 3PYXA 2BFPA 3GDFA 3ROMA 1Y81A 3AK4A 4ROSA 4J1QA 1ZEJA 2EF1A 5EJ2A 3V1TC 3KLMX 4CMJA 2G0TA 1E1NA 3JYQA 1KEVA 4UVGA 3QV1A 1R12A 3OMLA 3VPGA 4RO0A 3E5MA 4W7IA 4BKRA 4BNMA 3ZN2A 3JQAA 5EN4A 1EEHA 1MC5A 1LDYA 4M49A 1E3WB 4EEZA 2J3KA 3LT1A 5JCJA 1VM6A 3KETA 5JPIA 3B6ZA 3T7EA 3GT0A 4ND3A 4Q3NA 5A3JA 2C5EA 4KDEA 4BO2A 3IDSA 3PLRA 4J43A 1SB9A 2PKQP 1ONOA 4J1NA 1DFIA 5DF1A 4UVIA 1JKFA 1PTJA 3H9GA 1LRJA 1M67A 4GX2A 1FDSA 2NVBA 2NTVA 4J49A 3O8QA 3QVWA 1NQ5A 3U3XA 1YONA 4MIOA 2QRKA 2Y0CA 4CLOB 4BMSA 1DFHA 4GX1A 1C1DB 4M87A 4P4NA 3L6DA 1I24A 3NDIA 1DAOA 3RD5A 4E4YA 4CJXA 2QX7A 3CPSA 3ZWPA 2O50A 2I5PO 1EUDA 2E82A 4WJZA 3WWZA 3WGIA 4TVOA 3SVTA 4ALNA 3C8MA 4LCEA 4YCAA 2EKPA 2EW2A 3WS7A 5JXWA 5JMPA 5BNIA 3UN1A 3VZRA 3AM4A 1LA2A 1LSUA 3U09A 1T2EA 3IKVA 5CPBA 2GERA 3WYCA 3JQFC 4FPXA 4LMPA 4L76A 1JVSA 4DGSA 4FFRA 5DZSA 2SCUA 4RF5A 1WNTA 3GGOA 4BB6A 1B0AA 1VPDA 1PJSA 2WYVA 2GCGA 3ICPA 2AG8A 4JJIA 4XIYA 1GDHA 5EINA 5G4KB 3PK0A 2W90A 4IMRA 2X8LA 3BMNB 4ZHSA 1OC2A 3FHLA 2Y1GA 1N7HA 2YHIA 1A5ZA 4WE3A 3RWBA 1K89A 1P3DA 4UUNA 3AM5A 4KWIA 1FF9A 3IKTA 2OGUA 1TT5B 2Y99A 2HAEA 4JK3A 2JAPA 1UR5A 2HCTA 2QW8A 3BMQA 1YBVA 3W1VA 4A26A 3QVXA 5HTOA 1N8KA 4NNJA 5ILOA 3CXRA 3GA0A 3FN4A 3PJFA 1UH5A 1PQPA 1VLLA 5THKA 4FB5A 4IMPA 4IUYA 2FZWA 3UCFA 1RJWA 3I23A 2HQ1A 3MTGA 1C1XB 1WW8A 3GEDA 1QXSA 4OSPA 2Y05A 3F46A 4R4JA 4RV9A 3WIDA 3V1YA 1YL5A 2AA3A 3UICA 4HKTA 1HETA 1IUKA 4M1QA 4LK3A 1IOLA 4BGUA 4CLRA 1BDBA 4Q9NA 3G49A 2DFDA 2HJRA 1BG6A 2C59A 1BVRA 2VZ9A 1YL6A 4KUHA 1MA0A 1N9GA 4CR6A 4D3SA 1E1LA 3DFUA 3ETEA 1DC6A 4W9NC 3EVTA 1D4FA 2VHYA 4R1SA 1OC4A 1KC3A 4ZA2A 2NVUB 3NTOA 4PLVA 5L9AA 1U5AA 5GZ6A 4BVAA 2CVQA 1BXKA 3MJ4A 5JS6A 4BNWA 4U0JA 4U6QA 3CIFA 4RCVA 2QYTA 2GZ3A 3ONDA 2GN4A 3H65A 3KO8A 5CEFA 4E33A 3F3SA 5IJZA 5JC8A 4Y98A 4YJFB 2WSBA 3TPCA 4K6FA 2C2YA 2EJWA 3ZU2A 1GFSA 3KB6A 4GKVA 2W2KB 4XYEA 2IZ0A 4GX5A 3GVXA 4CLOA 1PZGA 3L0DA 1SEVA 1Y5MA 5AXBA 4UAGA 3TZCA 2PTGA 3U4HA 4EBFA 5BSGA 5B12A 1QV7A 4CM4B 1IL0A 3RC1A 1GQQA 3RKRA 3P7MA 4OQZA 4CM5A 3K30A 3WYEA 6LDHA 5HS6A 4PVCA 2C07A 2J3IA 1A9YA 3W6ZA 1NPDA 4CV1A 4D3FA 2I6TA 2I66A 4JN6B 4RPJA 2BGLA 3DBRA 4RVSA 1X7DA 2V6FA 5U1PA 1B2LA 3HHPA 4ZGWA 3M2TA 4TKLA 2V7PA 1GY8A 4AJ2A 4YWJA 4N5NA 3ZWBA 2PD6A 5CG1A 2Y1FA 5ENDA 4DQUA 2PZJA 1LDNA 2HDHA 5FWNA 1HE4A 2R00A 1E1MA 5L45A 2JHGA 4Q39A 4XGNA 4BO0A 5IZ4A 3WNQA 4IDAA 4XX0A 1P44A 5I8WA 1XHLA 3Q1LA 4XGIA 5KJCA 3HFSA 4O6VA 3PZBA 4YJHA 2VCYA 1B15A 1P74A 3WTBA 4IDFA 3VPXA 1M6WA 4Z6KA 5KKCA 3DZBA 3CKYA 1HXHA 4L8VA 1PJLA 3AU8A 4HP8A 2B5VA 1SAYA 4ALMA 3U5TA 2J5QA 2D0IA 1YWGO 8ADHA 4DBVO 5L95A 2GR9A 2IRWA 4R9RA 4QO7A 5A5FA 4XYMA 1LBEA 2DBRA 3GDGA 1NR1A 3ZHBA 1DAPA 3PXXA 4AICA 3LC2O 3PHJA 4TMFA 1PGQA 4PLWA 3GVIA 4BO9A 1PJBA 4EZBA 1EZ4A 4DYVA 1O95A 3O03A 4GQAA 1HDOA 1C0KA 1XELA 5C7LO 3G3EA 4BNFA 4NFSA 2Y1DA 5JFOA 4YRDA 2CMDA 3ULKA 3RROA 4D0SA 1C0LA 4YAEA 4CQMB 1UXKA 1D8AA 1DRUA 3NJ8A 1XEAA 3EK2A 4MVJP 1K6IA 2VNSA 3LC1O 4O1MA 4RDHA 3INTA 1UXGA 3TDKA 2CZCA 5DCYA 5JYFA 3HNPA 3VTZA 4PZEA 1HE5A 1T24A 4AVYA 4Y6SA 4NBTA 5K6AA 3H9UA 5EMHA 5KIAA 3E6AA 1B8UA 1B16A 1DIRA 4ND2A 2GN9A 1LLQA 1HDGO 1NPYA 3JQ7A 4Y67A 1UXHA 1I3MA 1WDLA 4NMHA 2VWQA 4RPKA 4IJKA 3PJEA 2AE2A 2EWMA 3PFFA 1DLJA 1VJ1A 2FR8A 2OORA 1O6ZA 2WE8A 1UP6A 1QYDA 3I1JA 4ALKA 3AUSA 4B4VA 3QWFA 3S55A 4IXWA 4CMKA 3BTVA 3F1KA 3W4JA 4YAGA 1FJHA 3PWZA 3OQBA 3GDOA 1H6BA 2VT3A 4E0BA 4FFOA 3WFIA 3HG7A 4WUVA 3FPCA 4E6PA 1WMBA 3PYMA 1GZ6A 1EBFA 2GRAA 2NACA 2OBNA 4E2YA 2FSVA 3LQFA 2YZ7A 5JO9A 3EGOA 4KTVE 1ISGA 1ZK2A 2VHVA 1XDWA 5L4SA 4IDBA 2QZ9A 3FNGA 1I3KA 4NR0A 4E3ZA 5CAEA 3OBBA 1DEHA 4R3NA 2VNAA 3GEGA 5IDWA 2Q4BA 5BNFA 1G0NA 4TZKA 5KJ1A 4NBRA 3H5NA 1VKOA 1YJQA 3ZWXA 3FNFA 4MVJA 2X6TA 2XXBA 2P4QA 5TT1A 4EUHA 1Y6JA 3COSA 4CUZA 1F06A 4FN4A 4BGIA 1U28A 1J0XO 2NTNA 1GZ3A 2Z1MA 5BSEA 4QECA 1C1DA 1PQUA 1QYCA 2PZKA 4CM9D 2PY6A 1QR6A 2YHIB 3AUAA 4DC0A 3EC7A 2C0CA 3VHRA 1ADFA 3DB2A 3V2HA 1E7WA 3EDMA 2GGSA 2YDXA 5TGDA 4XCVA 4BO6A 1QRRA 4JJGA 3PJDA 4WLEA 4PLFA 4EYEA 4GMFA 2C5AA 2UAGA 1VL8A 4XR9A 3EMKA 1XIVA 3JD0A 2CF6A 3WX0A 1IHXA 1CWUA 1ENZA 1U3TA 3STHA 1LUAA 3M2PA 4PLGA 3GAZA 1JW9B 5F5LA 5G0WA 3JQBA 1UXIA 3DZGA 4RVUA 4OOEA 1EVJA 1EQUA 1ZIDA 1U2DA 2GN6A 4DIBA 4B3HA 5T6BA 1UZNA 2AEJA 1GU7A 2WD7B 3KBOA 2O4UX 4DPKA 1F8GA 1ISIA 3S2EA 3WDSA 1YRLA 4BO5A 5T67A 4NG5A 4D3DA 1MB4A 3V2UA 4S3MA 2Q22A 3SLKA 1SB8A 3K2EA 1U1IA 1BTOA 3PHIA 1N7GA 2WEKA 1C14A 2EXXA 4FS3A 4KP7A 1G1AA 4N54A 1NVTA 3KEQA 1H6AA 4L9RA 2HK7A 2D4AA 1PWZA 2OXIA 1ZW1A 4J2HA 4CLRB 4I9HA 2Q2VA 5KVSA 1KY4A 4F6LA 5U9CA 4H3VA 1SOWA 3KV3O 3OHSX 4YB8A 4NZ9A 1PR9A 5L51A 4WGGA 2NV6A 3NUGA 3DOOA 3GUCA 1HE3A 8LDHA 1LTHR 1DC5A 1U4OA 4INAA 1YBMA 3RSHA 4R1UA 3V1UA 4YJFA 3KEOA 3OQ6A 2DPGA 3R6DA 3OJFA 5JLAA 1MFZA 4ZN6A 4JGBA 4DQVA 3DFZA 4YJDA 1IZ0A 1A4IA 3OIGA 4WLVA 4D42A 1BMDA 5BSHA 3JD4A 1V3VA 4D79A 3C85A 1U3VA 2CVZA 5LC1A 2QQ5A 2P91A 4CQLB 1S6YA 5DCWA 2PNFA 3RQSA 1JAYA 1LRLA 3EYWA 3ADOA 3T4EA 1ZO8A 5GZ3A 1H9AA 4I5GA 3WOHA 3SJUA 1WAMA 2DTEA 3HQ4O 2I67A 3F47A 5AVOA 5IXYA 1VKNA 3L6OO 1AHIA 1T26A 3ZU5A 1O89A 2DT5A 2C82A 4EEXA 4XJSA 3BTOA 2Y93A 1NXQA 1Q7GA 2C29D 4R1NA 2DM6A 3MJCA 4E5NA 4FDAA 5G2OA 3DOJA 4K26A 1HLPA 5CEEA 3DZFA 4M89A 3D5QA 3VZQA 4BNLA 2JFHA 3PFWO 4GBJA 4UUMA 4C7JA 2NSDA 4GVLA 3ADPA 5F3RA 3RUFA 1YJ8A 1ZSYA 4NPCA 3TOZA 2E49A 4EJ0A 3DBVO 3ZV3A 4OHUA 5DN9A 2D5AA 2O3JA 1KVSA 2WWRA 1E3JA 2B4RO 3BMOA 3LYLA 4PLCA 1FXSA 1PS8A 1T25A 4NI5A 4EW6A 4TKMA 2OZPA 2FWMX 2O3TA 1IHYA 5COAA 1A27A 2UYYA 4FJ0A 1TVEA 3ST7A 3WSVA 3VZPA 3FI9A 4R51A 5JCXA 1IPFA 4YDRA 4EGFA 1PQWA 4LRTB 1GUFA 1LI4A 2YW9A 3A9WA 3H8VA 1OOEA 4ITUA 4WEQA 4RPHA 4WKGA 1QYVA 4M55A 1P77A 2VOJA 1G6KA 1C0PA 2X0RA 4B4WA 1E3WA 4BNIA 5ADHA 4L73A 2H63A 4X54A 3MTJA 5L7WA 4U8GA 2TMGA 2P9GA 5GY7A 4BO3A 2ZB3A 2NUAA 2I65A 3PDUA 2JJYA 1Y8RA 2H9IA 4NJOA 1LC0A 2X9VA 3WLFA 3PI7A 3B1KA 5F1PA 4KUGA 4A03A 3RUHA 2VN8A 1GQYA 5IZCA 3IC5A 1Z6ZA 4RF3A 1K0UA 1NX6A 1VL0A 1RM4A 3ZU4A 4CL3A 4P8RA 1DJNA 3U4DA 3UFXA 4ND1A 2Y1CA 3RJ5A 1Z82A 2FY8A 1R0LA 1DIGA 3UF0A 1ID1A 5TSDA 3WWYA 5I9NA 3HSKA 3JYNA 4OKIA 3IS3A 3ASVA 1LDEA 1PSDA 1DC3A 4L4RA 3GMDA 4Y6PA 3GVPA 1ZBQA 3OFSA 4Y8VA 4YRBA 3KHUA 2NADA 3OICA 2VYND 1I36A 2AQKA 3F4BA 1CYDA 4LVCA 4E5MA 4J1TA 1X15A 2X1HA 3LLSA 1YDEA 4CQMA 3NYWA 1I5RA 4G5HA 2O48X 2XXJA 5HM8A 1ZXBA 3GRPA 3JQAD 3HDYA 3E9NA 5FFFA 4FR5A 1DIHA 5LCXA 4GWGA 1E7RA 2Y1EA 4CUKA 3KYCB 5M6DA 4WK6A 3ONFA 1PL8A 4ONEA 1AXEA 1B14A 1E6EA 4G2NA 1CERA 3F4LA 3WBBA 5IN4A 4B3IA 4BGVA 5H82A 2CF5A 3MJSA 5AYVA 4QEDA 3W8EA 4YXFA 2W98A 3DXFA 3OIFA 1R4MA 1UDBA 4J4BA 3WXBA 1X1EA 1U7TA 2VWHA 2X5KO 3UVEA 4B4OA 2BI7A 5C5IA 3HADA 2G5CA 2X86A 2PKRA 4BQRA 2YQ5A 2JD0A 4UREA 1DDOA 1Y8RB 3L6EA 1L7EA 1KBZA 2ZTMA 2Y66A 1J5PA 5CPFA 3KYBA 3GG2A 2HMUA 1PJ2A 5ITWA 4JBGA 4B7UA 5KKAA 1MFPA 3KSZO 2G1UA 3ZHXA 1P33A 2OP0A 2NU7A 4ZQEA 4F3YA 4AJPA 4XYLA 3PHLA 1DSSG 4Z0TA 5DOZA 4CMEC 4HXYA 3ZI0A 2GLXA 3DZHA 5T8KC 1TT5A 4WASA 1GUZA 4O5OA 3RFTA 5CDTA 4TSKA 1GTMA 5KNLA 1LSSA 3OEWA 1JA9A 3PYLA 3AFNA 4BNGA 1PS0A 1Y9EA 1YQXA 3JQCA 5AXAA 3RFVA 4A27A 1N9GB 4EJ6A 4Z9FA 2OMEA 4MJLA 1U8XX 6ADHA 1CJCA 4IDEA 4WCDA 4XQGA 4Q3EA 1Z75A 3WGQA 2EP5A 1YB1A 2YDYA 3EW7A 4B8WA 4EUEA 2VRBA 1E3IA 1T2FA 3TZ6A 2P5YA 4LSWA 5H83A 1CRWG 1U3UA 4RF4A 2QYSA 2AEMA 3ZHYA 4Y6RA 3ZV4A 4RDIA 4CV2A 3ZWNA 2BRUA 3JQGA 2PWZA 2EW8A 3GPDG 4W82A 1TT7A 5JCJD 4XQEA 2HMTA 2FP4A 4OOFA 2PH3A 1Z73A 1ZZEA 3DBHA 1JLLA 1GEGA 2O3SA 3OA0A 2A92A 5A9SA 4I9UA 3W6UA 1A7KA 1I2CA 2FR0A 1GUYA 3QY9A 3ORFA 1DIAA 3Q0EA 3ZCXA 2GDZA 4E2WA 3AY3A 3WTCA 1H93A 2X0NA 2O3RA 5DT9A 3DC2A 3PHGA 4EI2A 4GLOA 4BNTA 3TF5A 1R4NA 1ZSVA 3K9QO 5C7IO 4BL5A 2EKLA 1H6DA 1IY8A 3UGKA 4FQ8A 4NQZA 2X0IA 3HWRA 2WD8A 4FC6A 4YAJA 3GN2A 4GH5A 2FRDA 1Z74A 4RZIA 3LC7O 3AJRA 3KSUA 4RGBA 4BNUA 1P1JA 1K5HA 2JHFA 1KERA 7MDHA 2GPTA 2RBEA 1Z7EA 3S8MA 4GGOA 2NNLD 2AE1A 4YT8A 4QFCA 4CUJA 5JSFA 3DMYA 4PG5A 3MCVA 5IDXA 4F45A 4L4XA 5DULA 2VHXA 1AE1A 3LF1A 2RHCA 4NFYA 4BKQA 3HB5X 3RBZA 5T73A 4RPGA 2BLLA 3CSDA 1ZXLA 5K6AC 3JD1A 3GVCA 1BWSA 4NH4A 4OH1A 3RUAA 4DL9A 1U8FO 1P1HA 3E9QA 4IIVA 4GVXA 3E18A 3QVTA 3INGA 4URFA 5I7EA 5F5NA 3MJTA 3MZ0A 1SCUA 2W2LD 1CQJA 5TIIA 4OGWA 4LCJA 4BO4A 2IZZA 1QLHA 4IQGA 3SLGA 4B8ZA 4PG8A 3QVSA 2O2SA 1XCBA 4KOAA 2D8AA 1XA0A 5G0TA 2Q1TA 3P19A 2DQ4A 1RYDA 3GFBA 2VZ0A 3IOYA 3TQHA 5JY1A 2Z95A 3ONEA 3UCEA 4TRJA 4CMGA 3KLPX 4RLSA 4BNHA 3UUWA 3I4FA 4LN1A 1HSOA 1KC1A 3AOEA 4UEKA 2BKAA 4ZQBA 4RJTA 1BHSA 5BSFA 1N92A 1PGNA 2CSUA 4TRMA 3KXDA 3PRJA 1I2ZA 3C7DB 2Q1UA 1ENPA 2IEBA 5DP2A 3WNVA 2DTDA 4Q3BA 1B3RA 3CZRA 1Q0QA 5I7VA 2NU9A 2OUIA 3DTYA 4YVFA 4WEOA 1YH3A 1VSVA 3ZW8A 1ADBA 4ALLA 1ONPA 1F0YA 1MP0A 4WNCA 2DU8A 3E9MA 1D1SA 5IFLA 4N5LA 4NBUA 2CDBA 3VVBA 2I99A 1NBOA 3QWIA 4ND5A 3RC7A 4F6CA 1E3SA 2GF2A 2IXBA 2HUNA 4BNNA 3K92A 2VWPA 3LSYA 3JQ7B 2B35A 2QG4A 2YFHA 3QQPA 3F9IA 4IDCA 4AJOA 4CM9A 4OJNA 4ALJA 2A94A 2FOIA 4BQPA 3PEFA 1ZEMA 3TL2A 5JC1A 1PL7A 1MG5A 1NNUA 1ZK3A 3T7CA 5CFZA 4NJMB 4B7CA 3G1UA 1F8FA 3GHHA 5C7OO 1U3WA 2EERA 1VRWA 4KWHA 1VE9A 2O4CA 1Y9AA 1GZ4A 2HK9A 2O7SA 4IINA 4E13A 4ALIA 2O2YA 3QWAA 1X14A 3ABIA 4IS2A 1B8PA 2J5KA 4MINA 1WPQA 1BVUA 5EIOA 4HWKA 2Q2QA 5JAMA 5DDIP 4KZPA 1E6WA 1MLDA 3VC7A 4E5PA 4WCFB 1EVIA 3O38A 3L4BC 3R3JA 3H9EO 4Q3DA 4KMSA 4CV0A 1T2DA 1NQAO 2GNAA 2YHUA 4BO1A 1LLDA 1UXJA 4J91A 5JDCA 2UV8A 2NVWA 5K0ZA 3I83A 3CZMA 3UXYA 1I2BA 3DHEA 3PTZA 3WLEA 4BUCA 1S7CA 5ILGA 5KOIA 1NFQA 1V6AA 4RQUA 2PGJA 5A05A 5JAIA 1QG6A 1EUCA 1E77A 4H15A 4E2XA 5KWEA 3E03A 3OJ0A 2O3UA 1UDCA 2QIOA 1KETA 9LDBA 3KZVA 3VPSA 1BW9B 3DZIA 1SBYA 3HN2A 4I5DA 3DEYX 2JD1A 3I9MA 2JKVA 3IUPA 4IGFA 1K3TA 1DLIA 4FJ1A 2QRLA 5CP8A 3EZYA 4XKJA 1DBVO 2P9EA 1YO6A 4WLFA 1T2CA 1BXZA 3GAFA 1KY5A 3EY4A 1NQTA 3JQAB 4J0EA 2I76A 5B1YA 5IF3A 4MVJD 2F1KA 3GG9A 3KVOA 3VH2A 4CR7A 4Z3KA 3RU9A 3KYCA 1HYEA 3FCOA 3BAZA 3D4PA 4R01A 1GCUA 1W73A 3I6QA 5A03A 1A7AA 2C7VA 3VDQA 3FTPA 4E2ZA 5TX7A 1M66A 4ESOA 1NFRA 1EK5A 1NAHA 4NFHA 4P38A 2JD2A 3FBTA 3QLJA 4OXKA 1HYGA 2AG5A 3ZNQA 2PD3A 5JYDA 2VTEA 5JMWA 2A9FA 4FSHA 4S1VA 3NV9A 1VJTA 2JAHA 3W4KA 1Q0LA 1GCOA 1JQBA 4FW8A 4Z0PA 1LDGA 1PJTA 3F5QA 1A72A 3DHNA 1QYWA 3GZNA 3EVNA 1ISMA 2QZZA 2YV1A 3IP1A 4B4UA 4DWVA 5HA5A 2HLPA 3U49A 3LK7A 4FJ2A 5T57A 1ZH8A 5BR7A 4EDFA 1PR3A 3P2YA 1QORA 4II3A 1TLTA 4GGPA 2EP7A 2X5OA 4R5MA 3B70A 2LDBA 4I8XA 1LEHA 4CV3A 1U4SA 5DBIA 3H9QA 4PIVA 2Y0EA 1EUZA 1I0ZA 1XR3A 4NBVA 3RUEA 3Q6IA 3E8XA 5G4KA 2AQIA 2JFGA 1UZMA 4Z9YA 1V9LA 3AWDA 4ZQFA 4BV8A 3D3EA 4D7AA 4YPOA 3DONA 3KOUA 5HWSA 4J2OA 3JQ8B 3VZSA 2B36A 3FR8A 3UH1A 4J7XA 1EDZA 4DPLA 1LQTA 5TNXA 1E1KA 3JQ9A 2WYUA 1H9BA 1HDCA 2PFGA 3TL3A 2XPCA 2GN8A 2AXQA 1Y8QA 2AW5A 4CQMD 2ZIZA 4NIMA 4E5KA 4YACA 1TEHA 2H1SA 3FSRA 3I3OA 3BA1A 3NT2A 1K2WA 4E30A 3FF4A 3RFXA 1SNYA 4I9NA 4DLAA 4OL9A 1E7QA 1ZUD1 1LDMA 3UOGA 1SMKA 2C54A 5KJEA 1LLUA 3MJVA 3VH4A 5A04A 4DIOA 3GEMA 4HUJA 1QYXA 4YQZA 3PZRA 1N1GA 1P45A 4I5FA 2ZYGA 3I5MA 3T4XA 1TA4A 1NHWA 1XU7A 3TNLA 4LW8A 1WVGA 4FGSA 3D4NA 2DVMA 2PD4A 5JYAA 2V6GA 4ZRMA 3BMOB 4UVHA 3ZV6A 1RM3A 2ZKLA 1BGVA 4W7HA 4II2A 3I9OA 1LNQA 5BT9A 4FFNA 4Y9DA 3BHMA 3CMMA 4DLLA 3L4BA 1MG0A 5I9MA 1JN0A 3DAGA 4MKZA 3NDRA 1P1RA 1GR0A 1KYQA 1U2GA 4DREA 1YS4A 3WICA 1HRDA 1DXYA 2UVDA 2NU6A 2I3AA 3NAQA 3WR5A 5IN5A 4NHEA 1ISHA 1PZEA 3MOIA 5T5QA 4R68A 4CM4A 4CMCA 1ADGA 1PJ3A 2GUGA 4N5MA 1RPNA 3QA9A 1ONNA 1ISFA 2A4KA 3BHIA 4XD2A 2CD9A 1YB5A 3QE3A 5CDYA 2YY7A 1WDKA 1MXHA 3WBFA 4J4HA 2Y1OA 1PGOA 3N58A 3PGJA 2BFOA 2YQ4A 4D44A 4EUFA 2P5UA 3F1LA 4F46A 1WZIA 1I8TA 1HL3A 3GHYA 3OIDA 1MV8A 4D41A 3AFMA 4QX6A 2X5JO 1U9JA 1QLJA 4MVJG 2HMVA 5KVVA 4CMAA 4PLPA 4ZJUA 4E12A 1H5QA 1YQDA 2Q50A 2Z5LA 3JD2A 1PX0A 4LVUA 4YQYA 4UVEA 4MPDA 3WGZA 1T4DA 3Q11A 1P31A 4CLHA 1XG5A 3HFGA 4Q3CA 2ZCVA 3ZWAA 3H5AA 3E1KA 4B7XA 2ZQYA 4J1SA 2E48A 3QJ5A 4N18A 4WCFC 1LRKA 1YKFA 5A06A 5JAZA 5JDIC 4CQLA 2GD1O 3RBVA 1H2HA 1VI2A 5FI3A 1LLCA 3WGOA 1ZVMA 1WZEA 3WGYA 4BKOA 4YAIA 3AUTA 4MP6A 1MX3A 2IYPA 2B69A 1OAAA 3PVZA 1O9BA 3WFJA 3AY6A 1JAXA 4BNYA 2VZ8A 3KTDA 4U6SA 1CDOA 4XQ9A 5J9GA 3HJAA 2CUKA 1PIWA 4TROA 1ENYA 1HKUA 4FBGA 3O26A 4RLHA 3D1LA 1A4UA 2ET6A 2NWQA 4XIJA 5GMOA 1VL6A 1IZ9A 1V3TA 4CM3A 2EKQA 4PVDA 1NWCA 3UKOA 3GGPA 4H7PA 4WECA 1NM5A 4DC1A 2WDZA 3RVDA 2ZTLA 1E5QA 3PQEA 4AG3A 5CEJA 1Y7TA 5JDCC 2HO5A 3GY0A 4YT4A 2Q3EA 4PN3A 5ICMA 3D5TA 1CF2O 1AGNA 2J8ZA 3OH8A 2EHDA 2NLOA 1W4ZA 3PP8A 4PLTA 3U4CA 3G17A 1UJMA 3ZWMA 1NR7A 3OA2A 4PCVA 3VH1A 1P1KA 1Q1NA 5JDIA 3LF2A 1YQGA 1D3AA 4MIYA 2VYVA 3BTUA 2VTDA 2OBYA 3A14A 4HBGA 2EG9A 3KYDA 3BYZA 4R16A 4XA8A 5IDQA 1ZJYA 2X22A 2BF7A 2J6IA 1XSEA 1WDMA 2PH5A 3BMCB 3RUIA 3O9ZA 3ZWWA 2X0JA 2YUTA 3A28A 4QSMA 3HN7A 3ENNA 3BIOA 2Q4EA 1LJ8A 4K1LA 3M1AA 1H6CA 4IZIA 5HBRA 4A0SA 5KJFA 1ISJA 5KCZA 4BHTA 2E4AA 2OOSA 3ZWYA 3OM9A 4QUKA 4R41A 1Y5RA 4H16A 3UAGA 3HDQA 2VUTA 4QFDA 1JWBB 2CNBA 4GI2A 1A9ZA 4IDDA 3F5SA 4P4LA 3DL2A 3ASUA 3TN7A 3JV7A 4N7RA 1BW9A 1UAYA 1R4NB 4UVDA 2ZCUA 4O0LA 4WCFA 2ILTA 4HX5A 2X4GA 1DJQA 5ICSA 5I7FA 2YV3A 4RVDA 4XR4A 3JSAA 1XWFA 3JQ6A 4BNJA 2ZB4A 4CLDA 2PK3A 3JQ9C 2BMAA 4AJLA 4DMMA 3AOGA 2WMDA 3NT5A 3FNHA 3HZZA 4J6FA 3ZV5A 2PA3A 1NVMB 2HKIA 1V35A 2A35A 3G79A 3JQBC 4HFNA 3VAZA 2NVUA 5KTKA 1B3BA 1NQOA 1EDOA 3L07A 3MWEB 1AXGA 3RI3A 3A4VA 4D46A 4YA6A 2CFCA 1ZJZA 4BB5A 2GYYA 4OXNA 4DXHA 3NDJA 1E5LA 2PV7A 5JAQA 3NX4A 1R0KA 4CL8A 1G0OA 1E6UA 1YE3A 4J7UA 4DRYA 4IM7A 3KM0A 1IB6A 1IULA 4O63O 2GASA 3TOXA 3JQ8A 3OP4A 4JP2A 2NQTA 1ORRA 2E37A 3DMTA 5TJHA 3JQFA 4GMGA 2JCVA 2VOEA 3INRA 3P2OA 1LQUA 3PDJA 4U0KA 1XLTA 5DCUA 5FYDA 4CMEA 2D3TA 4IBOA 4YAKA 4AJ4A 4M54A 3RC2A 3OJEA 3R3SA 3V8BA 3ZNOA 5BNTA 1TI7A 3SC6A 2W2LA 4QT0A 1F14A 4IZHA 4ZQHA 3V5NA 4E32A 1Q0HA 4DTIA 1O8CA 2PZMA 4IJVA 1EVYA 5GZ1A 2VUUA 4ZQGA 4DBZA 4JJFA 4EITA 3WIEA 1MXFA 1YDWA 2DBQA 1I32A 5JO0A 5G0VA 1V3UA 4OMUA 5LDHA 4IJUA 3ETDA 3G0OA 1NWHA 2FPPA 3IJRA 3TJRA 3HE3A 1GL3A 4DQXA 4NDNE 4GSLA 3F6YA 5AOVA 3QHAA 3NGXA 1M75A 4W99A 1H2BA 5J23A 1YOVA 3U4IA 1SOVA 1SO8A
chains in the Genus database with same CATH superfamily
2WD7A 5DBGA 1RYZA 4Y18A 1E3DA 3LU1A 2QXTA 4KE8A 1U65A 1SBNE 3CBQA 3JYOA 2OAEA 2OV8A 1EP2B 1P1IA 2JGLA 1A96A 2VDWB 4OKNA 5ARCA 2E4YA 5KTPA 1TPYA 2G3YA 3O8OB 1BO6A 1GV0A 4ZTBA 3RHTA 1P0FA 3EMVA 4BMXA 5KNDA 1NU8A 1Y3DE 3O4RA 3KNZA 3LZ6A 1ZVVA 1RKXA 3B1JA 3M6FA 4JKIA 4OM8A 3KBBA 1UAGA 1DJMA 1DBRA 2ZVQX 2RHMA 1L4LA 5L7YA 3OHPA 5EXPA 2WIBA 4YGXB 3B5IA 3FKJA 4V0QA 2Z83A 3QFSA 2CLEB 4M9XA 4P08A 1E4VA 5H81A 3V1KA 1NR5A 1NULA 1Y34E 2ATXA 4GMHA 5HDQA 3L9XA 4JNCA 2FNAA 4LV6A 1R0ZA 3O9VA 4NVRA 3U44A 4ER6A 2OO3A 1QGDA 2XZTA 5DOVA 1KOLA 1B8OA 3L8ZA 4P1ZA 3HABA 4A73A 5TB5A 1G21E 5DH9A 3CZ4A 3A3NA 2C7BA 2C8JA 4BWFB 4UUPA 2ZBQA 1XP8A 4CIXA 6GPBA 4O89A 4Q05A 5EXDA 1MV5A 3RAGA 3RUCA 1DXHA 1LPSA 4DYDA 4ZI7A 5JVDB 4AS2A 1M2EA 3LXRA 1AT1A 3L92A 5BN1A 3AVXA 1O9GA 2A14A 3KZKA 2QZ4A 1K8YB 2G80A 2G67A 4BU0A 1Y9JA 3QF7A 4ESEA 4ZMSA 2YN2A 1M0TA 3T3NA 1BD4A 3CUVA 1M8GA 4KXXA 2J3JA 1YGPA 3S1LA 3ZD6A 1R0RE 1T15A 4ID9A 4BV2A 4DUGA 2GO1A 1DRVA 2Q46A 2QM3A 2RGYA 3CF6R 4D5EA 1L5FA 1X0VA 5DHAA 2FZEA 8OHMA 2W6CX 4QOEA 1DQSA 3BH7A 4MOWA 3PL5A 4B32A 3UZUA 5AVUA 2XUJA 1D5CA 3WIOA 1O58A 2JHCA 4ZQCB 1V8BA 4LYGA 4LGMA 2H48A 5EPOA 5L6MB 3ITKA 5B1EA 1JEAA 2XODA 3N0RA 2WKQA 2WKSA 2XLCA 5TQ0B 1IBLB 2C7GA 5EJAA 3DF7A 1QZTA 3LBIA 3UJCA 1GKKA 5JISA 5DHFA 4GEGA 4L0QA 5EIFA 3NBFA 3ZY6A 2WYWA 4CF5A 3E81A 4P2GA 3SJAA 5DNCA 2R97A 5KYKA 4LVNA 4G0PA 5BW8A 2JIZA 2QL6A 1Z7BA 3IGFA 5IC4A 3ANLA 4U5XA 3V7NA 4R8RA 4S12A 1E4OA 2QRJA 2QW1A 1ZA2A 3WJAA 4AJNA 1HWYA 1MO4A 2ZI9A 4WGFA 4WA8A 1P4RA 4OHCA 2HGSA 1JWLA 2ZSDA 1KS9A 3PX2A 5T3UA 3TLGB 4AS3A 1JJ7A 1L5VA 1V4NA 5LD2B 1GP2A 4KIFA 4OAQA 2IYFA 4RX1A 1TZBA 4W4TA 5HNKA 2XUKA 3Q3VA 5KYWB 3BQNB 1SCKA 2X2PA 3PPVA 1IQ0A 2BEVB 3AL2A 4IY1A 3SM3A 4EGJA 2B8WA 2P9QA 4GQBA 4NK4A 4RVOA 1Q74A 3PD7A 4YUWA 2W6ID 5MGBA 1DZ3A 1DINA 1FFAA 2YS7A 4HYTA 3EP6B 1U1CA 2RGCA 4J03A 2VF7A 4QBTA 1YHYA 1R3UA 2GBLC 3KR2A 5CYFA 2QF7A 1XJCA 4FHFA 2L0XA 3ZH2A 1YULA 3GNSA 5BV2P 2ZYAA 2PBZA 4XEHA 3TAUA 3WKAA 1CIVA 3EG5A 1D1QA 5CLLA 3MJEA 1UOOA 2VDPB 3LKVA 4MRVA 5CLQA 2AUTA 2BGTA 1P8JA 1XDGA 2PWBA 5CJ2A 5EJFA 2W37A 3K96A 3CX7A 4FI3F 2I7XA 1OF1A 2GHIA 1L4EA 3ZU3A 2F00A 3HJUA 1JTVA 1VYUA 4JLSA 2CLCX 3OOWA 2SKEA 1F60A 5CJPA 2GHTA 3GLHE 3ER8A 3Q10A 4X6LA 3OE5A 5FOTA 3VV2A 1E2PA 1SY7A 1X86B 4K46A 5JECA 4EMTA 1FNMA 2JFOA 1V8PA 1YVEI 3NHJA 4OX9Y 1NMQA 3VVCA 3NIDB 2QX6A 3U40A 3ZX5A 3GRKA 1EE9A 2FW8A 3HB4X 2C2XA 2BFMA 1TMGE 2DLDA 2ZB7A 3C3JA 1KDTA 2CWWA 5DHPA 4DA8A 4PQYA 2WUWE 4TX1A 2PNJA 1XO1A 2AF3C 3ENQA 1T4BA 1AB6A 5J63A 4GEKA 4D80A 1TPZA 3V32A 3FPKA 1O0SA 3AQIA 4RORA 5HKLA 4XTRA 4B6FA 3U0BA 1GGNA 2Y1WA 1VGQA 3LG2A 4QTZA 1PJAA 4CR8A 3DCNA 1TEZA 2KBFA 4EI7A 1PSWA 1ZMRA 4CMHA 1UBFA 5ENVA 3LM8A 3W5CA 4GSKA 5K8TA 3WGHA 1WETA 2FUCA 1NIJA 1DBIA 4S2EA 1GQ2A 3C8ZA 2FJ0A 3FWZA 3P97A 4G0NA 4HUQA 3IP5A 4RZHA 4Q9IA 1ORDA 3LYUA 3OT1B 5DGTA 2VA9A 3HJRA 5GV8A 1FK8A 5CB4F 2J3LA 2V58A 3QIVA 3G9UA 3EZFA 4QGBA 3SMVA 4NOLA 3EB9A 3GLKA 5DGHA 5H7XA 3IP3A 5B37A 1QKJA 1OFHA 3BMCA 4H1HA 2HHAA 4NU6A 3UQZA 4UOEA 5A6VA 1NG1A 1V7CA 4GPBA 3SYRA 2W2PA 3LWBA 1RYHA 3HKCA 1FX1A 1Y1LA 4JXJA 2W0MA 4U9IS 1L5SA 2B5WA 1OLXB 3GVHA 3LV8A 9MHTA 2WB2A 3QUSA 3W9YA 4DCMA 4PG4A 4TTAA 1E9RA 1E3TA 3K2BA 3OLZA 3RRBA 4JYMA 3OECA 5AKJA 4PIMA 1EXWA 3M6LA 1SRQA 2IUTA 2AS0A 1P2TA 1NW3A 3ZHUA 2C4VA 2Q6OA 3VGJA 1DE0A 4U7WA 2BFBA 2QLMA 1TTHA 3SP1A 2ZTVA 1UF9A 1XA4A 1TCVA 4JLWA 4JT2A 4YPVA 1E7SA 4BP1A 5JSKA 5KTOA 1EUYA 4Y0VA 5DT2A 3DQQA 2AGVA 3PENA 4H7JA 1IYZA 2ZS8A 2V03A 4AWXA 3T7JA 5EHNA 3B6JA 3GBSA 3Q8XB 1M2WA 1W4CA 3OJLA 3BTSA 3K0SA 1QF6A 1HTBA 2C58A 3BJRA 5DLYA 3EZLA 5HF9A 4QDTA 3ICEA 2EV9A 2PGNA 2R1VB 4K9DA 5MFPA 1V0JA 2EX0A 4AZWA 4MS1B 1ZJ6A 2ZT8A 3WJ1A 1CW2B 4F9GA 1YJBA 4BTVA 2ZYTX 1JBEA 1SPXA 1PFUA 1SXHA 1ZOPA 5FWDA 1G1MA 2CHVA 5LP6C 3U3DA 5GWXA 4NF2A 4D9HA 821PA 3R8CA 4URXR 1DS6A 4CM1A 1TGYA 2XCIA 2YZGA 2BFDB 1W9MA 2NTYC 1I3NA 3VI4B 2C5HA 2VJBA 1KRHA 2HRZA 3AF2A 4J90A 5AH0A 1XPRA 2H92A 3ABOB 3G9TA 3IE2A 4LOAA 3FDZB 5FEMA 2NM0A 3O2QB 4WFQA 4TWRA 3NH6A 4YV7A 3CWQA 3UT5A 4AUMA 3DNMA 2O6HA 5CRIA 4WFIA 1E32A 1XMVA 2FOXA 1H2ZA 4BJ5A 3D6FA 4OGLA 2GPYA 1DAKA 2KE5A 3VPHA 4NL4H 4PZDA 4C3VA 4R81A 1XQ1A 3K6SA 3RAEC 3VKUA 1NJ6A 1VE6A 4Q3AA 1RLMA 1GLNA 4GP6A 2X0DA 1Y1TA 3GEIA 2AFIE 3OURA 3SVLA 4MGYR 2HWUA 3R0XA 2XMDA 3OX3A 2ZQZA 1ODCA 2QR2A 4PLHA 4R8SA 3U16A 1VBFA 1JYSA 2ZUDA 4LX8A 4MS3B 5BSVA 1GT6A 3GP8A 1FRQA 2J9FA 3W2EA 3UMCA 3WWEA 5E2BA 4ARUA 4MK4A 3M5WA 4DJTA 3NJRA 2PX4A 3A3OA 4XZ3A 1ZD8A 2N42A 4MA5A 5GONA 1U2SA 2B4QA 4BIIA 5A9RA 1DQNA 5A02A 5A7HA 5I7SA 4BKPA 3ZZ1A 2YV2A 1OIWA 1XTVA 1XEWX 3KE8A 3JX9A 5IKPA 2N9UA 2ZBUA 5GOZA 3ZCUA 3DQPA 4QYXA 5KYNA 5FWAA 3EPBB 2R2GA 7MHTA 3U62A 1JR4A 2RH4A 4CTMA 1GN8A 1P91A 5FR2A 1OIXA 3ILHA 1CFZA 1XKQA 3CLSC 3R0IA 4JD5A 4BFWA 1NQXA 1TQ6A 3KQVA 3ZXSA 3LT5A 4MP3A 4Q4AA 4IQ0A 3R0QA 2BV3A 3AI2A 1AQNA 1QIGA 1ZSNA 5TDHA 4JP3A 3D6TB 3V9PA 16PKA 2QG9A 4RQTA 6ABPA 5COQA 1SD5A 2DPHA 3QI7A 4M1TA 5B58T 1L8XA 1B93A 3GMTA 4PGMA 4J7CA 4NATA 4ZAYA 2OZEA 2VT2A 3C3KA 3OUUA 3KD2A 4L15A 2P6PA 1J1ZA 4UEJA 3W7VA 5IK2D 2E5FA 3HP4A 3WMEA 4RA6A 5KAMA 1U2PA 3PNPA 5A71A 4HADA 1BS1A 3L8GA 1LXCA 1W29A 4PSAA 1J0BA 1TZ2A 2Y0DA 3QRWA 1TZJA 2IWRA 1YUBA 3TQRA 4DJAA 3FFAA 4J0IA 1V11B 2QL5A 3DL0A 3M9WA 3V8NA 1TMYA 2AZTA 3E35A 2IP2A 4YJGB 1MQ8B 1JG4A 3PIIA 4Q66C 2UVPB 1XVLA 3GLHA 2DJ5A 3WRYC 3M3PA 3IUNA 5CFOA 2OE2A 3JVEA 4TKUA 2J9YB 2P6UA 5KVQA 1P0CA 2ZRPA 2XT0A 1T1RA 4FZJA 4KPUA 3L7BA 2FZKA 2RIRA 1UJ6A 1LPOA 1GV1A 4LOJA 2WTNA 3LDHA 3MVEA 3E4DA 3N2IA 5CB6A 3GLGA 1SKMA 1VLJA 3WO0A 4Z7JA 2W48A 2QRZA 4AAYA 4O2BB 1T6YA 3LVFO 1B6GA 3CNQS 2W7TA 3DUWA 2CKMA 4AP5A 1GILA 1WX1A 3FCYA 3VJRA 1QOQB 2D8MA 1RI5A 2QHXA 1OI7A 4RVFA 3VISA 3WMXA 3DVAB 3LP5A 2Z2KA 1ZRHA 4OBWA 1GNRA 2ZUCA 1E18A 2ROQA 3IAHA 1QUFA 3IR6A 2CSXA 4XYGA 1JEQA 2NT3A 2QGFA 4Z9XA 5K0NA 1B6RA 2LW7A 4HFJA 4ODIA 4U2CA 2GYWA 1ML3A 3DEFA 4EUKA 4JI8B 3CF4A 1EEXB 1R37A 3F3KA 2DUUA 1NMEA 2IP4A 5ESWA 2YNMC 4H0FA 5SY6A 3RQSA 5ALGA 2C98A 4KB5A 3CVOA 2NXCA 2LXNA 5THQA 1KGSA 2AI3A 3QENA 1QVAA 4KLCA 3SBOA 4F91B 4G5GA 1IAQA 1TUBA 5D8DA 1BROA 1U04A 1U0LA 2CCGA 2ZSAA 5AM0A 4QYSA 3ZD7A 4P22A 1BRMA 3HB0A 3ZGYA 4CM7A 5I48A 4B5LA 4EVIA 5F21A 2Q6VA 1DUVG 4X1KA 1XK7A 1KJJA 4TMYA 3BX1A 3ET5A 1RYEA 4YRRA 5E95A 1KF0A 5BW6B 3R8XA 2VCHA 3OZXA 4P3YA 4C29A 9LDTA 2ECQA 1QHEA 2X5XA 5I9LA 1WLYA 4OMFG 4EVSA 5HS4A 4BATA 2OFOA 1NYTA 2Q1SA 3IHTA 3VQTA 4DIFA 3PE4A 3N9IA 5SY4A 1F17A 1XC7A 5A2GA 3U31A 2XUZA 1EH5A 1FDRA 4R6XA 3P2EA 4LISA 2WF5A 4LWOA 4RSGA 3VV3A 4PSCA 2HCRA 1QZZA 2A5GA 3CUKA 2Y77A 2GBIA 3K6RA 4CQNA 3N7UA 3FA2A 5E6RB 3HKDB 1QKIA 2WG0A 4MQEB 1UZUA 1FYEA 4OY3A 3S7TA 1EJ0A 2E4UA 4B73A 4HDKB 1YOBA 1XXHB 2DHRA 4LJ5A 2AWOA 4JBXA 4QUHA 4NENA 4UAJA 3D7KA 1W6UA 4HX9A 3PE3A 4IIUA 4NZMA 5GINE 1EVZA 4WJLA 3AG6A 2GX6A 3QWBA 4PCUA 4DSUA 4EHIA 1F5NA 2CFIA 3QK7A 3UAZA 3DMTC 2RAPA 1JX6A 1U99A 3STTA 1XZLA 5IWCA 2FWRA 2BSXA 1BQEA 2ES4A 3EJWA 1IBRA 3H2ZA 3HL0A 4TL8A 1RQXA 2F64A 3H84A 4P82A 4WUTA 5T3YA 2FP4B 5DNAA 2RAVA 4JEHA 2WTXA 4OXXA 4ZT2A 4DV0B 3FI0A 2C83A 1PT5A 3W1WA 3EN0A 3OZFA 3NCTA 3LKDA 3H2SA 4Z9AA 3ORYA 4L28A 3SMQA 2R0QC 1ULHA 3TUTA 3Q9UA 1OWNA 4YT2A 2V3CC 1NPTO 2GN0A 4KIWA 2AJLI 1KIMA 2FXVA 2ZLBA 2FU5C 1RJGA 1C3VA 3AYXB 4IOKA 4DWOA 1Z2AA 2D3WA 3FTDA 2XB9A 5JBIA 2EIHA 2VJNA 4IH4A 5CA1A 1AUVA 1QWSA 4B3DA 2DFTA 3DO5A 1H0RA 3NASA 4FK8A 4QXOA 3FZQA 4ZYUA 4JDUA 2DLCX 1PX2A 1OQAA 2CXSA 5LLTA 2ODPA 3NYIA 3QBTA 3OEYA 4BBPA 5HOEA 1AHNA 1J25A 2Q3LA 1CLUA 1RJ9B 1U1EA 3B82A 4EY7A 3AM1A 4CM6A 2ATEA 4MI3A 2Q5LA 4R1TA 4B84A 3AVQA 3GFTA 5LBUA 4DQLA 1GN9A 1XYGA 1V6SA 2CNLA 1RLTA 2DECA 2I4TA 4GOXA 4Z2AA 2I55A 1Z4QA 1PHPA 2GCOB 5BXQC 3WAJA 4JNKA 1DHRA 2CY0A 3DMNA 4ZOLB 5BV0A 5I4IA 1HNNA 1U94A 3ABQB 5I47A 1WQ4A 5A3VA 1U0FA 2WV9A 2NYRA 1ES9A 2WOJA 3ZBUA 1Y4SA 2FW7A 4EA9A 1YCGA 2QQFA 5MHTA 1Y4DE 2R6JA 3BMNA 2ATIA 4FIZA 2PU7A 3SG0A 4JAVC 1BE8A 1KWGA 5H3CA 5F23A 2ZBVA 1RXCA 5IH3A 3PXGA 4QLOA 1CF9A 1HQDA 4KBFA 4BMVA 4ERXA 2Y3IA 5JWOA 2RI1A 2D59A 2C9OA 5C5CA 3KDAA 4IQ8A 2PEYA 2XGSA 3D64A 3ELYA 4NK5A 5F4ZA 3CXUA 1RHKA 1RXIA 4TZTA 5EQFA 4UDXX 4EHHA 4RL6A 2WMNB 4F3NA 4LDPA 2QAJA 1Z5VA 2GCIA 1BXRB 3N3BC 5D85A 4EJMA 4IZ6A 2UZ0A 5CLJA 1JL3A 3DTVD 4NENB 3ZWCA 1ZKMA 2ZVDA 3F5MA 2XCSB 1UQRA 3NC4A 4IIJF 4DMLA 4ZAXA 4HLQB 2JLWA 1T4GA 3GLVA 3BQMB 1UUFA 3EZ6A 4XB1A 5EYPA 4HSEA 2XTMA 4DLBA 4F4IA 2ENWA 4EKYA 5JY6A 3EGXA 1EFRA 3VR6H 3VSBA 4HVLA 3OM1A 1X92A 1YS9A 2FQ1A 3LQ2A 2FG6C 1L5GB 1YT5A 3P9XA 3H2IA 1W0CA 3V34A 1J7JA 1UP4A 2H4JA 4R54A 3OSUA 1XQ6A 1NNEA 5CLHA 1E7MA 1Z5PA 4HY3A 4JU8A 4Y6OA 3PR1A 3VH3A 2XD4A 3CB4A 4RK5A 3EP8B 1P2FA 3RBXA 1VB3A 3KCQA 5GIOE 2R86A 3C7AA 1U31A 4LRWA 1J23A 1J6UA 1E69A 3EARA 1FUIA 1NBHA 3BE6A 1ZS9A 2SHKA 4YYEA 3ESZA 1ELOA 3WO1A 3MHPA 2BHLA 2OWEA 3OLCX 4HDQB 4NYJR 1D7OA 3DVRX 2I9PA 3BRQA 1MEJA 4P83A 5JZBA 1N6HA 4YRCA 2IZ6A 1R6UA 5FPQA 3PS9A 4RVGA 4CKBA 1WXQA 2ZBPA 1P29A 4RJJA 1IBKB 2B0JA 4TRNA 1TW2A 3IMKA 4Q7JB 4OQYA 5BVGA 2CUNA 5BURA 1EE1A 1RMYA 1JDJA 1T9AA 1C4WA 3NLLA 3F5DA 4B76A 2FFJA 1OWLA 2P2SA 2F9FA 2PGOA 3IHWA 3IPYA 3LWZA 2UZ3A 3ODGA 1M8PA 1X7HA 3ZW9A 4ZO8A 2PSHA 1Y98A 3SSOA 1QDEA 2Q6IA 1ARZA 1PJCA 2EBFX 4GZ6A 3IO5A 4JMPA 5H9VA 1V48A 2XAAA 5DHUA 5C4MA 3P96A 4ZOCA 3RYFA 3I9JA 1IDOA 5ITVA 4X1IB 2VQ3A 4DQ0A 5IT0A 1EGVB 2FQQA 3LT0A 5T7BA 1GXSB 1H4SA 3DXYA 4P7GA 1KJZA 1R9GA 2CXPA 2Z08A 5FEUA 5JRJA 4KFRA 3FOBA 2Y67A 1ZISA 2XZOA 5DM60 4BMNA 2PX0A 3I2GA 1FW6A 3GFQA 1K0FA 1MF7A 2P9CA 2VJLA 3JAWA 3QH4A 4WLUA 3R3ZA 4D43A 5G41A 3REQB 3PEUA 3BWEA 3KU1A 3PQFA 4N9QA 3GLGB 3G9ZA 4UASA 4Y9UA 4AMUA 4BFVA 5BOSA 1AUPA 4R84A 3IJ5A 3PQDA 4KPUB 4R2JA 3O95A 1ZFNA 2Q07A 3DEAA 4UZEA 2FMTA 2XMSA 1N9KA 1UKEA 5EE9A 2VPQA 3MLBA 1QF9A 3L8HA 1SQSA 1AUOA 2XT9A 1CEQA 1GPLA 2GN1A 2VYVD 1N57A 4L27A 1W88B 2EVWX 2ZIGA 4D0NA 3SFZA 3WHIA 5ER6A 2X58A 2YUIA 1XVUA 1WBDA 5K1ZA 1N3LA 3DAFA 3S44A 3IUBA 3VHQA 3NO4A 5A1JA 1BJRE 4YP0A 3JQRA 5AM5A 4LC0A 4RPCA 3Q8WA 2ZI7A 1NYQA 4Y0NA 1KDVA 2HHCA 4E21A 2OGWA 4WXMA 3IAS1 1K8ZB 3JZAA 4BAUA 1NP3A 2VFAA 1TZMA 4J94A 3H4VA 4YEDA 7GPBA 5CVUA 2RHHA 4IPTA 3B9BA 3LCJA 4N03A 1GQOA 1SVNA 4UNPA 4MNTA 3RSCA 5A4DA 5JS2A 2BGNA 3ACDA 3EWIA 2I3GA 3CKMA 1GD1O 2VAVA 4YXWA 1FP4B 3G1TA 5FADA 4D6XA 3QE9Y 1QCDA 4J0DA 2FMUA 2Q5IA 4S2UA 2R7LA 2XWJI 1X0XA 1CUZA 1L1RA 1L2TA 2XH8A 3AI3A 3CUTA 1I6WA 2VYCA 4PPYA 5K8CA 1JJAA 4KRFA 3UAOA 3G13A 4QSHA 4LWPA 3I9LA 3MC1A 4HX2A 3DDNA 2PU5A 5CM9C 3IXMA 2YWGA 1UBOS 1Z36A 2QT1A 1FYFA 1RRPA 4NBWA 2J0VA 1PLJA 4HB3A 2AMFA 4ESVA 1K6XA 1Q0PA 3Q3CA 3RDPA 4AUKA 4G1UC 4BNDA 1OH6A 2I71A 1Y81A 3SEAA 5ALMA 2AC4A 3O92A 4ROSA 2F1JA 2EAUA 3C15C 4ENQA 2AN1A 4QNRA 3KLMX 1C3XA 1REQA 2G0TA 2PUJA 4Z8XA 3U7QA 1E1NA 3JYQA 3N53A 5AD1A 5FQOA 3O7WA 5DN6D 5JSUA 5LMNB 4BKRA 4F06A 4K6OA 2ZE7A 4RO0A 2EKZA 3E5MA 4W7IA 3IHLA 2RH9B 3ZN2A 4BNMA 4DY4A 3L1HA 1EEHA 2HBQA 1LPAB 1MC5A 4LZJA 1E3WB 2WJZB 3K9NA 3LT1A 1EFTA 2D0DA 1Y48E 1W88A 1RLUA 1VM6A 2K2WA 3V3TA 2CT8A 3TPZA 3TTSA 1WSDA 3NEYA 4OHXA 2WYOA 1O5TA 3GT0A 3WDLA 4JI0B 2HNAA 1QRAA 3ZE0B 1FYDA 5JNRA 2P90A 3PLRA 4FHCA 4LXHA 2VO1A 1DKQA 1RYYA 1GCIA 1OYOA 1QMHA 1DFIA 3BMXA 1E2MA 3MGGA 2G77B 2XNDA 3X1XA 3S40A 1P18A 1NVBA 4J49A 1FDSA 1EI9A 2NTVA 2PANA 3UG6A 3U3XA 1YONA 2GOYA 2W6PA 2Y0CA 3L6UA 5KCMA 1GGVA 2GK7A 3GYBA 5AHXA 5DXAA 3A6EA 3W77A 3UK7A 2BRUC 3GXBA 4ZOLF 4ZJZA 4MUYA 5MN6A 1NBAA 3AKYA 1Y8ZA 3VKWA 2QM7A 1PT9A 3L7NA 2PYDA 1RW4A 4CJXA 3RADC 2ZIUB 1WU7A 1M83A 1A1VA 1E66A 3PA6A 2I5PO 3U80A 1EUDA 5JRDS 2ZPUA 2GK4A 5AKIA 3WWZA 1PP4A 1AQLA 1CX9B 1UPBA 1RRKA 3HMKA 3LLMA 1P7ZA 3BFVA 4WXYB 5AP9A 4TYWA 4RHTA 4RKYA 3ZBQA 5EJ7A 4HNAB 4RMNA 4YCAA 3WS7A 1I4EB 1YSCA 3BIJA 4Y0AA 1B76A 4XLTA 3V7FA 2WSSD 4FT2A 4Y7DA 4KBGA 4BVKA 1YU9A 1OT3A 3P9KA 4JWTA 3U09A 3OC6A 4GW3A 4FXPA 4IILA 3K09C 4LDAA 2GZMA 2I34A 4QNMA 3WGMA 1CUJA 2VPPA 4LMPA 2F90A 4L76A 1P5HA 5TARA 3TBFA 2XHZA 4D8TA 4MYCA 1K7EB 2SCUA 4RF5A 1Z12A 2UVPA 3GLHB 5E6SA 5LP6B 1FNBA 1JR3E 1ONSA 1QAOA 1XXHA 3GGOA 1VPDA 4MWOA 3A4NA 5ALOA 2AG8A 4JJIA 4XIYA 1TO2E 3HKDA 1GVNB 2NZ2A 2C96A 2W90A 1XZQA 2X8LA 1LVUA 1MB2A 3OPQA 2P9FA 4JX9A 5CJJA 5AW7A 5F2KA 3KUCA 1A5ZA 4FMBB 1JPUA 3RWBA 2V5VA 4P5EA 1SG9A 3W2TA 2BR5A 1KWKA 3JRXA 5AESA 4Y30A 4OP1A 4F1KA 1K7YA 1SUBA 5DIFA 1L8QA 1RI3A 2HCTA 2QW8A 1Z06A 4BEWA 5HKBA 4DNOA 5CXUA 5CXQA 1N8KA 2HPZA 2ECKA 5EJ5A 5EYPB 4WNAA 2OHGA 1UH5A 3P32A 1JE1A 4HAYA 4RHEA 3UCFA 1ZLXA 3KUDA 4FZ3A 3TSOA 3DCJA 1C3EA 4BRWA 1QFXA 1C1XB 3NRBA 3GEDA 2H5EA 1NXTA 3ZPXA 2Q2OA 3CS3A 4RV9A 4US0R 2WTMA 2AA3A 4A36A 3CLVA 2HTEA 3DDOA 1M3SA 4E09A 1T6XA 4WN9A 4KR3A 1P0PA 3AEQA 2F6RA 2VLIA 2YIDA 5J4HA 4C4YA 4I66A 1BG6A 2O2JA 2C59A 2RGUA 2HA4A 4G6ZA 1MA0A 5DNVA 3E7WA 4AY6A 3ETEA 3NGMA 5D1HA 4KNVA 1I14A 3EVTA 1D4FA 2VHYA 1J8DA 2HWKA 2X40A 3CN7A 4QATA 3B6EA 3Q72A 1Z9BA 4FMDF 1OH7A 5E9JA 2GB4A 2ZDGA 4JJKA 4DUGD 4ZA2A 2NVUB 3NTOA 1RJFA 4B9EA 1A04A 1HFWA 1U8ZA 1LF0A 2VDKB 4MLZA 4BEVA 3IVCA 5IKEA 4RKFA 2HJVA 2PZ8A 4IF4A 1JENB 1PKXA 3BVPA 3LPLA 1USWA 2J0EA 1TGVA 5M3BA 1QGAA 4U0JA 1UC9A 2OHFA 4RCVA 2GZ3A 2LIVA 5HFAA 5TMEA 1VG1A 3H65A 5CEFA 3KO8A 5L7WA 3H8WA 3AB7A 4K6FA 5CA0F 3G5MA 2EJWA 4KQ6A 1GFSA 4HDRA 1UBMS 3KB6A 4GKVA 4EB0A 1O94D 2B92A 2IZ0A 4QAQA 4GX5A 5FA5A 3ZHYA 4CIBA 3L0DA 1Y5MA 4GE0A 4PSKA 4UTVA 3TLJA 4QEZA 4DMUB 3DWEX 1ZGHA 2IDJA 2RGAA 1ND6A 4BN5A 5IKMA 1NL3A 3OLWA 1YTUA 1T2NA 3PQVA 1OUMA 1A98A 1KI9A 1P2SA 3BOSA 1QV7A 1ULBA 2XDQB 1Z4KA 1QHGA 2OUKA 3S2YA 4ZZ2A 5DBOA 4QQKA 2E4ZA 5A3QA 1Z0SA 3DBOB 3FVRA 3R7SA 1KMNA 4QG3A 1WOMA 4BUZA 5HUQA 1E64A 4CM5A 3R7BA 3CZCA 3K30A 3MTBA 2VP6A 4RSHA 4NAVA 2C07A 4LYDA 5K3CA 5JMOA 3B2EA 1ZCAA 2IZ7A 4U7TB 3MWLA 4RIIA 1NW4A 2NYVA 2I6TA 3R6WA 4L2IA 2BGLA 2SBTA 1IATA 2V96A 3V4PB 2NXWA 4D4IA 5I3ZA 3WP1B 1H4TA 1UKBA 2V4MA 3ZY2A 1JI0A 1JFSA 4UDYX 5EP2A 1QHHB 3BPSA 3ICQB 4C06A 1UKCA 1XP5A 2XB2A 4BAGA 1BVHA 4IOJA 1ORWA 3DLAA 2AKYA 3MQ2A 5DTQA 1JQJC 3TYXA 2PL5A 4JLDA 5DCWA 3V1MA 4AJ2A 3ZWBA 4YMTA 2UXDB 3DE3X 3I2KA 5HEKA 4WV3A 3QNWA 5DKFA 4DJEC 3S68A 4MTCA 2R00A 1E1MA 3RRXA 5L45A 4JR1A 4FHZA 5IZ4A 1MT3A 5BVGB 2G04A 1P44A 5KJCA 4XGIA 5H3LA 3HFSA 4LJ8A 1UT6A 4YJHA 1BA3A 3LOUA 2J9ZB 1UANA 2NV2B 3WTBA 4PXAA 4C87A 1M6WA 5KKCA 5JS7A 3HA3A 3DZBA 1K5GA 3CKYA 2E89A 3LXXA 4L5BA 4MO9A 4M8KA 1NX9A 2CXHA 1E62A 5BQOA 4IJMA 1PJLA 4HP8A 3SYNA 1SAYA 4ALMA 4U2FA 4PONA 2J5QA 2P9HA 1YWGO 1GG9A 1W44A 5AK4A 3E0QA 4OAOA 2QR3A 4V0RA 3W6OA 4AXBA 5DVZA 1LBEA 3D6JA 3U4MA 1NR1A 4MS1A 1TEVA 5KSPA 2C2BA 4E2FA 1FFBA 3LDFA 1YZFA 5I4BA 1X7WB 3S81A 3N2KA 4PLWA 1NT4A 4BRZA 1DOZA 2OFXA 1Q95A 2RK3A 4WZAA 2IZ5A 4A2QA 3CT6A 3O03A 1UM9A 1FUEA 3P9SA 1DCMA 1HQKA 5C7LO 1X1BA 1XELA 2AT1A 4BNFA 4DKXA 1FMFA 3WISA 1NXXA 3I2YX 5KPDA 1RHQA 5CAEB 1VLVA 5JNVA 1YACA 3RGGA 1ADYA 4GOJA 4H31A 1KNXA 1FFHA 2VRWA 4MVJP 5C1BA 1K6IA 1JPJA 1UEIA 3AKEA 4L95C 4OJYA 1UXGA 1LV7A 2MIIA 4R2WA 3PC7A 5DCYA 4P4UA 3ZHSA 5JYFA 4Q1BA 5FLYA 4JQYA 1PTJC 1S96A 3VTZA 4PZEA 4AVYA 1TAGA 3B1ZA 2IYLD 2IPNA 4DM4A 4JB8A 3KLOA 3DZDA 4OLBA 1OLSA 2BR4A 1EG7A 5KIAA 1B16A 1DIRA 5TXGA 2GN9A 2BTQA 2PXAA 2MDTA 1JH8A 2FFHA 1SIBE 3FDJA 5BR1A 1HDGO 5EIEA 3NTUA 4NTZA 1BKDR 2MR6A 4AZ3B 1UXHA 4DF3A 1FVXA 1UBKS 2HHLA 3FFWA 4RPKA 1DUSA 3K05A 3PJEA 2OVFA 1G8JA 1DLJA 2YVKA 3N8KA 3Q7EA 1RHMA 4O3FA 2CMKA 4TTRA 3I62A 2WE8A 1MOQA 4KN6A 1FUKA 4ALKA 4NHOA 1IVNA 3BTVA 3IWBB 3WLRA 1G20B 4H17A 5D5HA 1AMUA 1GT91 1C3JA 1VJ5A 4P36A 4YMWA 4M0FA 1H6BA 2GI4A 3N0WA 4HQNA 2XJ4A 4DSZA 1G8PA 1SHUX 1W59A 5KYUB 1E59A 3NXSA 4YK7A 1UBTS 4E6PA 4FBLA 5A0TA 3PYMA 1W0KD 3LDGA 4OQPA 3WLNA 3COWA 1EBFA 2JLRA 3IQXA 5DTIA 5K0FA 3FUWA 1N7IA 1ZCFA 1L0BA 5AK3A 2W6JA 4M7WA 4LC9A 2YZ7A 2WV7A 521PA 5JO9A 3DFFA 1M2NA 1ZK2A 2VHVA 2I2CA 1KP2A 2QZ9A 3DZ8A 4I5IA 4RK4A 3UK1A 3G7SA 1YB7A 5CAEA 1WPXA 3P20A 3VU1A 5I7OA 4ENWA 5IDWA 4MWCA 1G0NA 3EW9A 4TZKA 5I7RA 3GBPA 3REOA 5DIZA 4KL8S 4YLYA 3ZUPA 3H05A 1Z0UA 1IEXA 2CMHA 3WWCA 3M6VA 1Y6JA 2IJGX 2ZRCA 1F06A 3LP8A 3QU5A 4BGIA 4YCMA 3ZC3A 2NTNA 4EH1A 2F1OA 2PWYA 3AERA 4EY4A 4QECA 5FI1B 3ER6A 1EHYA 1PQUA 2PZKA 1BIFA 2OK7A 3NQ41 4N6NA 1CJKC 3EGXB 1UDRA 2C3MA 3QUQA 3BWXA 5DNEA 5FFNA 2NUPB 3BFKA 2ZOSA 1QQ5A 4V2UA 5P8WA 1ADFA 3V42A 2ZFUA 3VHRA 1VYTA 1X80A 2B1IA 2F55A 3FCAA 3MILA 2YDXA 5TGDA 2GJKA 4JB3A 4BO6A 4EY5A 3INNA 4AO6A 1MHMB 1GFWA 4LHYA 1PUIA 1Z62A 2OPBA 1T4CB 2RJOA 4I50A 3EMKA 2GDJA 1V8ZA 3JD0A 1T10A 3M4YA 2CF6A 3OI7A 1CWUA 4LGYA 1TW3A 4RZQA 5J1SB 1K1EA 2BGUA 3M2PA 4YAOA 3G7NA 1AOXA 3I01M 2R79A 1NURA 4NKRA 2Q62A 3IXLA 5F5LA 5G0WA 2EFGA 3CM0A 3NORA 4YLEA 2G1PA 4OYHA 1NVWQ 1L4MA 1ULTA 3Q7RA 2PBFA 3AEKB 3R23A 2Q3FA 4IG9A 3U3RA 5M34A 2A5JA 4OOEA 4RVUA 4NNPA 3KTFA 1ZIDA 1AG9A 5F9MA 3AR5A 3ZLVA 5H80A 4MWBA 1XRPA 2HA6A 3MM4A 2W6ZA 4DPKA 3WIBA 1ISIA 3S2EA 1YRLA 3K0BA 5LXTA 3R9KA 2RHDA 2Q22A 3SLKA 3UHOA 3K2EA 5KWSA 2H31A 4GUDA 3F6SA 1C14A 2JLUA 2EXXA 2E21A 5B1HA 4O4LB 1DWOA 3HJGA 2PGIA 2R6AA 3CNLA 4ZI5A 1SA0A 3R7WB 1XDBA 1R5JA 1G1AA 1UBSB 4M1MA 4KHPB 3E1SA 2HK7A 1DL5A 2OD9A 2ZE8A 4MMXB 2OXIA 4J0QA 1C7QA 1ESZA 5E2IA 3ORHA 3KKMA 2H08A 3L01A 3TX2A 4H7HA 2LD4A 2KS6A 2WKPA 1SOWA 3KV3O 3OHSX 2NXJA 2QLJA 3N0VA 1PR9A 3A9RA 3MD9A 2P6NA 4HAWA 4JLJA 4U6NA 3VR2A 4XGQA 5JJ5A 3DOOA 3GUCA 1HE3A 1MX9A 1KI6A 3VA7A 2A9RA 4KVGA 4DCGA 5T4HA 3ZHTA 2QMYA 2OKCA 2H0AA 3W9UA 1N2CB 3V1UA 1RE0A 4WD3A 3AVOA 4OI2A 3OQ6A 1J56A 4OH7A 4YRNA 2BKEA 2P62A 1HTWA 2XVXA 3DWGA 1JTFA 3SXUB 1M73E 2DGDA 4OLAA 3EF0A 5JVDA 3DFZA 4YJDA 3OIGA 1D4AA 3HSSA 3ZDYB 1NI4A 1W46A 4C1NA 5BSHA 2CBGA 1CUCA 3K5HA 1VTKA 4HL6A 2VSQA 5HJ5A 1KPGA 2CVZA 2PSDA 1P2VA 4H60A 4KK4A 1S6YA 1T9ZA 2FWPA 1W34A 2PNFA 1NSFA 1BWRA 2HV8A 3C6ZA 3HUEA 3P9ZA 4FP9A 5SZKB 4B6PA 3AJ8A 1OWOA 5AK6A 3SQNA 5KTRA 3ZVMA 2QXUA 5AW0A 5JSZA 3WOHA 5AVJA 3GLFE 4X5OA 4BFYA 1NC3A 5IXYA 1VKNA 1NLMA 2RGGA 2QVCA 2C2WA 2QLNA 3ZU5A 1JB9A 2P30A 5ALXA 3K70B 3KTOA 2C82A 2JEOA 4EEXA 1RBZA 4N65A 1VI6A 3D3JA 3IDZA 2UYQA 1WKVA 4MPPA 3BWMA 4CI9A 1NXQA 4HMOA 4E5NA 3DQZA 2PR7A 1HI9A 4HMQA 3OKCA 3DNPA 3DZFA 3L8MA 3MQ4A 4DM3A 1ZN2A 4J75A 4GVLA 2QM8A 5EHZA 1Q0SA 2OHVA 1F4PA 2B4KA 2YJ6A 3TL6A 2ZRDA 3KWMA 2R8XA 1N6LA 1Q1BA 2QUAA 1YJ8A 4JHLA 1EB8A 2J08A 5H0IA 2J0UA 1FQOA 1W5AA 3KVNA 4KQ9A 1T8TA 1XDDA 2EZUA 4OHUA 2M6LA 1A9XB 3A4YA 3E70C 4C2TA 2O3JA 4Q1VA 5AUNB 4LOIA 1YASA 1IXKA 3FE2A 3TIFA 4AX4A 2F4VB 3TPFA 1E3JA 3SXUA 4D92A 1ZY2A 3WHLA 1VKZA 1FXSA 1PS8A 3AF6A 2EZTA 4EW6A 1NQWA 1ND5A 3DD1A 1KMIY 1J9ZA 3EP4B 3A37A 5J2TB 4N49A 4UU8A 2JATA 5LM3A 2FWMX 1C41A 2FK8A 2O3TA 2PT5A 3CJRA 4X61A 5LQUA 2UYYA 1SXJA 4FJ0A 1TVEA 3C6YA 5BSWA 5C35A 3FI9A 5EPUA 3O31A 4F93B 1C5KA 4YDRA 1H05A 2NUTB 1CUWA 4MZDA 4NU8X 2X0EA 3CVUA 5DTMA 1GUFA 2YW9A 3GGSA 3E22B 5DYGA 4Q5IA 3ZQJA 1WB5A 4DLUA 4HLDA 5ISMA 4M21A 4E6EA 2HSZA 1CY4A 2YNMA 5E6UA 1G21B 1QS0B 5SYMA 3WOVA 1QQAA 3EFHA 3K9FC 2CUZA 1BNCA 4YDQA 2O8CA 3W8NA 5AI4A 4LBVA 1E3WA 5C1IA 4EPVA 3CRNA 4L73A 4CNBA 5LNK1 2HQSA 4V0MA 4DA6A 4JCCA 3MTJA 4ZKDA 5AFSA 3IQHX 3KPYA 4U8GA 1OHHA 2YVAA 5GY7A 3T12A 3TGPA 3IV6A 5E9QA 2IYUA 1MZPA 4KPGA 3LC0A 5C9ZA 3IE1A 3WLKX 3B1KA 2J7PA 4YRKA 4QZVA 4KUGA 4N82A 4GICA 2IS6A 4A03A 2VN8A 2ZYVX 2HNKA 2REQB 3HKEA 3IC5A 3PVCA 2G83A 1K0UA 1WZUA 2P35A 4G26A 4Q47A 4L50A 3D6MA 1RIIA 1RM4A 2Q7DA 4BVHA 1DJNA 4C5AA 1ZU5A 1YR6A 1L5OA 1WD7A 3CUYA 3PUYA 4ND1A 1XN4A 2QTZA 4IJQA 4RA6B 5JQGA 4UBNA 1DIGA