3QVKA

Allantoin racemase from klebsiella pneumoniae
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
245
structure length
245
Chain Sequence
SVRIQVINPNTSLAMTETIGAAARAVAAPGTEILAVCPRAGVPSIEGHFDEAIAAVGVLEQIRAGREQGVDGHVIASFGDPGLLAARELAQGPVIGIAEAAMHMATMVATRFSIVTTLPRTLIIARHLLHQYGFHQHCAALHAIDLPVLALEDGSGLAQEKVRERCIRALKEDGSGAIVLGSGGMATLAQQLTRELRVPVIDGVSAAVKMVESLVALGLATSKHGDLAFPEKKALSGQFQSLNPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of the Structure and Function of Klebsiella pneumoniae Allantoin Racemase.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Isomerase
molecule keywords Putative hydantoin racemase
total genus 77
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12500 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qvkA00
3QVKA 3DTVD 3DTVA 2XECA 3IXLA 4IX1A 3QVJA 3IP8A 3EISA 4FQ5A 4FQ7A 3QVLA 2VLBA 2XEDA 3DG9A 3IXMA 3DTVB
chains in the Genus database with same CATH superfamily
4NCAA 1BMDA 1NNI1 4YRLA 4WOKA 2PMCA 1PVDA 4JBNA 1Y8AA 3HJAA 3TLGA 4R2HA 3ZR4B 1Y63A 1QBGA 3CVYA 1F4LA 4E5PA 3R76A 1H4QA 2ONJA 2OAGA 1Z17A 2P8SA 3VC3A 5LN1A 4BBPA 2BL4A 2X9GA 4MDHA 1Y0BA 4KXXA 3RHFA 5DGIA 1FU7A 2WWTA 3QU4A 4YAWA 1JG1A 1XLWA 4MVJA 5AVTA 1L8XA 2ZQZA 1I36A 4OX9Y 4IILA 1YQEA 4EA8A 1IG0A 3OI7A 4MYTA 4OSPA 2V7GA 2ATIA 3PQCA 3M3PA 4BNLA 1Y1RA 4Q24A 3NLLA 3RLIA 1E2BA 5K0GA 2Y1EA 4K28A 3QEAZ 4PLVA 2GZ3A 4JCOA 1E9BA 1T4MA 2YMMA 2FPPA 3CFYA 4ON9A 3JQ7A 1KS9A 4PBRA 3V7YA 5JW6A 2Q3MA 2H54A 4X65B 2DP4E 4WY5A 2XCTB 1FBTA 3MPOA 1XMVA 2DMRA 4KE9A 3R8XA 4BKPA 2H1IA 2PCJA 4AD8A 2Z2XA 5AVWA 5KTNA 1SC4A 4HDRB 1U0GA 1Y3CE 1Y9DA 3EAQA 1VZ3A 4UDXX 3GLGE 3NHAA 4JKIA 5C8VA 1HLDA 1RQRA 2JHCA 2IPLA 3KCQA 5FEMA 1L1RA 1P3Y1 2PKCA 1FFBA 1RFLA 3QVTA 5A9SA 3QX7A 2M1XA 2V0CA 3AY3A 2BSXA 3SLKA 3TLXA 4WADA 4EAQA 5CW2A 5E6SB 1BCRA 3KCNA 3AEKB 4JFAA 3G0OA 3S2EA 3OG9A 2Z2KA 2OB2A 4XIYA 3TBKA 3VM6A 1PG5A 3A10A 3H2IA 2DFTA 4OJQA 5CLQA 3PEYA 2ODPA 1AS3A 1CZNA 2GH1A 2DY1A 3F3SA 4I2NA 1S8OA 4F4UA 3W0LB 3E22A 5L7YA 1R15A 3IO3A 2V3VA 2E5FA 2R66A 2CZGA 2YXNA 3JQAA 3A1FA 3MGAA 2FEWB 4HB2A 4BKOA 7GPBA 4JBIA 4B4DA 2GN2A 3FLMA 2C3UA 4EF6A 2X4LA 2ANBA 2ZJ5A 3CKKA 1YK0A 4B3BA 2C5BA 2YVQA 4HDOB 1EI9A 4Y1FA 4C3UA 3HJCA 3KQNA 3DM5A 1C3OA 4V38A 3TVTA 2GKOA 4K9OA 3QI7A 3ZZTA 1QFXA 3OFVA 4PQEA 3DEHA 1WU8A 3VISA 4KLAA 4DZRA 3WOVA 1HL7A 4IKPA 5KU1A 4JMLA 4Z7QB 4R1NA 1R4AA 3E05A 3E3MA 2ZIXB 3L4JA 3AF4A 5LZ2A 4ZCLA 3IXLA 1W6UA 2Q3CA 1GZUA 3O3OB 1LZLA 1G5TA 2E1RA 3UAOA 4QNMA 1CZRA 2IZ1A 2WC1A 2AB0A 3OE5A 4HDQB 4LZNA 4RD2A 3CS3A 4H2DA 4C0JA 5K99A 1SN7A 3GCXA 3L41A 4IWXA 1WCV1 4UHJA 3IIIA 3LVRE 1E1CA 1DI0A 2HPAA 5KWJA 3KEGA 5BN1A 5BSRA 3KJNA 4OPMA 1VXOA 3IDQA 4N5HX 1G3MA 2NV0A 4DILA 1YOVB 2NZXA 1BW9A 2P9FA 4FOOA 3REOA 4WKNA 4XQGA 3UKOA 2YY5A 5F9MA 1C8VB 2F62A 3K0AA 4UAVA 3ZU4A 4EJSA 4RPGA 4G8BA 1T0IA 4O3MA 2BV3A 4TZ0A 1WUTA 3PT9A 3JQAD 3WLKX 3MPUA 3BDVA 3C45A 5K03A 1JEQA 3KKPA 1XWIA 2CHUA 3U44A 2LNDA 2MSEB 1EG7A 4QT0A 3QXJA 1OD6A 1XAJA 2J6BA 1QZ3A 1YRQA 3QQPA 4L0DA 1R27A 1G42A 1V1RA 3ZUPA 1QK4A 1ISJA 3E9QA 4ITUA 5IDYA 3OEYA 1JSLA 3RIHA 2FZVA 4XUEA 2O2DA 3BC1A 5HFNA 2GA9A 1AKRA 2CFCA 2HCRA 3AERA 1T8RA 2Q99A 4RZHA 5KYVA 4A36A 2NSHA 4W5NA 4CT4B 1HE5A 1QHSA 2UKDA 1DOHA 1PL6A 2PYIA 4IUYA 3OFSA 1DC6A 1WXFA 1NP3A 1U04A 1PJ3A 3QXXA 4XX1A 1TADA 5EA2A 4LF4B 2RGAA 5TEVA 3ENKA 3D6HA 2AOUB 1L6RA 4NX2A 1PX2A 3BVPA 3VC2A 4KHPB 4TGLA 4HAVA 4X5OA 4CJXA 1BJTA 1IPEA 2OMEA 5AVJA 5HKLA 3UK2A 4CU2A 4UOQA 4DCVA 1VIVA 2Q8QA 4RK4A 1YFKA 3OPQA 1ADFA 4GX2A 4DLRA 2PLRA 2DBZA 4G24A 4OMDA 621PA 4RVHA 4BAUA 2WHEA 4RJKA 8GPBA 4J4TA 3FSGD 5HJEA 1JPNA 3CWCA 4TL7A 1ZN2A 4R2JA 1OWPA 3K3PA 3WQHA 1HDZA 5FPPA 2IHBA 2B37A 1CUDA 2H4ZA 2YNMA 3BGWA 4G9BA 5JZMA 1K2WA 1KJNA 4RGVA 2WINI 3LBYA 3IAM1 1W5FA 3ROQA 3UK0A 2NO5A 3ZIUA 4BO6A 1DFHA 4AMGA 3P2JA 2GKGA 5HNKA 4BMDA 4OKNA 1PL7A 1NXWA 2N3ZA 2ZPUA 3I30X 3WB9A 1LXCA 3WIDA 1ETUA 1J07A 1I80A 2R1ZA 1X13A 3PXGA 1AGXA 1G8KA 3WMRA 2MSKA 4R7ZA 1E4YA 1OZHA 1A1VA 1ULTA 3Q6IA 3IS3A 4K6KA 3CH7A 1EJ6A 3KTOA 1WB5A 1MZPA 2A92A 5IP5A 4BU0A 3O4FA 1VCIA 3ABOB 3WBBA 5KSYA 1NZFA 1X8JA 2VCHA 4ZRDA 1WCIA 1DRUA 2QN2A 1W1IA 2P11A 2DTEA 3LGXA 1DAOA 1UDAA 4F9EA 2XB6A 3MTBA 3KB1A 2NUPA 1Z12A 2A6PA 3SHWA 4XRGA 5BN3B 3AGPA 5LP6B 3IT3A 2QW8A 2G5PA 1MQ9A 3O2QB 1H8HA 3CUEF 1D03A 1C30A 4IPTA 3ZWNA 2PKQO 4E5VA 4WBNA 3UT0A 5TR9A 1FJXA 4DBLE 1B3BA 2ZT7A 3ITEA 4BXOA 4B5KA 3UUEA 1T8WA 1ODSA 3PT5A 5DE3A 3N8HA 4EATA 2EF0A 5BSHA 2R5NA 4N47A 5K9ZA 4MLCA 1EX6A 3WJ1A 3D8BA 2D74A 3WFZA 1XROA 1O0CA 2J9RA 3UT5B 1HNZB 2F1OA 4L8LA 5FI5A 1CF4A 1NP7A 3H97A 1N2SA 3I1JA 3OPVA 5KHLB 4B8YA 1QONA 3D3EA 4V0MA 1ZXXA 2PRKA 2VP4A 1IZYA 3GNSA 4P1ZA 3SLRA 5I7VA 3D6UA 3B8HA 3B13B 3UB2A 3V1KA 3BB1A 1T6NA 3VJRA 3NU1A 1TB4A 4PS0A 4KR7A 3O7MA 4Q9IA 1DT3A 1RIIA 2AC7A 1LV7A 1R0LA 2QOEA 1JEDA 3AFOA 5B55A 4IXNA 3HTXA 1EVJA 3MELA 3DV9A 2JCBA 3HWSA 4DG5A 1RXIA 1SQGA 3H9CA 3M5WA 5EIFA 3GLTA 4I4TA 1ABEA 2FLVA 4DA7A 2GXAA 3UV3A 4AZ3A 3OTHA 2XH8A 2ODWA 5THQA 3BL6A 2B3DA 2CLKB 5CDYA 1B00A 2FUG1 2QVXX 1JILA 2J3JA 1NXQA 4W7IA 4QUHA 4Y7CA 1AC5A 2CL5A 2YV1A 3COZA 2IYOA 2SCUB 3K4QA 4YBRA 5DHTA 2Z9BA 1WA5A 3K0CA 3KZ1E 3CNBA 1UBSB 1DWPA 3S2SA 3BBPA 3A6PC 5HW0A 3GYBA 1JR3E 1UBOS 1MUUA 2DPXA 3ZWVA 4E2ZA 3D8NA 4DCTA 4MW7A 1OC2A 1Z8HA 1NW5A 1PBNA 3H75A 3OLXA 1J09A 1SB8A 3UHPA 4C2AA 3QHQA 4EKIA 2O2YA 4RVNA 5KEIA 2CN1A 1XDSA 4GP7A 3GMSA 3NZEA 4A8JA 4AKHA 1P2GA 5JJLA 1YH3A 2AXNA 3IH5A 2E4XA 3DEAA 4Q1EA 3SVTA 2VUHB 4TMXA 3ZWYA 4AG6A 4TV8A 2PSSA 3MM4A 4XCXA 3TWOA 3WSWA 3A0RB 5TMEA 1FSPA 1GNLA 3B1KA 3D1LA 4GR9A 5DNVA 3RROA 4JV5B 2XB4A 4X92A 4DR7B 3UPUA 4FILA 1X80A 3AFHA 2VHVA 3BAFA 2J32A 1GRVA 3E8XA 3GJ7A 1KBOA 3I1YA 4WLOA 1AO0A 2ACKA 3Q3IA 4FYIA 2Q4EA 1SH7A 2Z1DA 3CE6A 4QYWA 3WK7A 4H6WA 1SCJA 1G6Q1 3GGJA 4E31A 4UVEA 4K3VA 3AETA 3DQQA 3HLYA 2BONA 2QYTA 4Q3DA 4CKWA 4PAOA 4FHEA 4TT8A 1P29A 3O21A 1GPNA 3R40A 4GMXA 2VAMA 2IW1A 3RSFA 4QXOA 1Y8CA 5JHHB 2QPTA 4CM6A 1Y6ZA 4H4EA 4G9GA 3T7TA 2GVDC 2VF8A 5BR8B 3L02A 4ZGWA 2QL9A 4R69A 2UUAB 2Z2IA 4IDHA 4AMUA 4FDLA 4B9AA 3S99A 2H3EA 3RAEC 2EGGA 1H6CA 4RKQA 2BKLA 1YD7A 3C6BA 2QF7A 1FNBA 3H1BA 2HQ1A 2ZUVA 5ANRB 3RDPA 3HO6A 3PXDA 3KB2A 4CTOA 3KS9A 1W75A 3GROA 5JO0A 4TTAA 4ND3A 3ECCA 3H0EA 4CQMB 4DQUA 5I4KA 4PR3A 2CJWB 3AY0A 3BMNA 3GBVA 3AVXA 1QRSA 4XB6B 1JSRA 1NYRA 4DVJA 4HUQA 1ZCZA 1S7CA 5E9JA 2X4DA 5I4BA 5KOYA 4EZEA 4OLJA 1PWEA 3EVBA 3HB9A 2FEMA 2JJ1A 5BUCA 1TTHA 3B9QA 4JYPA 3O1JC 4RM3A 1GT6A 4WGFA 3L0OA 2ZI5A 3Q4GA 1VLMA 3ZH9B 1KSHA 3C3CA 4IW3B 2VT3A 4ID3A 4KIJA 1X7HA 3DF9A 2WY2D 4ETMA 2FPRA 2FQXA 2ZBEA 1JKIA 1FP6A 1U7ZA 1V9CA 3E3AA 3H9JA 4GVXA 5ALXA 1BZYA 4YJ3B 4GPIB 4D9NA 3CZCA 4TSRA 4I55F 3FOCA 1GZ4A 4FC7A 3WQSB 1ZUWA 4M0LA 4BB5A 4M7PA 5FUQA 2JFWA 1NULA 4RHXA 1US8B 5SZHB 1QO0D 1EHYA 3IPCA 3K35A 3N28A 4IRMA 4CKCB 1FDUA 5DBIA 2L17A 3WK8A 4QUBA 4B6GA 1YZGA 4I3FA 2JAUA 3AESA 1RAEA 1XKLA 2JFNA 3CX8A 4XCVA 3RG8A 4JLBA 4PU0A 1FMCA 3EVFA 3JS5A 4H7EA 4IGKA 2O8VA 1GSHA 5JCOC 5IARA 1KI6B 2C61A 1XIVA 3KT3A 4MPJA 2CEAA 1CZUA 1EEHA 1XJ5A 2Y76A 3AFIA 4DKXA 3IUEA 1N5IA 1U4SA 4UVIA 3ZWOA 2JJ1D 2X42A 1D0IA 3L7IA 5LA6A 4OHWA 4AUNA 1RADA 2J87A 1N32B 1V4NA 5DSXA 5C81A 3MIZA 2EW8A 2X0KA 1V9LA 2R47A 1WPRA 4OGKA 1NRIA 1PRYA 1NUSA 1RZRD 2FWPA 4YFVA 1G5IA 1ZM2A 2F3RA 2IEBA 2ZJ7A 4LWPA 1QJCA 1Z2AA 4PRZA 3TQCA 4G1CA 3AY6A 4IDOA 1A27A 2RKOA 3EVNA 4PFSA 4UMDA 3PQ6A 3SX0A 3BTUA 4XTRA 3IQEA 3V6MA 4YCLA 5JFOA 4WXYB 4RK6A 4FGUA 5JNLA 3K6JA 4KK4A 3EIUA 4UQPA 3GPDG 2W43A 1E64A 5I5EA 3QEOA 3C2QA 4BX8A 1UUFA 4NPAA 3ROEA 1NQOA 2VHXA 2Z8YM 4HBZA 4MS4B 4AZ3B 2IGBA 2O0HA 4ZO4A 4DDTA 4KR0A 2J46A 3OY2A 1DX9A 2MSCB 1YZFA 2JJ8A 4P22A 5JARA 1J5EB 1XZ8A 1QYRA 2WIAA 2XTJA 5IWAB 1T8PA 3PC7A 2BE7A 2Y1DA 1YB5A 4YDRA 2P2DA 1UMKA 1USUA 5EZYB 3BRQA 1SCBA 2R8BA 4H6VA 1J2RA 1KIMA 2E18A 1L1QA 2RK3A 3PRYA 2Y1GA 5HQ3A 2E89A 3A9UA 3ZZ1A 4HWSA 1RPZA 2I3ZA 2I2BA 3JD4A 3WRXC 4UBKA 1KDRA 1Z6ZA 5F12A 3LLSA 5EE0A 1IN8A 4MGZR 2RHLA 3FPSA 3PFGA 1QG4A 4NENA 1E61A 5E3IA 1XB2A 4CCYA 1VPWA 3IJPA 2Q5OA 2JAPA 2ZRMA 2IU6A 3AHEA 3GJXC 4H1VA 4L4ZA 4D9HA 4CL2A 3FZNA 1SG0A 2D3TA 3AWIA 4HNSA 1NNLA 1MABA 1UFOA 2H1WA 3WKEA 1KVTA 2OWEA 2PUGA 3C6QA 5EWJA 2NTEA 2O6HA 3EN0A 3EZ7A 3ZGZA 5AKIA 1O95A 2ZULA 4U7HA 4C4AA 5CJ2A 1ITZA 1OE0A 3C1TA 2X1MA 5LFAA 1QZUA 3D2BA 3OZVA 4LYYA 1P73A 1UJ2A 1BCSB 1XQ1A 1K3UB 5AVYA 1RM5A 5TQ2A 4A6XA 5FTLA 4DIFA 1ULZA 1V45E 3FN4A 3IC5A 4A3SA 1W9MA 1YRBA 2HMYB 4EMTA 5IKPA 1IL0A 3V8PA 2BFDB 2VDQB 2LIPA 4ZQIA 3C3YA 1P5JA 4AQYB 1R8JA 4LBWA 4HVLA 1E2MA 2ZM6B 4MVJI 4RVDA 3TRFA 3AEQA 1RHRA 1VJDA 2JHAA 1W52X 2RGXA 2Z08A 1NPTO 3QYJA 1XVTA 2I0FA 3IGFA 1KFEB 5G4KB 2G9NA 4TUYF 1AZTA 2BTQA 5K09A 1JDUA 5LDDC 2MINA 4AMYA 3PTAA 3ABRB 2VPYA 3LUCA 4J0JA 4YJHB 5HUJA 2BFOA 1ULSA 2FHSA 3QKWA 3V7UA 3IAEA 2AQ8A 3CF0A 2AWOA 3CE9A 4BVHA 2VQDA 3CLHA 3OOEA 1CFJA 1KFJB 2FK8A 1TMYA 1ZL0A 4YRAA 3KSBC 1RXVA 1WUYA 3WL7A 5DN6D 2WSMA 1OH5A 2XSZA 4YP0A 3LP5A 2YWRA 4TMVA 4BPRA 1E1LA 1JL3A 1O95D 1PJCA 2VPIA 4G5XA 1SA0B 2FB9A 3AJ9A 3L2OB 5CH5A 1VKJA 1X6VA 1LI7A 3PQ3A 2Z6AA 1IY1A 2P1ZA 2IYNA 3V4RA 1BOFA 3IELA 4PQYA 1HEYA 5KHOC 2PX2A 1KVRA 3B1ZA 4C6TB 3QKTA 4ZPXA 1L7AA 2VIIA 1KH1A 2ZAGA 3QLEA 2OQ2A 4IYRA 1PFUA 5DXFA 3EA5A 4KPYA 3BIWA 3FLBA 4IDBA 4MOWA 4EA9A 3LFTA 2BUBA 2MSLA 4NZ9A 4P3KA 1KXJA 3VJLA 3A3OA 2P40A 2QV0A 1KJJA 4L5BA 4MR7B 4YJGA 1UMCB 2P4SA 5MGBA 4YPOA 1N9GA 5L6LB 1NV9A 2AJTA 3P8ZA 4MGEA 2QXYA 3NHWA 4NOMA 4UHKA 1G5QA 4RMGA 5B30A 4FYJA 2CMKA 2IZ0A 1DEHA 2QP9X 3CH5A 2I54A 4UXHA 4UZSA 1RLIA 4TWRA 3DUFB 3H13A 2ZB3A 1EFDN 2FEKA 4HJRA 4I81A 4Q9JA 5TLSA 5TQ2B 5IM4F 4FFDA 4KVZA 1CERA 3BA1A 4K5QA 5JPDA 2XRFA 3BWMA 3MMSA 2MTBA 2W58A 3ACCA 1E2PA 2VP5A 1U9YA 4MS1A 1L5QA 2ATXA 5KOHB 1WKVA 4YAKA 4K9NA 1EFVA 2OOSA 4HQ0A 1J2JA 1GCAA 2BR5A 3AHGA 3UJ8A 4BE9A 1ZBQA 2V6MA 1Z5PA 1YZQA 4X7MA 1ZYUA 3D5EA 2X4GA 3THYA 2RBEA 3FRIA 4G4SO 2IELA 1UZMA 2FX5A 2RDMA 4O33A 3VR5A 4PYOA 5FYQA 1E9FA 1BO6A 3WIVA 1WZCA 1J21A 1EA7A 2WA2A 2CFSA 4JN6B 2HDOA 3ZBTA 3NC4A 4OM7A 1A2KC 1B2RA 2J0QA 5H68A 5EWLA 1P4HA 5EG5A 4BO1A 3PFCA 4NOJA 3HYNA 2GX6A 1A8PA 1JG4A 3EDOA 2PUEA 2OSVA 4EHAA 3SGLA 1Q83A 2C0PA 2QNBA 4J8PA 5KYYB 2ZYRA 3KWMA 5HSGA 2EJUA 1L4EA 4DCOA 1KZ7B 2A4KA 4TM7A 3Q7IA 2PX8A 3JU3A 5HOEA 1UKAA 3FCXA 3MILA 1CUYA 4LNUA 1E7QA 5TQ0B 3TLKA 3JQBA 4C01A 1I9GA 2AFHA 2OBMA 2WOJA 1N6HA 1ZN8A 2ERCA 3H3FA 3KDPA 3W4IA 2FUKA 3MCZA 3NHBA 3F5DA 4B0PA 3TN7A 2UZIR 2INGX 5AXAA 3I8XA 3QKSA 5EUCA 4AKGA 3PHGA 1E5LA 1QKKA 2XCIA 3DBOB 3KRTA 3O8OB 3N07A 3Q9NA 3QBEA 2OFFA 3O9ZA 4UD6A 3K6SB 3RWBA 5BWOA 4EY5A 4MMZB 1PEDA 3LT0A 5DVZA 4ZHSA 1CB0A 3RJ5A 5DT9A 5FHQA 3C3EA 1SXHA 1IJFA 3ED5A 4FMCB 2WG2A 3QPVA 2HMSA 4UXIA 3R41A 1MIOB 5DTMA 4S1WA 1XYYA 3M6AA 4F7DA 2J0VA 3GV0A 4LOHA 1B6SA 2CF5A 1MTZA 2HT6A 1L7OA 1TZ2A 1IQUA 1L9XA 3OZGA 5TJ9A 2XT9A 3WLSA 3W6NA 1MOSA 3S7TA 1JZQA 4MUMA 1I8TA 1LU9A 2DUJA 3CO5A 4YGXB 1I7QB 1G8YA 4JVOA 5B6PA 3QFRA 2RGGA 1UXIA 4M4SA 5FV4A 2KBFA 1QUFA 1WV1A 2A59A 5EIBD 1I3KA 1NWHA 2QZJA 3PJGA 4I4CA 4AICA 1ISMA 1P7ZA 2CL0X 3AEZA 3UVEA 4DJEC 1ODIA 1LDMA 4FCCA 3JQ7B 4D0SA 1BNCA 3SZMA 3SXPA 1GYQA 5KNDA 2X22A 3R5XA 2NYRA 3QKRB 3FOAA 2O59A 4JZKA 1UWCA 5EIAA 3WYAA 4Q3NA 1U2PA 1E0AA 2NADA 4OQNA 1F3OA 2R11A 2XZPA 3OJEA 1UIRA 4NEHB 3V80A 2MR6A 2IHNA 4DRZA 4LOLA 3R8FA 2VSFA 2RHTA 3Q6NA 4YUVA 2X9NA 4LC9A 1YMVA 4W8GA 1M8JA 4FR5A 5B7QA 4G25A 4L72A 1AOXA 2UVDA 4NAUA 1FA9A 2BY4A 1Y8QA 4ZEWA 1P62B 1TK3A 1KK3A 4QHYA 1Q77A 2AK2A 3L8CA 4MVJP 4HAYA 4AULA 4JVMA 4LEIA 3D2AA 4MS4A 4RQBA 3W8NA 1AMOA 3A04A 1P2FA 1CEYA 5FKJA 5B58T 4AN1A 2KBEA 2HRQA 2FJPA 1U9ZA 1YCGA 3GFGA 3IQZA 4L3OA 3H5NA 1QGDA 3DTNA 2J3HA 4NMMA 1N4AA 1JLSA 1D4OA 1Q7EA 2PUCA 2BDUA 3G9UA 3ICCA 4GLBA 2H7CA 2JFYA 2ROQA 5IHXA 1N2GA 3IIEA 4B3SB 2QZSA 2XCSB 1VC2A 3PTZA 5H83A 4BNUA 3IBFA 4P81A 3PGLA 4Q82A 1XL0A 1WMEA 2Z83A 4HGQA 2ZS9A 5EVJA 3WXBA 4AQ7A 1SOMA 3DP9A 4WK0B 2DT8A 2I6QA 2RHCA 1NNSA 3INGA 5M3BA 3FDJA 4RIIA 4NC9A 4QXRA 1MIOA 4PG6A 2XUGA 1HTBA 4JBGA 2R96A 4URZR 3TXXA 3NVAA 1G17A 4WZAA 1QH8A 3CMCO 5DI3B 4B9EA 5DIZA 3IMFA 4XGKA 3PSHA 3H5WA 4CIXA 2AUMA 1FSFA 2CHQA 2EARA 1NVDA 3AKYA 3ND6A 1NSYA 2PV7A 1KJQA 2O06A 5CA1B 4M38A 4N5DA 1Y33E 4ND8A 1K4KA 3GLHB 5FR1A 2NW6A 5E8JA 5J2UF 4YUYA 1HFKA 5ULLA 4A0SA 5JAUA 4EQ6B 4M8LA 4FLMA 2CLEB 4OQYA 4NFYA 2IYUA 2NU9A 4ZOEA 4C1NA 5FA5A 4ANFA 4EPYA 1I7DA 4HMOA 1VIMA 2Y2UA 1RC0A 4JI0B 3VR1A 1DWUA 2XX3A 2QAGC 4GKKB 1KFKB 2J7KA 3VDXA 4DLVA 4MKZA 3TF5A 1PHRA 2XGGA 4LN1A 1XTRA 3MJTA 2XWPA 3W6PA 2DFPA 4R1TA 2QQGA 3I9LA 1UZNA 1D09A 2PJDA 4CIDA 4D9FA 3PV0A 4IJ6A 4OL9A 4X6YA 2A58A 3BRSA 5TB5A 2VDUE 3ECAA 3HCEA 3I5UA 4LW8A 3BAZA 4YDSA 1UPTA 3HSYA 5AVKA 3AGQA 5HBGA 2XEXA 1QC5B 3IULA 4KFCA 5B4VA 3M4NA 2QLTA 4DYDA 3IOCA 3U48A 4J6FA 2DTXA 3TSCA 1R4NB 1CZKA 4EHHA 1ENOA 1NQTA 2RKBA 3G2JA 2DFVA 5EJGA 2IYAA 4BFYA 4BMZA 5JNSA 1JPUA 4RTSA 1Z45A 3JR7A 2HK8A 3N3AC 4NYJR 4C0SA 4DUGD 1BVHA 1G20E 1UK7A 1I01A 1M6VA 1N25A 4LI0A 3GUHA 4GGOA 1VE3A 3EIWA 3JSXA 4LZLA 5A2GA 1VLQA 2YZ7A 3ZU2A 1QH1A 3G9QA 2Y0CA 4FGSA 4G65A 4IDAA 3H2JA 1LC3A 1LNZA 3O75A 3WMGA 4LRWA 2FSHA 5F98A 3JQGA 2R1TA 2RIRA 2VFAA 3N1UA 3FHLA 1MB4A 1QGZA 4MQUA 3UG7A 4E5KA 4FFBB 2C42A 1OH7A 3OTGA 1AK9A 2H2AA 2ODTX 5DLEA 2XBMA 1C1XB 1ZRMA 5DRTA 3QKIA 4YJGB 3NOQA 4HG2A 4RFSB 3IB6A 4KK3A 4BATA 1JH9A 3OSZA 1IIRA 3L0SA 4HADA 4NU5A 4QVGA 5IYZB 3ZOKA 3PKJA 4QEKA 3H2GA 2BZSA 3IEVA 1YR1A 3VYUB 4DJFC 2O8DB 3F90A 4YH1A 3H5VA 4QPNA 2Q4BA 1KQOA 5H80A 1JAIA 2ZDGA 2PL9A 3DZJA 3MOSA 4MQ4A 4URVR 1P0PA 3HA2A 4YQEA 3IP5A 1LJ8A 1WHSA 1FBNA 3N8IA 5EZ5A 4AY6A 1HKUA 4BU1A 1T2EA 3IVGA 6AT1A 4YGYA 4DLKA 3CM0A 1A9QA 4IVRA 4UREA 3VFDA 3IXMA 3C3PA 5HRAA 3M4ZA 3KJQA 3PI6A 3GFTA 3ADPA 4N40A 4RLQA 4ADSG 1KEKA 1GCUA 3JSAA 3W3AD 1I10A 1ZJZA 3GELA 2IH5A 3VZRA 1KAQA 4M36A 1R5OA 1X8LA 3SHVA 4DABA 5K4AA 5A6SA 1BXGB 4TOIA 2JI9A 3E23A 3G79A 1JMKC 1DJQA 2J9FB 2VF2A 5J23A 2IHTA 2X1HA 3NH9A 1PYDA 4QE3A 4IDEA 4F4CA 5LDHA 4TTVA 3ZQJA 5LU8A 1TECE 1PQPA 2AZXA 4QGFA 1MEEA 4N4AA 2W2KB 2XVYA 3HCDA 2OM2A 3CKMA 3KYJB 1STOA 5GVRA 2W6CX 4ZC8A 4YJ2B 4RY0A 2VR1A 2QTVB 2W11A 3FVWA 4QDZA 3VYVA 4EARA 1DKLA 1X7XB 2EOAA 3O5AA 5SY4A 2M6LA 1M75A 3T4XA 1JMYA 1EXVA 1OX6A 1UXKA 2AUTA 3D7MA 3BRWD 3FPBA 1MJ5A 1X2EA 3DV0B 3SNKA 3ZV3A 4EELA 3STYA 1RJDA 1GILA 3PC8C 1K0FA 1ZD3A 3PPYA 1U7PA 4RK5A 4BEJA 4ER5A 2WMYA 2ICAA 1PJBA 3FCYA 2AJBA 4PLWA 2C82A 4ZQHA 3VKGA 4Q9KA 1E2GA 2YBEA 3FROA 5B1SA 1UQTA 3NBZC 3IP7A 4J0CA 3SXUB 4JEHA 4PAQA 5E7MA 1TKRA 3PUVA 2Y05A 3Q7EA 3DLTA 1JA9A 3R44A 1NONA 2ILVA 2R44A 4QOSA 3Q3HA 3ZD8A 3R6DA 1GU1A 1SIOA 1RJEA 4MRAA 2J31A 4P92A 3FOZA 1W36D 4Z3DA 4JLUA 4RVSA 1GFSA 5FPYA 4MWSA 1QRDA 3E9YA 3HKCA 1ZGGA 4JOBA 5CR9A 3RRZA 4GP6A 2Q2QA 4QYMA 2X1VA 3ZOZA 3NGLA 4ALJA 3H9EO 3NYIA 3ANNA 1M34A 2W8ZA 1PKEA 3PYMA 4KGXA 1GL9B 3PGA1 4URUR 2Q6IA 4BE4A 2HBRA 2Y1OA 2QUIA 2OXEA 4YMTA 3HBJA 1RE1A 3K1AA 4H08A 3ZWPA 5C7IO 1FP2A 2WDZA 4HX2A 3FFBA 2ZITA 4XM0A 1K4MA 1T3TA 1EPUA 3AEKA 2WVGA 2R62A 4WECA 3RIXA 4XJTA 1EFRA 1IWPB 1Z6QA 4MYDA 3BRCA 2XOKD 2ORED 2ZLBA 3PIIA 4G4JA 4TKZA 2QTGA 4N9WA 2G83A 2HO4A 4C2TA 3THWA 2E82A 2JLQA 4XR4A 1WW3A 1NLYA 1NU6A 1EXWA 3WGKA 4ALLA 3BH0A 5AW5A 2FETA 3P19A 4YAIA 5TMBA 3GD5A 3G5MA 3VNSA 5IVPA 3GFQA 5KO2A 1Y6JA 2KB0A 1PIWA 4MYHA 5KSWB 1UDCA 4C89A 5CHEA 5HEKA 1FRFS 4IIUA 3V34A 1IAVA 3L9WA 4ZD6A 3HJFA 1G6KA 1EP3B 3KOXA 4OQFA 4ITVA 3JAWA 1BD4A 3AFMA 1G1MA 1O95C 2WU8A 1EFCA 2ISQA 4Z51A 2FTKE 1G55A 4KN9S 3I6MA 1SBTA 1CUFA 3LXRA 4MGYR 4LZOA 1N2HA 4MWEA 1VSVA 2PUHA 4D1YA 3IAS1 3A3YA 5FPSA 1HURA 2R2GA 1II0A 3IUQA 1CLUA 4JYCA 1QBKC 4HATA 1C81A 1Y9JA 2W42A 3UYKA 5HCIA 5FBLB 3QGMA 3O8BA 2WG0A 4BLSA 2RAVA 1S0UA 4DTIA 3W5IA 4U6QA 3O4JA 4TZTA 4EFMA 3CRRA 3OQBA 3UCXA 5JVDF 3NUZA 4GOND 1PYGA 3RSZA 2ZB7A 1JHPA 3VZQA 4HC4A 4ESOA 4ZYZA 1OV4A 4JD5A 3K0BA 3TNDA 4J0EA 3DMYA 3ZG6A 1XN1A 3EW7A 3LT5A 5B6JA 2YRXA 3DKKA 3D5QA 2P4HX 5B64A 4EYGA 3RF6A 3LPCA 3NNSA 4J2HA 1SBIA 5CYGA 3KXPA 3NRJA 1J42A 2JJMA 1C80A 3FYUB 2BGIA 1YOVA 2ZIFA 3CEHA 2CLLB 1JLRA 3M1IA 3LQ2A 1HC7A 5CDHA 1DARA 4KEAA 4KLZA 1OB2A 1QVWA 4Q1AA 3TW8A 4PYRA 5TMPA 1E1CB 2YX1A 3FSRA 3N70A 3JAMA 4P83A 4MPTA 1IVNA 5AJUA 1THGA 4QKQA 3F6SA 1HOTA 1KZGB 4KU4A 1T5BA 1K27A 4JELA 2VH2A 2ZSFA 4TSFD 1GGNA 3ACBA 2R48A 5JPIA 1MX9A 3ZUGA 3OZAA 1T1RA 2FLKA 3DJYA 4IBOA 1IHOA 3J81A 5HXAA 2GAIA 2XUDA 1KSFX 2IW3A 3GRRA 3B7GA 1N9GB 4N12A 2Q4TA 5DKFA 5H9VA 1G3RA 2ONCA 3S2FA 3HY4A 3JRWA 3QLVA 1S7GA 4XDZA 4AFNA 4EKNB 1E60A 4LTNA 3WL4A 2FEOA 5LPNA 4F3NA 3GGCA 2GVNA 1ZA1A 1J0XO 3CLRC 3HGTA 4KVFA 4KWCA 4UE6A 3SJUA 4J3NA 3WDMA 5ARBA 2N1BA 5D84A 4GE3A 3O91A 3DBLB 3GLFB 2YZNA 2A3NA 3GPCA 2KMLA 4RVFA 2G5TA 3IBTA 3K4PA 3KUKA 4AF7A 5CK4A 1Z6TA 4N48A 4GR5A 1GFIA 2XUQA 4JHXA 3R7NA 3DDZX 4HGZA 3EPLA 4WUVA 1E2NA 4KLCA 4LZAA 4Q34A 3DVRX 1TZJA 3LVBA 3REFA 2ANCA 5FPHA 3R9XB 3CR8A 1WBJB 3H05A 4H3KB 4I9UA 2WTUA 1OLOA 2F9LA 3QRWA 1M2GA 1POXA 3IV9A 2VZ9A 2NAFA 4A2PA 1KAOA 5AD1A 2BZGA 1EVLA 2VLIA 3R0XA 4HZIA 5BOSB 3K71B 3EXG1 5TPZD 3QE2A 1IHXA 5K01A 1JNXX 2A67A 2Q4DA 1CEXA 2C92A 5A71A 3QEKA 1B0PA 2EDAA 4BJHB 1ZGJA 1RRCA 4O2LA 1J1IA 4FEEA 2NX2A 4K87A 3KKOA 4P54A 1PQWA 2GJKA 3L7KA 3S2IA 1SCUA 1UBGA 2MINB 2PL5A 5AHOA 1XQYA 5DEOA 3U7FB 3ZGYA 2XJ4A 5GZ3A 4WY8A 1YHYA 2Q0HA 2ZIZA 3HKBA 3O8CA 4WL0A 2YFHA 3MCVA 1H85A 3VH4A 1V8PA 2XWJI 1GYRA 2NYVA 3DHWC 1PZMA 1ONBA 2UUPA 2K7ZA 4FNGA 4FE3A 2PVPA 3B7WA 2DPGA 4RJIA 4WT7A 3UYLA 2QTNA 5ER9A 1DNPA 1DELA 1E7SA 1NVXQ 5TQJA 4JYAB 1VJ0A 2F1JA 4DGQA 1NHGA 4MR7A 2XA2A 5T5QA 5KIAA 4RXMA 1M2OB 4J76A 3PC2A 5LWQA 3DW3X 3TW8B 2PZEA 3NDPA 5DDIP 3KQTA 1ZJYA 3KV1A 2VLBA 3L8ZA 4OEHA 4W5OA 1KOJA 2FXIA 2Y9MB 1NT2A 3THWB 2BPOA 3D6AA 3MWGA 3VSDA 2QROA 2DYKA 4UNRA 3GGGA 4M0DA 3WNCA 1ZQ9A 5LB4A 3WGHA 4D3XA 2OWDA 2VBCA 2WT4A 3W2TA 1WUKS 2LRHA 2C58A 2DLCX 2B20A 4TYQA 1B2LA 1U6JA 1ZC3A 5D3KA 1M6EX 3QQ5A 4L4XA 1GR0A 1NKSA 3G9XA 3K9WA 4HN2A 4QQRA 1C7RA 4X00A 5AJVB 2EKDA 1L4UA 1HH4A 1Y7TA 1P4GA 2AD5A 1XD2A 3LUHA 3I5XA 1L5HB 1LSOA 2QB5A 4KO4S 1QGUB 1V1MA 4Q7KA 4XZ3A 1HT0A 3O95A 5DSZA 2PX5A 1N1EA 4TTSA 3GEHA 1DXOA 1MJFA 5AKHA 7ADHA 3HKCB 1V5EA 2FUCA 2GD2A 3PXCX 4RD6A 5KOHA 4KP7A 4MW1A 2GJ9A 4U8GA 2PDAA 5EUMA 2HUPA 1QHFA 3OZ7A 4ZTBA 2ZWMA 5HGJA 4AJIA 3OH8A 4C30A 4MVYA 1YIOA 5ALGA 1M2WA 5LP6A 5DI9A 4HEA1 4IFBA 1UXGA 1VM6A 1UKBA 3NGMA 5AW2A 2RGRA 2VXYA 1TT5A 1THMA 2AI1A 3I0NA 4D9CA 3QVVA 4H3HB 2PX6A 4LDRA 1YDFA 1OXBB 3Q7QA 1LBTA 1Z3CA 3F6YA 4WA8A 5LB2A 3VKFA 1GG5A 2PWPA 3KQUA 4QFDA 5AUNB 2C95A 2ZM5A 3KZKA 1YRWA 2EAUA 4F5EA 3X44A 2ZWAA 1PSWA 3ENZA 5LZ8A 1UDXA 3TIIA 4U9UA 1ECLA 2FZLA 3RVSA 2CXPA 1Z34A 2JFFA 3IBGA 4GG1A 5LCXA 1XZJA 1ZNXA 5D8DA 5G1NA 3MK31 2D7DA 3QF4A 1GAQA 5DNDA 2AF4C 2OV1A 3G17A 1RC1A 1VKRA 1XKTA 2PVSA 3EDMA 3P2KA 4IYJA 3QNUA 4MK4A 5EXTA 4ZARA 1AQ6A 1P1RA 3KYIB 5LZ7A 1DZ3A 1MIHA 1MO6A 4GOJA 1PTKA 4RZUA 4GGPA 2AN4A 1DLIA 1XRMA 2A0UA 4V0ME 3RQSA 5KMGA 2HSGA 4Q1VA 1RKQA 1BKYA 4YRNA 1DRJA 3O38A 4RS4A 3UC9A 2QZ9A 4GT1A 2J3IA 3KUUA 3OZFA 4B7UA 1K89A 1E99A 2VXBA 2A0XA 4KACA 3H9QA 4XFKA 4G0NA 4TRNA 4UMFA 1CRLA 4KAJA 4W6QA 3EEBA 4G85A 1U8YA 3CSDA 4J1QA 1QIIA 2XMCA 4YAFA 4D5GA 5BNWA 5AK0A 3COSA 3R0JA 1BQEA 3QFHA 4V0NA 4QLAA 2VYNA 2IZ6A 3TFOA 5KYKA 1A7KA 2G8LA 3GEBA 3L4BA 4OK3A 1E2IA 1NSFA 4CN9A 5B2FA 2FQWA 2QTCA 5EGSA 5REQA 2BZ1A 4IF6A 4MUAA 1SXGA 1MZVA 1HF3A 2GWRA 3A4YA 3S5JA 4YECA 3OSUA 3RFVA 2FRXA 1TJ3A 4OGGA 4DNFA 2Z1NA 3FTQA 3HEAA 2VTKA 4IOMA 5LLTA 2DEUA 1CE8B 1IPHA 1RQPA 1U8EA 3UGQA 5HR5A 2BFDA 1XCMA 1VBKA 1C3LA 4OK5A 2VK4A 3DEIA 3LCJA 1J8MF 5G02A 3L7BA 5J5VA 3U7QA 4R8LA 4UBOA 4XPIA 5LMNB 3ID6C 1VE5A 2IDZA 5JSYA 3D3QA 4TROA 5CRIA 2H5LA 1U5BB 1KMCA 2HH9A 1IEVA 4IDDA 4WTOA 3CCCA 4Y67A 3SCZA 4Z5XA 2I1LA 2I2AA 2JI7A 2CBXA 3KNZA 4KXYA 1JLLA 2H11A 2OHJA 3FG9A 4I50F 4M55A 4NS4A 4UBJA 3WHIA 5A5GA 5HKKA 3GQBB 1SCUB 1HQCA 1FCJA 1ENPA 1GU0A 1LFDB 2VF5X 3DVAB 4FDAA 4L2IA 2W6ID 3LYLA 4OQLA 5DTQA 5CLHA 6GPBA 2OHXA 3GLRA 1HUQA 3WGIA 2JLZA 4FD3A 2IIVA 1T9ZA 2XEDA 4IHJB 4OBXA 4F4JA 1VCHA 2HJVA 3STUA 3WNVA 3VR4A 4EG4A 1E3QA 4M6WB 4MLPA 3E5MA 1T43A 3K8QA 4R1QA 2W4IA 4UXJA 2KJQA 3ED1A 4ZQEA 2XVZA 3OPXA 1SU4A 3ZU5A 1QV7A 1ZNYA 1ZGCA 3RK4A 4ZYUA 5KINB 4JOQA 2I7DA 3L0CA 4B6JA 1PU2A 3UJNA 1ZCJA 4EQZA 1R18A 3TQQA 2GBGA 1A4IA 4I8IA 4QULA 1C3OB 4ZVRA 4W1QA 2JIOA 4R0NA 1UINA 3C48A 2APJA 2CZCA 3OT1A 2XV1A 1CUJA 1EAYA 2EL7A 3MSXA 5HK9A 1GUFA 4IIJF 2FR1A 1E5VA 3HO1A 1CJVC 3PFIA 1EFKA 2IXEA 3QBDA 4LDZA 3RRJA 4DJ5X 3NUQA 1NVKA 3Q8KA 2LKDA 2JATA 1DAHA 3OLCX 1O5TA 4CNBA 5A5DA 2R4QA 3VTZA 3H11A 5JMPA 4ARBA 5KAPA 2WPDA 3EPRA 4A2CA 1VMAA 3P7MA 3X1YA 4JKYA 5J4YA 2FN8A 1FNCA 1PR3A 4C9BA 3BXPA 3V8QA 1JUDA 4ZIRB 5ALZA 2P3QA 4Y2JA 3G13A 1NVUQ 2VUSA 3IEXA 2DSTA 3OTIA 4N01A 4RELA 1MJGM 3ZU6A 1QOZA 2ZXFA 2N75A 3RQIA 1BGWA 2A35A 1WD5A 4CHGA 4D81A 2RCNA 1UDBA 3PX3A 5BSWA 1HDCA 1WX1A 4I3GA 5I7SA 2GN9A 3FKSD 2Q0XA 1H2ZA 4KRXA 3VVLA 3W6ZA 3KE8A 5C4MA 4P7KA 1JIIA 2B9VA 5EFOA 3C6MA 3EUFA 2N9UA 3RIMA 1AS2A 4YXWD 1QIKA 1Z0IA 2ZR7A 4A7PA 2FH5B 1GUDA 4Y2VA 5ESWA 3PVCA 1U7UA 5AHRA 2BR3A 2FMIA 1MXFA 3DONA 2C07A 1SVIA 3L7CA 1EBBA 4PG8A 1TUEA 2P3SA 1YNOA 2CNNA 1BS9A 1UWKA 2OR3A 3ZWCA 3L7LA 5HPYB 1GVNB 2EZ4A 1HL3A 6YASA 3FCSB 3SQLA 2CNKA 3STTA 3QMVA 3A1WA 2I34A 4DBZA 4M9RA 4HH4A 4DVGA 2X5KO 1IJEA 5HP4A 4ZALA 5DX0A 4FP9A 1W4BA 2D5LA 2PT9A 5CHYA 3WGTA 3FHCB 4EUNA 3NB0A 3UOAB 2P5YA 2NXNA 1AV7A 2YVUA 4UNIA 4EHDA 4TKMA 2AHOA 4QELA 4LWQA 3G23A 5JCOA 4R8RA 3W5UA 3ZWBA 2HWWA 5JJ5A 3LWBA 3WMFA 1XF1A 1PQ4A 1NDHA 1YJBA 4RO0A 1C0IA 3B1YA 3EMBA 4PGGA 2O0KA 5IC5A 3T9BA 4LV8B 1VCOA 2FRDC 3BJRA 3LDGA 3ZGVA 5DOVA 1J1UA 4DWWA 2Q5QA 2FY8A 1DO2A 4BNIA 3EUAA 3P32A 3P27A 4KQJA 1IZ0A 3GDHA 4M49A 2VYVD 3SXUA 3CPEA 4AKEA 3H2BA 1TLFA 3FBGA 3JATB 3DNMA 1TA4A 4JU9A 4YXWA 2WUVA 1S3FA 4J75A 1AD2A 4UAUA 1IG3A 3C87A 3OT1B 2CNWD 4PZDA 4YT2A 5IN4A 4QG3A 3WYDA 4B2PA 4PAMA 3M81A 4ND8B 4D9MA 1Z75A 2CW5A 4L1KA 2HHHB 3I39X 4O1HA 1YR8A 2GYWA 5KQMA 3KHTA 1BDMA 5L9AA 4CEHB 3NDBB 4HWRA 4NBVA 4NL4H 3I83A 4QBGB 2AIRA 4FW9A 4JDPA 2GOYA 1PUXA 3ZDAA 3I2IA 3OCZA 2F90A 2QT9A 2VHJA 3CRZA 2E6KA 3CVOA 3QWBA 1W7AA 2GCIA 3JRXA 4D3DA 2ZS8A 4HEQA 3R20A 4AZSA 2QM7A 2TECE 3LMKA 3UXHA 3EH2A 1VECA 4B73A 1ZI9A 4WNCA 2NZ8A 2R65A 3M1LA 4HBGA 4DLXA 4HNHA 2F3UA 4M9XA 4B32A 5C52B 1Z62A 2DQZA 1W0JD 3R09A 4F60A 4E4TA 5J4KA 4ECEA 4OHCA 1VMDA 1TEZA 1UFKA 1FSSA 1R00A 4EB6B 2Q4RA 4GKBA 2FDCA 3PFBA 2YIJA 4UEOA 1DUSA 5A6SB 2JLBA 1O6ZA 2RIPA 1N6RA 13PKA 4X8OA 3W2IA 4MCHA 2NPOA 3K9LA 3NTOA 1Y34E 5JAZA 1CDDA 1E58A 2J3QA 3H86A 5DYGA 1ZKMA 2QN6A 4HXGA 1KMNA 3VH1A 5LYJF 2OP0A 2O07A 4RYDA 4LTDA 4EG1A 3UMMA 3TAHA 3D3WA 4HWOA 1IN6A 3B1JA 2YOFA 3SJ7A 4R8VA 4B4VA 4K03A 2PH7A 4A5SA 2PS3A 3QWAA 1RCTE 5FDFA 1EGHA 2QRKA 1I0ZA 1L5YA 5LOVA 3SZRA 4MEJA 1QQ5A 3D9QX 3IVMA 3ND8A 3O8QA 3U7JA 1AN0A 4UE2A 4D2IA 1PJSA 1E7MA 2FNAA 5A4KA 3DZKA 3RNOA 4L16A 2YY6A 2JW5A 1WXEA 4RFSA 3JRNA 4WGGA 1J2TA 1UKEA 4GP9A 3M7IA 5KAMA 3LAWA 1C4KA 2QNRA 2CDBA 1GP2A 1T9HA 2FWMX 4FNMA 4L5JA 5L40A 3HYTA 3AL0C 1K88A 2Z04A 3FPAA 4GXQA 2ZREA 2MYUA 1XK7A 1T4BA 2OV2A 3S27A 2JS7A 1BEEA 1G6OA 3OIWA 4F96A 1KE1A 2D1RA 3I12A 4XVHA 4B40A 2WAXA 3P0IA 4ZYWA 1EE9A 1ZUD1 2CNDA 3WRYA 2O19A 1BFUA 3G0BA 1CCWA 2O2EA 2WYUA 3PLNA 4Z2YA 4EEZA 4M89A 1XA0A 2E87A 2V6JA 1R0SA 1L2TA 2D62A 4N1AA 9LDBA 3AR2A 3JZAA 3DXXA 5IZ4A 3IMEA 3MWYW 3SQMA 3D59A 3ZDXB 4PSAA 4BNDA 1UIMA 3AM5A 3N5CA 5JAHA 2WI8A 3A2NA 3SIXA 4BVLA 2D1SA 1X94A 4U5XA 4YMLA 1YRHA 2KYRA 2V7EA 3Q8XB 3LPLA 1UAAA 5ARDA 4LHEA 1Y48E 2WIBA 5HZKA 4JWTA 4E88A 4ZCIA 2ECOA 2O1XA 1C50A 2WF6A 2ZCVA 3LX4A 2XZDA 3HDHA 1SURA 4OB6A 3QTLA 4MAAA 2PMFA 1A88A 1SQ6A 1FQOA 1N2CE 1ZJJA 3ONFA 4U6SA 4WKPA 2AG5A 2DQ4A 3CXRA 2OXCA 2XMPA 3OWHA 1NSTA 3JALA 1N2EA 4JOSA 4QTYA 5DBHX 1FDRA 2OESA 1OIWA 1ORDA 1RP7A 4EJMA 1KVSA 3ONEA 1GUBA 3EVZA 4X20B 1IONA 3CLSD 3TAUA 3DO5A 1PGJA 5IF3A 1Z08A 3RTAA 1ZX1A 1N7GA 3I28A 2ZJYA 3VR5H 4DTCA 2WJ6A 4GSKA 4CMJA 5CEEA 3MLBA 2WZQA 3CRMA 5KKNB 2HQBA 4AWAA 3HCFA 1OXSC 3DWEX 5B6IA 4HT3B 4WBXC 4EB3A 2QL7A 1C41A 4NJMA 4G4SP 2VPQA 3A7EA 2BTQB 5L3QA 1K6XA 1ZG3A 3C97A 4ZANA 1FVFA 3A06A 3M82A 3H4IA 4Z9BA 2WWWA 5EESA 3P9SA 4J0HA 3UFBA 1HGXA 3GJ4A 1BHQ1 1MXHA 2JGDA 2ZRAA 4BNYA 1K8YB 3UOGA 1DEXA 3ZD6A 2R7MA 5B1DA 4DG8A 3IQHX 3CT6A 2HGSA 1CLEA 1LJLA 5JC1A 3KT0A 4M1MA 3PHLA 5F73A 3CSSA 5CB8A 4P4SB 2K4MA 4ZVOA 2P75A 1BDJA 4G9EA 2AYZA 1UBRS 4M0KA 1NJ2A 4J7UA 5JE8A 1FUEA 1B8UA 1J8YF 5F77A 3TLEA 1X7YB 1DAFA 1QHXA 1XVIA 1ZWLA 3C15C 1PW7A 4OI0A 3VR3A 2PZMA 5CT5A 4O2AA 3UMYA 1E3DA 4TYYA 2NIPA 2GNPA 4HPXB 4YR7A 5LVAA 5C3MA 2C2MA 5JATA 1JTEA 2O8FA 1SBQA 2ZUBA 5KS2A 4AKTA 1AQYA 1YE5A 2OD7A 2ZZKA 2IZ5A 4IJKA 3ESBA 4ENPA 4KSCA 4LHWA 5JLJA 1NLUA 1LB1B 4H1HA 2WM8A 3QEJA 4PVCA 4WFIA 5HIJA 4PC7A 3RVBA 1YDWA 2XWQA 5M34A 2OUIA 2FU5C 3HVIA 4Y7DA 1JQDA 2BI7A 2G3YA 4L08A 1X1TA 2OHGA 4RW0A 1KWGA 1KQGA 5ED4A 1N33B 1QGOA 4B6QA 5FTMA 2QI9C 2IY7A 1V1JA 1L8QA 2D2XA 2FZCA 2W6PA 2WWXA 2C2WA 1SCQA 2OD2A 1XLTA 4WEOA 3UQYS 4D6YA 3W9SA 5CAEB 1E2QA 1V6CA 3TTWA 3NBUA 4BKQA 3GRYA 4GZ3A 2C9OA 4N9QA 5NULA 2ZI9A 1SKAA 2OT3B 1VKOA 1I4TD 2TMDA 2YJ5A 2ZATA 1QOPB 4CKZA 4A03A 3GCWA 3HG7A 1SBCA 1CFZA 4P53A 4OCZA 4X6LA 4NBWA 2JAQA 4G5HA 1YZVA 2YJNA 4IIGA 4A2QA 4OGWA 2NAPA 1RXCA 1MEOA 2JK1A 3V4VB 5KPJA 4NK5A 3EEYA 5LD2C 2OZVA 1ZW1A 4D5EA 1JG3A 2YCLA 1TM5E 3G2MA 4W4TA 5GGYA 4ALIA 5A5FA 4KXMA 3D2LA 1K86A 4C7OB 3OPYI 3GLGB 4QUDA 1C1DB 2AFIA 4ZCTA 1T1EA 4LJ7A 1ZGZA 3F96A 4Q9AA 2FMXA 3RT7A 5F51A 4C08A 2A7QA 1NBME 2XD4A 2HBYA 2GBLC 5A0VA 1GLVA 2R8PA 1H4VB 3O9VA 1DGQA 2NU7B 3HVHA 2HA0A 3SD7A 4BVJA 5AW0A 4TLMB 3I58A 1A76A 1PZGA 4MJXA 3PE3A 4NHOA 2J3EA 3TG2A 3RVPA 2BHSA 2EJWA 5JNWA 5CB0A 1U0EA 2MSDB 3BS4A 4Q1FA 1L4NA 2O5RA 2CY0A 4FB4A 1ZUNB 2JANA 2IBSA 3ZNQA 4MQ6A 1T9CA 4K40A 4ZVKA 4I4IA 2P6UA 4NPHA 1MKYA 1VXRA 1UC5B 3RC3A 4CQLA 1KNQA 4R2WA 1OH8A 4D97A 1U8AA 1PJLA 2B8NA 4EGSA 3DDSA 4CKCA 2O2HA 6PFKA 5J3JA 3Q3VA 3OQJA 3KZVA 1HSZA 2EFYA 2HPHA 4RD3A 1W36B 4AMZA 4EHBA 1O9GA 2FR8A 4BLRA 1M1YA 2F43B 2DLNA 3TQTA 1NX9A 5JUWA 1NVVR 3H1FA 1T8SA 2RGDA 4PS1A 4OXRA 5ICGA 2CT8A 4YCMA 5F1YA 3ZHOA 1GPKA 4GVPA 1TUBA 4A6DA 3CEAA 2Y1LA 3HVKA 1KR2A 4NRDA 2ZWPA 3GLUA 3GUYA 3NCTA 4C21A 4N5LA 1K8QA 2PGJA 1RS0A 5JCPA 3TG8A 5EXDA 3RS9A 2VF4X 3VHRA 4G09A 3L0PA 4HNQA 2J0EA 4N6OA 2DUWA 3Q12A 4LFBB 1EJ0A 4JNKA 3DUFA 3KVOA 1JKJA 2PNJA 3TQRA 1KZHA 1ZFNA 3UAWA 1R64A 2HCFA 1FB5A 4K6GA 1XRJA 1ZKDA 2XIJA 2CLSA 3EPKA 2Y66A 4CKEA 3ROFA 3VPFA 3IDZA 3ICVA 4CDMA 4EY4A 4BVFA 5A4DA 5T3UA 4YRKA 4PIMA 2P67A 2FPSA 3T1OA 1FLAA 4LISA 4TYMA 2QU8A 3GH1A 2V3WA 4JEMA 4TV9A 2XOEA 1PR6A 2HX1A 4V2UA 4YLGA 4ZIRA 2B3TA 1TJ5A 4BLPA 4LAFA 2ZZNA 3A1TA 2JBAB 2OAP1 4BFUA 3D54D 1E3EA 4MUBA 5ITZA 1TJPB 2GRAA 2HDWA 3B1XA 3AZOA 3EPPA 5ALKA 1F6BA 5CCDA 1BYUA 5EWLB 3ST7A 1X1DA 3O82A 2JH9A 3BCHA 5TS2A 3DKPA 1SXQA 3COYA 4QZVA 1AURA 1DTEA 5J2TA 1ZVVA 2WSYB 2HRDA 4JHLA 5HZMA 2FZKA 3NX4A 4PZ0A 4RMNA 2HHLA 1M0TA 1XJCA 4H0FA 1A4RA 3L0BA 4D98A 1CJCA 3JWEA 5ELLA 3N87A 2O8NA 4HFJA 16PKA 4AN4A 2D7JA 4ZCQA 3BD7A 1JYFA 4BMPB 3PCTA 3UXEA 1TEVA 3ZCUA 4KN5A 2PQ2A 1G21E 1M2NA 1WNFA 3GDFA 4IJ5A 5CT9A 1JDBB 3H0CA 2X6RA 4EBFA 3QVJA 4JR0A 2VA8A 1YR2A 2Y99A 4KGZA 3RE1A 1JSXA 3T12A 2WWRA 4UHCA 3WK6A 3ZCQA 3ZCTA 3D4BA 3JAWB 2J8ZA 1YHNA 4KN8A 4UFOA 4EYOA 3R7AA 1JAZA 1T5LA 4RENA 3G02A 4I4LA 1QIFA 3OM8A 1P2UA 4RH1A 5A7HA 2Z2ZA 5HWSA 1YHZA 1MGOA 4A1FA 1DADA 1YCFA 4PEVA 4QAQA 5AHXA 5EJFA 1H0HA 4PNEA 1GN8A 1KYYA 1NVMB 4N0PA 2IDKA 2VHEA 1OBHA 1J8FA 1SUSA 3I2JA 4TMWA 3EXFA 3W1WA 1XDUA 3M1YA 2Z2YA 4JL6A 4DCCA 2B0JA 4NHEA 5F9HA 2EEZA 3FTNA 2PS0A 5DTJA 3OQOA 2C9MA 1NM5A 4K46A 1OWMA 3WOHA 2FWAA 1LGYA 3NPAA 2O7VA 4Q05A 4AJOA 3OQIA 5BWMA 2JKYA 4IGEA 2AEEA 4EY3A 3PK0A 4ZEVA 2ODBA 4MR9B 4MR8B 3EQ2A 5TGTA 3DLPX 4XA8A 5TJHA 2HA7A 2PSEA 3H87A 3RKUA 1PR5A 2JEYA 2IDMA 4FU0A 1FFHA 2DY0A 5JVDB 1XNJA 1T3SA 1IK4A 4EI8A 1U31A 5EJ5A 1V7CA 3PDHA 3QEMA 4Q18A 1IRIA 4UKDA 4EA7A 1BHO1 1IOZA 3EF0A 3INTA 4NAHA 3R6GA 3SSMA 1XO1A 5F2EA 2IP1A 4BWYA 2O2XA 1VDZA 3M70A 3ZTWA 3MJRA 1EX1A 1OASA 2ZUSA 2EJTA 4GBMA 4B76A 5BW8A 3NWEA 5L51A 1C14A 4ENSA 3T7AA 3EXEA 1H1LB 5ALDA 1QV9A 5G1PA 3RJ9A 2Z3WA 1ZU4A 3PXXA 3C0KA 3RYIB 1H3EA 4LC0A 3N53A 2D1TA 2ZSBA 3E70C 2JL1A 3JD2A 3T61A 6Q21A 4MJ7A 1MR3F 5FJIA 3K0SA 1Q1ZA 1TPYA 2XYRA 4WXEA 4X1KA 1KI7A 4BQSA 3FOEC 2ZAOA 1YXMA 1LPSA 1TXGA 2VJCA 4QDJA 4OKSA 2PIAA 1O1YA 4QJ5A 3H6KA 3ER8A 1I51A 2O2SA 2HWYA 4RBNA 1UEXC 3RARA 3T3DA 4BZPA 4O2BA 1A04A 1H2XA 1UBNA 2H1RA 2V5AA 4O4IF 3THXB 2JLCA 1YFLA 3QU7A 3C3KA 3EMDA 1SXJE 2UZ3A 4EPWA 4CMIB 2HBQA 1GQYA 2R8OA 1Y81A 2PEYA 4RZ3A 2UZ1B 3LCVB 4P5PA 4W1SA 3MMNA 3RU3A 3VA7A 3O8DA 3N6VA 1RNLA 1FL9A 1UODA 1DC7A 1SC3A 3V8NA 4N76A 1R9JA 4AI6A 1ENZA 1AZWA 5DB4A 1WQ4A 1ECPA 1P4RA 3OPYB 2RI6A 4G5QA 2VJPA 2O3UA 5BO5A 3B52X 2IHZA 1PG0A 1QYCA 3OZXA 3QA3E 4L74A 5DK4A 3ZVLA 4D4MA 4MW5A 5LU9A 1DIOB 3FYTA 3QX3A 1YO6A 5KKCA 2Z6UA 1OXTA 3P52A 4H31A 4MW6A 5CYFA 2QN1A 2LE0A 3ZNOA 4JIMA 5JSFA 4PCUA 2VSNA 3CW2A 2A8YA 3E9CA 4OJKA 5JJBA 4RCZA 1J5XA 1CR4A 1Y9EA 4ISBA 4JU8A 1HDYA 3R0IA 1MH9A 1D2EA 2X58A 3ESYA 1ZVMA 3PICA 3TZLA 1OPRA 5A03A 1P17A 4AC9A 4MVJM 3TPFA 4A23A 4YVFA 3HCWA 1WVMA 2PHZA 3D31A 4I7EA 1TAGA 5ALIA 4XLTA 5FI0B 4GD3Q 2FW6A 4DXAA 4QL3A 4OYRA 4F72A 3EFOA 4IAOA 2P79A 3L18A 2WIDA 4IZIA 4HMQA 4JEUA 4Z3OA 1W0KD 2H85A 2HWKA 4JQZA 3GT0A 1RI5A 1YS9A 3G0HA 2O50A 1XHEA 4YRFA 3IE2A 4O4LF 4TMKA 3JY6A 1LRKA 2AG1A 4JLWA 5HF9A 4YHHB 2VJAA 4YO7A 1EUZA 3QW4B 1ECBA 2DAPA 4PLFA 4KDCA 4XWGA 2XXAA 3ET5A 4XDYA 2R1TB 1L7RA 3LDFA 4BNJA 1OLSB 4DMGA 1H05A 2PAAA 2QD2A 4R1OA 3T1TA 3DDHA 4LE1A 5YASA 1KI6A 2COUA 1SUWA 3U9LA 1FYEA 2NVBA 2Z4RA 2Z8YA 4H4DA 1X1CA 3S6JA 4F3TA 5KTSA 1ODFA 3SJBA 2HZ7A 2VTBB 5SZKB 1R6UA 4YO8A 3AUYA 3WO1A 4B31A 4AIRA 3QNMA 3LTNC 3RRXA 4KQXA 3E6AA 4IQ0A 3HDGA 5EWMA 1LBHA 1XMQB 1KYXA 4NOLA 4BJ6A 1Z4IA 2HMVA 1W4CA 1F20A 2J9YB 3M5CA 1QDLB 3Q3JB 1HSOA 4V0QA 3W3AH 1I7SB 2N0SA 2C7QA 4QOEA 3CY6A 1SD5A 2CVPA 3WGYA 4XJVA 4ENWA 4NZOA 1E9CA 4KAFA 4MB2A 2QZ4A 2XYHA 3HM2A 1JBKA 3ICWA 1ORHA 3KOWA 3QVGB 5CD1A 4N3BA 2C5AA 4ARAA 4FYMA 2A5JA 1NVWQ 2YWFA 3KD2A 1X77A 4ROSA 2R6CA 5IJ0B 4RE6A 4P4UA 2WABA 4WZBA 3SICE 3H1AA 2FFAA 1N3LA 3GFPA 4A8JB 1SVWA 3JQRA 1FSGA 2I6GA 2ZOSA 3DHEA 2OE2A 1TE2A 2XT6A 3ROTA 4DBLC 1YBHA 3T99A 4YV7A 1KRHA 1C0EA 1PUJA 3A37A 1U3GA 1G16A 3C6YA 3DD5A 3R5FA 5E95A 8LDHA 1B6TA 1WKBA 1E3JA 3AERB 3G2NA 1VL8A 1GY8A 4OP3A 3QTBA 5SY6A 3UH0A 3A1EA 2OOKA 4ME6A 2CDCA 4HO1X 2O8EA 3AI1A 4URYR 2RB4A 3C41J 1UMBB 2YQ4A 1KI2A 2NXWA 3F9CA 1LH0A 2G1JA 1EFTA 1Q1GA 2P1RA 5LDGA 4BO9A 3NMUF 4LX0A 4OHOA 4O4HA 4FI3F 1DPGA 1W73A 2I8AA 2E4ZA 2VUTA 2OVFA 4JT9A 1S2DA 1YL5A 2GERA 2JFZA 3GD7A 4NP6A 3EYAA 5B12A 2AV6A 2C4KA 2D06A 3OKAA 2GXSA 3K2BA 3UT6A 3EB9A 1Z0JA 1SWWA 3M33A 1HYEA 1NT4A 2GLUA 2IVFA 4JT4A 3TKLA 3F6RA 5JFGA 2P9YA 1XGKA 3KQVA 1T3HA 4JCCA 4Y2SA 2QORA 4O0LA 4DANA 3ZKWA 5AKKA 1K3TA 3EARA 3UJAA 2WAYA 4Y8VA 2NTNA 2YBDA 4BN4A 1L7BA 1U3WA 2G8NA 3U62A 4WK2B 3L92A 3PHBE 4RCVA 1PSZA 1WL8A 3H42B 2QPAA 2ZIXA 1ES9A 3OIYA 2BGWA 4PY2A 2P27A 3PDUA 4L5YA 2JI8A 4JBXA 2C3OA 4HGOA 3B85A 4J0DA 5DOZA 1CQZA 2HA3A 1JFRA 5J4LA 5ALNA 3DO8A 5GY7A 1J22A 3JQFA 4KZKA 3TCKA 1SVMA 1VPTA 1L7VC 4I8XA 2AN3A 4AJEA 5LQDA 1G5PA 3L5OA 2IH4A 1HZJA 1P7WA 1VSQA 2MU1A 3FPGA 3TQIA 5JT1A 1CC1S 4OHYA 3AVPA 2IHKA 4A15A 4MV1A 4LE2A 4BLTA 2CLMB 2FOIA 1JR3A 3DE6X 3SFZA 1SM4A 2YDYA 1U0JA 4NCXA 4QQFA 4B45A 4TTQA 2OCGA 4BAGA 1LDNA 1NDQA 3PGKA 1NWCA 2HL6A 5DYIA 4R71A 1Z16A 5I5GA 3LCCA 3Q15C 4HRVA 1XCJA 5KI6A 3VOAA 1WXIA 2GEKA 3GUZA 5BV7A 4MHTA 4J0FA 4ATNA 3AVVA 2X3YA 3SZGA 4M8KA 1UK8A 3GFRA 1Y3DE 4YCAA 3B8EA 4QWMA 3UK7A 1M1ZA 3A70A 3RUCA 3DOUA 5GAJA 3I42A 3ZN2A 4EX7A 4AVYA 2W6JD 2XTMA 5DTRA 3WL8A 1NE7A 2ZQYA 4UHEA 4D45A 3WV5A 3KK0A 2JD1A 3RVNA 2VDWA 1VI5A 2CMGA 3S1AB 2BCEA 4OB7A 1K06A 1N2ZA 3CUTA 1Z4KA 4NONA 4WX2B 3Q9SA 3SN6A 1RWBA 1BXRA 4MRMA 3N2NA 4J1NA 2JLRA 3E7FA 4YUWA 3B6EA 4HZUB 2QP3A 4KVAA 3U4DA 5K45A 2IF2A 5JO9A 3BIFA 3MS2A 5E9WA 1GKIA 4G07A 3EG9B 4LF7B 3N8KA 5EUQB 3KQMA 3SBXA 3BD9A 2AJ8A 2VPPA 4RIGA 4U7TB 2E5LB 4KV7A 3LU1A 5J63A 1MU0A 1KGDA 3ETCA 4C4XA 1QVAA 3CTPA 4A0GA 3AFNA 1Z4LA 1YASA 4PZCA 5I9IA 4EUHA 1QRUA 4QM7A 3A0UA 5C4GB 1Y89A 1YOBA 3SHFA 4DM4A 4F2GA 1SR8A 2NUAB 3BQNB 4U5QA 5AM2A 4GSYA 1JVBA 4DCUA 4B74A 1YDEA 2REXB 1UAYA 1H8EA 1XALA 4QUGA 4ZQCB 5HIIA 5A4JA 4JI7B 3TZBA 1PLKA 1XELA 1PI3A 3KU1A 4QU0A 3BCRA 5BNTA 1L3CA 4XD2A 4N3AA 5H0IA 3L7JA 4BB6A 2C57A 4ILEA 2XWSA 3GL9A 2QGFA 3KTDA 3H1GA 1MVLA 1XQXA 3PYLA 3NHMA 4OFBA 2AD1A 2PWYA 3L49A 4PG7A 1T36B 3ZV4A 4L57A 1FS6A 3NXKA 2HJRA 4L9RA 4M1ZA 1JEQB 4QSHA 1JKMA 2VKQA 1S02A 4RQUA 421PA 4UTNA 2WHPA 3NOOA 2Q6KA 1V4VA 4DS3A 2BHTA 2P7HA 2J07A 2MMCA 3EAGA 4FIZA 3JD3A 3QF4B 1ZDMA 5DZSA 4ZJUA 2NP6A 2ZYTX 4NECA 3UMCA 4RSHA 5K51A 2RHRA 4K7JA 5CFQA 1N2IA 5TC4A 4JBWA 1H2FA 1JFSA 4NKRA 2WHRA 4CG3A 1TKCA 2FR0A 3U40A 1C3EA 3T1QA 1Z2PX 3AJDA 5A06A 1L9KA 4IIXA 1GTVA 5H8WA 5JQGF 4MW4A 3JPWA 2BP7B 4R98A 5H82A 3S7ZA 5KNBH 2IYTA 3KWFA 1PGOA 1RAFA 4ZHQF 5CXUA 2Q28A 3GRAA 3IE0A 1U0TA 5CW1A 5DGCA 3VSEA 3I9FA 1N75A 5E7JA 1U8TA 4D0RA 4CNQA 1VSUA 1XRRA 4UBLA 1IXSB 1CNEA 2ZVPX 2VK2A 3W05A 4ZU6X 4DYVA 4FSHA 5EE9A 2YJ4A 3H16A 1DWOA 1IH8A 5LKRA 3O90A 2Q0QA 4G1EB 5LOVB 3NW9A 1U8UA 5A4MS 1ODJA 3F5FA 1JX6A 4CKBB 5F35A 4PYLA 2BOVA 1G8PA 5AI9A 1HTTA 4KW7A 4CIVA 4NV0A 3EIEA 3TB4A 4KMSA 2Z4TA 1KJIA 1P5ZB 3N2KB 1X92A 3E48A 5IEJA 2NUTB 3JYLA 4G0YA 2IJGX 3M89A 4O1IA 3FFXA 2QLFA 4M0CA 3UBMA 2SKEA 4KIFA 3FAKA 1RYEA 3Q7RA 1VSTA 5DIFA 1EVKA 5KDLA 1TQDA 3A9WA 3GLIB 2IIPA 2QDKA 3ETJA 5B58C 1R6BX 4E08A 1DEKA 3X1ZA 2UUCB 1EGMB 4RY2A 3KQPA 4W6ZA 2HSEA 3PF8A 4ILKA 4MEBA 3QTTA 3S8YA 5THXA 1VIAA 2V1XA 4MA4A 2QUAA 4W7SA 4BWVA 3JVEA 3ZQ4A 1M66A 5DM2A 5BSMA 4YCNA 1KAMA 3T3HA 1C7IA 2RHBA 3SDSA 1RXSA 2ENUA 4IICA 1E6CA 3FZYA 5ERGB 3V9AA 2NMVA 1FQWA 1XPRA 1OZ0A 1NF3A 4YEDA 4KPGA 5BVHA 5B7GA 3FTCA 3WYNA 2CLDX 1D7OA 3RODA 1EK6A 1YI0A 4Z49A 5K0JA 4MKIA 3ICOA 5DCUA 2NP7A 1ZIPA 5E38A 2PU5A 5ALUA 4QUKA 5ICSA 1GKLA 1ACLA 1IUOA 1WS6A 2H48A 3PD0A 3VHLB 1KF0A 2HA4A 3NRBA 1XTVA 3HJBA 1O9BA 2ODEA 4F0JA 5JNRA 1CRQA 2Q5CA 1PT8A 5JSHA 4JMPA 2JCVA 3UK6A 4KPFC 4HVTA 4U7FA 4PANA 4DYHA 1JIQA 4GUDA 1NBEA 4BNXA 4G0WA 1XN4A 1MQSA 2HHJA 2EFGA 3JVDA 5DLQC 1KVUA 4ARZB 4B6PA 1LSUA 1FQJA 2AQHA 3GLKA 4GPAA 4LHSA 1Q5PA 3MJ4A 4AJHA 4BN0A 3IAXA 1MT3A 4HXEB 2GK4A 3BZWA 2GEUA 3DFMA 1Z4OA 4QYIB 1JXQA 5TV2A 2ODAA 5GIOE 1UEIA 1B0ZA 3LY5A 5CFNA 2AMVA 1A50B 1ZO8A 1B76A 1S01A 1S2IA 3VYSB 3DAPA 1J39A 4FFWA 3C3DA 3C14C 4CM1A 4K0KB 3N8GA 4QUAA 4EENA 1FJGB 4BEVA 4FPXA 3CONA 1UPXA 2R1UA 5TPWB 2PKXA 2QTAA 4BECA 1ISSA 5LXTF 3F3MA 3UZUA 5L8VA 4DMHA 2ZS7A 2PO7A 2HXYA 5AM0A 3LHSA 2JBAA 2JJ2A 3PNKA 3IQFA 3CVWA 1ZMBA 1SUEA 1DBSA 2SNIE 3MJEA 1V3TA 4OUKX 1XKXA 3WKAA 5BSFA 4FWTA 2JIZA 4UW9A 4Q4JB 1V16A 1Q92A 4HUQB 5IH3A 3RF7A 3VVCA 3L8HA 4HVCA 2GD0A 2AXPA 3LBHA 4GNKA 3V33A 4KTTE 1IN1A 4BFLA 4P4LA 1DAGA 1VKZA 1IDN1 4HH1A 3QVLA 5B4UA 2IBMA 2V0GA 2GRUA 3D7RA 3I9V1 2VPZA 1U9CA 3QXGA 4JC5A 4S3MA 2E5WA 4JI5B 6REQA 5AVUA 2YS7A 3V4SA 4IM7A 5DHPA 1X1QA 2V5VA 1TZKA 3LCRA 3CNLA 4MYUA 4N5MA 2NNLD 2NT4A 3OE4A 5I9NA 1FX1A 4ZAZA 3GFSA 3I61A 3DT6A 4A5OA 1ADCA 3R5SA 2C4HA 3U4AA 2C5SA 1UBLS 2LGJA 3I6YA 4HNGA 4KX5A 3PJRA 1DQPA 1V5GA 1WMFA 3ORRA 4LC1A 5EEGA 5KDDA 3N0WA 4Q3KA 4ZT6A 4TS1A 1YVPA 1UXOA 3PQ4A 4AT1A 2WU3A 5DT2A 2BH2A 1A96A 3AYXB 4BDTA 5F9FA 1QLHA 3DL4A 3W77A 2PZ8A 3PA8A 3T5GA 2JFXA 2DWPA 3TUZC 4DV1B 4QHSA 5IBPA 3SS8A 3PFFA 3KWLA 3IP9A 3QENA 4IIFA 4M8IA 3LE8A 2HDHA 1KEVA 2H92A 1L5VA 3N9IA 5CJJA 2HN9A 3BFXA 1VOTA 3LQFA 2H7VA 2WKSA 521PA 4MUGA 5JDIC 3RHZA 1CP3A 4ZT5A 4I1YA 3U4MA 2ZSAA 3TRJA 1RKVA 2PJZA 3TS1A 5JRJA 4XCQA 3VO8A 3H84A 1FF9A 1ZESA 2CB9A 3SYLA 2GZ1A 3U31A 1NA5A 5L3SB 3RFUA 2EJCA 4KR6A 4Y6OA 5CUQA 2WYWA 3E7WA 3SR0A 2BMJA 1NFRA 1FMLA 4ZKEA 1CVIA 2W48A 2R8RA 3HFSA 3JQFC 1DBVO 1O94D 1VPVA 2IF0A 3EVGA 3L8MA 4LY9A 3DDOA 4FYKA 2RI1A 2IOYA 4Q4JA 5K2MA 1J9GA 3HUDA 5T41A 4B4OA 2ZYVX 1GLGA 4KFTA 2GVZC 5ALSA 1QHIA 3T94A 2G1UA 1G8HA 2OYCA 1CJSA 2K87A 3ADBA 4W9RA 3DLHA 4AKIA 2GZ2A 1JTFA 5KQRA 4P0PB 3MAAC 1NBMD 4PWZA 2GXQA 2OCPA 1WETA 2QR2A 1NVGA 3WLPA 4UCFA 2JZOA 5BR4A 1T6ZA 2MSNA 4B4KA 5DBEX 3FB4A 3HH8A 1YJAA 4CFZA 5E1MA 5JFTA 1CR6A 2RCYA 1V11A 1Z4QA 5GZ1A 5EIEA 3BK1A 3FI9A 2XMSA 3JWGA 4HAIA 5TVGA 1L8LA 4UM9D 1S2NA 2GEFA 1SBHA 4NMXB 2ID8A 1DXYA 1RWWA 5G3YA 2OSBA 5FTJA 4EKEA 4Y3UA 1BDBA 3V8EA 2OBBA 3G59A 1C7FA 3DEFA 3NDRA 4WDQA 5F23A 4G1MB 1F5NA 1GG9A 3P0EA 4K26A 3VKUA 4Q16A 2EKPA 1WHSB 1U2GA 3V1LA 5AH0A 2JLWA 2A2ZA 3OOJA 1CUEA 3I8OA 3STWA 4B48A 1OWNA 4BRZA 4D41A 5CLJA 2FDRA 1OC4A 1QHGA 4EG5A 5JISA 1XDGA 3D7SA 3C7AA 3W5JA 5IJWA 4AW9A 4LS3A 1C30B 3KQKA 3GNLA 3QU9A 4C7VA 1RRGA 2O5CA 2AR0A 5FWYB 5IAAA 4N49A 4D4IA 5FLKA 4TTJA 3LK7A 1U0NA 3RV4A 1A98A 3H6HA 1HNWB 5FNVA 2W2MA 4QJ4A 3T38A 1U3TA 3OKCA 1M9NA 3DOCA 5SYAA 5B1IA 1QCZA 1JHUA 3VU9A 4PXSA 3BMCA 3IOMA 1OTHA 4QFMA 1PF7E 3J7AC 3PQ8A 5DTIA 1XZHA 2GNOA 3GJTA 4EAAA 4KOEC 2YFKA 2MDTA 4J07A 3DE5X 1XDWA 1NPDA 2XQFA 4RA6A 4WNYA 3TLAA 5C53B 4LF5B 1G20B 5LR6A 4LVCA 1XZFA 4GIBA 3S1LA 5EL0A 2PGXA 3U2QA 4LGMA 3KT6A 3QX8A 3ZH2A 4RMIA 1NL3A 1R5NA 3X1WA 1HPLA 3GGSA 4EZBA 2L69A 2GS9A 1L3IA 3AF0A 1Y4ZA 3L9XA 2XCQA 1RLJA 5C4IA 5I8PA 3LBIA 3OX1A 1GFWA 2IA5A 3WLJA 1EDZA 2DGDA 4HDMB 2RBGA 2AMYA 3AG5A 3IRVA 1P6QA 2QA5A 4BRWA 1KA9H 4FEYA 4KNWA 4BQEA 5IC4A 2H29A 4TUYA 1ZJ6A 4Y1EA 3WLTA 1OH6A 2ZDQA 3P9RA 4MKFA 3IPLA 1V3UA 3FPEA 2CDNA 2Y93A 5EQTA 1JEEA 1FUUA 1KZYC 1QMGA 3H5TA 1X2BA 2EKZA 2FX2A 3I45A 4LJ6A 4LXTA 4EFLA 2UXBB 2SKCA 2B1QA 1E0DA 5AXBA 4AJ2A 3LPNA 2JGMA 1VLHA 2F8LA 2WR8A 1E3IA 2P2ZA 3HU2A 1V7ZA 2CMFA 1WB6A 2PPVA 2VKTA 3MOGA 4H17A 4I99A 1BWPA 5EFZA 3WAGA 2BMEA 2PKQP 2ZB8A 2HXGA 5J5AA 3WDSA 4D02A 2XY4A 5EY5B 2CLHB 2WYVA 1IUPA 1J0DA 3DGFC 5EJ7A 2KM1A 5ICCA 2C8LA 4HLNA 1N2OA 4PZYA 3DFZA 2WEKA 3IPXA 5AOCA 3JWPA 2HFJA 2Q6TA 5K0FA 2BFCB 3BK2A 1VJ5A 3EVEA 3W5HA 1QORA 1M7HA 4Q3EA 3TNFA 2QK4A 1IHDA 1M6NA 2Q9AA 4DUPA 1M7GA 5LQCA 4K2AA 5JAQA 2FN3A 5F3WB 1EAMA 3U3XA 4ALNA 4IG4A 1AV6A 3K73O 4C6RA 4LDQA 2FAXA 2FMFA 4QPDA 4EUKA 3ICPA 4RJJA 3MB5A 3O4GA 5FPTA 2PUWA 2AKEA 1CIJA 2BMWA 1OU0A 3GAMA 1YGPA 2G36A 5ESRA 3BWDD 1YQGA 4QGBA 1PR9A 1SU7A 1WUHS 4ZO6A 4PFKA 5LL6P 1T2AA 4BJ1A 3R5TA 3PX7A 3HMQA 4CL0A 3H99A 3ES9A 5DNWA 1MX5A 4QYTA 3JATA 4QXPA 2PS1A 2WJJA 1BE8A 4RF3A 4XI9A 3GVXA 4M1QA 3E4CA 3G0DA 2EZTA 3TEFA 1VPLA 2AMLA 5AJXA 3VZBA 2IPMA 4XSHA 4F91B 3LUBA 4LOIA 5HCUA 2XSZD 3QY9A 2OPBA 4OD0A 4QLBA 3DTVA 5K6AC 5KWSA 2A94A 4ARZA 1YS7A 4A16A 4JLVA 3NWJA 2OBNA 1RD4A 5HIMA 3RK0A 1BDHA 4LE0A 5FCDA 4X7RA 4RF5A 5BYKA 3LO5A 2KQUA 3DXYA 4H3VA 1RRMA 3AVQA 5FBZA 2TMGA 1QH0A 1XJ0A 3DZBA 5E4YA 2V59A 1YQDA 4JI4B 3BMNB 3E15A 4NYMR 4U7DA 1BGXT 1ZINA 4HN9A 1XVAA 3NHKA 1KPIA 3SEAA 2ZUUA 3TRDA 1C1DA 1EUYA 4WASA 3I04M 4CTKA 4RHYA 2ECQA 1ENYA 2AI2A 2H63A 1W5EA 3OZDA 3LWZA 1EFHA 2R60A 3B3FA 3LNTA 5F64A 1CUZA 3GJSA 3EWIA 4EDHA 3GJ6A 1AKWA 3OP4A 5FT9A 1SFRA 4EB6A 4KITB 1TCVA 4TYPA 2AWNA 3VZDA 3FOBA 5BQXA 4Z9XA 2EBWA 1NJ5A 1JG6A 4ZJYA 3WHLA 1WPXA 3HYSA 1TUGA 3LFHA 4LOKA 4IJWA 4OMUA 4UULA 5AKLA 4W5RA 1DAMA 5IYZF 4HDRA 2GPYA 3IT0A 1RQGA 1FJ2A 1A82A 1Z07A 2OXFA 3C8HA 2PZKA 1X1SA 1AQLA 4B75A 4DMLA 1T1IA 5IAKA 2C2KA 3FUWA 3SM9A 2WK1A 5CVCA 3D0KA 4MO9A 4WKGA 3FAZA 1A5ZA 1RYDA 1T0HB 2DF8A 1AGYA 2H2FA 2WJ3A 4LK3A 5ADHA 1RKXA 4Q02A 1Y3IA 2HPZA 2ID9A 2JF0A 3O31A 3SQDA 5A7FA 4P32A 4FT4A 1ZIOA 4LMPA 4W5HA 5DP2A 3VR5D 2Q8NA 4IO1A 3DBRA 5FUBA 3L8YA 4CCAA 3EPJA 3ENWA 4V0SA 3OICA 3MXOA 4N18A 5ALYA 4B4UA 2BIFA 4D8UA 1DCTA 1XMIA 2JA1A 2PGIA 2HSZA 1PEKE 3DGEC 1FFYA 3QE0A 2XNDA 3PE4A 1ZZGA 1DDIA 2X8JA 2PGNA 1MB0A 2C78A 2Y0DA 3LCUA 4Q01A 5A0TA 1R8SA 5BXQC 4Y6PA 1PD1A 4NS1A 5F5LA 3WJ7A 3NYRA 3Q3GE 2CCKA 4HB3A 3NKLA 4JWKA 1U80A 4NJEB 4OYHA 3KAQA 5IDVA 2R7KA 4YB8A 3E35A 1QYDA 1ABFA 4FMCF 5J9FA 1FFSA 4N6NA 5I9SA 3RJZA 3VNBA 2FEXA 2HHAA 2ZVJA 3SF8A 4CU5A 1DHTA 4KX3A 5HBRA 2IH2A 2LWIA 3E0XA 1ZH2A 2DM6A 1CQWA 2GTIA 1SKBA 2AXQA 1RAIA 4UOEA 1MRZA 5KREA 1AKYA 1PV4A 2UU9B 1FP4A 2AK3A 3ZHVA 3VUFA 3KJEA 2Q5LA 1GV0A 2VHZA 3L82B 4AO8A 4AZ0B 4E51A 4UTPA 1CUVA 5KJ6A 2OK7A 3IHTA 4PTYA 2L2QA 4QA9A 3W9UA 3TGWA 4NFLA 3LQQA 2E37A 4MX8A 4TXNA 4ZODA 5JY6A 4P86A 1XZEA 2YWDA 1U2EA 5EKTA 3F6EX 3HUEA 4OH1A 3QSGA 1WR8A 4J0GA 3RO7A 1U1IA 5CGZA 2YS6A 3U7QB 1E9SA 1C7JA 1BAPA 1GIAA 2CD7A 3OLYA 4YYEA 4F6CA 3EX7C 1XRPA 2EEPA 2PL3A 5AQ1A 2BEWA 4JJEA 3IX7A 3KEFA 3I73A 3KWJA 3HADA 3WSTA 3K0CC 2DFDA 5KNDD 3TSZA 3GN1A 4WCFB 3PLAE 3K9NA 3I62A 2H1FA 5HYVA 1UC4B 3VPCA 2BH9A 2AOWA 4ENRA 3BJEA 2B7CA 3EVCA 2GAFA 2YHSA 3PRJA 4D9BA 3OQHA 1NJ1A 5K20A 3K0KA 3DZHA 2M1ZA 3FDIA 1TKBA 1S2OA 1SVSA 2AN1A 2P5SA 4HYYA 4QTZA 4FN5A 3AI3A 4GNRA 2V74B 3BWEA 1TCAA 1LS1A 3EXG2 3EIFA 3G68A 1KY3A 2VP3A 1JJIA 1RWQA 4R3NA 3R4VA 3V3TA 1J4AA 1PS0A 4YV1A 5DM60 1FNMA 2PYDA 3B89A 4CUZA 1XVUA 2OXTA 2RSLA 4R3UC 4TS4A 1NRXA 3W04A 3ME5A 2E85A 4ZOLA 4UUPA 3V8MA 3U0BA 4NF2A 4P84A 4PLZA 4UBIA 3RJMA 1O96B 2BGMA 4ZI2A 1EK5A 4D3YA 2A1UB 3QI2A 1X0VA 4KO2S 3OIDA 3IILA 1SY7A 5BQ3A 2QRUA 2XYPA 3ORQA 5KSZA 4BOYA 2YINC 5JALA 2V6FA 2BJHA 2ECFA 1KDTA 2RGWA 7MDHA 4ZOCA 1RQ7A 1GD1O 2YL2A 3QVSA 4KXQA 1KETA 4S0XA 1IY0A 2OO7A 3NQ41 1U8FO 2ENWA 3LQYA 3V4FA 3PUHA 4XPZA 2XBLA 3ZV5A 5JOQA 1GYPA 4J90A 3WO0A 3OFND