3QVKA

Allantoin racemase from klebsiella pneumoniae
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
245
structure length
245
Chain Sequence
SVRIQVINPNTSLAMTETIGAAARAVAAPGTEILAVCPRAGVPSIEGHFDEAIAAVGVLEQIRAGREQGVDGHVIASFGDPGLLAARELAQGPVIGIAEAAMHMATMVATRFSIVTTLPRTLIIARHLLHQYGFHQHCAALHAIDLPVLALEDGSGLAQEKVRERCIRALKEDGSGAIVLGSGGMATLAQQLTRELRVPVIDGVSAAVKMVESLVALGLATSKHGDLAFPEKKALSGQFQSLNPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of the Structure and Function of Klebsiella pneumoniae Allantoin Racemase.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Isomerase
molecule keywords Putative hydantoin racemase
total genus 77
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12500 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qvkA00
3IXMA 3DTVA 4FQ7A 4IX1A 3DTVD 3DTVB 4FQ5A 3QVKA 2VLBA 2XECA 3IP8A 3QVJA 2XEDA 3QVLA 3IXLA 3DG9A 3EISA
chains in the Genus database with same CATH superfamily
3OJFA 2D2XA 4IDOA 3ZX5A 1P81A 4Q3KA 1AG9A 1NOKA 1WA5A 2OB1A 1CNEA 3BDAA 1P2VA 1QV6A 2H9AA 5D7BA 5KX5F 4M9SA 3EXEA 3Q7SA 4PN3A 1E6MA 1IAQA 5K0NA 5ADWA 2RH8A 1ULTA 3VTKA 4P92A 3JQBA 5CBPB 4MZDA 1B23P 5EXSA 5FX2A 1WVIA 1KDYA 1VLHA 1Z74A 1BH6A 3WYEA 5AIBA 4H6PA 4DV3B 4O08A 4RJKA 3FI9A 2PT7A 4PONA 1YB7A 2BTQB 4KZKA 4MGZR 5HRAA 4IZ6A 1A0OA 5GJCA 1CD5A 3ZX4A 1V96A 1E2NA 1T1JA 4JXXA 3G5TA 3EOZA 1G7RA 3ZWOA 3OPYB 1U3DA 1DO2A 4D96A 3KOYA 2PFGA 3E8SA 3FMOB 5KYUB 2CF6A 3BXZA 4MW9A 2Y9MB 1YDEA 3AGQA 4K2HA 3K0CC 3GGDA 4JOCA 4M1SA 4M53A 4TRMA 3OA2A 1XA0A 2AK2A 3EZYA 5DCYA 5EPUA 1XZJA 2QY9A 2C5GA 3L46A 1Y81A 4HB2A 1ESNA 1SVOA 3GUZA 3T94A 3WIOA 4WFIA 3CINA 4O2LA 2H17A 2IHKA 2B7CA 5I9SA 5ARCA 4X6XA 1WHTA 3SFVA 5ANRB 5FUVA 4RKYA 1ZESA 5JSZA 5F5XA 1CR4A 5ALKA 2WHEA 1N7JA 1P7VA 4CKXA 5BRNA 1QO9A 1S8AA 1XL1A 1RWVA 2JJ2A 1GPBA 4MWCA 1GLGA 2FX5A 3FVWA 4DJJA 1RAFA 2W6NA 5JSFA 2AQIA 3ED5A 3KTDA 3OUTA 4ON9A 3B78A 1NVXQ 4YJ3A 4FD3A 3OTQA 1NLFA 2AW3A 2JFUA 2OFWA 1TEHA 3MTAA 4HUJA 1Z4JA 3BKWA 3VR2A 5A06A 4RTSA 3PQCA 2DJ5A 2YIJA 3NHRA 1C9YA 1QVZA 2HV9A 2BLNA 4GBGA 1Q1BA 2J1LA 5EQJB 1B8UA 1P9OA 4WZBE 1ZGJA 4Y2VA 1YBMA 2Z9BA 1MQ9A 4GQAA 3RYTC 4KPUA 1VLLA 4RE5A 4P36A 5FWXA 3W3ZB 5F21A 4YMTA 2VUSA 2ZS8A 2ZSAA 3N7TA 2GK3A 4HGNA 4MKIA 5ALIA 4XCVA 4ZXFA 5M5BA 3L4KA 1JKMA 1GNLA 2B3TA 2IEYA 3DYBA 4FHZA 4UD6A 1V2HE 3THYB 3MFQA 4ECAA 3D8TA 4I9UA 4HDNA 1TM7E 2IX9A 2HU2A 2YY6A 5DEOA 5EYPB 3ZI0A 5T3UA 1T6ZA 3DGFC 2BGMA 1J9ZA 5LWHA 1DAEA 3U6KA 3QV1A 1DG3A 3ETNA 5JQWA 2ZI5A 3W6PA 1YK0A 1RJ9A 1P9NA 2F43A 1Z8DA 2VEOA 3HCDA 4IGFA 2VUIB 4NCJA 5D3QA 4IIVA 3PIRA 1FMTA 2OD9A 1U0EA 2DPMA 3EDQA 1SHKA 3QYAA 1VMIA 1YJCA 4HQNA 2Z43A 1G21E 4N9QA 5AT1A 4D9HA 3LY8A 1O95C 3WB1A 1UZAA 2ID7A 2OO5C 2QTVB 3IVXA 3MVEA 4OJTA 2EFGA 1Z7WA 4OJNA 1HZZA 4YWJA 1YB2A 4TKUB 4KFTA 4QRIA 1PW7A 3VH4A 3ZW7A 1FLAA 1QHXA 1VHWA 1KZ9A 3P0FA 2GK4A 4ZI7B 3RNLA 2MT9A 3HACA 2Q0QA 4G1UC 1PT5A 2RGEA 2QUJA 3W5HA 1G2PA 1ZRHA 2CHUA 4O3MA 1Y3IA 1GAXA 1NP7A 2WVAA 1IHDA 4TKZA 2DPGA 3QA3E 2FXIA 3KJEA 3TQHA 1XXHE 4GWKA 4B0OA 4AKSA 2FK7A 1CY2A 5M29A 4PC1A 4JU8A 1FTQA 4KIJA 5ALTA 1N5RA 4B4VA 4A2QA 4CDGA 3OZWA 4B2YA 3CUWA 1VFPA 4LTMA 2QTCA 2X58A 4UU7A 2C9DA 4QBTA 4WKNA 2P35A 4WCFB 4CFSA 4DE5A 4EJSA 5A1JA 2IY8A 4LI3X 3F3SA 2R4UA 3D4PA 1AS2A 4ZV9A 4N18A 5E2IA 4OLBA 1I9CA 1ZWLA 2CLIB 3L41A 1FW8A 5KKAA 4A6EA 1CS4C 1P4AA 2FZ5A 3EBPA 1MC5A 4JELA 5DNVA 1GSAA 1M6VA 2ZI7A 4L8WB 5DTRA 5H9VA 5IAKA 1SKQA 2APJA 1FNSA 3ZJUA 3P0IA 2P5TB 2VHXA 4ES6A 1H9CA 1EJBA 1W34A 2C2MA 1ZA1A 4H1UA 1GPMA 1YS9A 4S2EA 1XRJA 1SJ9A 3AKEA 1O5TA 4FYJA 5E7MA 2TMKA 4FDUA 5EGNA 4FMCB 4PU0A 4YXWA 1NNEA 3PCTA 1PJAA 3DZKA 3RJTA 5KX5A 4GKBA 4L27A 3Q40A 3TKLA 3QUSA 3KHTA 1LNZA 3B1VA 1UPAA 5AW8A 1VE6A 4B5KA 5HKKD 2EV9A 5FAKA 2O8EA 5BN4B 2RHRA 3OLZA 3NHUA 2IUSA 4H3HB 3CW9A 4BVJA 1M2VB 4AO7A 1ECBA 3HJTA 4J4HA 4LOAA 3B2EA 3MQ2A 5EIBC 1TJ4A 1MH9A 4X20A 4D0LB 2ZIFA 4LI0A 1J70A 5FI0B 1QE3A 3OAAA 5IJXA 3VZQA 4PGGA 1HFJA 4HZUA 1OHHD 3U1TA 1HQYE 2J9RA 3I32A 3B5IA 4DR3B 4X20B 3GEBA 2CD9A 1TUBA 2EYUA 3V2UA 3PC8C 1P45A 3OM1A 2YXBA 4QQRA 4U6QA 3GJQA 3NYWA 4H7PA 4ARZA 4DR2B 3PXUA 3L0DA 5CIQA 4IHKA 3C5CA 3ZK7A 3NUGA 1AK1A 1K6XA 2PX6A 3CLUC 1GDTA 1WCV1 1Y8AA 3LDGA 4FHGA 1OHHA 1M72A 1GCAA 1RQNA 3VTZA 3QRWA 8MHTA 1U5BA 1ZIPA 3QHAA 2QVYX 4HG2A 4UVGA 4ANFA 4EA6A 1GQOA 3FYTA 4LRQA 1FP2A 3REQA 2AOUB 2G0TA 3T5PA 1XU7A 2QVGA 4WZAA 4FT2A 5GP1A 2YV2A 1FFCA 1LNSA 2PKXA 4GLLA 5EE0A 3UN1A 4C0BA 3WNQA 4B3MB 1QAOA 5G02A 4EMBA 1Y9EA 3DFMA 4ZTUB 3VHXA 4LYHA 1XL0A 4IDPA 2OZEA 1COWA 3GQVA 5HKKA 1AZLA 2BISA 3OZDA 2FZEA 4UULA 1VSTA 2WHQA 3V4OA 5LD2B 5ECWA 4DCTA 1CZUA 4UCXA 3FKSD 3K4QA 4FNAA 2QRZA 3WLHA 3WLNA 3UBTA 1FK8A 2XTMA 1SG0A 2QM7A 5IDXA 3I2FA 1I94B 3CXUA 5A3RA 2PMFA 2QRLA 1A9RA 4P3KA 1G20E 4LYEA 3FHTA 4O4IA 4IS2A 1TAQA 1OJLA 2Z9CA 5BWLA 1MB3A 5E6SB 2XODA 1CDZA 5ILGA 5KSZA 5SYAA 3WX0A 2NZUG 4Z7OB 5I9LA 5WRFA 5KKCA 1KEVA 4YRLA 1ZGHA 4RK4A 3ABRB 3LDHA 2PLAA 5TQJA 3NRCA 4PO9A 1S3FA 2PSSA 1E0KA 3EZXA 1U8UA 4YRJA 1Z5PA 1YMUA 4K6OA 3SHWA 3HH8A 2NZWA 4ESVA 1MV8A 1US8A 3L1VA 4B2LA 3D6UA 3FYUA 5HQJA 2IWHA 3Q4GA 2QMQA 1EX1A 1JJ7A 5I6DA 5L53A 1T9AA 1SBHA 1EIWA 5JZ9A 1FS4A 1GPDG 4FWBA 2WZCA 4LBVA 3KSZO 5ALVA 4X84A 3TSAA 2AC2A 3ASUA 3AR9A 4Z8XA 2Q3EA 4DJ5X 4C30A 3EXHA 3EEBA 3ZJTA 2CDAA 2PGLA 4B48A 3DE1X 3K7EA 2NUTA 4KQ2A 1P9WA 3DS8A 2ZTVA 1TQHA 2IZ1A 4LRSB 3CBGA 1GPYA 4BZWA 4CMEC 2XB8A 4YBZA 5BNTA 3K9FC 4BDSA 3IAS1 2IYXA 5GGYA 1N0HA 5FUBA 3TUJC 2QT0A 4BL5A 2QSYA 1AF7A 2YUIA 2XBUA 4OQNA 3W79A 4YRBA 2HR1A 1BEEA 1P17A 1XRNA 3JYHA 2FQWA 421PA 5SV2A 4FZJA 2QS9A 2DX7A 4R2XA 4UPEA 1NJ5A 3EVTA 2YDYA 3GA5A 3IP5A 3OTHA 3L7AA 4X1YB 2EKDA 4HVAA 3Q7RA 1RZ3A 2OGUA 2GRJA 1JEJA 1CWUA 2LRHA 3LT1A 1E69A 4IDBA 4QUJA 1VCOA 2HMUA 3R0QA 3OU6A 1RYMA 1XO1A 3OIYA 2YWCA 3BWYA 4L4SA 4ZI7F 1TQ6A 4RMNA 4Y9DA 4TTIA 2GXSA 3E7DA 3FPHA 5FLXA 5JARA 1JXAA 3JTMA 1RT9A 2Q6IA 1D7AA 1ORRA 4HRAA 3ECAA 5KYYB 2JCBA 1YOVA 3BCUA 3V00A 2E49A 5THXA 2VEDA 3SMQA 1V48A 5E8JA 3DV0B 1TJ5A 2P0AA 1LJUA 1O96A 5ALZA 5A3VA 5BQOA 4M36A 2QR5A 4CL0A 4EY3A 1XA4A 2QLJA 4ACAA 4ZZIA 1XR3A 1CRQA 4EVSA 3JYNA 4KI0A 4C7JA 1RQRA 5K1ZA 2Q8NA 5IDVA 3K16A 2ZJ5A 3IDQA 4NCIA 4YCAA 4ZT5A 3OTGA 2F4NA 1AKVA 3KQSA 3ZY3A 4ZMRA 5LUAA 4PYOA 4YDSA 4E1BA 2YYSA 4PQEA 4PFJA 1U9YA 2VK1A 2JJ2D 1JUDA 2ATIA 1PR2A 4PHGA 5EE3A 2NLOA 4O4HB 3WK9A 1JEOA 5IMBA 3DP7A 5BYAA 1CY6A 2R1VB 4U39A 5I7OA 1XZQA 3WFIA 1Y33E 3H9GA 4GMKA 1L5VA 2AHOA 4N76A 2A9KA 1XFDA 2PUDA 3MXTA 1A9ZA 4CLHA 5DLEA 3F90A 2WJPA 3DUFB 3HJRA 3NYIA 4Q9NA 5FYQA 4LGYA 3R9IA 5TMPA 4NHEA 7YASA 2DY0A 5KPDA 2IVFA 4WD3A 1BYUA 1EP9A 3KQVA 5KNBA 1JFRA 4B0PA 3R76A 2PWAA 3UAVA 2PKQP 1SCJA 4OF4A 1TYZA 3LWZA 5ALYA 5L51A 2IS1A 4L4YA 3OIVA 4ZRMA 4BO8A 1B74A 4C08A 2OV6A 3ET5A 3HPRA 4EL5A 2LGJA 4CKCA 1TKBA 4IQGA 5HIKA 3JAKA 1P75A 3OWOA 4GXRA 4IR7A 1DGQA 4CETA 3VPSA 5EYPA 3WYBA 3ZI7A 1QDEA 3OE7D 1JI0A 1P29A 5LOVA 1YRBA 2EZ9A 4YTEA 1WDLA 4XPZA 4B46A 1YTUA 4MCIA 1EP2B 1RJFA 3BK1A 3A1DA 5L4LA 2GDJA 3MGKA 2WUEA 3A9SA 5I47A 1SA0A 3K70D 4OPMA 3WSTA 1PJ3A 1Y1KE 4ZT2A 1O97D 1UADA 2ABWA 2HCJB 4K9PA 4RLQA 5I7FA 4WLFA 3VX4A 3UHPA 3RS7A 2MINA 2X86A 1ZN7A 2VTKA 2Y99A 3FSJX 4YV1A 1CJMA 1LLFA 1Q2UA 2HRQA 2NWQA 3FWPA 3LKZA 1Y4UA 4NZPA 5TARA 3H9BA 2JLUA 3ENWA 3ESRA 4N39A 4YP0A 3GJ6A 3X2EA 4ETNA 3DOFA 4PG7A 2O9JA 4YJKA 1OA1A 3WY9A 5LJLA 3T3PB 1DKQA 1OLUB 4HOYA 3MF4A 2W2OA 4IMIB 4NVRA 1AZSC 2IV2X 3S1AA 2I1LA 2RHJA 3DMHA 2FFJA 3HYCA 1QTNA 3P9CA 4BLPA 4PHFA 3F4LA 4MEJA 1E3LA 3I45A 5EWJA 3CPEA 2QD1A 2FN3A 3WGLA 3TUZC 2R66A 2D1RA 1IK4A 3CX3A 1CEQA 2JZCA 2OD7A 1I7PA 1RC1A 2AFVA 3KOXA 3MLBA 1WHTB 2RK3A 2SKCA 3TCKA 3I5YA 4MUAA 3CLSD 1E1QA 1XSEA 3I9KA 1NQTA 1DP4A 4DGQA 2GVNA 3RBAA 4IZHA 2CLKB 2A5GA 1XWFA 1RXCA 1X7HA 3P8ZA 4Y6PA 2ZIVB 3ZLJA 2QW1A 4M87A 5A9SA 3P0EA 3QWIA 3SICE 4RTKA 1N6IA 2KJQA 3OD1A 4I19A 4GSLA 1I4DD 3IP9A 2Y1XA 3U7EB 4AMBA 5KKNB 1W29A 5BR7A 3NVKI 2Z83A 3NYQA 1ZUNA 1Z83A 4UU0A 1CQZA 1D2CA 4AYXA 3GFFA 2RK4A 1R27A 2YJ4A 2R8OA 2A7XA 1XVIA 2YQZA 1NATA 1H69A 2F8MA 1O7JA 3I6BA 1OZGA 3PNBA 4LZZA 5LA6A 4DJEC 5H9WA 1KYTA 3AZOA 2ADOA 3A6FA 3EZ9A 2NNLD 4JJKA 1YE5A 4BB0A 1SZPA 2WK1A 4EP1A 3EIFA 2B0CA 1MXFA 1OXMA 1DUVG 1SC6A 4CHTA 3A4YA 3D6HA 4GL4A 2VATA 4M60A 5DK6A 4NIMA 4RABA 3B70A 4MR9B 4FTWA 3AHCA 1Z13A 3KB8A 4A8TA 1GYRA 3FLMA 3PXBA 1F0YA 1CLUA 2IEIA 3TLKA 3DHYA 4GPEA 5CT6A 2G28A 4PNPA 3EX7C 3QX3A 2F3QA 3CY6A 5G4KA 4BLVA 2X42A 1O97C 4CVNA 2VJNA 4LTDA 4WJZA 4F96A 4D02A 1IHYA 2DQ4A 3JD2A 4H0NA 4LVUA 3BMQB 4OHUA 4WESA 2GJKA 2C20A 3A28A 4D98A 1G291 1IEVA 4H7JA 3ICEA 3CZCA 3LT2A 2WJ3A 1PNRA 1WZUA 3F9IA 3VR2D 4WKOA 2EU8A 3UJ3X 3ZUPA 4F7DA 2JIMA 5AW4A 1T5BA 1E1RA 1W30A 3PJFA 1DIBA 4HLCA 3SOPA 4CM3A 5KWSA 4WZBA 3TG2A 3PL1A 4BVEA 4TXJA 4JXKA 2OYCA 1YZNA 5CLJA 1CJKC 2BGWA 2OCXA 2REQB 3EW9A 1JWLA 4IVPA 5LQJA 3B52X 1Y1QA 3C7DB 2IWRA 1Q16A 2RGXA 4RA6B 3CWQA 1A9PA 3D7RA 5A5EA 1JKFA 1ZI6A 2ZRMA 4JL5A 1TIBA 3AERA 4J1NA 4CR8A 5AVTA 2WD7B 2WWYA 5LB2A 5JVDB 4LXXA 5L7YA 2QTAA 2R8RA 4TKVA 2X7XA 1FYVA 4XX0A 1ZK3A 3LT5A 4H7HA 1DIGA 2JFZA 3AERB 4MPDA 1N8TA 4O25A 5FPPA 5H5JA 1QIHA 4TXLA 2PKWA 2WIFA 3OZVA 4CQMD 4U8GA 1D1TA 2AK3A 2R9VA 2XDWA 1FZTA 1L7PA 1UUFA 1X2BA 4BFXA 1TO6A 1J9EA 1G7CA 3KBBA 5G40A 4ACBA 4EUHA 4Z9XA 4CR7A 3LQYA 4M9XA 2PIDA 4RTOA 4JI3B 5EWMB 1LA2A 2BHTA 5ICFA 3R6LA 3NHWA 4J16A 4S1TA 4EGCB 5IU6A 1XD2A 4HYTA 4LZAA 2PUHA 4O4LA 3S0JA 2BGGA 3EC1A 1P7PA 1UT6A 2AFRA 3CSSA 2GLTA 3M6MD 3DO5A 2GJAA 5ALLA 4M1QA 1XJQA 5A71A 4J7CA 1QQ5A 3K30A 1CDOA 3QHPA 2I3GA 3OESA 4BFCA 4DV1B 3BXHA 1QG2A 5DP1A 2H18A 3OQIB 5EFZA 3NNDA 3ZYZA 1H6BA 2CCKA 2V7QD 3SM9A 4LNHA 4GGMX 4KSYA 4QT4A 3DEIA 2BFNA 4HZUB 1UC5B 5CUQA 3A1SA 4RD0A 2XQVA 4F2HA 3UAOA 2D7DA 2NAFA 1GPNA 1KFKB 4XGQA 1DUSA 1AK9A 1W25A 3F7OA 1IUPA 2AS0A 3KKLA 3PTZA 2IUFA 1FDRA 4H77A 4ZT3A 2NADA 4BIIA 1GQRA 1VA5A 3SN6A 2EKPA 3EVGA 3S2FA 2XQJA 3CVVA 1S9DA 1XVLA 3I04A 1KEEB 1L5QA 2DPLA 4QAJA 2WPNA 1O9GA 2J45A 1T4BA 4IF6A 3HEBA 2R8XA 1ACJA 6GPBA 1KDRA 3DCNA 1LK7A 1S8FA 1G8JA 3FX2A 3G2QA 3OM8A 3TTSA 1PJLA 1SAYA 2PUJA 2QXUA 3LHDA 4WDQA 1Z5ZA 4L22A 5EP3A 1SXQA 3PYLA 2JJ1A 4UZFA 5GONF 4TSFA 3WMXA 4CFYA 3COJA 3AVTA 2PS0A 4AZ3B 2HLNA 4D9GA 4MWBA 1PZMA 3I23A 3IT2A 3B3GA 3GG2A 1ZI8A 2BHLA 1GDHA 4IUCS 2MSEB 2Z95A 3DV0A 2NU7A 4G0PA 2YFQA 3S5JA 4DV6B 2I0FA 2RGAA 2ODQA 4ZODA 1S9HA 1HRDA 1G9TA 1XTBA 4MV1A 1P3DA 1A2OA 1JTVA 2Y05A 3OEHA 5JDIA 1ZNQO 5F9FA 2VBCA 2L69A 3JQAB 1VYUA 1FFBA 4J7AA 1F9AA 1C3XA 5BWOA 5AMXA 1IG3A 1SOUA 3MM4A 3ZWQA 3V32A 4XQGA 2OK8A 1USIA 4LJKA 2CE2X 2X0DA 1J2UA 1SOVA 4XVRA 1JXMA 3H5VA 4HPWA 1XZCA 2QUHA 5I9NA 4V0OA 1NQOA 3V55A 4RMHA 1Z0KA 3R0IA 5LP6B 2QF7A 4DV5B 2C7OA 1JWBB 1W93A 1Z29A 2IKQA 3DBHB 1ADBA 1F4PA 2CMFA 4OTZA 4RO0A 3T12A 1ZSNA 2IH5A 4TXNA 1UPCA 5BURA 3OPMA 4B6PA 2YNMC 4GS5A 4LE2A 4X7BA 2AB0A 1LC3A 1HLDA 4Z1OA 2VZEA 1L8LA 5IULC 2J0SA 5LNK1 4S1PA 4MQFB 3DOUA 4IIJF 3FDZA 4QXRA 1EVIA 3H2IA 1XRLA 1QFZA 5A5DA 4MV0A 4BC0A 2HNAA 2ZIWB 1CEYA 3AIOA 3KXIA 1KJYA 3INGA 2H2IA 3L04A 3PD0A 4HLDA 2HWKA 4N6OA 1SMKA 5E1OA 3R7FA 3PC2A 1NY6A 3FWNA 2VTBA 2ZM5A 1XDDA 3Q9UA 2G76A 4RHXA 4FFBA 3I9OA 1BVRA 1WNTA 3OKAA 1VPLA 1KMMA 2IY7A 3N75A 3FPKA 1NVFA 3LQ4A 1EVZA 3IO5A 2WSLA 4HYEA 4E1AA 3VJRA 2HK6A 1ZUWA 2OILA 3BRWD 3EBLA 2ZB2A 3ODPA 3SR4A 1PFYA 3T7TA 4GOOD 4C7MA 4K5QA 2A1TS 3MW8A 1E1CA 2WTUA 3U13A 1L7QA 1YIOA 2P1RA 4P0PB 3VVMA 2XBMA 2G1AA 1NOJA 5IAGA 2PAAA 2KM1A 2O48X 1G42A 1SXJD 4QPDA 1FS6A 1K6IA 1JHXA 1PSDA 2J7PA 2NO1A 4BGIA 2CL6X 1F2UA 4I1OA 4BFVA 4Q4JB 1XZIA 3DVAA 1MCZA 2YJ5A 3H3XA 4JSTA 1CX9B 1QAMA 3QUAA 1LQTA 1TC1A 1BDIA 1LRKA 1F7VA 2E5WA 4RH3A 3A6PC 2O8BA 2YIMA 4LKOA 3SFTA 4P3OA 4U7WA 3IUSA 5EZSA 1QS0A 2JH9A 3DCJA 3AL0C 4NNJA 1F0NA 2CNNA 3E1SA 5EESA 2NUBA 5EXDA 2FPXA 2XRMA 1FZQA 4WV3A 1J1UA 3AB8A 4JLNA 5EJ7A 1HV8A 2WINI 1LBHA 2EJVA 4LHZA 2XUOA 3KUUA 3PGVA 5JH7A 5D2CA 2HDHA 3KCNA 5GOTA 4DA7A 5MHTA 3I52A 3CX8A 4QLAA 4R31A 4G4JA 3DMDA 3J7AC 5B12A 4ZQFA 1E7MA 2YYZA 2O7RA 2OO5A 1FFWA 1IHUA 3LIPA 2X9VA 2B1GA 1L5HA 3UNXA 1SO8A 3GEIA 4F2WA 4ZYXA 3LUFA 3V9AA 7MHTA 1OIWA 1AGPA 3T0GA 1O9BA 3ROGA 2F3TA 1D03A 1H2HA 4TS1A 5FBQB 5G1OA 2HGSA 4MMXB 5EMKA 4R05A 2BFFB 1SCBA 1WPQA 4UEQA 3IA7A 4KIGA 4DARA 1G5HA 2WC1A 3F8SA 3D0OA 3NM6B 4NBSA 3I5MA 1QIMA 2YN0A 3T95A 4E12A 3THYA 5CX4A 1TCVA 3BICA 1W581 3GYBA 4OFZA 2XHZA 5DI9A 1GGEA 2P2CA 3RAEC 4JYAB 2YNMD 3VU3A 2JGEA 1JDPA 3CF6R 3L6BA 5AVUA 1SCNE 2J30A 5HRUA 1VKHA 4Z0PA 1L7RA 2GXUA 5T6MA 1DRWA 2BBWA 5BO5A 2G4CA 3FPCA 5AXCA 3TRFA 3U4MA 4I4TA 3FGPA 4TS4A 3GVCA 3L4JA 2VR1A 4CGZA 2VOJA 3LC2O 4FSDA 5DN6A 1BW9A 3IHKA 5E38A 1GPWB 5BV1A 5JS1A 2Y1FA 5F3DA 1JEEA 3ANXA 2GILA 4BLQA 1X13A 1NNSA 4GKVA 2GM4A 1CUHA 2BVNA 5J1SB 3FUVA 2GCGA 4F12A 2A58A 3FWYA 1MRZA 2NVUB 2O6LA 3PKZA 3WADA 1LWOA 1TI7A 1ZS9A 2C92A 2VQ3A 3DR3A 4QWMA 1KK2A 3GFSA 3GT0A 4XYEA 3HS3A 4LA4A 3UHFA 4DQ0A 1NBAA 3X2FA 3ZHOA 3PGMA 3TI9A 1RPZA 1P6XA 3EXIB 4MYCA 4NMLA 5IAJA 4NCAA 1K27A 3NALA 5DNWA 3W1EA 2L82A 2K2WA 3H9JA 4OQZA 3QGMA 4RPIA 1A2QA 4DLAA 5B2FA 4BGUA 1ZA2A 4KQEA 3Q0TA 4N5LA 5EJ2A 4ENPA 1O9HA 2GN6A 5E2AA 5DTMA 1M5UA 1VG9B 4ZO9A 5FUMA 1TKCA 1NR5A 3C14C 3E5NA 2EFEB 1YRWA 2HMVA 4WHMA 4TT3A 2QBYB 1T4GA 4X0EA 1TNDA 2C4WA 4IJ6A 1GPUA 3C8MA 1VBKA 2YJNA 3FJ1A 4FGUA 4C7XA 2V03A 1T1SA 2QE6A 2J3HA 3NHBA 4MRNA 4LF9B 1PO7A 3GJ4A 5AW2A 2DCMA 1Z28A 3LBYA 4WVLA 1VIAA 3LZCA 4D81A 3V1YA 2ZSJA 3GO4A 3DDCA 2CNLA 3B7PA 4TZ0A 1S3SA 4FCTA 4LOHA 3D6AA 2ONKA 2WJ6A 3OQJA 1YKFA 3UW3A 4LTNA 5JFGA 1GNSA 1ACLA 4II2A 5LQCA 4HNRA 4P3NA 1SRRA 1NMXA 4R9SA 1ZL2A 3PPVA 1G5RA 4R9VA 4YRCA 5DHUA 1C1YA 2HPZA 3NKLA 4TWIA 4HR7A 4MIOA 3RI3A 2A57A 2D5AA 4XPIA 3RC7A 4C0HA 4J03A 1RHKA 4ABYA 1DARA 3PQEA 1JHZA 1QVVA 6ADHA 1WMFA 1W19A 1IH8A 3CH4B 5BV2P 4DMLA 4BTVA 2NU8B 2IOFK 4B6OA 3V8RA 4I50F 3ZEIA 2ZWAA 1RYNA 3ACCA 4R1UA 4YJHA 5AR1A 4QVIA 4KHPB 1P2FA 1M0EA 4S1OA 1T36B 2MR6A 1T1GA 3WJAA 1TQ4A 5BORA 3I2YX 4YRTA 3IEVA 1SQ6A 3O1HB 4D5GA 3IOYA 5CLHA 2FRDA 2SCUA 2ZVDA 5A05A 4F06A 3IVCA 3PUHA 2HDOA 4QODA 3PHLA 4CIAA 2HEIA 2D59A 1FE8A 4WCVA 1XVVA 3EIOA 3F5FA 1U2RA 3X1MA 4GSYA 4GAEA 5C1PA 4I08A 4GD3Q 4PBTA 4O5OA 4UUAA 5AKEA 3HL0A 1QF6A 2JGNA 3CZRA 3MEQA 3HO8A 4ZV7A 2YL2A 4EW2A 4LCJA 1SUPA 1ETUA 1XZKA 3BSFA 4OBBA 5JSUA 1VKNA 1C2YA 1MVLA 2Z0MA 1UT5A 1VHJA 2O2GA 3G8YA 3QV2A 3JQQA 2VJDA 3LY7A 3OOWA 4UW9A 2VF2A 2VWGA 4B8YA 1J07A 1R3UA 4E11A 1VXRA 2FG6C 4A6PA 1TEXA 3D6TB 3TFQA 1B3RA 4A82A 3TM5A 4KQFA 3PXCX 4GGPA 1TVMA 3N0TA 4KW7A 5C1IA 1V71A 3WSVA 3C3WA 3TTVA 5IHPA 4JDUA 1JFSA 3UTCA 5CA1A 1I4EB 2C31A 4FW9A 1EBFA 3IIEA 1MO5A 1H85A 1MX5A 2WB4A 3PYXA 2HRBA 1DAFA 3SZOA 3PHIA 1E1QD 1HFWA 4OG2A 3WYFA 5IYZF 4EY7A 2FVXA 2PNJA 1NNI1 4RW0A 3QEKA 4JL8A 4RVNA 3UOWA 2N1BA 3VR5D 1NQWA 4GNKA 3VZRA 1SK9A 4F1WA 5IANA 5K0SA 3PX3A 4H7FA 4UPVA 4A15A 2PL3A 1RMTA 1U98A 5FKJA 1W0JA 4YBRA 4K87A 1G5PA 3ENKA 2P9EA 1D6NA 3VR6H 2NUTB 1TTHA 3KZKA 3DM5A 4H17A 1QQ6A 4RX1A 3RU9A 5CITA 3THWB 4GYJA 1NUUA 2QE7A 3FDZB 2PSJA 4FONA 4BO2A 1DJPA 3G9ZA 3WRXA 3EAGA 2VDPB 1Z17A 3AR7A 4CUJA 4DDHA 3SBEA 2YY5A 3NDRA 4IG9A 1LVUA 3NPMA 3H13A 4JUDX 3I9V1 3AVOA 3O31A 2C4TA 5BV7A 2VA8A 3PG5A 4OK5A 5J2TB 3HPQA 3EVDA 3EPHA 3G6WA 2VHVA 4NXNB 4AMGA 1VKJA 3QZUA 1Z18A 2JH3A 2I2BA 3BS4A 4KXMA 3QK7A 3HY3A 1RI5A 3CVUA 5AHWA 1FP7A 1BX0A 2HHLA 2RHTA 2RE8A 2JASA 3E2MA 4OLFA 4IHJB 1YQUA 2R25B 3ZHBA 4EELA 4A3SA 1DFGA 2W4IA 4EA8A 1DV1A 1MD9A 4JP8A 1WCXA 2CFOA 2I6XA 4PSUA 4ZQIA 1VIMA 2SNIE 3L7CA 3V7FA 3AU8A 5F1PA 1SBNE 1DQSA 5C4IA 2BKAA 3ORYA 4OH1A 2GZAA 1I6MA 3PPYA 3GGJA 3G2OA 2HHHB 3VA7A 1HTWA 4UFNA 3O8OB 2F67A 4COKA 2GFIA 1UEXC 3HEMA 4AP6A 1ISFA 1Y0BA 1WB4A 1KFJB 4OHWA 3FOFC 1XNRB 1TUGA 4NZNA 5DYIA 3X44A 1HWYA 1UKVY 1EHCA 1E2GA 5GJVC 5MDHA 3VKGA 5COAA 2QMZA 3C39A 3NBZC 3BWCA 4ZDWA 1EXWA 2YYYA 4WCFA 5KAPA 4EJSB 3QTTA 3BXFA 2ZBPA 2O8DA 4FYWA 4ZV4A 2QHXA 3AUAA 3VOBA 4EABA 4ILKA 4ESOA 3BPSA 3OCUA 3CVJA 3ET4A 4HTAA 4ZICA 4JI0B 2AN3A 5BSVA 1IUKA 1GUDA 5FR2A 1JG7A 2RGRA 4YRPA 1V3TA 1H9AA 1ZVQA 2HFKA 3JALA 5G3YA 4Y6LA 1E7SA 1Y8QB 3HKEA 3CLRC 5IBCA 1HURA 4HNAA 3RRYA 4HQ0A 3VNVA 4UTRA 4DSTA 2I65A 2PL1A 1KZGB 1D5CA 4FFSA 4N49A 2PJUA 4QU8A 3W5VA 1VLQA 2P2GA 4IOLA 2R11A 5IVIA 1JLLA 4RK6A 3QBVA 4EFLA 1V95A 1VCIA 1NN5A 3WGTA 3NOOA 1BWPA 1M34A 4FUQA 3CRNA 4XOUA 5CT5A 2HSEA 3LPNA 1W36C 4PN7A 2F1JA 2IYNA 2HXYA 3RODA 1J2JA 1SFRA 1KEWA 3AHFA 2QMOA 3H84A 1AQLA 3AHIA 1DBPA 3P2OA 1TJ3A 1RWMA 2OG1A 1W47A 4IL5A 3LAWA 1ODSA 2CVOA 5HP4A 1OFUX 1AQIA 1R8JA 2P1ZA 3WIUA 1O94A 5BVHB 1Z4PX 3A4NA 3CTMA 4JT8A 5FF9A 2QV7A 1ZSYA 2ZB8A 5ELXA 3HB4X 5FV4A 1JBEA 1H1DA 1T5TA 3PHGA 4DJDC 3M5PA 3DHWC 1T8TA 4S1NA 1FJ2A 1YRLA 2J5RA 3OX2A 2BTEA 5BW5A 2PZLA 2IW3A 2Z4TA 3A8TA 5CYPA 3IX7A 3W05A 3IV7A 1ZW6A 5L40A 3TGWA 4I4TF 3G7UA 2HJ9A 4PFQA 4MOWA 4YT4A 5EJMA 1O0BA 1JEQB 1T9KA 3D8SA 1A9TA 1TA4A 3C0KA 3IFSA 3RYIA 4PGMA 2PZBA 2M1XA 2V58A 4FFNA 5I9BA 4JUFA 2YJGA 4I8IA 1X74A 2PXAA 4IDHA 3U3MA 4I1VA 4KQCA 4YRSA 3DEZA 5FT9A 2I2AA 4MDEA 3EMDA 3NGLA 4J0HA 4N8EA 1A50B 2JCYA 4ZC8A 3RLFA 2FF7A 4K8RB 4FK8A 2GUGA 4M0KA 1OWLA 2F2TA 4HDMA 3A06A 1ZIOA 1PJRA 5GY7A 4IJKA 3UEOA 4CKWA 4EG0A 1IRXA 4XX0B 3H87A 5B5SA 2ZBGA 4ZFNA 1TU4A 1U3TA 3FKJA 1MW8X 1QK3A 4P4GA 3A27A 1Z4QA 5GM1A 2GI4A 2W2KB 4PLTA 2HWUA 5BMVF 4O4JA 9MHTA 5B53A 3IUEA 2ZETA 4OHXA 4Y9UA 4JBGA 3BBPA 3G49A 4E4RA 1JFFA 4MGKR 2GK6A 4UCWA 4P8RA 2VDNB 3OFSA 5P21A 4BGDA 1KE2A 4DBLE 2HA7A 1T6BY 4CMBA 4RGVA 5JI2E 3EGDB 4EDFA 4JFAA 4QOSA 4AMVA 3PQ7A 2DLDA 4ZEOA 3VOTA 4Z4EA 1HDZA 1NE2A 1HDXA 1F0KA 5EUCA 3U7RA 5JSKA 3E22B 3PNMA 3Q9LA 2HNBA 4Z53A 2WU3A 3HDHA 3KSBC 4RGYA 3LA6A 3U5TA 2MSCB 3LUJA 4BZZA 4UAJA 3E0QA 4YVFA 5ERYA 1E58A 5FBKA 4YRFA 3IUMA 1UM9A 1YKSA 3LWNA 4PTZA 3PUJA 1U7PA 1NRWA 2PWBA 5TV2A 3WWOA 1A98A 4HFJA 5ULLA 5JZBA 1PTKA 1XEWY 2E4XA 2VJBA 4HNGA 1HEIA 4YP6A 3STYA 5JSQA 2V74B 3DVQX 3FZEA 4E2YA 1KYQA 4LC0A 3CN9A 1JE0A 5AIAA 1RLIA 4OKNA 1LX6A 2B92A 1XV5A 3EH1A 1SWVA 1Y9AA 4ZVKA 4G3XA 1X77A 3VNAA 4KR7A 5G4KB 4J3NA 4HBZA 1R6BX 4L5YA 2V7TA 2WIDA 1IZ0A 2J4CA 2XZDA 3SI7A 1ONOA 1S2MA 3AI7A 2PBFA 3N7UA 3I4LA 1N5OX 2REXB 2AKAB 3CJTA 5EMHA 1FQOA 4QJ3A 4GX1A 3A0RB 4D57A 3AONB 1BOFA 1C9KA 1KZ6A 1T0HB 4KV9A 5EXPA 5EHZA 4M1YA 1ZMXA 1KU6A 5C32A 5HS4A 5DTEA 1GITA 1Q3HA 1NVKA 3KR1A 2QAJA 3ND6A 1N25A 1EVLA 3RLIA 2IXBA 2G82A 3T06B 4DFDA 5IXSA 1IRIA 1VMAA 2QEQA 1GARA 4ALKA 3AM3A 4Q34A 4RTRA 1BDJA 1W35A 4ID9A 3L4BC 1SUFA 4G2TA 1C9MA 2I7TA 1DEKA 2DGDA 2GBIA 1SBIA 2W2LD 4PC6A 1M5RA 3ZHZA 1MEEA 4QNMA 3FYUC 4HX2A 3DFIA 4QYMA 2IA5A 5LIPA 2HO4A 3EQZA 5B1DA 4BKRA 3M4XA 2D3WA 3C16C 1Q1AA 4US0R 2OXRA 1R4MB 3RQSA 1WB9A 3S27A 4HLUC 3PUXA 4MO9A 2R7NA 4HGRA 2Y66A 4NFYA 5D84A 4W99A 2DSNA 2XWQA 1CVIA 1T2CA 1Y6QA 3FSRA 3G85A 4G5RA 4HYYA 2GT1A 3DVSX 4MEBA 5DHSA 4F3YA 4OHFA 5I51A 1NU6A 3FPJA 5B58T 1SEPA 3PI7A 1DC8A 3TB4A 1TM5E 1EE9A 1X3LA 2HX1A 2QLBA 2UZAA 3DT6A 5KWIA 2PSEA 1LDYA 3DFUA 1AHHA 1MVNA 3E3MA 5E6SA 3WRWA 2W2NA 4PYJA 2BL4A 5HJEA 4OL0A 2WUDA 4AJ9A 4DG5A 2JZOA 1DCMA 4FDMA 4C78A 4W63A 2V45A 4C29A 2OPBA 1ZKMA 3WSWA 2H63A 5FUWA 4GVPA 1N92A 2FLKA 2AXEA 4EBBA 3EUWA 5B3LA 4MHOA 4YP1A 5JISA 1LUAA 1X9HA 1DJMA 5JJKA 1E4OA 2EBFX 3DMRA 1LPSA 1Q22A 3LW8A 3OJ0A 4JJ7A 3T4PA 4U0KA 3IQIX 1Q7CA 3QF7A 4KJZA 4D9CA 2OFOA 3IMEA 3JQDA 2FLWA 2B1RA 4GPIB 4JI2B 1KZ4A 2QRGA 2O2XA 4INZA 4NV1A 4JIGA 2O2YA 1XTPA 3F97A 2HH9A 2E3JA 3IAHA 5HCNA 4CDMA 4JB8A 4DBVO 5I4KA 1ZDMA 1PGJA 1WCWA 4BQSA 2SECE 1ENOA 3ZV7A 2OHVA 2GZ2A 1OFIA 4IV5A 3AJEA 4ZOQI 2VYQA 4WKCA 5EIHA 3ZGVA 2F8SA 3X1XA 2XD4A 3GJXC 1M7BA 4A8PA 4OU4A 3C24A 3OQVA 4YROA 5K0LA 4LDAA 2ILTA 1R0XA 5A7FA 1G8AA 1KDVA 2VHTA 1XZFA 1BGWA 2VDRB 2VH5R 5HPYB 3KETA 2ZBFA 3L6CA 1EMDA 4QEDA 3GDFA 4YJHB 4ENQA 4JYZA 1H8EA 2V54A 2AOTB 2GD2A 4HDCA 1XI2A 2VH2A 1GN9A 3N8GA 1UBMS 3IS3A 2QU8A 3QBTA 3O8BA 4YLYA 3I8OA 2OYRA 1MP0A 1EUQA 4CV2A 2YHIB 2ZYGA 2F3SA 2ID4A 2IZ5A 2RAUA 2VPYA 2R86A 3QKUA 4CMEA 5BMOA 1E98A 4EGSA 3R9XB 4HGQA 1B16A 5EZYB 3AP1A 3ESQA 2IOFA 1DOZA 5C46F 4MQ6A 3MAGA 3RSQA 4PY2A 3KU1A 1YQ9A 3CR3C 4HEHA 4HTFA 1LDGA 4QU5A 4TM8A 4OX9B 1PVOA 2H1LA 4XTCS 4Q0MA 1EFHA 4JEMA 4KH1A 3A1TA 2HPHA 3QOWA 2WMYA 3MZ0A 4TUYF 5BR8B 2VF7A 5HUQA 2RH5A 4GMXA 1GXSB 3DMNA 3IBCA 1IEQA 3EGVA 3WGOA 3P0HA 4JLSA 3K1YA 4MI6A 4PWZA 3RG8A 2IYTA 4IG4A 2DERA 2XMBA 1PR5A 1VG0B 2O1XA 2Q62A 3P5SA 4YCMA 1V5WA 2P6NA 3O8QB 1KR5A 3CNLA 1KEUA 4P7KA 2NGRA 1HPLA 1LTKA 1BDHA 2NZYA 2EIHA 2X23A 3AJ8A 4LBZA 4KN5A 4RWEA 3TQRA 1Z4NA 4K9RA 4LBWA 2O1WA 1FSSA 2PKQO 2IYLD 4ER5A 3RYCA 1JKJA 3H1PA 1U4SA 1PZEA 1WUTA 4NOLA 2DR0A 1LI4A 2ZJBA 3FR7A 3MHPA 5AM3A 5FEUA 3HXQA 1MJFA 4AF7A 1Q7EA 2XNHA 2GN9A 2V4ZA 1Z63A 4D26A 3VZPA 1V8DA 1WMBA 2FN7A 2JDIA 4ZK2A 4OI0A 4FNGA 4Y0VA 5AW5A 3WJ2A 5FOXA 2QW0X 3GHHA 2CNDA 4B7XA 3OO0A 3KAQA 1C7EA 1QHHA 1CUUA 1DNPA 3JAKB 1C4OA 4JQZA 3WDKA 3OEEA 2AX3A 4AX4A 3AVXA 3FDJA 2QYTA 3GQBB 4XRRA 1TD1A 2C7BA 1JB1A 3IQXA 3OJEA 4RDIA 1K4MA 4RZUA 1SUWA 1N75A 3E2IA 4WLNA 5FLKA 1M34E 1X0VA 4RV4A 2R79A 2R8EA 3FMFA 4CR6A 1XCBA 2R3SA 3RS4A 1RAEA 1OWOA 3GF4A 4K9SA 3U4DA 3OQ6A 4CEIA 1PIWA 1RKXA 2XCSB 5D3ZA 5AVQA 1JG2A 2JK0A 4V2UA 2P79A 2N47A 3V2GA 2YC4C 5C8YF 2P75A 3DWIA 3PTLA 1HE2A 2ZP1A 2M1ZA 1L4GA 4JJEA 1ZQ9A 2BGUA 3F67A 1GTG1 3IR6A 3NS7A 3V4VB 4Q4CA 2QTMA 3Q7QA 5EIOA 4I5EA 3PDIB 4RD4A 2YV3A 3LRPA 4CN9A 1QM5A 1Y7PA 2X1MA 2Y27A 2VRWA 1KF0A 1GTL1 3DEFA 3B1ZA 3MJCA 3Q6MA 1F5NA 4EG8A 3BD6A 3IH5A 4PO3X 2NTEA 1ZLYA 3U1BA 1QP0A 4TZTA 3K6SA 1AUOA 5T8KC 4ZDJA 2BDEA 2XT6A 1X2EA 3JSAA 4MS3B 5JTUA 2J3DA 4W9RA 2BFPA 1EFKA 2D6FA 1RJDA 1P1JA 1IG0A 3M6FA 2FWPA 3NWJA 3AR6A 1AU9A 1SELA 5HDBB 2EAUA 3CKLA 1ZNYA 2WABA 1PLKA 2PVPA 4XFKA 5EIFA 2PUEA 4LGMA 4UHKA 3VPXA 3W7AA 3KTOA 1R10A 2QOEA 3KXLA 4WK6A 4DIDA 2JAWA 3OG9A 5LKAA 1IXKA 2ZYHA 3NIBA 2R8BA 4J0DA 3M4YA 1EZZA 5K8UA 1YCDA 3H6HA 1SHJA 4F3TA 3UMCA 4U7HA 2JVJA 4CODB 2E1RA 2NUAA 2NAPA 4HBGA 1OU4A 1WRBA 1XQVA 4KX5A 1KQNA 1OH5A 3PHCA 4N5DA 2O8FB 3HB0A 3AZPA 5E6RA 4MQ4A 4Z4CA 2ZT6A 1Y3HA 2DBRA 2YZMA 1GRVA 1NUQA 3DTYA 3OETA 3E15A 3KQOA 3LLCA 3U3XA 5KI6A 1CDDA 1BE0A 3SC2B 1T2FA 2PZKA 3OHPA 3W8DA 4BMCA 4OB6A 3ZNPA 1BXRB 1DL5A 3MUFA 4Q21A 1MAHA 2KB0A 4D9BA 4HEA6 4ND8B 3BMCA 3DKIA 2V65A 3NNSA 4V0ME 1BJTA 5BT8A 2W83A 2DHRA 3NHFA 1G4HA 4NOJA 4QECA 2BYTA 1EWQA 3LQ2A 5C0OE 1E9VA 3T9DA 5JCZA 4RLHA 1D6JA 1YE3A 3HVRA 1WSDA 3E9YA 3EJWA 3EEIA 1W48A 4MWOA 3RK4A 3AUFA 4L95C 4LGCA 1PEAA 3W2FA 2EZUA 3AHGA 4PV7A 1M6WA 4G5QA 2GXAA 4PYNA 3LCCA 1TE2A 3ZS8A 2HMTA 4L9WA 1U90A 4YY3B 3HB9A 1TAUA 1JHPA 1VL0A 5J5CA 1B93A 1ESDA 2G8NA 1U7UA 3OT5A 1SQ5A 4G41A 4TYNA 2R87A 3TIVA 1Z0DA 3KKQA 4BVKA 2BSAA 1THTA 3T3DA 3ILSA 3PFBA 1AO0A 1KO8A 4JBNA 5JS6A 3GRPA 1UFRA 1J8QA 2ZDGA 4X24A 4UPDA 1H93A 3KEQA 5FL3A 2WFLA 4TLAA 3KTAA 1MEOA 2RGNA 3KKMA 3UK0A 4DM7A 2PANA 1A82A 2J08A 3IUPA 4F5DA 2WD7A 2H4YA 3GN2A 1BS2A 4ZJPA 2B8EA 1ZY2A 3IQEA 3F2IA 4Z5XA 1CRLA 1PT6A 3RRZA 3QYJA 2BM0A 1AHNA 1KI8A 1N0VC 3EEYA 2Q2WA 4LC1A 2FMIA 4O1HA 5G41A 4B7AA 1XMIA 3S1LA 1YQWA 2OUKA 2NP6A 4WN9A 3RYFB 1VLMA 3USES 4X93A 4ZCTA 3L8DA 1TRHA 3OPNA 2V97A 3AR3A 3EJ6A 1H5UA 1YMQA 3VH1A 3EEOA 3AILA 3P1JA 3RSLA 1MGPA 4PZZA 3ADPA 1LLDA 4TYYA 1NBMD 2PGAA 1DCTA 3LO8A 1CZRA 4JN6B 1IL0A 1P7YA 2A94A 3C6MA 5DXAA 3PSAA 4ZVQA 2W0SA 2Z1MA 4BPBA 1E0DA 3STHA 5A4IS 3NVAA 2B1IA 3MWGA 3D6FA 3RFTA 3HB5X 1HQDA 4B43A 3PEWA 4DT1B 3EXHB 3MJVA 1VL8A 4MR8B 2A86A 5KNLA 5IEJA 4MKGA 3H75A 4L02A 5BSTA 3HLYA 4DG9A 3MWEA 1XTRA 3D3JA 4TQUS 1KJZA 5AVJA 3ONDA 5ED0A 4W5WA 4YIHA 1QG0A 2AE2A 2A5FA 2QZZA 3NHLA 3MJ4A 5CBPA 2V7BA 3AG6A 3AF6A 5AVWA 5CDTA 1P4SA 3HB1A 1IZ8A 1UKZA 1E2KA 3SS8A 2F3UA 4AROA 4OXKA 2ZT7A 3MMZA 2FPUA 4KMOA 1ZG3A 4MINA 4XDZA 4PLGA 2BFAA 1QGYA 2IUTA 3QF4A 5B2EA 4XWYA 5DOVA 3U2QA 4NZYA 4JI7B 3HADA 4KTVE 2WYIA 3EVZA 4GLFA 3O7MA 3AFIA 3CF4A 4LHXA 5CDGA 2VDOB 1BO6A 1B6GA 2EXXA 3BGDA 1QX3A 2C57A 4HWOA 4TKMA 4TL6A 5D5QA 5HK8A 4W5NA 2VF4X 1I3KA 1WXHA 2QX8A 4KXUA 4M0MA 4IV8A 2QRNA 3D0KA 4GPD1 3OZIA 3KWMA 1CEXA 3DO6A 3QXSA 1KO7A 1IC6A 2OLKA 3E5MA 2IL1A 3D8BA 2IV7A 3FBWA 2RHWA 1Z33A 4J0GA 4YCLA 2QTLA 1MVOA 4IRXA 3S8MA 4GMFA 4FYIA 1YL7A 4W8HA 1ZRNA 2OY0A 3ZVMA 2XV1A 3GRVA 4ALLA 1P62B 1F51E 2Y0DA 4X63A 1X1RA 4ZHSA 1XZLA 4V0LA 3K0CA 4RVOA 1AZTA 1T91A 2WAAA 3QEJA 2L18A 1R6AA 1VJ1A 4NMMA 1FB5A 1YR9A 3JVUA 1SM4A 3CISA 3EPKA 2DCUA 3DB1A 1J21A 1NFFA 4PLWA 3ZQKA 2Y0BA 3X1KA 4QZVA 4YMLA 2O8DB 2HSGA 1K06A 3B13B 4N4AA 1NPYA 5DLDA 3T15A 5JY1A 2BZ1A 1MR3F 3PGKA 4F04A 4IDAA 1DT5A 1VE9A 5KNBH 1SQFA 4DMUB 3WGJA 4HADA 3RV3A 4Z2AA 2O8BB 5K6AA 1VB5A 4OL9A 2HDNB 2L2QA 2OP1A 4HQLA 2XB6A 1CG6A 3FZGA 2YYAA 2R1VA 3K32A 4PRLA 4BMSA 5KUTA 1XDUA 2Q4RA 2G9ZA 3JQBC 3RVSA 1Y42X 3GIWA 3F3MA 4FIDA 4QSMA 1KETA 4IXDA 1PWZA 4JC5A 4CJXA 4Q1BA 1UJMA 4O4LF 4RFLA 3WIEA 4MK4A 3RTBA 4V39A 4XVQA 1TB4A 4YAIA 5CFLA 9LDTA 3VNQA 1M2EA 3OZGA 4ZOEA 2QRUA 3STXA 1F2TB 1XAJA 4LQ4A 3KWFA 3S55A 3ZK9A 3OCZA 3PGXA 5CFMA 5J43A 2F4VB 2F3PA 1NJ6A 3ISJA 1V1JA 3NBFA 4F85A 3HB7A 4XM1A 4EKNB 4FHFA 4GQBA 4IEIA 5IM4A 1MBZA 3ESXA 4ZOLF 1V4VA 2FFBA 3EOAI 3SFZA 3DXZA 3GJ3A 3ZE0B 3TB6A 2P4UA 3RS2A 4PGHA 3TLCA 2W42A 2TMDA 3E4DA 3VDRA 4M1KA 4A6DA 1RYEA 3K6JA 5SYNA 1RPAA 4IXTA 5FOQA 4UFPA 1RFLA 4BNXA 1QHNA 4LXUA 4AYTA 1YB4A 4R4JA 5I7RA 2PZFA 1WM1A 3IBFA 1RJWA 3M70A 2GNPA 4AN0A 1PK8A 4MWTA 1PGPA 3HP1A 4CFZA 1ORWA 4MVJG 4PPYA 1FNNA 4S04A 2ZIGA 2JI6A 1DDOA 1IZZA 1JU4A 3KC2A 4JKOA 1DWQA 3VRHA 2J87A 1ESEA 2GZMA 4PNHA 1XNGA 1YMVA 4MHSA 4ARAA 3IR5A 4S12A 3ZWPA 2VYVA 4FYVA 2ZPTX 1CS0A 3I6QA 2FUCA 1UOPA 3INNA 4UD2A 4DAOA 1E8MA 1H3NA 4DHWA 4DUGD 4F4FA 2EEPA 5LQRA 4V0KA 3VKWA 3GZNB 3T5DA 2JVKA 4WNAA 2YR0A 5KOHA 1ECFA 3BL6A 4F3CA 2VCEA 4CCAA 1ISSA 1ADYA 3CRRA 3NANA 4P08A 4DLSA 4BNIA 4RU1A 4W7SA 3DNPA 2HJGA 4D45A 4TT8A 3Q0EA 2HPVA 2WYVA 2I4RA 1A9YA 3D9QX 3IP1A 5HKBA 3UWDA 5KOJB 3KOOA 3KJFA 1VYTA 3T9FA 2BFWA 3SE7A 3VYTB 5CXUA 2JJ1D 1WSWA 3JALB 3PL5A 2XADA 1JIKA 3I6MA 3E22A 4HKTA 3PLNA 5IUKC 5IUJC 1BOOA 1PR1A 3DC2A 3UICA 4Q7EA 2LIPA 1RC8A 4FMCF 1N8NA 2XCIA 4F4JA 1U6IA 4NXMB 1U63A 1K7FB 4LWZA 1E1NA 1OC4A 4KDEA 1P73A 3WLLA 3WWPA 3IILA 3QOXA 4W7HA 4LJLA 3EE6A 5LSAA 4TXHA 4NEQA 3VR4H 2XNSA 2FVYA 3M9XA 4E5KA 4B3RB 5F7OA 1VE7A 1FDTA 2A9JA 2ODNA 3IEKA 4LIPD 3PPWA 1GNTA 4MRAA 3RVNA 3FCYA 3SNHA 2Z2XA 2XUGA 3TLEA 2GF9A 5GVRA 3W3AD 4ZHQB 4R7GA 2WBLC 4QUKA 4D4KA 4LF8B 2NW6A 1VPDA 3EUEA 3LSYA 5SZKB 3DBLA 3ZV5A 1QLJA 4D8YA 1XT6A 4U2KA 3MUNA 1N4AA 2G9RA 3H6KA 3ECCA 2G71A 5IM5A 3HE3A 1JDTA 4RF4A 1H3EA 2WSYB 1NASA 1P2BA 1RAGA 3OZBA 5JXHA 1YU9A 3NEAA 2NU9A 1QZUA 2ZGVA 3DDOA 4MRVA 2V98A 3VISA 3ZQJA 3MG9A 3LT4A 1ODLA 3UK2A 4WJLA 1U8ZA 4P0QB 2QZPA 4KB5A 1A72A 1N8SA 1S3GA 1JR3D 3BMCB 1CB0A 1LPOA 2H7VA 3PE4A 3QXJA 4I6JA 3CZMA 2DMRA 3ZU4A 3OQOA 2BF4A 2MYUA 1B0PA 1E1DA 2W43A 2L0XA 4LOIA 1MO6A 1C0EA 3RC3A 4IQFA 4N8SA 1H94A 1JHVA 2VC2B 3BH0A 3C5WP 2AZDA 1Z26A 2QTTA 5HWSA 1WETA 3GRCA 1QNFA 4NDAA 4XYBA 5EIBD 3E53A 3WRXC 4RTMA 1PNTA 2R7LA 2QQFA 2D7CA 3R5JA 4BMVA 2ZUDA 2C96A 3F4BA 3WAKA 1TZ2A 1E6CA 3RIMA 1K98A 1P7CA 1ADFA 1XA3A 2AZTA 1ECLA 2VYND 3G88A 3JX9A 3NXKA 3PRKE 4H35A 4XWKA 4J1QA 4UAGA 3T1NA 4G25A 5CT9A 2JKZA 2YN2A 1UMBB 1EESA 1B7GO 1NKTA 3H6GA 4I4NA 4Q3LA 3LLMA 2IYFA 4FC7A 1BD4A 4LMPA 3A9TA 1HE4A 3MN1A 1CQXA 1E94E 4F0JA 5DT9A 2PA0A 2P2ZA 3JD3A 1EG7A 1VQ1A 3RJ5A 2Q2QA 4J1TA 1YFLA 4KLCA 5ALXA 1M6HA 4YUYA 1D09A 1Z12A 3B2QA 4GLBA 4X1OA 2QWXA 2JS7A 2ZSKA 1EWVA 1UXHA 2DBZA 2GTPA 5FRDA 4A2PA 1PFVA 1SXJE 2Y1GA 3DOCA 3WGGA 1LPAB 1P2TA 4BUZA 2BFBA 3Q2KA 4W9NA 2ZI6A 4C2BA 4NENA 5JYEA 3C4QA 2UUOA 2XYRA 1DX6A 1L1EA 3CU5A 1Y1PA 3WKBA 4FINA 1ML3A 2UVDA 1HE8B 1R8QA 3MLAA 1SCUA 3NB0A 3IBTA 3BQNB 4QASA 4TUYA 4ZOCA 2BAGA 4ZAWA 5JBQA 4FSXA 4DT1A 1N6KA 5BOSB 2ETVA 1FDUA 3I2HA 1E1MA 1PJCA 1T2EA 2I29A 3OAAD 3UFXB 4CBVA 4D9FA 1JFTA 1FJHA 4BQIA 2H4FA 5I3ZA 3CPJB 1VCNA 3QX9A 4G63A 1C4KA 4EG5A 2HEGA 5ERXA 4TV8A 3HU1A 3VU1A 2WF8A 3RJ9A 4YRMA 2O59A 1NVTA 4X71A 1W1IA 1F12A 4MW1A 4GPAA 2FK8A 3SF8B 1JEYA 3IEPA 1X0XA 4CV3A 3VR5A 3PNKA 4RVDA 2P9CA 5AP9A 3R8FA 4RZHA 2BP7A 1KI7A 2KSQA 2J32A 4N6NA 2CGEA 4P5EA 5AJTA 5CFRA 1PZGA 1M5TA 2FFAA 2NN3C 2P69A 5B1SA 3J80A 2XZPA 3BA6A 1SK8A 1BMFD 2JI7A 2QR2A 3T0IA 3FTCA 4DR6B 3K0KA 4HRXA 3JYQA 4E32A 5ILOA 5EZ5A 1IY1A 2ENUA 1A4IA 4PHCA 2AEMA 4E5NA 1SZJG 4EUEA 2GEBA 5AUPB 3LX6A 2VAMA 4FWIB 3RS9A 3KR9A 1MZPA 2GEJA 1B6SA 1W5SA 3A1FA 3L1UA 4KLAA 3SDZA 4L6IA 1ESMA 2OORA 2QW8A 1K3FA 3A37A 1GRQA 2FV8A 3N70A 3MS7A 4HATA 1NXTA 4WPGA 5TGTA 3OFVA 2A4KA 1TLFA 2YQ4A 3QYFA 2P41A 4FR2A 4L8GA 1V1MB 3HBNA 1O6CA 4FN5A 2VZLA 3B3QA 2FE1A 3PC4A 2RC5A 2ZCJA 1NVMB 1WUKS 4YR7A 1X7WB 1U0FA 3ANNA 4EHIA 3U7QA 2Z2IA 1DAHA 4GXQA 4OEHA 3VPFA 2Z2KA 2H1HA 1IVNA 1RWKA 2CXHA 5I9IA 4LZPA 5GADl 4C7OB 4OOEA 4CMAA 4KWCA 5E3HA 1RMQA 1BCRB 1ODTC 1FFXB 4LOJA 2H4WA 4LWOA 5MGNA 1XLUA 3ZQ4A 1TEZA 3LDAA 1AKQA 2C4MA 4QBFA 1CXZA 4UOEA 4US2R 2EP7A 1QG4A 4MUBA 2JAPA 3CX4A 1ZOSA 1UQUA 1NVVR 3QXGA 4G5FA 4X00A 5L7WA 5LP6C 3ZVNA 2BGKA 3K4HA 3CLSC 4CMJA 4RPHA 1QYCA 4QFBA 5JD6A 1OBCA 3U1VA 2UVQA 3HV0A 4YLEA 4BLTA 4DIMA 4ZP1A 1NI3A 3USZA 3R5HA 1KKMA 1N5KA 3DKVA 7ABPA 1OTXA 2ZRIA 1M8KA 2HJHA 5B6PA 4XR4A 4PC2A 4WGFA 3DF7A 3H2SA 5HCUA 2P11A 1W44A 2IHVA 2Q0HA 1Z2EA 1E9RA 1QP4A 4Y2RA 2H16A 3JVIA 4W1QA 1HR0B 1YHNA 4F2GA 3K0EA 1YQXA 1TF7A 1DC6A 4E70A 3V48A 3AETB 2VPTA 3F6YA 1ILWA 3B3AA 1GYPA 4E5MA 1A9XA 3GH3A 4I46A 3LBHA 1OFUA 4FOSA 1CS0B 1I01A 1J7JA 4FYKA 1N57A 2MINB 5I9TA 4QJIA 4MYRA 3AZQA 3L1JA 1NRIA 1YTLA 1ZIDA 5JV5A 2PGIA 1T2AA 3LX8A 1WXXA 2FU5C 1LFAA 2Q7XA 1U65A 1VJCA 4ZVVA 3COVA 5LCXA 1L5FA 1CZNA 1KGDA 5LZ2A 1HFKA 1WZIA 4LCEA 1ORTA 3CNBA 3U16A 4BWGA 4TM7A 3LK7A 2IDMA 4V03A 2WVGA 1T26A 4NLLA 1NBWB 4P84A 4TTRA 1RU3A 2XVYA 3NTLA 3GJ0A 2G1UA 3A1NA 3PJDA 1Z07A 2PZAA 1T0JB 4NJMA 2VNJA 3MCAA 4OYYA 3T99A 1M1ZA 3L0ZA 2DKFA 4C4RA 2PVSA 4GM1A 3J81k 2DXIA 3W5IA 2ZJ3A 4ZAVA 4JI4B 1JAIA 1BQEA 2GFHA 4W6ZA 3MNFA 3LH5A 1JIUA 2XDYA 3Q85A 4IH4A 2OZKA 4A03A 1QU3A 4YJ2B 1DUIA 1J0EA 2B2CA 4UASA 5E3JA 4DCUA 2C3UA 3MWYW 4C3OB 8ATCA 2DPXA 5K9ZA 1H1TA 2PRYA 3M1LA 3PE6A 1EM8A 4R2WA 1UCFA 3SXUA 4BCBA 1G6HA 3WGVA 2KMLA 2AQKA 2VSOA 3K1AA 4YDHB 5SY6A 5JADA 2BOVA 2PYIA 1FRVA 4EG7A 3NKFA 3SZRA 5K0EA 1Z73A 1PKEA 3ELDA 4TTVA 1EPUA 3FPAA 1MUUA 3R5KA 4ZOAA 4ZD6A 4N12A 1M83A 4B8WA 3FIUA 2I2XB 4GYWA 4Z51A 5BWCA 1YCFA 1GL3A 2ANBA 1OD6A 3ETJA 3IA2A 2O5RA 2Y76A 1X80B 2V96A 2XNJA 3QKRA 4EHJA 3DB2A 2WIKA 2HUNA 1VRVA 3OFJA 4I6GA 1GRCA 2WFAA 5AK6A 4CU2A 5BV0A 4FR0A 1XG5A 3I53A 1MAUA 1E20A 1JB9A 1QB7A 1Z15A 2B37A 2P9HA 3AJAA 1YC5A 3LHKA 3ODGA 3VDMA 3X1JA 1PLJA 4UTPA 2PZ8A 5IZ4A 1UBJS 2Y4NA 1UT8A 5DGTA 2GZ1A 4PYMA 3J7TA 1P9RA 1NDQA 3D2BA 3ZV4A 2OG2A 1XMQB 1HZZC 9ABPA 1LC0A 5CX1A 1JHQA 2BGNA 1P5FA 1JU9A 4JUAA 4OYLA 3TL2A 3A3KA 2HJWA 4RHUA 3HDYA 5AJWA 2BZGA 2AI1A 2Q6KA 3ZE6A 1G4UR 4BLRA 1I2ZA 2PO5A 3CUYA 3O03A 1FXSA 4NCNA 2PFSA 3GLHB 3KLPX 2EBWA 4NAVA 3ZR4B 4OQLA 2ZE8A 2FFRA 3DZHA 1B6RA 3KNZA 3LNCA 5KINB 1WPRA 3M6AA 5CT4A 1KIFA 2LXNA 3SZ3A 1LCIA 4XYGA 1MB9A 4C4SA 1ARZA 1DC3A 2GK7A 4RELA 3BMQA 2G04A 3OJCA 5E0KB 5AHRA 3VHRA 1QDLB 2Z8XA 3FRIA 2IPOA 3D4LA 2WEKA 4TLMB 1CQJB 4FILA 4O4JF 2HJRA 4IFEA 2FWAA 4XSHA 1BDMA 2HPAA 3IGFA 4ZVRA 4JSYA 1JJVA 1QORA 2COUA 2XJ9A 1QJCA 3DM9B 4FFLA 1T9BA 4LJ4A 2UYCA 1KU0A 2CJXA 5AICA 1CQJA 1JR2A 1YHZA 3I9LA 4TRJA 2D2IA 1HDEA 1TX4B 1ZCFA 2W2MA 3VJKA 2ZITA 3W9YA 5JCPA 1R0SA 5JXWA 3H5OA 1E2HA 1QFXA 4DANA 3WWEA 1O95A 4IY1A 3TPCA 5FR1A 2FQXA 2B6NA 2WSBA 4BB6A 4L6CA 4W5RA 2UU9B 3A7EA 4ERXA 1MORA 2EKBA 4B4DA 1CCWA 1T4MA 4HAWA 4HAUA 1EAYA 3EGXB 4FYYA 1OVGA 1KI6A 3LBAA 2NXJA 4Q1CA 3HCBA 4L15A 5KTTA 2PNFA 4NESA 1XWWA 4RJJA 1CY0A 1GNRA 4EJ6A 4L7VA 1Q19A 1OV6A 2IOYA 4O4LB 1W6UA 4RZXA 4QEZA 2A1TR 3IAUA 5J4VA 4LSZA 3RHFA 4J07A 1I30A 1X38A 1COZA 1HSOA 3AUXA 5DP2A 5E9JA 3O8RA 4ZVNA 2FWBA 4B85A 3VBCA 4BO4A 2DRIA 5LFAA 4IJVA 1W8DA 3LJKA 2CXNA 2Z09A 4MW6A 1PFUA 2Q1TA 2RH4A 3AUYA 3GUCA 3LHFA 4ESEA 1CUEA 1TYCA 1W5FA 1YXMA 1GQSA 1RYFA 5AVOA 2A9PA 3L6OO 4KG7A 4EHFA 5HZGA 3O8LA 3LWBA 2D8MA 4L7QA 4RA9A 2VJLA 1M1YB 4PR3A 3T38A 3I9JA 1DBIA 3HZZA 1U7XA 3MTEA 3ZBUA 2GHRA 3BRCA 4MW5A 4E6PA 3PJEA 4JB0A 5I5EA 2BI7A 2HRRA 2ILVA 3GMIA 4BO1A 1YRHA 4FWTA 1E3WA 4Q9HA 3DZJA 4BYGA 1YZQA 4YN3A 1EQ2A 4FDTA 3F5QA 3KHUA 5F4BA 3VR1A 4B3JA 5C7IO 3ZWWA 3T3EA 3AKCA 5D6OA 5IZCC 2HZBA 2OKGA 2BH2A 1T1EA 1ZD5A 2MOKA 1ECJA 3O73A 1OLOA 4J0IA 3MBKA 1NM5C 3CMMA 3DOEA 5E2BA 5BRAA 4ZCPA 4NBVA 2A5LA 2WT8A 1FY2A 2R7KA 3H9QA 3CHYA 3UPTA 3QELB 2A3RA 2AG5A 4GXTA 1A7KA 5JVDF 2W2PA 2ZAOA 5TNXA 4GMHA 4XM0A 3M5CA 3F49S 2XA9A 2P9QA 4L5BA 2JIRA 1J0XO 1J33A 1QGAA 3KVOA 1EHYA 4IRUB 5KVQA 4RD1A 3FJOA 4AM8A 4TWBA 3BXEA 1JDNA 2F9MA 2TMYA 4KSBA 4UDOA 3UIEA 1UXGA 3WBKA 2AF4C 5HFJA 1XGKA 5EJIA 1OGYA 2GTHA 2ZFUA 3RT1A 2ET6A 4U7TB 3OQPA 2PBRA 3C43A 3P26A 1Y3CE 2QUKA 4Y6QA 5CTJA 3L8FA 2DOKA 3TSZA 1LI7A 4UTOA 4LPKA 5L3SB 1W9HA 1LDBA 1Z5UA 1UC4B 3C3CA 5L3QB 2EKQA 2WNHA 2FX2A 2ZK7A 4L0MA 4BNDA 3E1GA 3PF8A 1L8QA 2IXDA 3BB4A 4WX2B 4X7MA 1K0FA 3TVDA 4EUKA 1EFCA 2I4IA 4G6ZA 1MRNA 1RHQA 1B8VA 2E6UX 4DA8A 3H1TA 4XH9B 3PCXA 3IQZA 4E14A 1HY3A 2J09A 3P9PA 3JQAA 1DTWA 4EJMA 1NXXA 2VNHA 3KJGA 1R5BA 3NAQA 2B7BA 5ENDA 4DC0A 4Z4FA 2C77A 3RCBA 2DULA 5DXJA 1WEKA 1XTZA 3I72A 4MWGA 2BY4A 2V7EA 4PSVA 4QOFA 4YEDA 3WYCA 4CM5A 3MGBA 4FFWA 3OJLA 3ICOA 1IE3A 3DZBA 4I3GA 4WN9B 3RYFA 4PC3A 3VO2A 3VVBA 2CF5A 3SE0A 1AHIA 4M1EA 1P7ZA 5JHGB 2XE6A 1GKIA 2JHCA 2FZGA 3ELUA 2LDXA 2PKEA 4U2GA 1HYBA 2GNAA 2JF0A 1CIJA 1Q6ZA 1P0FA 2IDZA 3DLAA 4UBOA 5J5VA 3RUPA 4E31A 3KQKA 2IU6A 1E9SA 4WNIA 3B1YA 5JAIA 3FETA 4FE4A 5EHIA 4N82A 2C0CA 1ATIA 1NJSA 2I67A 4G0OA 5HOQA 2GM3A 4HRVA 4U3JA 1AKNA 1NF9A 4HH3C 2XUJA 3VR6D 3P71T 2DZDA 1N2OA 2Q8PA 3IB6A 2FCAA 4BNNA 1BCSA 4WNCA 4V24A 1OF1A 2EEZA 4MO2A 4P34A 1MX1A 4PX5A 3AOEA 3GGOA 1NE7A 2YINC 1E0JA 1NZJA 3SJUA 3U17A 3O5AA 3ISTA 1U2GC 3HJAA 4JLVA 4JS0A 1XAGA 1Q0QA 4M1ZA 1O0SA 2NZXA 2C5BA 5TF4A 2F1KA 3M82A 4OATA 2RHBA 2X7JA 1G20A 4IGKA 5CU7A 1EFRD 2D3TA 5A0VA 2QLMA 3A6DA 2YZ7A 4TWZA 3D3QA 3PX2A 2QPAA 3LKDA 4EPWA 1XQXA 1ZH0A 1FMCA 2MSKA 3EZNA 3FN4A 4OHCA 1K6JA 1RNLA 2QN2A 5CA1F 4NSNA 1GU7A 1LEHA 1B3BA 3K71B 1QCYA 5KO2A 1RQ7A 4HQFA 3SYKA 2C9ZA 1BGVA 1F38A 1XALA 5FUXA 5LP6F 1S8OA 2FJ0A 2J6BA 3BXXA 4U7JA 5D3KA 2C3YA 2QGZA 4TV9B 4C0JA 3IUYA 4MP3A 4YRIA 4B6SA 1G1MA 1L2TA 1HDCA 4M0LA 4B84A 4H27A 2FPWA 3OU2A 4EW1A 4JP3A 3GIDA 1PQ4A 2AZ4A 4LAFA 1K9VF 4LZWA 4PYLA 5HRCA 5J23A 5JUWA 3JARA 1XROA 3ADCA 1YJBA 1JR6A 5JMOA 2IT1A 4YRDA 5C81A 3GJZA 2YCBA 1PGOA 1Z39A 1ZD4A 3IKMB 1VBMA 1N2EA 1N6PA 2JBWA 2RMKA 4OQYA 4V0QA 4R54A 1EGQA 1HA3A 2CE7A 2VJMB 3GDGA 4LWPA 4XEUA 3RC1A 1AIPA 1G18A 1NL3A 1Z88A 4FX5A 3WKAA 1FMJA 4MMYB 3V97A 1PAUA 2VT2A 3DSRA 5DN6D 1GXSA 2BM1A 1VJ5A 4JBLA 4WQMA 4D3SA 1H22A 3PR2B 3VPHA 2VDWA 1ZUNB 3R5FA 4C3ZA 3V7WA 3AEUA 2BCJQ 3N9IA 1JR4A 2E4VA 2BIFA 1A8SA 3HJBA 5LBIA 1GT6A 2J41A 2P9BA 4PAGA 4BJ6A 2Q4OA 3CTPA 5CT8A 2HWYA 1KBQA 2DPHA 3OEYA 4RPCA 2QRKA 3TEJA 4FOOA 2Z1DA 1F8FA 2ZTLA 3AFHA 3NTVA 4DBLC 4CEJA 3UTDA 1INLA 3LFUA 2YOFA 1S02A 1ISJA 4HQOA 4IM7A 4MTCA 1BS9A 2Q5EA 1U7OA 4KSCA 3UY4A 2OE2A 1Y9DA 4F86A 1RE1A 4WBSA 3TCNA 2YHAA 1PZFA 4MLZA 1EA7A 3RANA 4N0EA 3WXMA 5FL7A 3KWLA 1VPEA 1JJBA 2NU6A 3CUKA 3IYLW 1Z6YA 1RRKA 5FIUA 4HWPA 3URMA 2NM0A 1JI3A 1V11A 2Q3CA 1ZITA 1R0YA 2Z3ZA 1A96A 4JLDA 3VR3D 1S0UA 3QI7A 1JT2A 3FOAA 3VKFA 4Y98A 1KZHA 3E9CA 4IJMA 5LZ8A 1KSGA 4MPPA 4GIBA 4TSFD 5FPTA 4U1RA 3R3WA 4CI0B 5CNJA 4CLEA 4KVFA 3KYDB 2QVBA 1G9SA 1VIVA 3RM3A 1HBJA 2ZSIA 1G2OA 2H08A 3JY6A 4FFBB 2PR7A 3SJBA 3FAZA 3U37A 3U4HA 3H97A 4OHKA 1Z06A 2IU0A 4CT0A 1BHO1 2RI0A 3IE1A 4RVFA 5KOHB 3BKXA 2IS6A 3ZDXB 3IOCA 5KC9A 3BMOB 3KJIA 4X85A 1YS2X 2X0KA 3BM5A 3IODA 5IJ0B 121PA 4FEEA 1XXHA 5LLDA 1I10A 3GR6A 3OMLA 3OHSX 5C5DA 1WBBA 3ILYA 1K88A 1FFEA 2V5UA 1LB1B 1IZYA 4UHDA 4YQYA 3OOSA 5JAZA 2LW7A 4QQ8A 1YQEA 3DOIA 4NCHA 3LMKA 3SYLA 1MG0A 4D3ZA 1F48A 2ZWPA 1HRKA 2NYAA 3PWTA 3DW1X 1FYFA 2JDID 3I73A 1FYEA 1NVAA 3HY6A 4X65B 2BN4A 1U7HA 1QGUA 1YASA 3QENA 4HGZA 2C4VA 4TVBA 3MAAC 2ONJA 1XP5A 2HSZA 1SBTA 5T4BA 3PQ4A 4N5MA 4DTCA 2OOKA 5JR3A 3U3ZA 2E4WA 3U7GA 3GCXA 4TUYB 3TR0A 3EODA 1M6VB 4DQLA 1XD2B 2II6A 3I3SR 2QXTA 4LYYA 1FXUA 4ZHQA 1XF9A 1V35A 2YJ3A 4IXMA 4YACA 1XWIA 3ORHA 3N2NA 2CFSA 2EP8A 3QLJA 4Q1VA 4XD2A 5CNIA 3OEED 3U4AA 4WINA 2R8YA 4S35A 5EJEA 4CKEA 1I2AA 3JASA 5EEHA 5K2MA 3T41A 2WM9B 1VG1A 2Q2NA 5JH7B 2KX7A 3WK8A 3UMGA 1QP8A 1XZNA 3WGYA 3H1AA 3LLUA 5EHGA 3HDJA 4S0ZA 4BNTA 4OKIA 3E82A 2WJIA 4CKEB 3JQCA 3NWPA 2ZPUA 2IY9A 5AVRA 2WSIA 3SJAA 4DNPA 1AXEA 1WMSA 3IMGA 3R41A 4FE7A 1BMQA 4ROTA 1KJNA 1N5LA 5CB8A 1UPBA 1U6KA 3D59A 4PYIA 4Q05A 3WMFA 4C14A 2XTZA 4J76A 2IUEA 3G2HA 3DDWA 3RFCA 2LP4Y 4CM8A 3TF5A 1ABBA 2R5NA 1HL7A 1RYDA 2ZRDA 4ZKEA 3ZDEA 4H18A 4WESB 1TC2A 3I83A 2QL9A 3KV1A 4JY7A 4E88A 1TDJA 3ZBTA 4YQEA 5C4GB 1PJ2A 2PQ6A 3F5DA 3P2MA 5JNTA 3DXXA 3LXXA 3PC6A 4C7BA 3AY6A 4ZIRA 3ER6A 3GJRA 2Q4TA 2R65A 2QRQA 2HQ1A 3CO5A 3RKRA 1LSSA 4RTLA 1FC0A 2RSLA 1UOQA 1F2VA 1L8OA 4MJXA 4QD3A 1ZJJA 2IIVA 4B40A 4FOTA 1NW5A 5H68A 3TRJA 4LJSA 5ESXA 3LC7O 4AIRA 3VPGA 3LWDA 1PV1A 1SVNA 2HHCA 2WPDA 3FLEA 1Y6JA 2CXTA 3NDIA 4J0CA 4JYBA 2DR2A 1UZLA 2ANCA 2OAGA 4UNQA 5HHTA 3JVVA 3HO6A 5GZ6A 3SZMA 1ZGBA 2QMHA 4Q02A 3D6JA 1K0UA 5BOVA 3D2AA 4U00A 5BSMA 1G3QA 3SC6A 4KDFA 3PV0A 2WU0A 1UJ4A 3A11A 4U8HA 2HTEA 2HWXA 4MA4A 13PKA 3U7IA 3O82A 1TKAA 3GZ4A 4MVJD 1VP9A 4JUIA 1BVYF 2C9MA 4RL4A 2DWPA 4Y6RA 1F8UA 3L7BA 3NTOA 3CEAA 3PT9A 1SU7A 5KAMA 2HU7A 4G5HA 4UBNA 1H2RS 1PU2A 3MGAA 4P5DA 1H0RA 1E8NA 2YDXA 5IG2A 2QB5A 4Q3DA 3UXMA 5KYKA 2IP1A 3EWIA 3E3NA 4YPFA 1QVWA 1MDBA 4BKQA 4BWVA 3T9EA 3QVUA 4JHXA 4DQXA 3D2CA 2DLNA 1H6AA 2VSYA 1VXOA 3GEEA 2C2OA 4F3RA 2HCRA 3KZNA 1VZ3A 2ODAA 2OCAA 4J7XA 3V33A 3TL3A 3KSDO 4C5AA 1I1QB 1U3VA 3LE8A 1KI1A 3QOYA 1XQ6A 8LDHA 1C0PA 1QLWA 5EJGA 4REQA 5DSTA 1QFJA 2CDRA 2CV0A 1ZISA 1E5VA 2PTHA 4NFSA 1FDVA 2OYSA 3ELBA 3ZIAD 5CFQA 4B3TB 2WD8A 5DO9A 2UZ1A 1FLDA 3PNQA 3NPAA 4F38A 1MAVA 4GP7A 3LBIA 2P2NA 1KHTA 5IKPA 2Q29A 1D2EA 1E4EA 4P58A 3ZCTA 3K9GA 4XUEA 3V8MA 5DNCA 3H3JA 5C31A 4HFMA 2WIAA 4RY9A 2QQGA 4B3GA 3FHCB 1L4MA 3VDNB 2FI1A 1RCUA 1MHPA 1CY7A 4D74A 3TQFA 3A14A 2OAQ1 1ZBQA 4ITUA 4MYHA 3W3AH 1VE5A 2C2XA 2OWEA 4A1OA 5EJ4A 2C42A 2GJ9A 5EMNA 3LP5A 1A4UA 1GEEA 1LJ8A 1P4HA 4J7UA 3HDQA 5CB4F 2A14A 2NSHA 1PUJA 4JB3A 3SEAA 4XJTA 4YRZA 2SICE 3GH1A 4YCBA 3WL8A 5K8VA 5ALJA 2VXOA 4GOLD 1AO3A 1JQ3A 3B51X 3VQTA 3VYUB 4BQNA 4CLXA 5KS2A 1YV9A 1GGHA 1JPUA 3V2IA 2F1OA 1QKKA 3C3PA 1WAMA 4JB2A 1MFZA 3F96A 3ZWDA 4QGSA 4G97A 2RGBA 3EW7A 4L8LA 2JBHA 1G55A 2D5CA 2WKSA 3ANTA 3W5BA 2IF2A 2ZSDA 3Q15C 5GIPE 1KZYC 2G80A 1M8PA 5FBWB 1QOPB 1CPYA 3ESCA 5BSUA 5JLAA 4ETWA 1WSBA 2B83A 5A4JA 2VXCA 3SC4A 1AF4A 5C7YA 3ONFA 5FFMA 2MYTA 4O4HA 3FCXA 3MTBA 2JD1A 5BWMA 4INPA 3K2IA 1UZUA 1TVEA 3HRIA 4RHCA 1RRVA 3AV3A 3OJOA 1V3UA 1WCIA 1UBEA 3HR8A 1I0LA 3NHKA 3R23A 3I6IA 4ZVMA 1T9CA 4NU6A 4CF5A 1TD9A 4D8XA 3TIGA 3LGXA 3OP4A 2CFTA 2HYIC 1DJLA 4F46A 1V25A 5B3AA 4IDQA 5H81A 1S2IA 2WFZA 4KRGA 4WZAE 3R75A 3SLKA 1QTQA 1JKJB 2HMSA 3AVQA 1T8RA 5BMVB 4W8OA 2REBA 2UYHA 1XPOA 1MEJA 1VIYA 2ZT8A 4U7PB 1PTJA 3W6UA 1M10A 4XFDA 4UEOA 3NEPX 2ODPA 3SAJA 2EC5A 3DCIA 2G70A 1CT9A 4GZ5A 4EAQA 2FPRA 2QROA 3IKVA 1I4OA 5EQFA 4Z2YA 4A0SA 4D41A 4MHTA 1OX4B 3V8NA 1LKZA 3QEMB 5BMVA 3F5MA 2CKMA 4MCHA 1H65A 1KH3A 2JHAA 4EPXA 3G2IA 4WN3A 5KSOA 2XF2A 1GSOA 1DKNA 1V1RB 5FBVB 3RAFC 3V7YA 2Z8YA 2EW2A 3CG0A 2JKYA 3I6YA 1ZCBA 1XVUA 1ECCA 3EF0A 2YVQA 3SX4A 5IFKA 1YI8A 5LYJA 2FN8A 3N2YA 3I8SA 2XMPA 3WJ7A 2X15A 1EX7A 1F4LA 2XKBA 3FVQA 1YDMA 3M33A 4UNNA 3QMPA 3KT0A 3SEFA 2P90A 2E85A 1P1KA 4A2WA 3CC8A 5C5IA 3JZAA 5C37A 1MZVA 2GMWA 3S2ZA 3GC6A 1U0OC 3KBOA 3N5CA 1TZKA 2DU8A 2GH1A 2I8CA 2WM2A 4OIFA 3OCWA 3THRA 1KKLA 1MQSA 1I7NA 1N3YA 3ESZA 3UWPA 2R0QC 1WIWA 3WLRA 2AEFA 2XMDA 2C97A 2LD4A 3JQAD 2PPLA 1FU4A 2J31A 3C87A 2IYPA 2ENWA 4J0KA 5DBFA 2QD5A 1AN0A 4IXWA 4IHAA 2PUBA 3HGMA 4FLEA 3TI7A 2YFKA 2B35A 1T2NA 2R8ZA 4LY0A 2Z2JA 1V6SA 3CVXA 1VYVA 1J4AA 2H7CA 2PQMA 3ESBA 1PKXA 2QY6A 4OBXA 2D4HA 2IS2A 5AJHA 3WG9A 1X39A 1IXRC 1OQAA 2J5BA 2V59A 1KDZA 1CJTC 1HOTA 2OSBA 2X2PA 4G23A 4Z7QB 1T9DA 3TZBA 1EDEA 2GERA 2VHYA 3KDPA 3UQYS 3D4NA 4OP1A 4PQGA 2FR1A 2P5YA 2R44A 1HGXA 2ZJ1A 3JQGB 1IJBA 4J4TA 4LPSA 3T9AA 1UBTS 2UUCB 2YJ6A 4NYMR 1L4BA 1OUMA 1SD1A 2OV8A 3H8WA 4K6FA 4EO7A 4D8TA 2PT6A 1TIPA 2ZREA 2R4QA 3BGIA 4P22A 5TQ0A 3G2KA 1EXNA 1E9EA 1LRLA 4OYHA 4QTXA 5DM2A 4DDKA 5KVVA 3OIDA 2UAGA 2Q2VA 3H17A 2H1SA 2QG9A 4ECEA 1PL6A 1TK2A 3SLRA 4H1WA 2QTWB 5ESWA 5CBKA 4IF4A 1R15A 1GTZA 3D8HA 4OOFA 5H82A 2YY7A 4XM2A 3CA8A 3H8SA 2QAIA 1THGA 3A4TA 4N8DA 1YGPA 5DMHA 2C7GA 2V4UA 1ADGA 3K0FB 5H80A 4FZ5A 2E4ZA 1XLWA 3WHIA 2Q50A 2C1ZA 5IWAB 1BKSB 1TFUA 1DZ3A 4OP3A 3BH7A 3WQBA 2BT4A 2VVTA 3ZE9A 1YVRA 3JQFA 2PHZA 4ZOLB 4JLMA 4DW8A 3O2SB 5F3RA 3JZFA 5J1TB 3U48A 5IJ9A 2ODEA 4NPAA 3FB1A 4KREA 5D5HA 5H7XA 4AKTA 4KMSA 4HAIA 3ZTTA 2O8CB 4L6AA 3KOMA 4HQKA 4K28A 4HMPA 2I7DA 1YL6A 2J3LA 3VO8A 1D2NA 2Z56A 1A5SB 3CR7A 5ELLA 4DVGA 1QHGA 3L4SO 4I55A 3GLIE 4BBJA 2ZRQA 1STOA 1HM5A 5FI5A 3K31A 4ZANA 5TC4A 3IUQA 1BKDR 3SPXA 2WW8A 1JEQA 4UARA 4F9GA 2O7QA 5MN4A 4LF7B 1GZUA 4PF1A 3HI6A 3BMOA 3RVJA 1OAOC 5EHQA 1OASA 3HQ4O 4CQMB 4QGBA 4ZYTA 2IJGX 1NT4A 3AM1A 3I37X 4KPFC 2CB0A 2WAXA 4JMLA 5DGCA 1PD0A 2MR5A 3WISA 1GJRA 1RSZA 1X8KA 3V1MA 3EGXA 5IT5A 3D3WB 3R9XA 4HHEA 4E1VA 2B5WA 3I5AA