3QVLA

Allantoin racemase from klebsiella pneumoniae
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
245
structure length
244
Chain Sequence
b'SVRIQVINPNTSLAMTETIGAAARAVAAPGTEILAVCPRAGVPSIEGHFDEAIAAVGVLEQIRAGREQGVDGHVIAFGDPGLLAARELAQGPVIGIAEAAMHMATMVATRFSIVTTLPRTLIIARHLLHQYGFHQHCAALHAIDLPVLALEDGSGLAQEKVRERCIRALKEDGSGAIVLGSGGMATLAQQLTRELRVPVIDGVSAAVKMVESLVALGLATSKHGDLAFPEKKALSGQFQSLNPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydantoin racemase
publication title Characterization of the Structure and Function of Klebsiella pneumoniae Allantoin Racemase.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Isomerase
total genus 82
structure length 244
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12500 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qvlA00
2XEDA 3QVLA 3DG9A 3IP8A 4IX1A 3QVKA 3QVJA 4FQ5A 2VLBA 3IXLA 2XECA 4FQ7A 3DTVA 3EISA 3IXMA 3DTVD 3DTVB
chains in the Genus database with same CATH superfamily
1LLFA 3JPYA 1QFYA 4MMZB 4P33A 2Q2OA 4B73A 4BWFB 3OLCX 1VP3A 1U4OA 1XZMA 1W0JA 2WVGA 1J5PA 3E48A 4LNUA 3WK6A 1Z68A 3C6KA 2PV7A 1H3EA 1ZY2A 3FCOA 4BCCA 3BE4A 3SJ7A 4A0FA 3U4QA 2YKGA 2EFEB 1Y63A 3Q7EA 5IZCC 3ZU5A 1DWOA 1X80A 1R5BA 2BT4A 2ZBQA 4RD4A 4JUCA 3U9LA 2A14A 1JA0A 3PQEA 2NM0A 1VHDA 3W4JA 3HKEA 3EBPA 3VDQA 1E9CA 4J7UA 5KSYA 3UT5B 1U63A 5DNAA 1HXHA 5IABA 4XWOA 4F2PA 1VC2A 1E4EB 3OKAA 4ZRMA 5D5QA 4L74A 5AM0A 2WU4A 3UAOA 3HXOA 3DZHA 5TC4A 2OTCA 2HQ1A 1TK2A 1XI2A 2GTHA 3LG2A 1X7HA 4CTMA 4CMBA 2QZSA 4CUKA 3IALA 3ZXSA 1L5FA 2J4CA 4NAVA 3SIWA 1M2VB 2GERA 4UCWA 1I9CA 3VSBA 2VOJA 3KAKA 4D9MA 1X70A 3C3PA 1PUJA 5LMUB 2IS2A 3BMCB 3R9IA 3AKZA 1W48A 2GZHA 3IHKA 1MAVA 1JTFA 1JR2A 1NURA 3EEIA 3R5TA 3FOEC 2FHSA 1QIDA 3GFTA 2OZKA 1LDEA 2I7VA 3HO8A 3P9SA 3ESDA 4WE3A 4DV2B 2VYVA 4ICIA 1LI5A 4XCVA 3UHFA 4FR5A 1Z7YA 2M98A 4IMJB 2K7FA 4Z4FA 4BHTA 2RGEA 2RK4A 1T5HX 1WP4A 4FW8A 3G2JA 5F7XA 3RWMB 5IM4F 1UBSB 2FX5A 3VJLA 4Z49A 2ZIXB 1L4UA 1KYZA 2WVJA 3E1SA 4XX0A 1SQGA 3HDVA 1HETA 4K6CA 5KYXA 4IM7A 2XUQA 5SY4A 3WGKA 2AJTA 3IOMA 5I7RA 4IZIA 3A6PC 5FL7A 2Q7XA 4PPYA 1C9DB 2C3YA 4QTZA 4U0KA 1PJSA 4MAMA 2JIPA 3GFPA 1Z4PX 1BA2A 2HDWA 5J2TF 5LQCA 2QE7D 3CRQA 3ORHA 3IDFA 3VJKA 2AV6A 2WFLA 1U3DA 4MVJM 3V7UA 1E0SA 1I3CA 1K6JA 1JEQA 1JHYA 3FTQA 4C6RA 2H2HA 2HXSA 3GBVA 3AF2A 3R4CA 4D0GA 4YRBA 3CEAA 3GJTA 3RIHA 2ZPTX 3HSKA 4NECA 5EWJA 5C4GB 3A1SA 4IFEA 4NX2A 4XQ9A 4ACBA 5H1YA 1MJGM 4W9MC 3IT2A 2JLAA 4KAXA 4V0QA 1GZDA 1AHHA 1GUDA 1YS6A 2OXRA 3DFZA 4O4LB 4QOSA 5G3YA 5NLLA 3V8NA 1M74A 4YQFA 3WG9A 3RC7A 1NQVA 3R9XA 3GFQA 1ESDA 1EE1A 2AG6A 3FCUB 4KRGA 4P98A 4Z8XA 4NMWA 1TT7A 1ZONA 3HU5A 3EVTA 4QFCA 2PRKA 4YJGB 3PIRA 5DP2A 621PA 5T8KA 3TPCA 2ZM5A 5GWXA 1Z26A 2FLKA 3IP9A 4ZOEA 4HTAA 1WQ1R 2XA9A 4E46A 5ICCA 4O2BB 5D5HA 1AHPA 2P91A 3I4LA 3HA7A 4YNBA 1H5QA 3PKIA 2OVFA 4PYLA 3AV3A 3KZ1E 2RONA 4J16C 2AKAB 3FNIA 1EJ6A 4QPZA 4ZEOA 3O4VA 2ORYA 3TGPA 3AVVA 1OASA 1AGNA 4JC5A 4YRGA 4D25A 1N25A 1LQTA 4DNQA 3AERA 2R6R1 1EK1A 3KO8A 3S2IA 3REQB 1H0SA 1H9CA 2WM2A 3AF4A 2JFPA 1D2RA 1MT3A 1WLYA 4M9UA 4WRRA 1VPWA 3C85A 1L4HA 1M8JA 2GCOB 2YIVX 1MAWA 4IOJA 4UVHA 3PNOA 5BURA 4KQ9A 3BSWA 3QUCA 4MCHA 4BQOA 5BN5A 1MT0A 2WWYA 1VJTA 3H5NA 4OMCA 1BX3A 3GNLA 1V5WA 2BTQA 3MT7A 1UODA 4PS1A 4WESA 1R66A 2BZ1A 5G40A 3X1WA 2ZJOA 5EJAA 4DM4A 1XNRB 2XBLA 3K0EA 3TLBA 4HWTA 1V7CA 4HN2A 4IV0A 3QV1A 1B1AA 1NIPA 4LRWA 1NG9A 4WCFB 2Y0DA 2XITA 1XT6A 3R3VA 5ALJA 1V5EA 3C6QA 1XA4A 3TPFA 3FB1A 3O5AA 1LI4A 1XZLA 2DFTA 1XXHE 2GNPA 4GZ3A 1BRMA 1H66A 1BDBA 3O2SB 1TQ6A 3EXG2 2FW6A 3WBFA 3VOTA 5A9SA 3Q87B 1QFJA 2HLPA 4ENVA 1T8UA 1CCWA 3FOWA 1O96B 4LEIA 4IEIA 4B5KA 3NV7A 3HVHA 3M6UA 3EXFA 4P36A 3B51X 1T8RA 3CUYA 1DDGA 5ILQA 1Q7CA 3HCEA 4HGRA 3QVLA 3PD0A 2IDZA 4LYDA 4MMYB 2A67A 3PG5A 4Q4HA 2DTEA 5UKDA 1QRRA 2NU7A 3ST7A 4REOA 2GLXA 2OB2A 3ZIDA 2N46A 4DXDA 2QAIA 5TNXA 4TVSA 3IULA 3HPRA 2FFAA 3QE0A 5BVGB 3RKSA 1K7FB 3STTA 4WNIA 1RYBA 1RZ3A 2FW0A 4KU4A 4PSVA 3T0IA 2I91A 4AJIA 2BCJQ 5E3JA 1A69A 1Q1NA 2NSJA 4HSGA 3IHWA 4U3JB 4FJ1A 3RC2A 3TH5A 3RBAA 4FK8A 2C8LA 2OHVA 5T5QA 4KSYA 4B17A 1OFIA 5K03A 3TO5A 1NN3A 5JUWA 3OJWA 1RPJA 1T9GS 1Z7WA 3IA2A 4QYXA 3C45A 2EKDA 4YCBA 2XTNA 1I7SB 2AFHA 2ATEA 7ABPA 3KJFA 2O0JA 5F1PA 1EESA 3PEFA 3I4CA 3W7AA 5K0EA 4JGBA 1P80A 3UJHA 5FPSA 3L0OA 5AM2A 1NUUA 2P9CA 2NW6A 2FG6C 3F7MA 4KIGA 5E2AA 1Q1ZA 4DT1B 1N6KA 1P2DA 4XRGA 1QOZA 1TZKA 4L9SA 3FNEA 4G5YA 2VHTA 3TQCA 1A50B 2EFYA 4UQLA 1ZXXA 1K97A 1MX1A 3JASB 4ZVRA 3LP8A 4RKEA 1IUKA 3RK4A 3H2HA 2QDXA 1U04A 2DKOA 4ZQFA 5CH5A 2QYHA 1Y1SA 3BGWA 3FVTA 4F3KA 1W9HA 2PUHA 2YOFA 3ENKA 4JKIA 5CH3A 4TKVA 3L8EA 2AN3A 3EGEA 3VVLA 3WAGA 3VPDA 3M1IA 4EA6A 1UMBB 4IRXA 2JHPA 3SQDA 1G20A 4TLLB 3LP5A 3UTCA 5KQPA 1AK2A 3LF2A 1RXWA 3GP3A 2OHHA 5ARCA 1M2HA 3V4VB 2A9OA 2PTGA 3E61A 3F6BX 3WGOA 1DC6A 1DBVO 2QTRA 4IL5A 5LPNA 1G6HA 5EL0A 2Q0SA 4EDFA 3UMMA 1SIBE 2FWMX 1FSFA 1GNRA 1NUQA 3BJZA 4UU1A 5B5SA 4RSGA 2GILA 2YWXA 1T9ZA 3KQSA 4W9NC 4BLVA 1T3SA 3LYLA 4H27A 2I4RA 1U99A 4FWTA 3BE6A 2XMGA 1DL5A 4IJMA 4MMXB 4YRRA 4EX7A 3PE4A 3VPSA 6YASA 5A4AA 2PGXA 2W4MA 3OAAD 4KAFA 4ZQIA 3IKJA 2WC1A 4O4IA 1O6BA 3MOGA 4NU5A 4J75A 5J40A 2QLLA 4C14A 4F92B 3NGLA 2OXEA 2JARA 4HEA1 3FCSB 4QU0A 2AE2A 4HI0E 4FUQA 3EVNA 3GOHA 2HBZA 2CL0X 5FUQA 1Q0UA 2PV0A 2OGSA 2FMKA 1Z4JA 5BO5A 3RFCA 3E35A 3JD1A 2KPOA 3Q98A 4HFRA 4ZVPA 1GQYA 2HTFA 1F8UA 1E0KA 3H3JA 3L1KA 4CF6A 3T9AA 2B1IA 1QNFA 4NH4A 2P3LA 3RUAA 2XOXA 1O95A 1CEYA 2HSEA 4UOEA 4ZCPA 2ZUEA 1N9KA 2HIGA 2H92A 2JAOA 2QE6A 4AQ7A 2PXHA 1HYEA 1P7CA 2H4ZA 3DJYA 3STUA 3M82A 1XWFA 3EY9A 3BRSA 4JDPA 2OAEA 1Q0TA 1IONA 1E2NA 3C3JA 5ILGA 2AVNA 1IMOA 3X2FA 1N5RA 2VCYA 1VFNA 3JW8A 1DU4A 1BE0A 2ZI5A 4OBXA 1OB2A 1E64A 3TLCA 1RAGA 1N5MA 1ZMBA 2M32A 4LPKA 4ZOLF 5KOHB 3FZYA 4OKNA 5REQA 2EX1A 1DWPA 3ETHA 3OBIA 4JJ4A 3U3ZA 2V5VA 3BTVA 3FLAA 3OIVA 4TYWA 4OGGA 1BX1A 4X7RA 1UJ5A 2YH2A 2BW0A 3DE2X 3N0RA 1SUDA 3JQGB 1USGA 2BFBA 1MV8A 4QTYA 1R18A 5IUKC 3WGIA 4I9UA 4FSXA 3FSJX 1F0PA 1Q3TA 3HI6A 5EP4A 4WXHA 2EYUA 3SKVA 4GGOA 3KBOA 3N87A 3V7WA 4D92A 5KNBA 2N1BA 5FX2A 1RFGE 2JFXA 2PX8A 3OLVA 2ICAA 3P45A 4TV9A 5FPPA 2JAXA 5K1ZA 2I4NA 2R1ZA 1BHQ1 3X1XA 3RT9A 1R00A 2PS0A 2QT1A 3B1WA 3W2HA 4F72A 2WF7A 1P4AA 4AY4A 3MWDB 4Z0NA 1S2MA 1NJ8A 3AR4A 1EGMB 4C3OB 3G23A 3PXGA 4LDPA 3C8HA 1F12A 5FNVB 3JALB 5CVDA 1SO8A 2ZQYA 4BO1A 3KXIA 1KEWA 1M8PA 1NN0A 1SQSA 1WS6A 1Y8AA 3GRYA 1H0RA 4NNJA 1Q14A 1FY2A 2GLUA 3K2EA 1J97A 3PFBA 2MCFA 1AUPA 2G63A 3T94A 1B74A 1JPVA 2IDMA 3T4UA 3IVMA 1CY4A 2ZI4A 4S1VA 1OYWA 4UATA 3O91A 3ZWXA 3F6YA 1LFDB 2RHGB 4PNHA 3KHTA 1L0BA 5CGZA 5ALGA 4AWBA 2C7OA 3FYHA 4NNPA 1MZPA 3VDNB 2Z8XA 2Q41A 5EWLB 2Q1YA 5DNCA 3I61A 4E88A 4RFVA 1KMIY 3I5MA 3G8DA 1ZBQA 2XDYA 1YR8A 2XNDA 3BREA 1YRYE 3W9UA 4BZWA 4EA8A 4Y1RA 3FGZA 4G89A 4I1YA 3HO6A 2BKXA 2RSLA 1OYVA 1KMCA 2C5FA 3BK7A 3DBHA 2H16A 1G9XA 1PR2A 2QYTA 2QLJA 2Y1CA 3DT8A 3FJOA 3AHEA 1KSGA 2AN1A 1ODLA 5AI8A 2EQAA 2DFDA 4MW5A 4GI2A 4V39A 4X1IB 4DIBA 4ESHA 5K4HA 2FYTA 1A27A 3U5ZB 2ZJ8A 3DUFB 4DLYA 1DIRA 3NBKA 2A5DA 4DLUA 4IPTA 1QK5A 4AJEA 5AKZA 4DWJA 3IPRA 2B21A 3VU3A 2QLBA 1A8HA 5JWRA 3O47A 4YJHB 2ZT5A 4NAUA 3THYB 3LCJA 3D7SA 4PZEA 4FYHA 2YOHA 4IF4A 4MR9A 5GINE 3OECA 4Y6PA 5BRAA 1AN9A 2QD5A 2XT0A 3IP7A 1CSEE 5BMVB 3ONFA 2F8TA 3CNQS 3WZLA 3WO0A 4R81A 4P0TA 3L5OA 3QEBZ 1KZ7B 2EYQA 3HFJA 2C9OA 2E49A 1UJMA 3FSEA 2IY8A 2OESA 3LC0A 2CNWD 4JP3A 2PR2A 3DM5A 3KETA 1WZIA 1E20A 2EERA 3TNYA 2C7GA 3I9KA 5KNCA 1ZXLA 3TINA 4EYGA 4BV9A 1KKUA 2H1CA 3AP2A 1E92A 3R5HA 2J67A 4JIMA 2P1RA 3HLKA 3NJ4A 4YAKA 2A9JA 5MDHA 3BXGA 2EL9A 1QKJA 2Z2ZA 3C3BA 5C37A 2PSFA 4PGAA 1MF7A 2MMGA 1RKBA 1S3FA 2FR8A 4UAGA 1RYNA 2PH1A 2Z08A 2V8BA 2NYUA 3I09A 1UKCA 3PNMA 4OM8A 1K5PA 5AOAA 1N2JA 3D9QX 4WTOA 5JNUA 4XIFA 1JEJA 4RNDB 3G0IA 3THWB 1IIBA 2JASA 2YY7A 2RK3A 4YAUA 1VKHA 3JSXA 4YREA 1CQPA 1TAUA 4BU1A 1ADFA 3FDFA 4U7GA 1GPLA 5CA1A 1IXYA 1KQOA 2D0IA 1WZNA 2PZLA 3REFA 4IGEA 3JATA 2CFTA 2JH3A 4LSZA 4O2AB 3K5PA 2QYSA 1V2GA 5EHQA 1Q7BA 5E3HA 4PVDA 2AFRA 2D1SA 1PD1A 2YXEA 4K9MA 4JBGA 5EJ4A 1B6GA 3BHNA 4ZJYA 3MT0A 3QX8A 3FFXA 4E5MA 1FYWA 1T6BY 1Q5PA 1PFWA 3UMJA 2GA9A 1I6MA 2ISSD 4PAGA 4L5IA 2R87A 2ZSKA 4NJMB 1BJRE 4RJLA 5ES3A 1U0OC 1TZJA 5DCLA 3D7KA 1CUBA 3AZQA 4OIFA 1FYXA 2IUSA 5KAPA 1WOYA 2ZB8A 4L51A 5FBZA 5BWBA 4ZJPA 3M6WA 2OMEA 3FJ1A 3BXPA 3TB4A 4IYJA 4A23A 3BGSA 2VXOA 2PZMA 3R7WB 1V8PA 5HA5A 4XDHA 3FNHA 2DPGA 1THMA 2VL7A 1F0NA 1FYDA 3W79A 2PU7A 3T5AA 1NOIA 1P7YA 4RMNA 3HYCA 1SBZA 5CBPB 4BZQA 2R6GA 1KKLA 1HMYA 4U00A 5G3ZA 4W5RA 1XNJA 4C03A 3ZCSA 1GGJA 3K4HA 4D8UA 3EG5A 5AJXA 2QS9A 3PSAA 3AFNA 4XFDA 1M75A 2IF0A 2PTHA 1FPQA 3P4YA 4B47A 3DC2A 4AP9A 1PJ4A 2B8JA 1EP9A 3TLXA 3EFHA 1VGVA 4HYYA 1PWYE 3N9IA 2J3HA 3HJUA 3L7YA 4BNDB 1DV2A 3ZCQA 4EG8A 4PRZA 1SAYA 3DMRA 1SBQA 2BFAA 4PZCA 1SB8A 4M9ZA 3HXQA 5LZ7A 5TGTA 4F6RB 1CS0A 2CY0A 5IYZA 3BJIC 4J07A 3BFVA 5L4LA 3FKSD 3TZEA 4CODB 1FUUA 4HN9A 1R8XA 3LV8A 2ZIUB 2DLCX 3QPAA 3FLMA 4B4WA 3FDXA 1O6ZA 3B89A 4KACA 2CT8A 3FMIA 4FGLA 3LPNA 4CQLA 3C5VA 3RSZA 3ILVA 1XEXA 5D1HA 3CX3A 3R6TA 2R65A 4JVSB 2P62A 4D80A 5I7OA 4BXOB 4AG6A 1RMQA 2RAUA 3N5CA 4UPVA 1PR9A 5FOQA 3SX4A 1EINA 4TRMA 4DSTA 5JDIC 4INAA 4XOIA 1W75A 4JVLA 4IX1A 5CCXA 1FYFA 1D4OA 4HLUA 3B3AA 4S2EA 5A3QA 1X9GA 1ULUA 3HXKA 1VJRA 1NQTA 1KFCB 4GP7A 4B33A 4Z9AA 1HRDA 1N9ZA 1YJCA 2IYSA 1GNPA 1TAQA 3ZQ6A 2QDKA 3A9TA 5KCZA 3WE7A 4EJ0A 2VHEA 3FPCA 3ZWMA 1IB6A 1C3OB 3DBIA 1L8QA 4ILKA 1J8DA 1RJFA 4HO1X 4DWOA 4L5CA 1P45A 3W8NA 4BB6A 3ZDYB 4ZTZB 2ZTUA 3D6JA 4JYMA 1XP5A 3PX7A 2ZRPA 2IELA 4GL2A 4HAIA 2I29A 4FLEA 3LC1O 3ZLTA 1VJ1A 3VO8A 2XMRA 2YV3A 2BSAA 1GAXA 1D6JA 1N2GA 1AUXA 1PJ8A 4WOJA 3VR6H 1ZSVA 2QY6A 4M1TA 3OCYA 1JB1A 1RNLA 5CLHA 1W1UA 3NDIA 4FXOA 1EFHA 3G82C 4MTCA 4BO2A 1BVHA 3OPYI 4FCTA 3LA6A 2XX3A 4LI0A 1QVAA 5AP9A 2CMDA 2RCNA 1O7JA 1T8TA 1SCJA 1X7GA 1YJAA 2KI5A 3GCGA 4ON9A 1I13A 3DPIA 3TDNA 3EFOB 3ZDBA 2BGRA 4LJLA 1QVZA 1L5ZA 3ANNA 2FUG1 3IMKA 4ETNA 2AOXA 4B81A 1MP0A 1XLTC 4H7FA 4YDQA 2XKAA 1TMGE 1Z7EA 4JZKA 1UQUA 3RWBA 1H3NA 1AUQA 2J7KA 1I2CA 3S70A 3UAGA 1MB9A 4LY6A 3MILA 4AL4A 4I4LA 3ER8A 4JYAB 3G3EA 2R8OA 5LLSA 4F86A 1Q19A 2PUEA 2J3LA 2Y2VA 4C30A 4GIBA 4RY0A 2EFGA 3TZKA 3IR6A 3ZVMA 1CVRA 2OCIA 3HVJA 2BOVA 3QPDA 1HT1E 4RJ2A 3Q7PA 5J1TB 3EMDA 1UEXC 1NW5A 1JLMA 1R0XA 2PGLA 1EUCA 2IIPA 2V7QD 3KRTA 3N2KA 3QHAA 4V0LA 4Y6OA 3WYCA 2WU1A 5C35A 4QU5A 3BCHA 1ECFA 2WTBA 2PJDA 4Z4GA 2F3TA 3EGXA 1FB5A 2PFKA 3O8QA 1REQB 1LVUA 1ORVA 1T5DX 4NBLA 4G56A 3W2IA 1K5GA 4EO9A 2HRZA 1S2DA 2HK6A 3LP6A 3Q8LA 1E4OA 1UMCA 3BDVA 4BZXA 3E9MA 2FRDA 3FPJA 4AY5A 1H4VB 3RFFA 4WKNA 4GF5A 2RI6A 5HE8A 3E0XA 1CQIA 1WVIA 1TECE 2E4WA 3PQ5A 1CQXA 4C6TB 1QZ3A 4AMYA 4FDVA 1EB9A 2H5LA 1EEXB 1S2GA 1D0IA 3PFNA 1KBOA 5F9HA 2YNMA 2PLWA 3TMAA 3ICCA 2IITA 3LRPA 3MLEA 1TDJA 4I1SA 1VBMA 3CN9A 2Z4SA 4R6WA 2NYVA 2ZIFA 3DCNA 1XQXA 2TSYB 4R9NA 1NF9A 1PJQA 4OLAA 4B45A 1N9GA 3OLQA 5LBTA 4JHLA 2EWVA 2LDBA 1BCRB 5H80A 3RNLA 2Q8NA 1TEHA 3J7TA 1ZR2A 4RJIA 4JEUA 4M1EA 2E5LB 1YB7A 1AXRA 1LSUA 4PYMA 5ESRA 3UOGA 3WO1A 4YRNA 2BE9A 2D62A 5E4TA 1UZUA 4TZKA 1U8YA 5F12A 3IEMA 2XMSA 4LYJA 3VRHA 2D0DA 2DUWA 4BFCA 4R2HA 4BNVA 3K4QA 1RQNA 4AT1A 4V1CA 1QB8A 1DAIA 2P9GA 3DZJA 5AOCA 1HWYA 1PYOA 3UMRA 4XB2A 1XPUA 2AFIE 4KO8A 4UVIA 4BE9A 2YJTD 2Z3ZA 4YEDA 2H4YA 4M98A 4N5LA 2H9IA 3T7CA 2GF0A 3UT6A 1HH4A 3A4LA 3ASYA 4FOTA 3LC2O 3UGKA 2RH9B 1HNNA 3IMFA 3L7NA 4FZVA 3WQRA 5JROA 1NATA 4HGPA 2X42A 2B1GA 2VRBA 1ECGA 4F3CA 1YI1A 3S2GA 3M1YA 3TJMA 1AMUA 1UZLA 2QPOA 4TXHA 4DA9A 2AMFA 1E3QA 4FFDA 3RUDA 1Q7GA 3NBYC 1HR0B 1BMDA 2XB4A 3C6ZA 4W8OA 3ZWNA 1EWKA 4BLSA 2IODA 2WUWE 2EC5A 3VR0A 5F1YA 3RODA 4YRFA 3R76A 2LCFA 4C0XA 5IN5A 1SWWA 4C07A 4AKGA 1DBPA 3DWGA 1OFVA 1XZCA 4Z1MD 3GMTA 5DASA 8GPBA 3IKTA 5E9QA 3KOYA 2O8DB 5JVDF 4DIOA 3TLMA 3C3YA 1TUGA 2FUEA 3INNA 1AE1A 2WMOB 2HYIC 3GLHB 2ZXUA 4GKJB 4MW7A 2FTKE 3DA8A 2ZJYA 1MPXA 2BMDA 1YL6A 4PLHA 5LIPA 1T5SA 1P8AA 2H63A 3HUEA 5CAEB 1ZD8A 4LV5B 1V4VA 3JVUA 4FDTA 1JG4A 1TZCA 1UPCA 5EAIA 2OHGA 3A05A 3EPRA 2F8SA 4ZV7A 4U2CA 1O54A 4AU1A 3ZCPA 1LBEA 3DVSX 5SZKB 4E4YA 5AVYA 1HY3A 3F6EX 4R7TA 1WF3A 1P2TA 2FP4B 4BEWA 3QU4A 4OP3A 2XWJI 2W2NA 2DE0X 1NBMD 2I78A 2E48A 6LDHA 5CIYA 1DTEA 4KQWA 2NN3C 1QFXA 1KEZA 5TXGA 1JLLA 3TJZA 5A0VA 3HKBB 4C0SA 2PDAA 3M4YA 5CXSA 1QMPA 1ZN2A 4MI3A 3MJHA 5B12A 2X1HA 4XX1A 2P0AA 2NZUG 1P33A 3MMNA 3MINA 4JKYA 4CIYA 5K99A 3A6LA 3QEAZ 1KZGB 1CR2A 1K1EA 2NSYA 2QORA 1CNFA 3OZIA 4WAUA 2NTEA 1ZO8A 1QIKA 2WYVA 1OC2A 2NSHA 3CA8A 1IXZA 1EQ2A 2Q1XA 3GLUA 3TM4A 4EUHA 1KEEA 3AR8A 1J8FA 2BFEB 2WUFA 1ZC4A 4BNNA 1MQAA 3GAFA 3NETA 1YGPA 4IVPA 3MGAA 1PR6A 3PVZA 3QEKA 3WGYA 2R5WA 4P8RA 3T35A 3ZE1B 4YPVA 5EE9A 1QF9A 4KXQA 3SYNA 5E1MA 2QN3A 2JFYA 2ZJ5A 4AG5A 3HSSA 4GMDA 5JFOA 4P2GA 1CJVC 5IHXA 1VJ5A 2FP3A 2EKQA 4H17A 1P9RA 2ZI6A 1PZFA 4V2IA 3ZHSA 2B8NA 4JMPA 5IN4A 4RLHA 4PGMA 2HA4A 1KSFX 5AKIA 4JJAA 1YIDA 5A71A 3A2MA 3FPKA 3PGXA 5JJBA 3DZDA 5A5EA 1M6YA 1PW5A 2YFHA 1SUEA 3PJDA 3C7DB 4AS2A 1BMQA 3L4JA 1VKZA 1NLUA 4B46A 2Q4EA 1AKVA 3AOEC 2D8AA 2FMIA 2GB4A 5CDFA 2ZWIA 1PVDA 5BN3A 2ZUFA 1ODKA 2IS4A 2X8BA 2XGJA 3IJRA 2CNWA 6REQB 2V7XA 4NZNA 1SBCA 1W29A 4CEIB 1JZTA 2C8VA 3DTYA 1R3DA 3LY8A 4CMGA 4XCQA 2F55A 3S99A 4CV1A 3FY4A 2Y1GA 3G0HA 1O8BA 1DEXA 4I2NA 4GOXA 3IDSA 3IPLA 3SC2B 4R5MA 2P3SA 1VG9B 1IRIA 1Y6RA 1MW9X 3V5NA 1BMFD 1UOEA 1MFPA 3L46A 4LMPA 4TZ6A 1RMTA 2HY7A 3OPNA 4HDSB 4RF3A 3RS4A 4C2BA 2C97A 4LHZA 5MGBA 2O52A 1M7HA 4OP2A 1NSTA 3HEAA 4KB5A 4PG6A 2IY7A 1EFRA 2WG2A 3QENA 2CJWA 4RTLA 2C9MA 1NXVA 3OQIA 4B4KA 4BP1A 2C4NA 3N3BC 2PS9A 4DEYA 1E7YA 4YRQA 3O8BA 1X38A 2FJ0A 1KS2A 3F6CA 1LW7A 4YRDA 1CULC 1DAPA 1X1CA 3ZHCA 4R1OA 5FR1A 3JRWA 3LDHA 4RLFA 5DGIA 4US0R 3OMLA 3PBKA 4RJTA 4W1SA 3D4PA 5F78A 3L0IB 4F1JA 5E6UA 2VP5A 1ULBA 2OHFA 2J9GA 2XUOA 3GZTB 1XL0A 3PDUA 4UMEA 2ZU6A 2B4AA 3RW9A 3F4KA 4AIRA 1O5TA 3UO8B 1U8CB 4WDQA 1ZITA 4LAFA 4GRIA 4NBUA 1IPHA 2GMWA 3AFMA 3JR3A 3I9LA 1FF9A 3PCRB 4G67A 4HGQA 3RF7A 4X61A 3RVPA 3RROA 1V71A 2PJZA 1IBLB 5EIEA 3EAGA 3HDJA 4NVRA 5A4IS 1G55A 1XXHB 3WBBA 3NHJA 1OFUA 1GPYA 2AOVA 4BFVA 4F12A 5M2QA 4GZ6A 3PPVA 2GPJA 1QGUA 4WY2A 3D02A 4NF2A 3ZYZA 2HXGA 3H2YA 5KZMB 1G8AA 1QU2A 2EWMA 3OVMA 3Q0EA 2PEZA 4LV6A 1KDOA 5ECWA 1YVUA 4EO7A 2HU7A 2MU1A 1RRVA 3PA8A 3SHQA 3UPDA 3GRFA 3OQMA 1HE4A 4EEZA 4J0KA 1R74A 3H4VA 4NG5A 1DKRA 1T8YA 2I71A 3NJRA 4HQKA 5EZ6B 3F71A 3ZHVA 3R6GA 3BFJA 4PX5A 2D3TA 3B52X 2HBYA 4OHVA 3VAAA 1BXRA 4HDCA 4BLWA 2X40A 4CIDA 2UYHA 3ICEA 1OKKD 2FJUA 2W6ZA 4HUJA 4N7MA 4MQFB 2Y9PB 1IFXA 1T2EA 3LO5A 5K3FA 1JQDA 5ALHA 1WNTA 4OG2A 5A3VA 3FYUA 1IHDA 1CNMA 4S0XA 1Y5NA 4HOYA 4ZCTA 2ID9A 2WNSA 2NZ2A 2YV5A 2XWQA 3CZRA 2I1VB 2D2XA 2MYUA 3BGIA 3Q1KA 2R7AA 1JZSA 4AZ0B 1NV8A 5JAUA 1RWNA 1LI7A 1USKA 4UBLA 4ETWA 3ELDA 3K0FA 3BIJA 3SC3A 2W11A 1DT5A 2XOKA 1Z5WA 3TOSA 4LKRA 3MN1A 4RVOA 3SGLA 4Y2VA 1WHSA 3FKSA 1FJGB 4NZ9A 3CPJB 1X74A 5ITWA 1XIVA 1ENYA 4P4NA 5KOJB 1A8IA 2RGNC 1UADA 1FRQA 4RFSB 1PSDA 4YRKA 2WD7A 3EXAA 1PEAA 3SIRA 3LBAA 4JYCA 5KJCA 1KSJA 2JGLA 4F1KA 1NMXA 5JFGA 3TIFA 2I6GA 1C8KA 1WEHA 3BAFA 3CRRA 3FWNA 3UMCA 1JKJB 1AHNA 2IUEA 2QM7A 4HB3A 3Q0TA 1XCMA 3UC9A 3CVXA 2J7PA 1B93A 3GLSA 4PFKA 3HXPA 2YW9A 2J1LA 3N7TA 1HE8B 4QO8A 4DZZA 3ZDZB 4AMUA 4EI7A 3CF2A 3LPDA 4NEGA 5D3MA 2V74B 4M76B 5T57A 2CCKA 1RFLA 2IDKA 1NL3A 3F5SA 1PT9A 3H4MA 4Y2UA 3BXZA 4Q21A 5EE0A 4LXYA 1KQGA 1AN0A 2EJWA 3AEUB 1IHYA 3GN2A 2GD2A 2HEIA 1YHZA 4X5OA 5J59A 5AIBA 2PMDA 2XTMA 2W0MA 4RZUA 4AZVA 4ONEA 1SZJG 1N2SA 3LQRA 4TTRA 2E5WA 2ZJ2A 3HP1A 3UANA 4C78A 3TG8A 2HA6A 2YUTA 2VZEA 4GLBA 2A1IA 2V9PA 4OXIA 4P08A 3HKDA 4DB4A 5B1IA 4EVQA 1NBIA 5TR9A 4NHEA 4KR6A 4RZQA 3L41A 1IM2A 2JBWA 2JNWA 4O25A 5AI0A 4BTEA 1I3MA 3AILA 2HLHA 3TIVA 4WVLA 1IBCA 4X20A 3WVNA 3JXEA 2XR1A 3B48A 3RG2A 2CSUA 2A2ZA 5BQPA 4QGBA 4QO7A 2D7CA 2IYOA 2MSWA 4UDXX 1QQ7A 1R9GA 3DYIA 2NG1A 3QBVA 4P4TA 5F9FA 3C5WP 5DV9A 1ENOA 2GNAA 1G8GA 3M6LA 4QG7A 5HVNA 1JJBA 1NBWB 4WXEA 1VRVA 1QH9A 2LXNA 3DTVD 1C3JA 4JB8A 2J9YB 1SVWA 1V37A 3TW6A 3H7IA 1G5TA 3C87A 4ZAXA 3ZU2A 4F84A 2NXJA 1K75A 3ENVA 3OY7A 5J2UB 3RYIB 4LXIA 3E3NA 4MGYR 4MI1A 1G8YA 4MR8B 1VKOA 4JUIA 2HTEA 1JPJA 2ZJ4A 3EPPA 4KBFA 4DJDC 4MKFA 2AG1A 4A8HA 5A2GA 5CUQA 2OCLA 1F38A 2IYTA 2UYGA 1Y3CE 2V7QA 2VH5R 1FJHA 4PLGA 3U4GA 2E6UX 4H15A 4Q3EA 2OY0A 2ZSDA 1YZVA 1Z6AA 5DX8A 4BZPA 2QLMA 3D3KA 4EUKA 4W8GA 1QGZA 1E0DA 1L7OA 1EFLA 1BQ4A 2DF8A 2MSKA 3EF1A 4M22A 5TARA 1OZHA 4A2PA 2EW2A 4BS9A 1Y8QB 4Y6LA 5AVTA 1KJWA 2JJ2D 3SKYA 1DPGA 4WKCA 4PZUA 2XCOA 3CUKA 3WSTA 2KLBA 3MWFA 4YI5A 4O1IA 4WN9B 3N2YA 1NVGA 1ZCAA 5AO9A 3LLMA 1MOPA 1KPIA 4BJ6A 1X19A 2WD8A 4WXMA 4G85A 1MUUA 1SRQA 4CF3A 2QV7A 1Y3DE 2OR3A 2RHJA 4HVAA 4M0CA 3ZTWA 3MCTA 3BT7A 2FWJA 3I34X 2XNSA 2F9MA 1TO1E 1UK7A 3BCUA 1NZJA 3PWZA 5CVJA 3KTAB 4PYJA 3W8FA 3PHLA 2HCFA 1GUAA 3CJQA 1Z74A 3U1TA 4AK9A 2HF9A 1I0IA 3BILA 3CZQA 4RGYA 4I5FA 3FIJA 1UBFA 3FRHA 4O4IF 4PY2A 3ZBTA 2C7BA 3AVOA 2NTVA 3GPLA 4KRYA 3UT5A 1GQQA 2W37A 3NHYA 4K7JA 5DCYA 2PUTA 2AI3A 4L76A 1ORIA 2IYYA 3FSGD 4CF7A 4OHBA 1PJTA 2HNKA 4PHFA 2BHRA 2OBYA 3JD3A 4XVRA 3LVRE 3FUCA 4FYWA 5EJGA 4AJ1A 4ARBA 2C03A 2O8BA 4KPUB 4AMZA 4QXQA 1P17A 4EY6A 2MINB 1M2VA 1UDRA 2HSZA 2V58A 2Y3IA 3A1NA 1C41A 1JHUA 4MUGA 5FFMA 2GVNA 2HT6A 4RMJA 5EMJA 3U1VA 2P9TA 2QMOA 1BC5A 2BBSA 3BS4A 4EQ6B 2D1QA 2JCBA 3DZGA 3NQ41 4OMDA 1B0UA 1MLDA 2WIAA 2V6BA 4FOOA 3K1TA 4FDAA 4KDFA 2PPLA 4RL6A 3WLOA 2FAXA 1E6LA 2G4CA 4L7QA 4D0NA 2JGDB 3L7IA 1WW8A 2RHRA 3DDOA 3P2YA 2BH9A 4HDMB 4UEWA 5KQSA 4Q7MB 2ZIXA 3K09C 1VLHA 4EL5A 4OX9B 1V11B 1WSAA 5ECDA 3LKDA 5B6JA 1VMEA 4LBYA 4ZYVA 1AUVA 2DX7A 2PSSA 3IAHA 5DGCA 3FCXA 4ZHSA 3SVLA 1UC9A 4I55A 1O3YA 1A5SB 3CC8A 1L2TA 2M1ZA 2XQGA 3CLTD 3O82A 3E5HA 3OWOA 1ABFA 2IZ0A 2FXIA 2PZFA 3DB2A 1WPRA 3K1JA 4GPBA 3TOZA 3UXHA 5EJ8A 1WZUA 1D0SA 5AJHA 1PJZA 4L4RA 1GNLA 5K0TA 3U61B 1B1CA 2AZ4A 3I5AA 2YR0A 4D8TA 1TEZA 1Z82A 3FB4A 2ERCA 2VF8A 4RHCA 1F7UA 1T5OA 4RUKA 4WIAA 1E77A 3ID6C 4RABA 2H6EA 4DIDA 4N5DA 1A9OA 2VDVE 2ID8A 1Z83A 2GAAA 3LNTA 4O4LA 4DDVA 1BGXT 3EFBA 5C7YA 2BDEA 4OBBA 1AKNA 3FFTA 1TM7E 3BZUA 3DKIA 5FI1B 1KI9A 3KT8A 3WGLA 3AQIA 4DKXA 1KR2A 4E1VA 1ZI6A 4YJGA 1NJGA 2EBFX 3B9BA 3IS3A 4R1LA 2OFFA 3VUFA 3FNRA 3OCXA 5IF9A 4CGZA 2IP1A 3W2TA 5CB4B 2Q2VA 2IPOA 4GGPA 2XE6A 4IVRA 4ARSA 4DTIA 1RQPA 1N6LA 5GM1A 3V2UA 2PX3A 1DC4A 3KVYA 3P5BA 3K9BA 2NYRA 2V8OA 2ZRLA 2W58A 4B5LA 3MMSA 1RXVA 3MFYA 4CDMA 4CQMA 5IWAB 2VA9A 4N76A 1XRRA 4EG3A 1OGYA 3Q12A 1NBMA 3ET5A 4B6RA 4DBZA 5ESXA 2OM2A 3BZBA 1CUVA 3FROA 1O89A 1H22A 3LDAA 3QI7A 3QKSA 3OC0A 4MW1A 4BNMA 2G0NA 4BB5A 1USVA 3DUWA 1J2YA 4DV0B 4OQ4A 2HIHA 1OU0A 3BH0A 3KJGA 3NTLA 2QJTA 3QWIA 4V02A 2H08A 2ZAMA 1T34A 4JBWA 5IDVA 1MTZA 1NN5A 3CF4A 1SQ0A 3PU6A 4YV1A 5LYYA 2ZU0C 2FEXA 4II7A 1VYUA 2AJDA 1A88A 1PO7A 3ELUA 4LYGA 4R1NA 4BMVA 2QVZX 4JR1A 1CR4A 4KO3S 4JYPA 3KWLA 4MVWA 3S3TA 3KKEA 4LFAB 5KQRA 1ZK0A 2BEWA 2OBNA 3OKPA 3E1KA 3NVKI 2ZBFA 3NX4A 2XOEA 4G4GA 2BLLA 2WZBA 3PYXA 4MVYA 4WT7A 4QDXA 2AKEA 1FDUA 1Z47A 4MZDA 4RZHA 5BSMA 1FQKA 1O96A 1JHPA 4TUYB 4LSWA 2PKYX 4FYJA 5CFMA 1UBOS 3PC7A 4LX0A 5JD3A 1NJ2A 5MN6A 1DKLA 1X3SA 3VHXB 1KAHA 2FPKA 3SF8A 5C8DA 1FIUA 3MMPA 1CZNA 4HNRA 2G82A 4RK6A 1VSQA 4S0ZA 3AIIA 4DR3B 4G26A 3CZCA 4MR7A 3D81A 3ROGA 5JMWA 2WF8A 3PXXA 1YA6A 2VZ8A 2JPDA 3MK31 4FCCA 3RNOA 4ZHQB 1DLIA 1JSCA 2ZSIA 1ZN8A 4P53A 2G3YA 2WRZA 3IKMB 4YMLA 3CRZA 2DETA 3IP1A 1DG1G 1OOEA 4N01A 4U3JA 521PA 2ABWA 1ZQ9A 2OLKA 3IUNA 4PO3X 2OO3A 5AR1A 2XYQA 5SY9A 4EKIA 2PUBA 2JLWA 2E89A 1ZJYA 3P20A 1T0PA 2GI4A 2I3AA 3M3PA 3IIMA 2FF5A 2DR0A 3K5WA 4LZPA 5EUQB 4GZ5A 3BWDD 1COWA 3RH0A 3HGQA 4KCGA 5B7QA 1QF6A 1U3CA 1ENPA 1XMIA 1JI3A 1DG3A 1TCUA 2J3QA 3U17A 3B1YA 2G9NA 3E5NA 4HFNA 3TI7A 3GHHA 2X1VA 3PPXA 3WHIA 1NNLA 4LW8A 4JIGA 2WT4A 1T4GA 4FHGA 3FZNA 4DJAA 3K30A 3K94A 3I1FA 2RGGA 3ZXXA 1K63A 2PRSA 3O4GA 2HL6A 3TRDA 1P7ZA 4HADA 4KE6A 5IMSA 3EQ7A 1XB2A 3MGCA 2RH8A 1TJPB 4NBSA 2X5OA 2B3DA 2CLHB 2H65A 2JKVA 3TR6A 2XT6A 3JASA 4ADSG 3AEQA 1F8XA 1Y33E 3SMVA 3N70A 3QFCA 3LZDA 4IHJB 3CJTA 4P5PA 1M1YA 4P3OA 1JEYB 3LX5A 4NCAA 2IEZA 3CEJA 3A3NA 4MX8A 4XEHA 2PUJA 1NT2A 1W5BA 3GYBA 2VS1A 3W5HA 1JFFB 2G76A 2JC3A 1OJ7A 3CNHA 3FZGA 2HHJA 1NVWQ 2J0UB 1U7OA 2OG2A 2P4SA 2R11A 1MN6A 1UMBA 2WUDA 3KJXA 4BFXA 1K7CA 4HWOA 4NS4A 1Z25A 1YTLA 2H4FA 2GZDA 2R47A 2FKNA 4UEKA 4OSPA 5G4LA 4XGRA 1XCBA 4NULA 4KPFC 4TKMA 5IH3A 2VBFA 1MXHA 2YFQA 3SHOA 5GIOE 1PQUA 2D13A 2Z8YM 1ZNXA 2WR8A 1M6WA 2AG8A 2V65A 3OETA 4JJFA 4KUEA 3CW8X 2Q9BA 4K9RA 4QDTA 5AVXA 2BFMA 3NEYA 3NM6B 4DZTA 4TMTA 2OBBA 2P0YA 5EGSA 3HFGA 3LUCA 5E4JA 4NFYA 1G1AA 2RGCA 1ZI8A 3ISVA 4BOYA 3TW8A 2EJBA 5HZMA 4ZXPA 2KBFA 3TBFA 3QX9A 1TGYA 3OZ7A 4LKOA 5A05A 4I4NA 5B4UA 3TQFA 1E1KA 4ZJUA 2YRXA 1VDMA 4B3MB 4B31A 1THGA 3A4TA 2YWGA 2IPNA 3BXFA 2VP2A 5C8YB 1SXJE 4HEJA 4TLBA 4PIPA 4E2FA 1RIIA 3AB8A 4IDOA 3A06A 1LPBB 2VTBB 4U8HA 3SQXA 4CRWB 1E5TA 3BKXA 1TF7A 1K6XA 1OKKA 4B6EA 1GA4A 4R84A 4EECA 3I37X 4WKOA 5MN5A 4XWWA 3OZGA 2IJGX 1ZOPA 2P90A 3VH4A 4MH0R 3AXSA 4ERNA 1BSVA 3F6SA 3ND7A 4Z6KA 5IBRA 4Q3BA 1T3ZA 1QH8B 3GVIA 4XQ0A 3RAJA 4CPDA 4LBWA 3C8MA 5BT9A 2C5EA 2ZAGA 4CCAA 5FLXA 2ZCJA 2CD9A 4OHZA 1Z0DA 3AB7A 3MJVA 1NUHA 3WK9A 3RU2A 4CLRA 2XCLA 4Y7CA 1U7ZA 3OIDA 4BB0A 4GPIB 5KOHA 4JX8A 4NU6A 3WQSB 1U2DA 5E95A 1G9SA 3UIEA 1H23A 4R9VA 2XW6A 4M8NE 4UASA 1HLGA 2BMFA 4IDPA 3EPHA 3EGCA 2XNKA 3D64A 2RGBA 3HJGA 3C8DA 2OE2A 3IPAA 3NYWA 5IARA 4Q9IA 2OPBA 3ZZMA 1P1IA 4PIMA 3JQGA 3RT7A 2XUIA 1AKYA 3JQPA 4P35A 1D5WA 1DQRA 1AQJA 1V5IA 4XYBA 2O2SA 4QGSA 1G7RA 2P5TB 3BHJA 4C7BA 1X7XB 1P2GA 4C1BA 3AUAA 3ORFA 3U9TA 4ER5A 3FPGA 4XIYA 3PR3A 1AO0A 1A9PA 2G04A 3KIPA 3AJDA 4LJ5A 3ROKA 3TD9A 6ADHA 1ODIA 2R8YA 1ODCA 5JQWA 1MTOA 2CXQA 5FNVA 3JALA 3LBFA 4WBNF 5KYTA 4QHSA 4YT2A 4HYQA 2IE0A 1KBZA 2O23A 4QSMA 1L5KA 4D3FA 3GA5A 4KVFA 5FUYA 1C0IA 4I19A 4M88A 2OCGA 5E9WA 5IWCA 2CK3D 5TQ2A 1UKZA 2LZ0A 3IXLA 5LQUA 3HU3A 5DHSA 4D46A 4RTKA 5B3AA 3SR4A 1VIVA 5EEHA 4PAWA 1F6BA 2VTEA 5EWLA 4ZYWA 3VZRA 4BNXA 2QNRA 2MYTA 2YYZA 3PD7A 1JU3A 3WKAA 2OBFA 4MLDA 1P1KA 4KTTE 4MQ6A 4QPNA 3X44A 3GLFE 4JBYA 2ZYTX 2F3SA 4G8CA 3QBDA 3CO0S 2W90A 4U6SA 1OX6A 2OZEA 3HZHA 4EJ6A 4RORA 4AQYB 1GLVA 1JVNA 1VL2A 2L2QA 2ZYWX 2QP4A 3FOBA 4INOA 1RYZA 1A9TA 1U28A 2WNHA 2CVPA 2XGGA 3B60A 3I83A 1MC8A 4Y2PA 5DRYA 3ZH2A 2OUKA 4A91A 4E07A 1UJNA 5AXAA 1KMHA 3KZKA 2XI4A 2A3NA 4KWTA 5DOVA 2YVUA 1G16A 1PV2A 4LE1A 4NEHB 4EJSB 4UU7A 4B2LA 4MV7A 3WKBA 3CBGA 5KNDD 2CMFA 1ONPA 1R4ZA 4KUGA 3WRXA 4BQRA 1AURA 4NQZA 4BIMA 4CTJA 4YJHA 3K05A 3K73O 4L9AA 1IXRC 4QJIA 3GDHA 3A6GA 5C4IA 1T2DA 5KDOA 2PX5A 1UWLA 3OE7D 1GGEA 4RPLA 2P9QA 1N5DA 2G80A 4QRHA 5BMVA 1N5IA 2AW5A 2H4WA 3GI1A 1W85B 3T61A 3FW1A 5CCEA 2H57A 2P2YA 4TS9A 2HMWA 3F98A 3ETGA 3H2BA 4B87A 1JH8A 1HEIA 1F9EA 4HAWA 5BXQC 3GLGB 3A8TA 5J4KA 4PCAA 1VJDA 1RTKA 1YK0A 3UG6A 4R9UC 3UW3A 2Q3BA 2VJBA 1N6IA 3RVBA 4AM8A 3TMYA 4C5AA 3WZ2A 1E8DA 1TYAE 4GFDA 5HG0A 1YS9A 2GRJA 2QQEA 3CCCA 3Q9UA 4UCXA 2W8BA 3OE5A 4OLHA 3DDNA 1GVHA 3KBBA 1A7KA 1GPJA 5LD2C 3UKDA 3B38A 1XQ9A 1JIXA 3KR1A 4G1CA 3O8RA 3ZE8A 5DCUA 3THWA 3PZRA 3U44B 4CF5A 1CERA 2BH2A 4BKOA 1W88A 2CLLB 2GCGA 2Q0QA 3KPVA 1R1DA 4ASUD 4DAOA 2EHDA 1SWVA 3D1JA 1GAJA 4W9RA 3TUJC 3LY9A 4C29A 1JZQA 1JG2A 2CNNA 4IFTA 1CUHA 3NUQA 4AP6A 2ZRFA 4QOFA 2C2HA 2BFCB 2GA8A 1CEQA 4GM4A 3BHMA 5ALKA 3FG9A 3CH4B 5JTTA 5AVVA 1D2EA 1Q57A 2GJAA 3DDZX 4DG5A 2GSWA 3LFUA 4CMKA 1G5IA 4D8XA 3SYMA 1VE1A 4E1BA 3NG1A 1X0XA 2XUJA 1JWBB 1YZ3A 3A31A 3QU2A 2OYCA 4BGVA 1J0XO 3AI3A 4E2WA 2B8TA 2PRIA 4GL4A 4EYEA 5JADA 1E2FA 3B2NA 3WDSA 3IMGA 5H4GA 2DH6A 3IEKA 1PK8A 4RDXA 2QVBA 3CVUA 2X3UA 3GR6A 4G0XA 1LFAA 4G6ZA 2QTGA 2JK1A 5CBPA 4IDCA 3PHIA 2JJ8A 3UMGA 4UNRA 2B98A 1YZLA 4FFLA 4RO0A 1GZ4A 1JG1A 1BS2A 2QRNA 1DBRA 4UNPA 5EZYA 5EP2A 2QRGA 1OPXA 1MJHA 1MEJA 2P9EA 2W6NA 3PL5A 3K5IA 4ACAA 1PCXA 2L0XA 3RTCA 1PT5A 3MCWA 4J3FA 4PSKA 4RVFA 1SOUA 5CFPA 1I3KA 2AT1A 1I7NA 2F62A 3WMGA 2FEOA 3F7TA 4TGLA 1XJCA 4BB9A 1TF2A 3M4ZA 1OZGA 1UKAA 3DEHA 3EUEA 1J2UA 4IQ0A 4ARZB 2HADA 4BNDA 2OZLB 5GMOA 5H0IA 2C4WA 2R2GA 3AEYA 4GH5A 1V47A 4ITUA 1DIHA 3W7VA 1YR2A 2RJ3A 4EATA 3HH8A 3OC6A 2FX2A 1KVUA 1QBGA 2JGKA 5KNLA 4WLFA 3G88A 5IULC 4CT5A 3R0VA 5FB3A 2H52A 1SUIA 1UOOA 3I53A 2R25B 3B9RA 1UDBA 2Z3VA 1ZRSA 2FPSA 2V3VA 3CVJA 3QM1A 4YTEA 4AWAA 1IAQA 3CG4A 4YS6A 3TSOA 4UMFA 3WLSA 1ONBA 1FXWF 1CETA 3HXTA 1FX0A 4P7KA 1LNZA 4CEHB 1HE5A 5D1NA 5CP8A 2BJVA 2VPZA 3UVEA 5BWLA 3RGGA 3N6RA 2UZAA 4CXMA 1RXCA 3UFXB 3PTLA 5IK2D 4BXOA 3LLSA 2DJIA 1SG9A 4HZUA 2WTUA 1EAMA 5EI5A 2M2IA 1FNMA 1LY1A 3OD5A 3CNNA 1PFQA 3MWGA 4Q03A 2ET6A 3G6KA 4MVJA 3B5IA 4EPTA 2W6JD 2ZUUA 1ZW1A 3Q0IA 2I2FA 1T9HA 2EGHA 3KJZA 3EOAI 3ZE2B 4UBJA 4J49A 5FADA 2VPTA 2XODA 1Q0HA 3DW1X 1NVTA 1ESMA 1ZDMA 3FYCA 4WXYB 1EKXA 4ODIA 3VR2A 1MJGA 3CLVA 3HNRA 1C3OA 1MRZA 3MWLA 2IYUA 3FTDA 3PUYA 4QXRA 4KR3A 1KY3A 1OVGA 1NE7A 4L2IA 4RD2A 1RRCA 1LTHR 1NM5A 4HNTA 1T4DA 3L7LA 2E4AA 4MV5A 2VQ3A 5EE1A 3V46A 1GYPA 3PDIA 2V9CA 1EE2A 1I33A 2FSSA 1YOVB 3L6DA 4PW0A 1OU4A 2IYWA 3DNFA 3R74A 3WXMA 3G59A 4NZOA 4L57A 3EIFA 4YXWA 4C88A 3WLPA 2C8JA 1NVMB 2P75A 3E1GA 1DCTA 3EVAA 4FMCB 1Z38A 1G0OA 4M4SA 2Q6VA 1BHJA 2YY5A 4M9SA 2C5HA 1T4CA 3IUQA 1EWYA 2Q3CA 3KZXA 2X5NA 3OOEA 4GLJA 1KC3A 5TDHA 3NKFA 4M8KA 1WD7A 1G1MA 2ZPAA 4AUNA 1DADA 3H1AA 1U98A 5BYJA 1IJBA 3IBCA 1IL0A 5TQ0B 4D9NA 2CMKA 4J7XA 3WSVA 3VKFA 2C1EA 5I3CA 1WJGA 4M8SA 4BWYA 1BOFA 1QO0A 3AUXA 4YHBA 4UTRA 3RPEA 5AMXA 3P71T 2AJBA 1OA0A 5D2CA 3N2LA 4QQNA 1QQTA 2LCIA 3R3HA 3DPSA 2ZTLA 3WYGA 5KHLB 2GZ3A 2A5FA 1V4BA 3K9HA 4WA8A 3JQ6A 2GK7A 2AX4A 3KQTA 1GPKA 4QYMA 3IQHX 3WYNA 2NO4A 3E9EA 3WWZA 4PPQA 4QDZA 4D5EA 2IYRA 2JF0A 2UZ3A 3CR7A 1E2LA 1REQA 3IMCA 3NXSA 4GP6A 3ZGOA 4E94A 2ZGVA 4ZU3A 5CVUA 4RXTA 3QBEA 2R44A 1JBKA 2L82A 3HA3A 2PD4A 1ZMXA 2JANA 3PWKA 3QITA 2J07A 4GR9A 4DPMA 1T6XA 4DSUA 2WPDD 2XZLA 2RGXA 4Q34A 2IW3A 3NVMB 4W1PA 1FFXA 3KR9A 5DOZA 2R2AA 4PHTA 1ZD5A 2XV1A 4EGCB 4H1TA 4KP7A 2ZCUA 2HPAA 4DA7A 4ZEMA 2C1XA 5LLDA 1M6EX 1I14A 1V8ZA 2XY4A 4IW3B 3KQUA 1KZ4A 1ZCZA 4BNFA 3KYCA 4M7PA 4Q4AA 3DE7X 1V8BA 2Q3FA 4XB6B 1EX1A 3IAFA 1IN4A 5L7WA 1PHRA 2YOGA 3EXHA 4GPZA 4KIFA 2CCGA 3HACA 1KH2A 1QFZA 1GR0A 1U94A 2QR5A 3OEEA 3OQVA 4MA0A 3W1WA 5K3EA 5L45A 2ZXEA 3LHDA 3ZGVA 3OURA 3WL6A 1HE1C 4BVEA 3G8BA 4DQLA 5ULLA 1JXAA 1I1QB 1CNEA 2RGWA 3F3KA 1BCRA 5ANRB 4ZMSA 4EI2A 2G7MC 4F45A 1GJRA 1A9SA 4KOAA 3VM6A 2WVHA 2ZRMA 4V1CI 3NLLA 1UT6A 1XTKA 2AEJA 3AF1A 3BIWA 3FKQA 2FH5B 3E3AA 3JVIA 1KPGA 4B4UA 4EP1A 1QONA 1W25A 2FJPA 2VUIB 4YP9A 1UCFA 4Q93A 4QTUB 5EHGA 1GY8A 3AUTA 1UEJA 1OV4A 1OLXB 3D6FA 1NDHA 2ZVQX 1C2YA 1BN6A 2CYBA 4QNRA 5DYNA 2GN1A 2WQ7A 2P2DA 2C9YA 5JU6A 4Z4EA 3DEIA 2W42A 2XNCA 4Z3DA 1CDEA 4RCVA 3REGA 4G8JA 1EFDN 3O26A 3I64A 3KOOA 5HKOA 3IE2A 3URMA 4BQIA 5AESA 3PIIA 2BCGY 3UK1A 5EEGA 2QT0A 3PLAE 1U2EA 3DV9A 3R0QA 2XNJA 5F3RA 3H5IA 1L9XA 2FWPA 4RHTA 3U39A 2TECE 4OQQA 2EZTA 1M2FA 2BGUA 4OD0A 4M36A 4S12A 2H2IA 1J8YF 3B5JA 2GD0A 3V8MA 3MWEB 3ZHXA 3AH8A 2PKEA 3JY6A 4KQJA 2C0CA 4NMLA 4QT0A 3FUXA 5I3ZA 4NCJA 5DN6A 5HK9A 3VX3A 4CUJA 1R9JA 5CPFA 2QROA 1A9RA 3PEEA 4XJTA 3II6X 3N28A 1ICIA 2DWCA 3VPXA 2AB0A 2VATA 3QLUA 4R16A 4URXR 1NQAO 4RZ3A 2O8DA 1WP9A 2I87A 1IHUA 4J9VA 1K6EA 2ORWA 4DTCA 2PGAA 4GKBA 4UMDA 3ZE7A 3NGXA 3W05A 2H1HA 3GLHA 2E4XA 4NOMA 4OI2A 1QLJA 1MJNA 1MIOB 3GEDA 3GV0A 4J94A 4BAGA 5KKAA 1FSGA 5CAEA 4DY6A 2AWNA 3ZV7A 1MAHA 2QA5A 1RLIA 3LGAA 3VNSA 3T9FA 4CFSA 1PAUA 1U8XX 5JAOA 4KGVA 3NHRA 4URFA 4FE4A 1QYWA 2DU8A 2QUIA 1T1RA 2BHSA 2PO7A 3EEFA 5IVDA 1MW8X 4ZZ0A 2CSXA 1VCNA 1ST2A 1YF3A 3D0QA 3R0JA 1TOAA 2C4KA 3IBSA 1FP7A 2FP4A 4PXYA 2WTNA 3MAJA 3S2EA 1ABEA 3CB2A 5IAJA 4M38A 2EFJA 2O8EA 1VJ0A 4HNQA 1XMXA 2AOUB 3N8DA 1FOEB 2V45A 3VNAA 1Y6FA 3JQ8B 1SU4A 3QELB 1ZVJA 3HKBA 3QK7A 5LL6P 4ABYA 3ZJ5A 4LHWA 5HGXA 4KFRA 3OPMA 1GSOA 1NRXA 1R6DA 3OKFA 1T91A 1YRHA 4M89A 4ND2A 4S1TA 3TD6A 4LVOA 2CJXA 2LR0A 3G2PA 2C4MA 8LDHA 3I3OA 2OQRA 4BX2A 1ADGA 3THXB 1OXVA 3ETEA 3VSCA 3T7EA 3GMDA 4Q66C 4UCQA 2BFEA 3MUEA 4XJXA 1AQLA 4DV4B 3FR7A 2XD4A 4PRKA 1E58A 2ARKA 4P80A 3WWYA 4CLXA 2PZJA 3BXHA 4MB2A 5CJPA 5K0GA 2PPVA 1P5RA 3PQ7A 4I1UA 4I50A 3VI4B 3U31A 3NHSA 4Q19A 3ZY3A 4YAFA 3AVXA 2R6CA 4ATNA 1XQ1A 5C5EA 1EK5A 1P61B 2R6FA 1V7PC 4HDRB 4WV3A 3UK6A 1N6PA 3O31A 2JCGA 1RCUA 3QPVA 2AJCA 4KODA 2GCIA 4UEJA 1UL1X 2CZGA 3QEMA 5COBA 5TVGA 4CM3A 1HDZA 5JCZA 2OG1A 5THQA 3JQRA 3Q10A 1IN1A 4ARCA 4D82A 4NI5A 1E2UA 1E3TA 1KAEA 3TKYA 2YZNA 1J07A 4NFLA 5AI6A 2XKBA 4L85A 5MFPA 2IS1A 4FWIB 2JJMA 4QRIA 3ELWA 5JCJA 4GICA 1FFSA 4N47A 4ALKA 1ADCA 4AJ9A 4B79A 1IY0A 1SNYA 2C00A 3LTNC 1KFJB 3K70D 2X2OA 2X0EA 4B83A 4CEIA 1JDPA 3HUFA 5KMGA 1DFGA 4Q9HA 4YN3A 3KAPA 1JF8A 1XYVA 3FHCB 3QNWA 3UXMA 2JLVA 5F7JA 4EB8A 2JFHA 2XCUA 1UWKA 4N7JA 3VSEA 4JJ8A 2QN1A 4PQFA 1PQYA 2GPNA 1N57A 3ZWWA 4CM9D 4EUSA 1XMQB 1D2CA 4LRTB 1TF5A 3FMVA 4NBRA 2VXBA 4GOLD 1NHGA 1W96A 1YCHA 4J2TA 3I5XA 1IWOA 3I2YX 2W6IA 4ITVA 2CZCA 3OJEA 5HE9A 1FNBA 2QLFA 3WGJA 5JATA 4LK2A 5KVSA 1RHRA 2GBFA 2J3EA 2JD1A 4NSNA 3K2IA 2Q7DA 4EPWA 1EHIA 3A3KA 4OBWA 5FUVA 4WNAA 4AZSA 3FAZA 3L4BA 4PR3A 3UY4A 4ZFNA 1KXZA 5IXJA 5JXJA 3VVMA 2PH3A 4B6GA 2JLXA 3TRHA 1NSYA 4W1QA 3LGSA 2EKBA 3NH6A 6CHYA 5TPWB 1ZD2P 5ESWA 4BO6A 1EGVB 2Q28A 5FEUA 3QXJA 3QY9A 4WCFC 1FC0A 4ZKEA 5I9NA 3H99A 3ABIA 4NATA 4UU0A 1NF8A 1QX4A 3O3OB 4NV1A 3W8RA 3EGDA 1DC5A 4ZVNA 1JV2B 3CURA 2RHTA 4JBHA 2V0CA 5FOWA 1PGQA 4EY3A 3CNOA 2PCJA 1UBEA 1GCUA 1HK7A 1E7MA 1I8TA 2A9RA 1YBVA 3GRRA 1BMTA 2DP4E 3ENQA 2HREA 4FZJA 4KL8S 2ZSBA 3JAKB 4W5TA 5AUQA 3QE9Y 4H1WA 3F8SA 4M0DA 1A8QA 3KSAC 1QBKC 4PC1A 3IQWA 3DOFA 3BMXA 5K2OA 1WXFA 3JD2A 1ISPA 1BG6A 2BMAA 1JHAA 1CR6A 2FHPA 2YS6A 3OMXA 2EZ4A 3QMMA 1SU6A 1XXHA 1WR8A 1M9NA 2VAPA 2WHPA 5KOYA 3FTFA 5AYVA 4NH0A 3TW0A 2ZT8A 3AU8A 1E5XA 4TS1A 2ZJ1A 4Y6SA 3UV7A 5KU7A 3OG9A 3CMCO 1XCJA 2ETXA 3AY6A 3OZBA 1H6BA 1Y8CA 2JIZA 3EZYA 3LTEA 4JI7B 2JLRA 4O4LF 5HF8A 3W5CA 3F49S 1ZHHA 5EMLA 1ISRA 3VC2A 3K9NA 1YGYA 1DT3A 4ZTBA 4DCCA 3NVAA 2DTXA 3EH2A 1AD2A 5EXSA 4CKYA 5BSUA 1J09A 4YJ3B 4ALJA 3BEDA 3NIGB 3NDJA 1CUSA 2G67A 3D6AA 4DVJA 4RVCA 4HYEA 1XX6A 2QM0A 2Q3DA 1QP8A 2GUWA 3P32A 4E14A 1T2FA 4O2BF 4MQFA 1SUSA 1QB7A 2O2CA 3EGIA 2NU8A 5ARBA 1NR1A 1IZ7A 1HYGA 2M9MA 3AIOA 1MCZA 4LTDA 1DUSA 2ANBA 1HTBA 4N0PA 3DOHA 2I3GA 1PDWA 4MS4A 1PK9A 1R8QA 3HSYA 3UB4A 5HRCA 5JIBA 1J9ZA 1SCBA 4RKYA 3RC3A 4NOKA 1M10A 4OGKA 3ZCTA 3I4FA 4WCDA 2BBTA 2OD2A 1OXXK 3GEGA 2H4XA 2VJPA 5HFJA 3WB0A 1KQNA 4AZ3B 3DAYA 3R20A 1HDRA 3GJXC 2YMPA 2H85A 2REBA 2Y8EA 5TE9A 1MABB 3BMOB 4GXQA 4MINA 1U31A 4R40A 4BPRA 4L9WA 3VO9A 5C5DA 3EOZA 5JMOA 2I2WA 1EBUA 1PV1A 4FZ5A 1U9ZA 2FR0A 1Z2PX 2CL5A 5IK2A 1RKUA 3FWYA 4H1VA 2GASA 4R9RA 1NLMA 1Z4KA 1A77A 3UXEA 1P9LA 5C7IO 2HXYA 1H05A 2YXDA 4M1MA 4YI3A 2I34A 1SOMA 2QSUA 2R5FA 3ESXA 1LC0A 3M83A 4IGAA 1G5FA 2HA5A 2PLRA 2W6JA 5ERXA 2OV4A 5M04A 2V6GA 1HRKA 4RSRA 2ADFA 1PLKA 1PL8A 1R0CA 1NMEA 1OFTA 3EXEA 3RE1A 4GEKA 1MDFA 3LY5A 3AEUA 3DPUA 3SHTA 5KJFA 3D6NB 2XYPA 3D0OA 3RTBA 3FMGA 4Q9JA 1NQXA 4LOAA 1UBUS 1F1JA 2AWOA 4I8IA 4MRPA 5EVCA 5L7TA 5TIIA 2X8JB 2UXBB 3VNBA 3OUTA 3WNDA 1Y8RB 2ZUBA 4JLVA 4MUNA 2FDCA 1B23P 3T7IA 5JSZB 5KYKA 1USIA 2ECOA 3UJCA 1DDIA 4GX5A 4ZCRA 4H16A 3PQ2A 3K9WA 4PZ9A 3SN6A 3ABQB 1U2SA 3GPCA 3NYRA 2GAIA 2RE8A 2C8KA 2EP7A 1NVVR 1L3BA 3LU1A 4WKPA 2VCHA 3P2OA 1TMYA 4LY3A 5IC4A 3NB0A 4DDTA 4OQFA 4CL2A 5DM1A 3K6JA 4E6PA 3IAUA 2RG1A 3ZGZA 2O2IA 3DHEA 4BO7A 1BQEA 1HT3A 3KWMA 3NM5A 1T3LA 4YUVA 3NV9A 4YLYA 3VISA 2I54A 4YALA 5GP1A 4N5MA 2IWHA 2OWDA 3ZQ4A 5BR1A 3U4DA 1CUGA 3HCCA 4KQKA 3WADA 4F5DA 3U3OA 3TRFA 1H1LB 4ZMBA 3RRYA 4URVR 2QQ0A 2HPVA 3L40A 2D1FA 1J6UA 3KKNA 1Y1RA 4FI3C 4MEAA 4I2VA 2YIDA 1N7JA 3NPMA 3V1KA 4PRYA 3RYIA 1YQQA 1M1XB 2RKWA 5F2EA 5J2UA 3K0AB 1QNLA 3KSUA 3DDUA 4MR8A 1Z2DA 2QBYA 2PZEA 4RVHA 2WAYA 2GBLA 3K0SA 5F7ZA 3T5GA 2C3UA 2IU4A 2QMYA 3EQ8A 4XUEA 5C1DA 1N2HA 3F46A 3OF2A 1D8TA 4O59O 1H42A 4EKEA 2NXCA 2D00A 2IIQA 2VKQA 1N1GA 1QYXA 4KQ6A 5A03A 1U1IA 4F9GA 3MRXA 4YCNA 4Q48A 4R98A 3O8NA 1Y8QA 3UUEA 1YFLA 3IVAA 4LZAA 1YUMA 3ZZ1A 3U13A 2UUOA 1ZUHA 3DE5X 2ZK7A 1OV6A 4QARA 1KJIA 4BASA 3EZ6A 821PA 2V1UA 2ASEA 2WIGA 4FZRA 3M49A 5DTRA 4F4JA 4QTTB 3BK2A 2GDZA 3ON5A 2Z04A 4IDFA 3QVWA 3TIXB 4RY8A 4YYZA 1E7RA 1Q0QA 1M2EA 2D2VA 4JUFA 1FTQA 2JB9A 4BVGA 2W70A 2OB1A 2YVQA 1X7ZB 2NZJA 3KTAA 4MVXA 2RARA 4IG4A 3HZRA 2NNWB 4MIYA 1P3DA 1Y9ZA 2ZI9A 3H11B 1GO2A 1YR9A 5BYAA 3B1VA 4YRZA 1PZXA 2CZQA 1R9NA 3DZBA 4AX4A 3OE1A 4D8VA 3GY0A 1I2DA 1NVUQ 1TM5E 2AF3C 1NUTA 2ZYAA 4GRDA 1NVAA 4JQZA 4TRJA 3PUHA 1TRHA 3MRVA 1E1DA 1UBRS 1NIJA 1U0TA 2W2PA 1H8HD 2CMHA 5K8JB 2VNSA 2VSQA 4P84A 3OWXA 4RD1A 4BE7B 4B6OA 3L4SO 1WKCA 4MWSA 2J6CA 3EDOA 4CW7A 4FFVA 1EA5A 2QLNA 4ESOA 3NNDA 2Q29A 4FLMA 4BEJA 1YCGA 3QVSA 3DC7A 3TGLA 2QG9A 3KHKA 1P6QA 1QVRA 3L02A 3LSYA 2AD5A 1AGPA 1VIDA 5BNZA 4UNSA 3MTEA 3VAYA 3VMMA 2KHZA 1YV9A 3KR0A 2QRMA 1XD2B 3V3TA 1GCOA 2C4TA 1U7XA 3K15A 4B32A 1LF0A 4K87A 3BPSA 2B30A 4JA2A 4KQXA 1ZCFA 1GARA 2GTIA 3C3KA 3DAPA 3G7UA 1DX6A 3HJNA 3GLIA 1T0BA 4DV1B 4HDMA 2D06A 2WIBA 3VU9A 3OQPA 4BBJA 4F2WA 1J8MF 5C1OA 4KLZA 3PEVA 4V0SA 4EBBA 1ONNA 4GC9A 5JSKA 2HSJA 2IZ5A 3ZWAA 1FDOA 4BFTA 1JP7A 2CXNA 3BL5A 4PTLA 4UHDA 1ORWA 4K2HA 3T3MB 1TJ3A 1SBHA 2BRUC 2O8CB 4FB5A 3RREA 2AQHA 2G9UA 4HEQA 3P9XA 4ER6A 5CXUA 4EY5A 2VTDA 1YUNA 4MWBA 2HLDD 3B6MA 2IWRA 3T7DA 4AYTA 2EZUA 5LM3A 1YQXA 1NXSA 2XYRA 3H7AA 3A6FA 1XJ5A 2AN5A 5FWYB 1D4FA 3ED1A 1B6SA 1RXSA 3T1VA 1XDSA 5C2JB 1AGRA 3LQFA 3WIEA 1EWQA 1Z12A 4CJXA 1BXGB 4JLKA 5FNVF 3T5TA 2R85A 3LW8A 1Y42X 4QREA 5EKSA 5CDUA 3FYSA 2QW8A 3HB0A 3EVBA 4GECA 1UXGA 4EG7A 4UREA 1DTSA 2G5CA 3R6LA 3T52A 5KNDH 1V1MA 1GPMA 2WSYB 2YIJA 2CHGA 3LUFA 4L16A 1MVOA 3L8YA 3NXKA 5I7FA 1GTVA 1VLQA 3D1VA 5CB4A 2V59A 4A8TA 1KQPA 3QPUA 3ESZA 1DKNA 2E4UA 3P0IA 2BEKA 4UM8B 2NSLA 1AXEA 1Q6YA 3GVPA 5E2BA 5E6SA 3UH1A 1UBKS 2HA3A 1RTTA 5B1YA 3P4UA 4DBLC 1Z75A 2K7ZA 5G0VA 1DRJA 3MC1A 3FOFC 2ALJA 5HMLA 1C7EA 4ZPJA 5H82A 3RUHA 4LZZA 2DOKA 3H2IA 4PANA 4B74A 3MHPA 1UT5A 4EI9A 4UOZA 4UUBA 3ROQA 1P2BA 1ICEA 3LT0A 4G97A 4OEHA 4CMIB 3ICQB 4L8VA 1T1JA 2BLNA 4UNQA 3DMNA 1ZM9A 4RU1A 1UBMS 4HXEB 4YMIA 3RCBA 3GGCA 4HG2A 1U9IA 2I7DA 4QFBA 4RHXA 2XE4A 2Z4TA 3T99A 3LCUA 4IIEA 1XDUA 3MWJA 5A7GA 4DRZA 1VL0A 2ZULA 3I1IA 4OJYA 2YHBA 4BKPA 2AN4A 2ZI3A 4RQTA 3CVVA 2WB2A 5DN9A 2RI1A 3FKJA 2UAGA 4QEKA 4CMJA 1QM5A 2DR2A 2J08A 2WHEA 3I2IA 4Q9NA 3IE1A 1QV7A 2OXIA 5EUBA 5BMVF 5EMMA 5CT8A 1GILA 2O3UA 4LOKA 3MJTA 4JBNA 3CLTC 3BDIA 1EZZA 1WMSA 4QYTA 2VDMB 4Q1VA 2AZXA 4AD8A 1E98A 4TUYA 2Z6VA 3I30X 3L43A 3GA0A 1U1FA 2D4HA 3TJRA 2J3MA 1KH3A 1MX9A 4MITA 1DWQA 4PPFA 1BHSA 1L1EA 3LUHA 3ZJUA 4FEYA 2A33A 2ORIA 1IEQA 3PRHA 3MMZA 3W4IA 1H2WA 4L0MA 1OHHD 1SEPA 2NUTB 1OI2A 2F4NA 2HJRA 2PEYA 3EMBA 3NBXX 2FFHA 3AFGA 3V1YA 1B15A 3QP9A 1SCNE 3KT6A 3C6XA 4UW9A 3HDGA 3VA7A 4DUZB 5B4VA 2YW2A 2O7VA 4EZIA 2OO5A 1YDMA 1JLHA 4ZHQA 2AQ8A 4ZIRB 1YZNA 3CISA 1P74A 2BSXA 1R9MA 1EGQA 1PEYA 5GONA 4CL8A 4JXZA 1FNCA 2F67A 1CLEA 5B1DA 5KVAA 5ALIA 1P8JA 1ZU4A 3DBRB 3NFYA 2B7CA 2QD1A 3SDSA 4EYKA 4MQMA 4PO1A 1PJAA 4Y9TA 1TM3E 4RTMA 1XVTA 4I7EA 1NVKA 2BF7A 2Y1EA 1XEFA 1AKTA 2PWAA 3G13A 4DMCA 5J4HA 3R1IA 4OKIA 4X97A 2BY4A 5EJFA 4P6VF 2P30A 5FTMA 1XA0A 4O2AF 3NZEA 1SELA 5AJVB 3FUTA 1EWTA 2ZYIA 1QAOA 3IAM6 3K2BA 1UR5A 2UV8A 3KHSA 4J0GA 4X7PA 5ECGC 2FQQA 2JGIA 5LA6A 1N4DA 1MG5A 1Y5LA 3I2FA 2ZIGA 3JQEA 1KRXA 1JHMA 1U0LA 3KYJB 4IDDA 4FMBB 1OXTA 1UP7A 5DSZA 4ISCA 3FPHA 3Q6MA 5KO2A 2HJHA 4D74A 1L5OA 2HPHA 2CFOA 2PSDA 3DAGA 4PXAA 3RSFA 4PPGA 2AYZA 3KCNA 4HH1A 1QR6A 4JAVC 3SX0A 1P4GA 3I0ZA 4UU8A 5BR4A 2OV1A 5CK4A 3N3AC 1Y3IA 2J0UA 3AR2A 4MO2A 4DDKA 4MRMB 1U1DA 3KB6A 3PRJA 3ENWA 3G1WA 4AVYA 1MXFA 3NOOA 4TVBA 2NZYA 1P1JA 5IVIA 1FRNA 4YJFB 4J0EA 1IM8A 2Q4OA 5ALYA 4CMAA 4A8JB 3OFND 4B3HA 1TAGA 4PG8A 3U5TA 4S05A 1IZYA 2I80A 4D9HA 1R4AA 2B20A 2NOAA 1KU6A 1UPXA 4XA8A 2J46A 1GZSA 2Z4RA 2VT6A 2WABA 1RS0A 3DOCA 3T34A 4HEA6 4EA9A 4LF8B 1OXKB 1XOIA 3EOBI 4RQUA 1EFPA 2GX6A 1YQ9A 3GJ0A 3ZXUB 3QQPA 4CKWB 4EKDA 3OZCA 3CUEF 4TL7A 2ERYA 3QYJA 3NT2A 4TPKA 2WWGA 4JLPA 1V43A 4X91A 3KPJA 5DX1A 5DWVA 4BV3A 1FA9A 4J0QA 1FSPA 2YXBA 1LWOA 3HYLA 3H05A 1D1PA 5LR6A 3F9RA 1BH6A 3GWZA 5EIHA 2PMFA 4WK4B 1S9HA 2BEJA 2BISA 3G5AA 4AN1A 3ND5A 2XJ4A 1FDWA 1LZLA 1Q77A 3R7NA 1FZQA 4W5HA 1Z7BA 1ID1A 4HGOA 4OFZA 2I4OA 2VPPA 2VJKA 4D57A 4ER3A 3HBAA 4TM8A 3T4PA 3AWIA 3KALA 2VTBA 5L40A 2P9JA 1TK3A 2NUAB 2GN9A 3V7FA 1E3SA 2EV9A 4MQEB 1XJQA 2X4DA 3BGDA 3OOYA 3A04A 5IH7A 3D4NA 1ZWKA 1ZPDA 5KYYB 4HBZA 4TTQA 1T9CA 2OEPA 1RWVA 4WVFA 5K3DA 5CNJA 3KKPA 5HIAA 1I1OA 1QG4A 2PSJA 2JAPA 4FYKA 1OCEA 4TXNA 2WEKA 5SZIA 1QH8A 1H5UA 1UFVA 4RSHA 5K3AA 2WM8A 1RZRA 1SEVA 3REOA 3W2EA 4FS8A 2A5YB 1QTNA 2IYNA 1K5HA 1JU4A 2QMEA 1QO9A 3MBOA 2ZREA 4D3ZA 2BGGA 3OU2A 5ELLA 1XYGA 1QUFA 4ALIA 4Z3OA 1XCLA 1CTQA 2ZRQA 3IQDB 3QI2A 3KKLA 4ME6A 2O5VA 4OP1A 4WK0B 1MG0A 1JTVA 1MO3A 4WSOA 5K9ZA 1M33A 3EBLA 3FX2A 2WZDA 5HF9A 2AEEA 5FAXA 3ZDXB 3GGSA 4C4AA 4EUEA 3AHHA 4CMEC 3LCRA 1XK7A 3I39X 3KV3O 4R31A 4R8MA 5DCWA 1LD3A 5F2OA 3BRQA 2H1RA 2QL9A 3GRAA 5JQGB 3IAS1 4IRUB 1BKSB 1KYQA 1TE2A 3S28A 4YV0A 2ZUWA 1TTQB 3IR7A 4FYYA 3PNBA 4WZAB 5ENZA 4DB2A 4OH7A 2VP6A 4TZ0A 3QVTA 4LQ4A 1ADYA 1X7XA 2G4VA 2R7KA 4RL4A 2AN9A 3VVCA 5BV1A 3DNMA 4EABA 1P2FA 3FWHA 1ZD1A 4F5EA 2BHNA 1IBRA 4IQGA 1EVLA 4BVJA 5KPDA 3IJ5A 4BFWA 1ZA1A 3N7AA 3OT1B 1X7DA 2ZB3A 1J2TA 9LDTA 5JEDA 4PLZA 3AHJA 4NYMR 1UPTA 1GKUB 1IMJA 1QCCA 3SBXA 1O4WA 1BFKA 1V2HE 2CDAA 2W2TA 1L7PA 3OOJA 5LQRA 1ABBA 4F5WA 3EIOA 4PSDA 2X6QA 2EF0A 4DV3B 1U5BB 4DCPA 1UWCA 2VRWA 3HCNA 2E18A 4TWJA 4CM5A 4NL4H 1U2GA 2FCAA 2X8AA 4FDUA 4LF9B 9MHTA 2JFOA 2AC4A 3Q4GA 5HZKA 1KH1A 1DP4A 3AHFA 3A2KA 2IX9A 1Q17A 2ZSUA 3BCSA 3FFWA 4HK4A 4K26A 1UKYA 8ABPA 2PZGA 4KPEC 2Y05A 5A3JA 1F5SA 1M73E 1TKCA 3BB4A 3BD8A 1PS0A 1HBJA 2L69A 3F5FA 3L8DA 3LQQA 3OA2A 3QLVA 5DPMA 1KDZA 3THOA 5ALLA 3I04M 2HR1A 2AYYA 4Z54A 3T95A 3ZWCA 4D99A 4ER7A 1SD2A 4Z0PA 5KWVA 3B85A 2J6BA 3U7EB 2OCKA 5KTNA 4IZOA 2B8EA 1OZAA 4M54A 4N82A 3LYUA 2A0XA 5DBIA 2B0CA 3OPXA 3CTMA 3FNBA 4EJSA 4A92A 1ZH6A 2ZSEA 2ZAIA 3A9WA 4QQRA 4E33A 2E7ZA 3PJRA 1YQEA 2Y66A 3WL7A 2OMKA 1V3TA 4KFSA 1VP9A 1DBWA 3PUXA 4PX9A 3KQOA 1OLUB 1F2TB 1H6AA 3F2IA 1Y48E 3V32A 5I8PA 2E4VA 2I4IA 1MB0A 2EBUA 1FRVA 2XMDA 2F6RA 3VH1A 3S4YA 4PONA 2UZIR 1E79D 2ZRKA 2Q4RA 4J2OA 1J8QA 4KLCA 3TNDA 2J0EA 3EMKA 5AJYA 3NUZA 4CDGA 3R3YA 2DZDA 3GEMA 3M5CA 3QFTA 4JT2A 5ED0A 1A82A 2NACA 4KXMA 1PQ4A 3A9RA 1QGDA 4LXQA 3N2GB 5JS8A 5CT5A 4GLOA 4RXUA 1GUZA 1C9MA 5BSHA 2XE7A 1VB3A 3Q7IA 1O03A 4J6FA 1FP2A 4M1YA 4MVCA 3HWSA 5JC1A 1TX4B 1KETA 2JL1A 4DA0A 1W73A 2QG6A 2XJ9A 3PL1A 4F8EA 3GCWA 1AXGA 3FTCA 3I32A 4LBZA 4BCBA 1JNXX 4YDHB 1CY1A 1Y3AA 4H7IA 3C4QA 1I10A 1SM4A 3KJNA 3MWYW 3KLNA 4BVBA 1EG2A 4QE3A 2IA5A 4LZNA 1J2EA 1Y7HA 2P9YA 1IQPA 1YZYA 4KLNA 4BJ5A 1PTJC 1HDEA 1QHHB 4YB8A 1X7YA 2DKFA 3BWBA 1YBHA 5DGHA 2O54A 3A0RB 2BGLA 5JAQA 3VO2A 3M5PA 3TQRA 5IDYA 5JAPA 2G83A 2OHIA 1BEZA 2I5PO 3P2JA 2WKPA 1TADA 3ZJ4A 4D3XA 5K6TA 2NIPA 1YDWA 2BFCA 5CFZA 4YRTA 2JCVA 3SSMA 1LCIA 2FMFA 4NEQA 3ET4A 2JATA 3S68A 3LY7A 3VI3B 3BFKA 1G21B 5YASA 1KK3A 1JT2A 4C7KA 3LUKA 1CRQA 1WE2A 4ZAYA 1SKMA 2O2EA 5HWSA 3G6WA 2R4QA 1J1IA 1Z5GA 2QZPA 4TTTS 4U2FA 3ZIAD 3BQ9A 5BNTA 2HRQA 1FTGA 3OJCA 4QNMA 2POCA 4L08A 4MLPA 4CQJA 3CINA 2G36A 2P7IA 3OESA 5C1PA 2J5BA 5MGNA 4QAQA 5A3SA 1NVDA 4HWGA 3I9FA 3KR2A 1IYZA 1C3LA 5HJ5A 2BIFA 3QIVA 3KOZA 3VJMA 2C2XA 1T2AA 3KQMA 1JI0A 3Q40A 4Y9DA 1Z29A 2BFDA 4ESEA 2IHYA 2FETA 1EUQA 2PKWA 4P34A 1E1CA 4P7BA 2ATIA 1M1UA 1OIVA 3AL3A 2FA9A 4BMCA 1PN3A 2ZTMA 5K4GA 3D4LA 1BD4A 2HCBA 3E8SA 1W0KA 3N2IA 1MENA 5TV2A 3U4CA 3VHRA 1WHTA 1JAXA 4RVSA 1THZA 1KI7A 4AC9A 2H11A 1UDXA 2I55A 1L4KA 1E2BA 1RJ9B 1W94A 1EXMA 1U3FA 2LKDA 4EJFA 4B8WA 2AUMA 4Q00A 1K0UA 2RJNA 4I66A 4LE2A 3O8CA 1IIRA 3O8LA 2RGUA 2Y0BA 3A4IA 5DGXA 1CJTC 1RWBA 2AJLI 4OQXA 1U5AA 3WLRA 5ICSA 4AN0A 3ES9A 1DEOA 1KP3A 4FFSA 1R0BA 2V4ZA 1QGOA 2IBTA 1EVJA 4L7VA 3T7JA 3CF4G 2VG8A 2RJOA 1C80A 1DJPA 3E3MA 5ILOA 2QZ9A 5CD9A 3QTBA 1ZM4A 3AV0B 3C7TA 3EIWA 3DXZA 2VSOA 3H17A 4FN5A 1QIEA 4TQAA 1H65A 1GTMA 9ATCA 3OEHD 4Q18A 1GL9B 1W4ZA 3TBKA 4LVUA 1S7GA 4XR9A 1SVIA 1CV2A 1PE0A 2HJVA 1VHTA 3R6WA 4RPGA 5FBRB 1H4SA 5H68A 1U2TA 1BZYA 1U9YA 2WINI 4YAGA 2F43A 2XAAA 3E82A 1KMQA 2RAVA 4MNTA 5BN1A 4YK7A 1N92A 4MVJI 3SC4A 3TUIC 3UFXA 3IEVA 2JGAA 5ALDA 1QQAA 3JQCA 3FPAA 4BNGA 4K05A 1M34B 3AM5A 2O14A 3NAQA 3M3DA 3OP1A 3SZOA 1Z15A 1Q95A 4YJ2B 1U0GA 3NEJA 2EJTA 1M67A 1FFYA 3ZHYA 1L5WA 3H18A 3A4VA 3LM8A 4Q7KA 4GP9A 3RARA 1HYHA 4GYJA 1I2MA 1OJLA 1ES9A 5A9TA 2VUTA 4KGXA 3KYDB 4G5SA 2X5XA 2QN8A 2Y2UA 1YB4A 3JQ9A 3OWHA 4P86A 2VEOA 2DSTA 1DBQA 2QD4A 4F2DA 4F3TA 2FSIA 3EXG1 4ZEWA 1JHDA 2Z9BA 2YVAA 2ZIEA 2HCTA 3TNJA 4Z5XA 4CNBA 3ZDDA 3W6PA 4YDRA 3U19A 4EY7A 1YJQA 1DXHA 1RAHA 1YOVA 2BEUB 4FCVA 5EFOA 4XWKA 2ZUSA 2EJCA 3HCWA 3LBHA 3MUFA 1P1FA 3L05A 1FLDA 2FQ1A 2BE7A 2Z57A 3NHAA 3NTUA 1O77A 2C4HA 3NTVA 4RK5A 4XB1A 3EQZA 3M1AA 4DQXA 1GAQA 5K09A 5LZ5A 1FQOA 2IXBA 1UFKA 4WH0A 4Y30A 3E84A 1RT9A 4PXSA 1T8PA 1V0JA 1KERA 3V4ZA 1B14A 4D02A 3HPQA 3AXTA 4RTRA 1EFAA 3H75A 1EZ1A 1S0UA 5GOZA 4DR1B 1V1RB 4FILA 4XKJA 1RVV1 4XQGA 3R7DA 5IM4A 3QWBA 2Y6UA 3B1KA 1SU7A 5LOVA 2WOJA 1MR3F 1WBBA 4E11A 3DAOA 5ALXA 4CLDA 4XPIB 2WSSA 4F4UA