3QVSA

L-myo-inositol 1-phosphate synthase from archaeoglobus fulgidus wild type
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
392
structure length
392
Chain Sequence
b'MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol-1-phosphate synthase (Ino1)
publication title Atomic crowding drives the catalysis of myo-inositol phosphate synthase, as deduced from a crystal structure of a trapped catalytic intermediate
rcsb
source organism Archaeoglobus fulgidus
molecule tags Isomerase
total genus 159
structure length 392
sequence length 392
ec nomenclature ec 5.5.1.4: Inositol-3-phosphate synthase.
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qvsA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qvsA01
5BSEA 4ZA2A 4J0EA 3WB9A 3V1YA 1PTJA 4WOJA 4IINA 1Y5MA 5EQFA 1DPGA 4GMGA 1C1XA 4OQZA 3S1LA 2HSDA 4R4JA 1WMAA 4EJ6A 1IZ9A 3JQ8A 3Q3CA 2JAHA 1N1EA 4ZQHA 1PZEA 2X5JO 3P19A 4J4TA 4F6CA 4YB8A 1GADO 3SLGA 3ABIA 1O9BA 1ZCJA 2AE2A 4YQZA 3DAPA 2WE7A 1QV7A 1E5LA 5DOZA 1FJHA 2G76A 3HWRA 4TVBA 1TEHA 3UF0A 1SC6A 3BTVA 4B4WA 2X5OA 3TRIA 3GT0A 1DAPA 3NTOA 1ADBA 1ZXBA 2Z1MA 4UEKA 3QIVA 1YBAA 4XRRA 1NFFA 4KMSA 5DOVA 4TMFA 2PV7A 3VVCA 1FF9A 1XELA 4ITUA 1MC4A 4GKBA 1HWYA 1EK6A 3JQBA 5U9CA 1ZK0A 2NVUB 4UUOA 1DIHA 1W6UA 4BQPA 2E4AA 5EERA 4BNLA 1ENZA 3WNVA 4FGSA 3ZWVA 4B79A 1UP6A 1I0ZA 1GUZA 2XF8A 2X0IA 2NM0A 1ENOA 2X22A 2Q4EA 2DPGA 1A4UA 3PGJA 1NX6A 3FBGA 2EGHA 1QMGA 2WYUA 4PCVA 4QXMA 5EPOA 3KXDA 3IS3A 1D7OA 4J4BA 1V35A 4LGVA 1Y5RA 3X2FA 5A9RA 4H3VA 3GEDA 3T4XA 4E5YA 1BWSA 4MP8A 3PYLA 3ZN2A 1T4BA 1NHGA 3FN4A 1LI4A 2GUGA 3F1KA 1RPNA 1A7KA 1YL6A 4BNGA 3BAZA 4KDEA 1KEVA 2R00C 3TFQA 4D0SA 4B7XA 4HUJA 4GH5A 2JFHA 4H7PA 4DMMA 4LRTB 2FZEA 1GD1O 3R1IA 5BSGA 5A9SB 4AJ4A 1ML3A 1NM5A 3WJAA 4BMSA 3GZNA 1T1SA 5A3VA 1ZSVA 5DCWA 1PR3A 3RASA 3VPGA 5EIOA 3OECA 1BMDA 2UUOA 4KUHA 4LMRA 3C8MA 4PLHA 4JNKA 1FDTA 4R69A 1I2BA 2J3IA 4D3FA 4CM7A 4JJIA 2CNBA 4NBRA 4DIFA 2G17A 3QA9A 2VYNA 1DHRA 1RYDA 2OBNA 3BMCB 3L6OO 3PDJA 4OM8A 1LC3A 2E48A 3GPIA 3O8QA 3K2BA 1ZK3A 4WK6A 4GX2A 5CG2A 3DBLA 5L4NA 1EE9A 5EMHA 1PJTA 3IQDB 4DIBA 2CDBA 3JQCA 2OFPA 3ON5A 2NSDA 3OF2A 5KNLA 3NDRA 3RBZA 4Y8VA 4F45A 5TIIA 4BO8A 3JV7A 3RFTA 1PZFA 4LSWA 1SMKA 3OEWA 2EW8A 4RF2A 4GLOA 4BO1A 3KSDO 4RL6A 3H5NA 3CE6A 4E3ZA 5HTOA 1IL0A 3PLNA 1Q0QA 3KV3O 1UR5A 4KP7A 3JQ6A 3VH3A 1ISFA 1N1GA 3WR5A 3CPSA 1UAGA 1YQDA 3OSUA 4R41A 1YB1A 3JQDA 5C37A 4N18A 1E6WA 4LMPA 5KJCA 1DLIA 2DM6A 3WYEA 2IRWA 1AUPA 2OZPA 1EDZA 5T64A 3WGYA 3M1AA 2JHFA 5JBIA 3INTA 1JW9B 3OJLA 3A4VA 4J1NA 4WE3A 5LDGA 4CQLB 3AOEA 1TVEA 2Q49A 2FR1A 3GGGA 2JD0A 5I7VA 3AOEC 2C5AA 3PWZA 3ZWBA 5JS6A 1QYVA 1QYDA 4GI2A 3F5SA 3PHHA 4QSMA 4L8VA 1GZ6A 1PJ4A 5JCJA 3LT0A 3ZWAA 4E5MA 2ZQYA 4EYEA 4RVDA 9LDBA 4E2ZA 2UDPA 1ISGA 1EE2A 3U4HA 3L4SO 1GQ2A 3S2IA 5J9GA 5DBGA 3F4BA 1XU7A 3GHHA 1PJ3A 3H65A 2POQX 1O6ZA 1KY5A 4I5FA 2P2SA 1FMCA 3UCFA 4DYVA 1ADCA 2VHVA 3PJEA 1VL6A 1UXKA 1EVIA 2Y1FA 3BMOB 4YTEA 4FIZA 1G6KA 4FCCA 5TGDA 2XXJA 3JQEA 2NLOA 4OKIA 4R1UA 4NK4A 2CVZA 4CQMB 2JFFA 4M89A 2I3GA 4U0KA 1I2ZA 3ST7A 4MJLA 1Y8RB 1QYCA 2AG8A 3JD0A 4DPMA 4ALNA 3DC2A 1FXSA 3A1NA 2BGKA 2Y68A 2YZ7A 2RHCA 1YS4A 3RFVA 4ALIA 3E5RA 2O3TA 2HO5A 3CH6A 4RDIA 1MFZA 2VHXA 4OOEA 1X14A 2PD3A 2VRBA 4NH4A 5F3RA 1Y8QB 3JQ9A 4CM5A 1KS9A 2NNLD 4J49A 1PGQA 3FCOA 2TMGA 3JQ9C 3KRTA 4J9UE 5JMWA 3DOCA 4XQCA 5DULA 5EN4A 1NYTA 2EGGA 1EVJA 5TF4A 3V1UA 1XHLA 3IOYA 4AJEA 1A72A 2HK9A 3I1JA 2VNSA 3DAFA 1VL0A 2I3AA 3BTOA 4HFNA 3BMNB 4CUKA 1QLHA 3OBBA 2VHYA 1VE9A 2G1UA 1YB4A 5KVCA 2CVQA 4BNXA 1WXDA 3DHYA 1PZHA 4BNUA 3FWNA 4PZEA 4C7KA 3NTQA 1C1DA 1Q2XA 1GEEA 4Q39A 4XDYA 4E5NA 4IDCA 4O6VA 1B3BA 4FB5A 4ZJUA 3W6UA 4D42A 4QUKA 3O4RA 3GF4A 5JCXA 1K6JA 4IXWA 4DQVA 3AUUA 4E21A 4HP8A 1PJBA 4W99A 4CMGA 3M2TA 2Y93A 1H6DA 1B2LA 3P2YA 3FRJA 5JAIA 1AHHA 1VJ0A 2YJZA 3HFGA 5IDWA 4YA6A 1IB6A 1CDOA 2Y1CA 5G0VA 3WS7A 5DT9A 1HDCA 4OMUA 1HE3A 3AW9A 1YB5A 1NXQA 3ZWXA 3K9QO 1M75A 1GYRA 1M6HA 1V3TA 2QRJA 1YBMA 3OH8A 1R6DA 3GPDG 2WDZA 4YT2A 4OSOA 2HKIA 1ONOA 4CLRB 1DDOA 1LEHA 1DC3A 2JL1A 3HDHA 5B1YA 4RVHA 3WBFA 1F12A 4KTTE 4IQGA 1EVYA 1T2DA 3ANLA 1TB4A 3EVNA 1B8UA 1C1XB 1K6IA 4TZKA 5F1KA 5K0ZA 1E7MA 4IQ0A 3NX4A 3C24A 4HBGA 2FR8A 5JMPA 5U1PA 4DLBA 5THQA 4UUMA 4PG5A 5A03A 1KEUA 3ICCA 4KZPA 2X8LA 2GD1O 1XR3A 4AJPA 3JQAB 3CZMA 1K5HA 2H6EA 3QVSA 3I9KA 3WJ7A 2BGMA 1E6UA 2ZYDA 4WGGA 1H9BA 4WLVA 2ZB4A 4GBJA 4IJKA 1O89A 3CINA 1ZSNA 2I65A 4ND2A 3E9NA 3D4OA 4CV2A 3C1AA 2E37A 2GR9A 3C7AA 1VL8A 3X2EA 2ZIZA 2NQ8A 1MUUA 5TLSA 3F4LA 3HE3A 2IEBA 3F46A 2LDXA 3DZJA 3GK3A 4NR0A 5ER6A 3ZV4A 5JNLA 4RLSA 3JD1A 4P38A 3TPCA 2D3TA 5ADHA 4WKGA 3PHJA 1AXGA 4DXHA 1W8DA 3PGXA 5C7LO 1MFPA 4E5KA 4HADA 5CDTA 4IZHA 3RC9A 1Z45A 3DZKA 2AEMA 1QR6A 4NU5A 2BMAA 3T7EA 3PEFA 3Q9NA 1ARZA 2B5WA 3H9QA 4DC0A 4LISA 5TS3A 4AJ2A 2Q45A 1B26A 3Q0EA 4IQ8A 3U4IA 2ZTLA 2IDZA 4HKTA 1EQ2A 1OC2A 2H5LA 3ZI0A 2NVUA 3C1OA 3R0IA 3VHRA 2Y67A 3LZ6A 3GNQA 4BNIA 2I67A 5JY6A 3TZ6A 3UUWA 5FF9A 3TQHA 2B0JA 3U0BA 3ETGA 4EI2A 4CUZA 3H2SA 2HLPA 4HY3A 1A7AA 4G65A 4ZRNA 3PQFA 4XYEA 2UAGA 1WW8A 3DAGA 3WQSB 3TZQA 3NGLA 3S8MA 3GZNB 1ZK2A 3IL2A 3JYLA 1R0SA 4CM3A 3SC4A 3H7AA 1PJLA 1JAXA 4Z9YA 2C5EA 3AI1A 3FSRA 3HHPA 1ONPA 3EYWA 1BXGB 3PVZA 3GVXA 2QZ9A 4K6FA 4P8RA 3WNQA 1UAYA 4TVOA 3E48A 1NQ5A 4NBUA 1ZIDA 4ND1A 4WOKA 4G2NA 1CF2O 4G5HA 3UN1A 3WGGA 4NK5A 3MWEB 5TT1A 3RBVA 4IDAA 2W2KA 2EXXA 5B37A 5A9SA 3WMWA 5K6AA 1EBUA 4PIVA 3MJSA 5A04A 4ZQGA 2HMTA 3OQ1A 3ROKA 5K6AC 4AJNA 3KEOA 2QRKA 2VRCD 4FFOA 4FSHA 5JY1A 3ZHZA 2CFCA 4RPGA 1PR9A 1VKOA 2BFOA 1X15A 2PK3A 1JLLA 5ICSA 3KYCB 3GRKA 4D44A 3VTZA 1MGOA 4L4SA 1XQ1A 3R3SA 1C0IA 4OQYA 2C59A 4I5DA 5G4KB 5TT0A 3D5QA 2YW9A 3OA2A 4ESOA 4GGPA 3N74A 5G2OA 3TDKA 4NFYA 1UZMA 5B4UA 2NADA 3SLKA 3WGQA 4AJ1A 4NFHA 1PWZA 5DNAA 4YAEA 1MXHA 5IFLA 2X86A 1PGJA 4NHEA 3D1LA 4H16A 5T67A 2CY0A 2Q46A 3RQSA 4HX5A 5I7FA 3A14A 4DMLA 3H9UA 3JD3A 4XQGA 4WLEA 1OZAA 4DLLA 2WYWA 3AU8A 3AK4A 2BFAA 1NPYA 5M6DA 3QVTA 3BA1A 3DBRB 4L74A 3H9EO 2IXAA 1WDMA 3H8VA 5L3ZA 4I9UA 1YGYA 4L4XA 3PHGA 5CP8A 3F1LA 2B37A 1X1TA 1YJQA 1BDMA 1U1IA 2HMUA 1EFKA 3H5RA 1PQWA 2VCYA 1EUCA 2PWZA 4FGWA 3Q2KA 4E2WA 5ITVA 3PWSA 1UXJA 1EFLA 3GG9A 5A1TA 3KUXA 1BVUA 1E3JA 1NWCA 3I9JA 1P9LA 2H63A 4XB1A 2VZ9A 4GPD1 1DIGA 4PG8A 2Y0EA 3FNFA 1LUAA 4W82A 4XDZA 2CVOA 3CUKA 3EC7A 4MIYA 4IJVA 5A05A 3I6IA 4IJWA 4CQLA 1LC0A 3HZZA 4R9SA 2ZTMA 4R51A 1AHIA 1PS0A 1HZJA 2ZQZA 5CPFA 4Q3AA 2V65A 1BTOA 1NAHA 5AOVA 2X4GA 5KWEA 4OH1A 2Y1EA 2E82A 3DDNA 4Z0TA 1R66A 1ZVMA 5FWNA 4BGIA 4BS9A 2GN4A 2C82A 5EESA 3I9OA 4CLXA 3V5NA 1HYGA 1PSDA 1Z7BA 2D5AA 1ZXLA 2PZKA 1UH5A 2YHIB 3ZU3A 5IXSA 2DC1A 3RC1A 2ZKLA 1U5CA 2O3UA 2YYYA 3AM4A 4BNHA 2Q99A 3L07A 1B8VA 1DBVO 3BMOA 4FC6A 3ZHYA 4DA9A 5I8WA 4CMKA 3GH3A 4CQMA 5T5QA 3LK7A 4BUCA 2PKQO 4TKLA 1QXSA 4IMRA 1Y8RA 5ES3A 1KEPA 4WLFA 2ZYGA 3MZ0A 4RPJA 4OXNA 4CMBA 4R68A 4OJNA 1UXHA 3PIIA 5DDIP 1EQUA 3FR8A 3RWBA 4E32A 1ADGA 3GGPA 4RVFA 1T26A 5JW6A 5CPBA 4O1MA 3RROA 4XQEA 1U2GA 1HE2A 1TT7A 2EG9A 4M54A 4OO3A 3UFXA 5BT9A 1ENYA 4Q9NA 4ZICA 2Z5LA 4L0QA 3ZW9A 3KLPX 1GDHA 5IN5A 1LRJA 1J49A 5IDQA 4WPGA 1OFGA 4RORA 4N5NA 1OI7A 4ZQBA 5JE8A 4M49A 2Z1NA 3BMNA 1DSSG 4CLDA 1I3LA 1DRWA 2OP0A 4NJMB 3C3XA 1GQQA 3GAFA 3GVPA 1U3WA 3UICA 3INGA 2AQ8A 3AM5A 2AMFA 2JFGA 4RPKA 3TFOA 3KVOA 1XDWA 4W9NA 3MTJA 1KVTA 3WGOA 4UVIA 1NQOA 2JD2A 2IYPA 4J7UA 4CMAA 5JAMA 3HDQA 3AY7A 4J7XA 3LT2A 4UVEA 3WQQA 4PG6A 4CV1A 2QX7A 4U6QA 4RZIA 1AGNA 3E9MA 4IGFA 3SX2A 1XA0A 3D3WB 4NU6A 5TNXA 3WIEA 3PRJA 3U09A 4H15A 4PLVA 1M66A 1P1KA 3F9IA 4R3NA 5GZ6A 2B36A 1IHXA 2YUTA 4GL4A 3RJ9A 1E1NA 1DOHA 4EJMA 4EUHA 5IDXA 2CF5A 2PY6A 4WLNA 3SC6A 4IS2A 4AG3A 5FEUA 3ADOA 1M2WA 1E7RA 3WYCA 3BYZA 4CM8B 2HRZA 4RO0A 3WGZA 3MOGA 3AWDA 3D4NA 1KVSA 3GFBA 3AFMA 3HADA 4YYZA 4CLRA 2WMDA 1DC5A 1IE3A 4TRMA 3C7CB 4JROA 4J90A 2EERA 3ZCXA 2VHWA 1M67A 1X7HA 2C29D 4ZU3A 1ZUD1 2GZ2A 1H0KA 1PWXA 1R37A 4WNCA 2GF2A 3WQRA 2VWQA 4WEQA 1VPDA 5CEJA 3DOJA 4KWIA 3JQAA 4YEDA 3PFWO 3M6IA 4GX5A 1U3TA 3GDOA 2WD7B 3L9WA 3LC7O 2NU6A 4MPDA 1ZBQA 1GCUA 5ILGA 1E7SA 2X0RA 4BNZA 1NPDA 1WMBA 4N7RA 8ADHA 4BQRA 2O4CA 3GN2A 1GY8A 2I5PO 1CQJA 2IODA 3ONFA 4LSMA 3QY9A 4YPOA 3NV9A 3ZWYA 2I76A 3WIDA 2J5QA 4B4UA 3HN2A 1ZKMA 2O23A 6LDHA 3RUDA 2NVWA 1P33A 4WEOA 3H4VA 2J5RA 4RCVA 3GFGA 3OA0A 4J16A 2BHLA 1HF3A 1Q7CA 2NTVA 4J7CA 2XPCA 4YRDA 4LN1A 2Z95A 3HB4X 4XR9A 5G0SA 3RJ5A 3S2GA 1FDUA 2ZK7A 4DBVO 4PN3A 1I8TA 5ENDA 3QWIA 4TRRA 1IPEA 4BO4A 4XYLA 3OJOA 3D0OA 4AJLA 4OAQA 3HFSA 3KLMX 3PJDA 5JSFA 4BNFA 4OXKA 1PJCA 3BHJA 1HDRA 4QTZA 3HJAA 5JC8A 2A9FA 4IDEA 1ZK1A 4AL4A 4MKZA 1JWAB 2CUKA 4XYGA 1W0CA 2HMSA 4WECA 3GAZA 5T73A 3WFJA 5T57A 2J5KA 1E3WB 5F5LA 7MDHA 3SJ7A 1XGKA 1NHWA 5BQFA 2R00A 2AQKA 1F17A 2SCUA 4BO2A 1LU9A 1HE4A 1YJ8A 2ZTUA 3GVIA 2BF7A 1PS9A 3H9GA 4CODB 3AI2A 3U4CA 1PQPA 1IOLA 2CZCA 2W2KB 3VPHA 1U7HA 1YKFA 4BNNA 2PGLA 3MTGA 3RIHA 1I36A 1T4DA 3NAQA 4YRBA 1UP4A 3BIOA 3LC1O 3FHLA 3AY3A 4ZVVA 1NVTA 3INRA 3VH1A 2J6IA 2P91A 3OEYA 3OICA 4JLWA 3SJUA 2HAEA 2JCYA 1GPJA 3VPXA 3V2UA 3ROPA 4J4HA 4U7WA 4IDDA 2IE0A 4JJFA 1GUYA 4BV8A 4E6PA 1BXGA 4YRAA 3ONEA 3CEAA 2Y0DA 3LF1A 3MJTA 3L4BA 5CEEA 2E6UX 1JU9A 2V6FA 1QYXA 3GVCA 3EGOA 3C7DB 3L4BC 3E9QA 3ZU2A 3NJ8A 3PXXA 5IN4A 2GYYA 1NASA 4DGSA 4A26A 3SVTA 1NVMB 4A7PA 2Q2WA 4B3IA 5C7IO 3FBTA 4W6ZA 3EVTA 4ND4A 3HG7A 3UVEA 1HDGO 1A9ZA 2VWGA 2DTXA 1EUZA 4BNYA 2C2XA 3PLRA 3RUIA 4XB2A 2DT5A 1ZMOA 3PJGA 1Z75A 5A02A 1DIBA 1XQ6A 3B70A 4EBFA 3KYCA 3PQEA 4J9VA 3ZWNA 2DUWA 3EK2A 3LT1A 2J3JA 5G4KA 2VOEA 4CM9D 3WYBA 3GUCA 4DBZA 2JAPA 1K3TA 4Q3BA 1H2BA 1V9LA 3KEQA 3KB6A 3L6EA 1K0UA 3QQPA 3WFIA 4D3SA 4JX8A 4YAKA 5DP1A 4UEOA 3WGHA 5FI3A 3PFFA 4BNTA 1H6CA 4AJHA 1HYEA 3ZZNA 3IJPA 2GERA 4K6CA 5JDCA 3STHA 1O5IA 3PK0A 2D0IA 4F3YA 2O3RA 3DBRA 5TC4A 4IIVA 5JDCC 4I9NA 4A0SA 3DOOA 3Q11A 3E03A 4IJUA 5KJ6A 1P1IA 2D2IA 1JN0A 2EKLA 2HRBA 4IBOA 3WOHA 5DZSA 5CG1A 3NTRA 4J6FA 2O3QA 3F6YA 4BHTA 4Y98A 2TMDA 1ORRA 4CPDA 1C3VA 3OIFA 2FP4A 1ZNQO 2A92A 1WDKA 4HNGA 3WLFA 5L9AA 3VOSA 4KDFA 5KTKA 4QFDA 4JQCA 4IMPA 4MIOA 4PVCA 2DFVA 3GA0A 4RJTA 5JYDA 4IIUA 4JBGA 1H93A 1ZO8A 2B4QA 3HN7A 1SOWA 4YACA 4CM4B 3ZHXA 2EV9A 3W1VA 4B8ZA 4E4YA 1Z73A 2X9GA 2G0TA 4FJ1A 4CUJA 2QW8A 4D3DA 4U5QA 2IZZA 4NNJA 4YDRA 1LX6A 1LRLA 1BW9A 4NMHA 3JYQA 1H9AA 1WAMA 3D3EA 4E2YA 2ZCVA 2WJPA 2YHIA 2J8ZA 3A28A 2HK8A 3CZRA 4I5EA 5IZCC 1QKIA 3COSA 3L6DA 3MJVA 4E12A 3Q2IA 1LRKA 1KY4A 1ISJA 2NU8A 5IAAA 2ZTVA 1UJMA 3CTMA 4DQXA 4RZHA 4OOFA 1P0FA 4XZ3A 4CLHA 4X54A 5CHEA 2CD9A 3OJEA 3F47A 4JP3A 2B4TO 4XJSA 1NTOA 3LLVA 4BNKA 5BNTA 3JD4A 3ZW8A 4PLFA 4XEHA 4FBGA 4XRGA 1D1TA 3ITDA 4M1QA 4E30A 3O9ZA 3B1JA 5F21A 1DB3A 4Z9FA 1GR0A 2O7QA 3WTCA 3S2EA 1Y1PA 4Y9DA 2VYVA 3IP3A 3G17A 1TI7A 1HTBA 1WNTA 4XIJA 4K26A 1P74A 2QIOA 3JQ7B 4Q3NA 3UXYA 3PHIA 3DR3A 3RD5A 1P0CA 2G5CA 3H5AA 1Y6JA 2Y99A 3JSAA 3RU9A 1PGNA 3MEQA 2NTNA 5AXAA 1KVRA 2VRCA 2FPPA 1DO8A 2EEZA 4A03A 2W8ZA 4WCDA 4NJMA 1Q0HA 4CLEA 2Y05A 3FR7A 1PJQA 1RKXA 3NT4A 5JPIA 2FRDA 1GU7A 2V6MA 5C3MA 2W4QA 4DQUA 1RYEA 1ZFNA 1XU9A 1NP3A 4BKOA 3RC2A 1K6XA 2NACA 3E1KA 1NR1A 1R4NB 1I30A 1NWHA 3NDJA 1UDAA 3AJRA 1ISHA 2FWMX 3WSVA 5CDSA 2PZLA 4CLOB 3D3WA 1N92A 2BD0A 1O0SA 1R15A 3RUCA 3DZFA 3QSGA 1E3IA 3V8BA 3JYOA 4UAGA 5GMOA 3V1TC 3A06A 2F1KA 1W4ZA 4EGFA 2AQHA 4R9RA 4D0RA 3DZGA 4P4LA 1NPTO 1GL3A 4P4NA 4ALJA 4NFSA 1DLJA 4XIYA 4CM8A 1HT0A 3WTBA 5COAA 1GAEO 3F3SA 3DHEA 1ZH8A 4CM1A 4Z6KA 3GLQA 1YQXA 1R0KA 1V0JA 4OHUA 3CXRA 4EUEA 2HJRA 4K1LA 3I52A 3SEFA 4D79A 1LDGA 4FW8A 3AY6A 4R5HA 2BFMA 2GASA 3E18A 1C0PA 1N9GA 2CDAA 2DBZA 4DVJA 2C2YA 5H82A 5L4LA 3MCVA 3IC5A 4KTVE 3K5PA 1PS8A 1P77A 2W2LD 5JYEA 3ORFA 3JYNA 1SAYA 3WG9A 4B4VA 5DCYA 1X13A 2WD7A 2GLXA 1F0YA 3WBBA 4RDHA 3LYLA 4GVXA 2O48X 3DBVO 3NT5A 4RVUA 4BV9A 1IZ0A 2I9PA 4FR5A 5ILOA 3AU9A 4TRNA 2GRAA 2O50A 1X0XA 1E6EA 3OHSX 3RU7A 3ZWPA 4BKQA 2PH3A 4IDGA 2Q50A 1B7GO 1ISIA 4YJGB 1HETA 5EINA 3TZHA 3ZDFA 1JKFA 3OFSA 1KETA 3FNEA 4IDBA 1A71A 1YO6A 3K92A 2G82A 1Q0LA 1NNUA 1XIVA 2I66A 3P5SA 2WD8A 2BRUA 4QECA 4JBIA 2FHSA 2WTBA 5IZ4A 2C7GA 5KJFA 1ENPA 1B14A 1JKJA 2XXBA 3FWZA 2JJYA 5HRUA 1XG5A 4LCEA 1Y81A 3VZSA 2DUUA 1EZ4A 4FOOA 4BMVA 4BO0A 1E3WA 1YVEI 3IUPA 4RF4A 2P5UA 1GZ4A 3KSZO 1QRRA 1DXYA 2RIRA 4ILKA 1A27A 3KETA 2GNAA 1D8AA 2Y1GA 5ICMA 4FJ0A 4C4OA 1HE5A 1J5PA 1BXKA 3NUGA 1KBZA 1DEHA 3EMKA 1R4MB 3HNPA 2V6GA 2UV8A 4GQAA 1PL6A 1I2CA 2DLDA 1I5RA 2J3HA 2RH4A 1WVGA 1E77A 5HS6A 1LTHR 1ULUA 1L1FA 3UOGA 4II2A 3WWZA 2OMEA 4CMHA 1FK8A 5G0TA 5LC1A 1E0DA 1HSOA 1VSVA 3RKUA 2C07A 3TL3A 3WWYA 4DYDA 3K8ZA 2OXIA 4RVGA 1LJ8A 4QEDA 3IIEA 4CMCA 4QO8A 1Q1NA 3WICA 3VZPA 2O2SA 1ZEMA 4PZCA 1WZIA 2OBYA 4D46A 1D4FA 2CMDA 3I4FA 2NTJA 2YY7A 3ROMA 3LF2A 1HXHA 4MINA 1TA4A 2EJWA 3BTSA 1H6BA 3LC2O 5TQVA 2VZ0A 4E33A 1SNYA 3VC7A 3KOUA 4CR8A 1GQYA 1SZJG 3TNLA 5KOIA 4MP3A 2VUSA 1Z82A 3G1UA 4RQTA 4ZQFA 5CFZA 2PTGA 4AJIA 4YBZA 4OYRA 5TJHA 2AE1A 3OIGA 1LSUA 1CERA 5C5IA 1CRWG 1B16A 2EJVA 1LDEA 4FQ8A 2DU8A 3DTTA 5H81A 4MVJF 4XJTA 1PL8A 3VVBA 1NVGA 5KVQA 4NPCA 3H2ZA 4DIOA 4YJHB 3VZRA 4GX0A 3WLEA 3DXFA 3K30A 2I99A 2NQTA 3GY0A 4WASA 2HMVA 5DF1A 3DFUA 5HWSA 1HDOA 1G1AA 1HLDA 2YFHA 2IZ0A 2V6BA 4DTIA 4YWJA 1SOVA 3GN1A 2C54A 1F8FA 2WSBA 1HRDA 4CM6A 1V3UA 4J1TA 1B15A 1VJTA 1YE3A 1VM6A 2A94A 3WMXA 1H2HA 2O4UX 1BW9B 1U5AA 2JHGA 4WCFB 5KKCA 1DFHA 2DBRA 2QYTA 3ZH2A 1LDNA 1ZJYA 1ADFA 3RCBA 3GQVA 1MP0A 2ZJ1A 1C14A 4ND5A 3H3JA 4KWHA 2YV1A 1EMDA 4L4RA 3KHUA 3UKOA 3QVOA 2A4KA 4JGBA 3PZRA 1T25A 4HNHA 3W8EA 1E7YA 5I8ZA 4R16A 1YDEA 3UAGA 5I7SA 4CM4A 4MVJG 3DO5A 4D45A 3FPLA 5IDYA 3Q9UA 4I8XA 2EW2A 1YQGA 5BNFA 1P31A 3DTYA 4PLYA 2Q1SA 1K89A 2X1HA 2C20A 4J43A 3UCXA 1P45A 4CR7A 5JO0A 5A5EA 3KYDB 2P9CA 2Q4BA 3LVFO 1SO8A 2NU7A 3PDUA 4PRKA 3ENNA 1U3UA 2VWHA 4ALMA 4AJKA 2ZB3A 4XWYA 2P5YA 1KERA 4JN6B 2GO1A 3AUAA 3GUYA 1SB9A 2RBEA 3QJ5A 4WNIA 1IUKA 5B12A 2E49A 3UHAA 2VUUA 2BLLA 3GDFA 4OL9A 1I24A 1P1FA 3RUFA 4YXFA 5GZ1A 1T24A 2CSUA 2VOJA 3MJEA 4NBTA 4R01A 2WEKA 4XGIA 3QWAA 4BO9A 3O38A 3ZNNA 5L95A 2IEDA 4UVDA 4FC7A 1QV6A 1YXMA 4IDFA 4DREA 3AUTA 1D3AA 1BSVA 5THKA 4MVJI 1I3NA 5JDIA 2GZ1A 4I1IA 4CMJA 1I01A 3VDRA 2EP7A 5JYAA 1MLDA 5COQA 4E2XA 4PG4A 5JDIC 3TF5A 1LSSA 3T7CA 4U8GA 3I9NA 5U4QA 3KZVA 5G4LA 1UP7A 3L77A 3HUDA 5FFFA 2Q1WA 2QHXA 4R1TA 1BXZA 3ZV5A 3ZV6A 3GC6A 2B35A 1Q7BA 2PKRA 3JQ7A 2WM3A 4XQ9A 4TQGA 4L9RA 4BGEA 4R5MA 5T6BA 4EUFA 2DPHA 1SBYA 1T2FA 5A3JA 5BR7A 5ENVA 3PIDA 1UUFA 2ZYAA 4PLZA 2PKQP 3IMFA 3ZV3A 2VN8A 3L0DA 5HBRA 3BHMA 3EHEA 4TWRA 3QHAA 4J1SA 1E92A 4CM9A 2JCVA 2FSVA 4BKPA 1T1RA 5CEFA 3WSWA 3I3OA 4CMIB 3IUSA 4ZN6A 4YJFB 4YVFA 1ZK4A 1MB4A 1HL3A 4Y6RA 4ZRMA 4ROSA 3ZWMA 1PGOA 2EF1A 1SEVA 5I9MA 4DWVA 1R4NA 1MXFA 3RI3A 4QFCA 4HFMA 4HFRA 4CLOA 3OQBA 4MO2A 1O8CA 4QT0A 1N9GB 4FD3A 5LDHA 5JYFA 4UULA 1IULA 4NIMA 3Q6IA 4ID9A 3B1FA 4XGKA 1O95A 3D5TA 2YDYA 1I33A 3IJRA 4M87A 4FFRA 2CDCA 3RUHA 3DZIA 3HDJA 5TSDA 4BNWA 4FJ2A 3SXPA 3CMCO 3FPCA 1JAYA 3GNTA 1V6AA 3JQGB 5ITWA 4GSLA 1U4SA 3U4DA 4IPTA 2YFQA 3DQPA 2VWPA 4AJOA 2RCYA 3BXXA 2FR0A 2YDXA 4LVCA 1BG6A 2VQ3A 3TZCA 2I6TA 2D1YA 4YAIA 4A2CA 4MP6A 4FFLA 1B8PA 4RGBA 1E3EA 3K31A 4YT8A 4R1SA 4ONEA 1U4OA 1Y7TA 3S2FA 3RBXA 4UVGA 3BHIA 4YT4A 2DFDA 4P22A 1SB8A 4QQRA 2GCGA 1AN9A 5DBIA 1MG0A 3D64A 2PNFA 3TOZA 2C7VA 1YDWA 4GX1A 1BDBA 3C1TA 4E0BA 4HXYA 3JQBC 3ONDA 2DQ4A 4DL9A 4DRYA 3DBHB 1NR7A 4Y6PA 1GV1A 3OJFA 4FFMA 1GZ3A 1Y9AA 3OMLA 1I3MA 3RUEA 3FI9A 2NVBA 3GMDA 1KC3A 1PJ2A 4HWKA 4YJGA 1LLUA 4J91A 3IP1A 5GZ3A 4CQMD 5JO9A 2P9EA 4LCJA 3G1TA 3UGKA 3BMQA 4RPLA 3MJ4A 2UUPA 4WJZA 4MVJH 4XX0A 5AXDA 4E31A 4YCAA 4K9DA 5L40A 1A5ZA 1GCOA 3DMTA 4E5PA 4BMNA 1IY8A 3TJRA 2JCXA 3ANNA 1M76A 5I7EA 3DMTC 1I3KA 3AOGA 3DZBA 4U0JA 1ID1A 3RAJA 2P9GA 2FOIA 4KUEA 1KVUA 4B8WA 3IKVA 1F8GA 2BH9A 3OQ6A 4RV9A 1J0XO 4NDNE 1ONNA 4PLPA 3U62A 3EZYA 1D1SA 6ADHA 1Y9EA 2QG4A 3LDHA 2Q2QA 4S3MA 5FYDA 4AFNA 4R54A 1RJWA 2DAPA 3KTDA 3NT2A 2PLAA 4TROA 3PWKA 3LLSA 3RFXA 1R4MA 2GN6A 4MVJD 3M1LA 5AXCA 4B7CA 3QE3A 4L73A 1PEDA 4Z3KA 1LLQA 1GEGA 4N54A 1W73A 4IM7A 3B20A 2H1SA 4IY1A 4FN4A 1NFRA 1U8XX 3KO8A 5GY7A 1OOEA 2GN9A 3OP4A 1XYGA 4I9HA 3JD2A 1DRVA 4KUGA 2X0NA 2HCTA 3K96A 2VT2A 5J23A 1SCUA 1BRMA 2JD1A 1DC4A 5DBFA 2VHZA 3RSHA 1AE1A 2IZ1A 3AI3A 3QWBA 2PGJA 5FI5A 3FD8A 2EKPA 5KJEA 1GYPA 2FSSA 5K9ZA 2VZ8A 1EEHA 4MVJE 3TOXA 3GVHA 1NAIA 1SEPA 1WWKA 2HK7A 5A4DA 1TXGA 1DAOA 4DC1A 4FDAA 3ZNPA 5BSFA 5L51A 2DTEA 1LBEA 4OSPA 2ET6A 1HLPA 2HQ1A 5A9TA 4MKXA 4YQYA 3ZNOA 3DHNA 3JQFA 4F6LA 1DRUA 4INAA 3Q1LA 4ALKA 3W4KA 3JQFC 3T4EA 2OO5A 4YJHA 3QWFA 3OJ0A 3QV1A 3QW2A 1Z6ZA 3QRWA 1P3DA 1FDVA 2CF6A 4R1NA 4CJXA 5KJ1A 2VTDA 2W2LA 5L7WA 4QO7A 3QVXA 3JQAD 1BHSA 1DJQA 2X23A 1QP8A 2C0CA 2XAAA 3VPSA 5KCZA 2A35A 1ZZEA 4GMFA 2QZZA 4PLWA 2VTEA 3L9XA 5L45A 5AYVA 5I9LA 1ULSA 4Y6SA 1I10A 2P4HX 1GTMA 3O03A 2ZCUA 1P1HA 3HSKA 2BFPA 1UXIA 3CIFA 5IZCA 2Q2VA 2Y1OA 1KEWA 4WCFA 1U3VA 3PYXA 3EZLA 4UUPA 4BO6A 3I9LA 3GHYA 2R6JA 4WCFC 3HB5X 1WPQA 3AM3A 2HDHA 3CKYA 1FDSA 4XCVA 1S7CA 1WLYA 4F46A 4WLOA 1YH3A 1PQUA 3KM0A 2YQ5A 1CJCA 4FFNA 1PJSA 3DEYX 3ZNQA 2RH8A 3ASUA 1HDZA 3UCEA 3VKVA 1YWGO 3KSUA 1EDOA 1AXEA 4RPHA 5DCUA 3HQ4O 4IXTA 2GDZA 5JFOA 4JJGA 1YOVB 5EQDA 2X7HA 3RKRA 4B7UA 4R3WA 1LDYA 4BL5A 1KIFA 3NEPX 3BTUA 2OUIA 3PQDA 3WXBA 4I08A 3S55A 1A9YA 3VTFA 1DFGA 1E7QA 1C0KA 5H83A 5JLAA 1HZZA 3KYDA 1XSEA 2UVDA 2JKVA 1QSGA 5BSHA 3EUWA 2DKNA 4B3JA 1E1MA 4O0LA 4XR4A 1JVBA 5F1PA 4J1QA 1TT5B 4PLCA 4PGFA 3TZKA 2EHDA 3CMMA 1IHYA 1RM4A 3LT4A 3MOIA 2DTDA 3D4PA 2Y1DA 3AUSA 3GRPA 2D5CA 4ZGWA 1GFSA 9LDTA 3N58A 4DLAA 5L7YA 1HKUA 1V8BA 4M55A 1E3SA 1VKNA 4I5GA 1HEUA 1OMOA 3MJCA 4CV3A 3G79A 4O63O 2PZJA 5LCXA 4Z9XA 3TN7A 5HS4A 2VYND 3ADPA 4GGOA 3W6ZA 4NQZA 4JCOA 4HV4A 3EDMA 1L7EA 2PFGA 2OORA 3R6DA 2PH5A 3F5QA 2X5KO 2HU2A 5A5FA 3N7UA 1JVSA 4UVHA 4C7JA 4PG7A 3VAZA 1N7HA 4BO3A 5KKAA 1U28A 1RM0A 1E3LA 2Q3EA 1XWFA 4O5OA 4M86A 3CSDA 4FFPA 2HMWA 4EITA 4DPLA 4A10A 1U8FO 4A73A 4PFJA 1JTVA 4BO5A 5JC1A 5JAQA 3UH1A 3VKUA 1JA9A 5B4VA 3GG2A 5COBA 2AXQA 1H94A 1GYQA 4RF5A 1YBVA 1P44A 3K2EA 3EW7A 4W7HA 4NBVA 3E8XA 4AJJA 2BI8A 4KQWA 3FTPA 4LW8A 4CMIA 3SBOA 2OL4A 4YJFA 4NBWA 2RAFA 5IG2A 1T2EA 2EP5A 3JQ8B 4RLHA 3TWOA 4CMEA 3V2GA 1J4AA 5EL0A 3NRCA 5IJZA 2OP1A 4JBHA 4CMEC 4Z0PA 3V2HA 1TLTA 5CDUA 2NV6A 1HYHA 4BO7A 4IZIA 3ITKA 2X9NA 3GGOA 3GMSA 4LRSB 1U7TA 3EY4A 3G3EA 5CDGA 3OIDA 3ZHBA 2FN7A 2Q1TA 1NQTA 3PPIA 1DIRA 1U2DA 3E82A 3BZUA 5JCJD 3FNGA 1Z74A 3NJ4A 2EKQA 2QYSA 3IAHA 3LU1A 3ZU5A 3JQGA 1LLDA 2EIHA 1P1RA 1R0LA 5TX7A 3QP9A 3ASVA 1CEQA 4WLUA 1Z7EA 1VC2A 3ZU4A 1HDYA 1VSUA 3W8FA 2W98A 1ISMA 3JYPA 4D41A 4HFJA 1E5QA 4S1VA 4O59O 2AA3A 2DVMA 4OXYA 5TRTA 4BNJA 5JXWA 2AW5A 5BNIA 3IKTA 3PZBA 2BI7A 4XYMA 3ROQA 3PHLA 4EDFA 2AQIA 3VH4A 2PD4A 3GOHA 3BMQB 8LDHA 4BNMA 2FMUA 2VUTA 2X0JA 5L7TA 1LDBA 3B1KA 1M6WA 2OGUA 4AVYA 1FDWA 2D8AA 3EAGA 4NZ9A 2GZ3A 1MG5A 3PP8A 3DBHA 4ZQEA 1CIVA 1PZGA 4URFA 5KIAA 2Q22A 1UDCA 1B0AA 2O7SA 2NU9A 4J3FA 4P4GA 3C85A 5JAZA 2J3KA 4XD2A 2ZJ0A 3I23A 1RWBA 2GGSA 2R2GA 5MGBA 3ANMA 5L53A 4M8SA 1CYDA 1UZNA 4MKRA 4L76A 1T2AA 1ZJZA 3U9LA 2AEFA 4AICA 1XLTA 3PJFA 3B6ZA 3DWFA 4YAGA 3O26A 2UYYA 4J2HA 4J2OA 4Z3DA 1HDXA 4K28A 3NDIA 4JXKA 3FNHA 3WDSA 4CL3A 4ND3A 4CV0A 1ZMTA 1H6AA 1ZEJA 2B5VA 5HM8A 3O8QB 1T2CA 2ILTA 1SPXA 2VYVD 1R16A 4RF3A 3DBLB 5AQ1A 1LNQA 2RHRA 3OM9A 1CWUA 2FZWA 5IXYA 3DB2A 4ZHSA 4Z0HO 3M2PA 1YONA 1X7DA 3VH2A 3G0OA 3P7MA 5L4SA 1E1KA 3ZWWA 4BNVA 2DBVO 2FPIA 1JQBA 4XYBA 4FPXA 1LSOA 1PIWA 1BVRA 3OETA 4RVSA 4DUPA 3U5TA 2X6TA 1QORA 2F00A 4OGWA 3W4IA 1XEAA 2IYOA 2PGDA 3G49A 3ZWCA 4JIGA 1OC4A 4Q3EA 5IF3A 5ER9A 4JK3A 3AFNA 4TSKA 4BKRA 3I6QA 3GDGA 3BMCA 1VI2A 3HDYA 4II3A 4GWKA 1UDBA 1B3RA 3I9MA 1K2WA 4MIEA 1F14A 4CR6A 1F06A 1MV8A 4CL8A 3JTMA 5CAEA 3DONA 2WE8A 2V7PA 1GV0A 4LK3A 4NI5A 1LLCA 2X9VA 4W4TA 3H6KA 4W7IA 1NQAO 3ZGYA 1QG6A 3P2OA 1J6UA 1PGPA 3QLJA 4BIIA 4ALLA 5T8KA 4GVLA 4BB5A 4BGVA 4EW6A 1WDLA 2GSDA 1DHTA 2ZATA 1EUDA 5T8KC 1L7DA 1DC6A 1PU2A 1XKQA 4YJDA 3W4JA 5MDHA 1ZSYA 3NGXA 1Q7GA 4YAJA 1X7GA 3U3XA 1X0VA 2YQ4A 4Q3DA 7ADHA 5KVSA 3PI7A 3E6AA 4D43A 2W90A 1LSJA 3QWHA 1MX3A 1VRWA 4GAEA 3WX0A 2H9IA 1WP4A 1YL5A 2O3JA 3KBOA 3ETDA 4B3HA 2DBQA 4MOWA 3GNSA 4IS3A 1DIAA 3VDQA 4IUYA 1QLJA 3KYBA 4EEXA 5I9NA 2YV2A 5F1OA 5G0UA 1CQIA 3D7LA 4XKJA 1DJNA 4FOSA 3ZWOA 5A06A 4MDHA 2NWQA 3NYWA 4GLLA 2YHUA 2BELA 3W8DA 1OBFO 2X58A 2O2YA 3K73O 1O94A 5EJ2A 5C7OO 4TRJA 1E1LA 3NKLA 3VZQA 2FPGA 2P4QA 1JKIA 2PR2A 5AVOA 3I5MA 3FF4A 4MVJP 1EVZA 2Q1UA 2VNAA 4NG5A 3LSYA 4TZTA 5DP2A 3TL2A 3RVDA 1OAAA 4ZD6A 1H5QA 2GPTA 3VPFA 4Y67A 4A5OA 3RC7A 1UZLA 1LXCA 1KYQA 3GEGA 2GN8A 5AXBA 3FTNA 3DL2A 1VJ1A 4EEZA 4JP2A 3E5MA 1S6YA 3I83A 4UREA 5F5NA 4A27A 1PL7A 1CETA 5HA5A 1KOLA 1BGVA 4UEJA 2FY8A 1LA2A 2PZMA 2WWRA 1IPFA 4LVUA 1KC1A 4GKVA 3PYMA 4YR9A 4DPKA 4D7AA 1U9JA 2VT3A 5KVVA 4PVDA 2B4RO 4KOAA 3UW3A 2OOSA 1KVQA 1A4IA 1YOVA 1WZEA 1C1DB 2BKAA 4N5LA 1G0NA 1UXGA 1YL7A 2BGLA 4GSKA 1Y8QA 3WGTA 4B4OA 2PD6A 4EZBA 3H3FA 1LQTA 3ULKA 4E13A 2P68A 3WGIA 4BVAA 1R12A 3ICPA 1ZW1A 2AHRA 2B69A 4L75A 1NFQA 4RQUA 5B4TA 3ETEA 4WUVA 3GR6A 1N5DA 2B83A 4GWGA 2YV3A 1VLLA 2NUAA 4UUNA 1N8KA 3H9JA 4BOYA 1TT5A 1JWBB 2XOXA 1E7WA 4BB6A 4PLTA 3PTZA 2O3SA 3IDSA 3DFZA 1P1JA 3MWDB 4MVJA 4FS3A 1V3VA 1YRLA 3JCZA 1EK5A 4Q3CA 2QRLA 2EWMA 4KQXA 1DFIA 2LDBA 1MC5A 2QQ5A 2IXBA 1C0LA 5G0WA 1PX0A 4QX6A 4G81A 5DN9A 1X1EA 4PRLA 1HSZA 2ZB7A 3R3JA 4TKMA 3K6JA 4YT5A 4W9NC 4PZDA 1GUFA 2OHXA 3U49A 2ZB8A 1N2SA 4BKUA 4IGEA 2D59A 4J0FA 1MA0A 2D4AA 1IYZA 3TSCA 1XCBA 1RM5A 4XGNA 2HUNA 5CDYA 4OKNA 3GEMA 2AEJA 1LDMA 1I32A 4U6SA 4PLGA 3A9WA 3GZ4A 1LQUA 2PA3A 4OIMA 4XA8A 3QVWA 1EBFA 3ENKA 3RUAA 3LQFA 2AG5A 2WYVA 4N5MA 1RM3A 3DMYA 3I4CA 4EJ0A 4BGUA 5TJ9A 1NBOA 4MVJM 2Y66A 1GPDG 1N7GA 1JDJA 1QYWA 2HJSA 3DZHA 4NJOA 1G0OA 2Y0CA
chains in the Genus database with same CATH superfamily
3GLFE 5BSEA 4ZA2A 5K3FA 2H0AA 3WB9A 1G3UA 1KSJA 2DHDA 3LLCA 4EG7A 3HXKA 4G0WA 4ANFA 1COWA 1GP2A 1U1EA 2FQYA 2XODA 2YXLA 5SZJA 3ZHCA 3VPBA 2BGJA 4M9SA 1WPGA 3FDXA 3TLKA 4E46A 1EUQA 1FQJA 2HSDA 2QV0A 1WMAA 5BSVA 3OPYA 3O3OB 3TW3A 3L5OA 3SJCA 4B46A 2UZ4A 2R97A 5HOQA 1RQRA 4MRRA 4F6CA 2QN9A 2Q0HA 1GADO 1O9BA 2AE2A 1SD5A 4E5DA 1AQLA 2ZSHA 1J25A 1FJHA 4INPA 3RHSA 2BLNA 3T5DA 3JWIA 4BLQA 2IBTA 1SC6A 3BTVA 1YJCA 4DKXA 2JAXA 2PUCA 1USWA 2I2BA 2O59A 4AUEA 4C76A 3T3DA 4RCZA 3RABA 3WK8A 1QUEA 3G88A 4EMSA 1DIOB 1YBAA 4QNNA 5EI5A 1IONA 3DOIA 5GOTA 1MAAA 2XYQA 3QUCA 1GAXA 4JH0A 3K5IA 4XJVA 4RA9B 1ZLYA 2WWGA 1FB5A 1HWYA 2PJUA 3INYA 3JQBA 1ZK0A 2A33A 1ORHA 4M4SA 4F6RB 4HAZA 4NCIA 4ADSG 2DOKA 1OIXA 2E18A 4RTQA 5HKOA 1SHJA 5LDDC 1RQLA 3WNVA 4LXIA 5CFNA 2XNHA 1WX1A 5EHXA 4LYHA 3DOHA 1ZU4A 1UP6A 5IC6A 4P2BA 4F9GA 1GUZA 2X0IA 3BSWA 5HIAA 4XFJA 3WAJA 3H0WB 3HHEA 1IVSA 2X22A 5IPFA 2Q4EA 2DPGA 1A4UA 2E4VA 4V0NA 3ZDZB 4CEIB 1E9EA 2FTKE 1KZYC 4OI2A 1NX6A 4PCVA 2B7LA 3K0FA 1Q77A 2WYUA 3JAWB 5EPOA 3KXDA 4WY5A 3T5PA 4QBHA 4ML3A 2DHQA 4LNUB 4LGVA 5JQGA 5A9RA 4F84A 4H3VA 1G6OA 1Y98A 3BBLA 3CV3A 4E5YA 1BWSA 4P34A 4MP8A 4A4DA 3FVVA 4S04A 4ER0A 3I2IA 1Z62A 4ETMA 3PYLA 3OOSA 4DCCA 3ZUGA 1H2AS 4QFMA 3BK7A 2BMDA 3O8NA 1I7CB 3EGWA 1RPNA 4H60A 1W44A 5HE8A 2JIOA 1KJJA 2F2TA 1LKZA 1PJZA 3NNNA 1ZOLA 2R00C 3TFQA 3N2EA 4B7XA 4H7PA 3IOMA 3IV7A 4PZ0A 3V1MA 1EHIA 4ASUA 4DMMA 3KR9A 5LKAA 2FZEA 3P5BA 1HT3A 3GLVA 2PMBA 3R1IA 2CVFA 5D3QA 2JLRA 2Z3ZA 1NVUQ 1YFZA 1NM5A 2PSSA 4D4IA 1PDVA 3RYCA 3GZNA 4LHVA 1OASA 5C4IA 1JTFA 1VPWA 1XX6A 2CDRA 2Q7XA 2ZRJA 4Z99A 3TTXA 3M34A 4INJA 3RASA 1CHNA 6REQB 1NVVQ 4PRYA 2G9VA 5IH3A 3F96A 4C1BA 2RGYA 3GCXA 4NU8X 4LMRA 3C8MA 4F9TA 2PGIA 1FDTA 1WHTB 4B2YA 4KFCA 1T8RA 1U5BB 4CM7A 1JALA 2G17A 3QA9A 2VYNA 4WOBA 3KFLA 4GYKA 1FP4A 1H42A 1Y33E 2ONZA 4TS3A 3V8VA 1OTYA 4CL0A 4CRWB 1G4HA 3BMCB 1KO5A 1D09A 5JARA 2YRWA 3CX8A 1S2OA 4OBWA 3WHKA 2E48A 3GPIA 2ZU0C 3O8QA 4MARA 2ECKA 1XTKA 1HDIA 2X15A 2CMHA 3I09A 3PFNA 4Q48A 4AXXA 1VL2A 2LCFA 1D9XA 2A6PA 4DVGA 4DIBA 2A0UA 1N5KA 2YOFA 1PR5A 2JK0A 1Y7PA 5KNLA 2NSDA 3OF2A 4JEIA 1VPEA 3AYZB 3NDRA 2FN3A 4Y8VA 1RJFA 4F5YA 5F78A 1OXXK 1PZFA 2NO4A 4R83A 3OEWA 1MBZA 3FOZA 1IPHA 2EW8A 3EGVA 2CYCA 3TOCA 4YRCA 4UJ3A 4QIHA 1WVMA 4X1YA 5H4GA 3N6VA 1WUTA 5EKTA 4CCYB 7REQA 1N3LA 4E3ZA 2AHOA 3G9QA 4HZUA 4KV9A 3SEQA 3PLNA 1ZR2A 1Q0QA 3KV3O 3VH3A 2KLBA 2Q9AA 4G0YA 3CM0A 3OCVA 3F5DA 3NC1C 4G01B 1EUCB 1YQDA 1UAGA 1VSBA 3OSUA 4R41A 4RKWA 5HUQA 2C9OA 1LFAA 2C3OA 3I04M 1NI3A 3WQBA 1Z38A 4HNTA 4N18A 1Q21A 1E6WA 2WB4A 3DOEA 4Y9SA 1DLIA 5HZGA 4QDZA 4ZI7B 3AUKA 3WYEA 4B4DA 1L7BA 5T64A 1BWQA 1QCDA 3WGYA 2C3UA 2JHFA 2YWXA 3ESCA 3INTA 5DW3A 2ISQA 2NTEA 3QMPA 3QU7A 4HRYA 2NUTA 3OJLA 4F38A 4J1NA 2WILA 3KZOA 3QXGA 3C1UA 5LDGA 1H2ZA 3WB0A 3STVA 4EELA 5MFPA 1Z8NA 1G9XA 3I73A 1J09A 3DZ3B 1I9CA 2I2FA 4G6ZA 3HP4A 3PWZA 3KGDA 5C31A 1M73E 1RVV1 4JSTA 3ZWBA 4KGDA 5JS6A 5AOCA 1YTLA 2XJ9A 4J75A 3FGZA 3S1SA 1QS0A 3DJYA 2UZ1A 3ZI4A 2FPKA 4F06A 1P29A 5REQB 1W7AA 4IR7A 1PJ4A 4R8KA 5DHTA 4DKJA 3DLAA 4EYEA 4BLWA 5J4VA 5CT4A 1EE2A 3TE7A 3L4SO 2N47A 5ILQA 2OVBA 4O8CA 4OQFA 2O5VA 3JYHA 3H65A 4FNOA 1CQPA 1GKIA 1P0PA 2FPXA 2P2SA 2C99A 2FZ5A 2N9UA 2XYVA 2XDYA 3E7DA 4IZ6A 1ADCA 1G8YA 4MPTA 4O4JB 3PJEA 3E35A 1PX2A 1ZA2A 2Y1FA 3N3BC 4UD6A 5TGDA 9GPBA 1A4RA 1WUYA 4O4HB 3TIGA 4HNSA 1K88A 2XKJE 2VF4X 4UFNA 4C7OB 4MLPA 2CVZA 2XT9A 2Q27A 5DNEA 3PDIA 4TZ6A 4K6OA 4OX9Y 1I2ZA 1XMJA 4NBSA 5JAUA 3L6RA 3QI7A 3AHEA 3RFUA 1PWHA 4O8ZA 1Y8RB 1QYCA 3ST7A 4I1UA 3EIUA 2XB2A 3S81A 2D0PB 1R0CA 3NXSA 4HPJB 2WAXA 4MUNA 1UBUS 3FNBA 3UT5A 2BGKA 2X1VA 2JLBA 2EYQA 2O3TA 1Y8CA 4MPPA 3UBTA 2VHXA 1TEXA 5TS2A 4YCSA 1N0UA 4WNYA 3RIMA 5F3RA 3HV2A 2OZLB 2QD4A 3T7TA 4LGMA 1X1QA 2NNLD 2ZQ5A 3HP1A 4ZK2A 1KA9H 1PGQA 3K9WA 3KRTA 3P0EA 5AKGA 5KSZA 1T36B 1Z4PX 4C7VA 2AI3A 5ADUS 3C7KA 2BP7A 4X1IB 2QL7A 5IVPA 1EVJA 1T29A 2R5FA 2BKXA 4AJEA 3H5OA 1A72A 3CH5A 3LRXA 4PZUA 1QP7A 5JEEA 2HK9A 3RIYA 5CVUA 2WJAA 5I9TA 2Y2VA 1VL0A 4MVXA 1W94A 2D06A 4CUKA 2RHOA 2C94A 1QTIA 2VBCA 1TE2A 4QYSA 5CBKA 3ROXA 4E22A 3BSFA 2VHYA 2VP0A 2X3FA 4U9HS 5DSZA 4QDOA 1SPBS 2YXPX 5EWMA 5KVCA 2XGGA 1WF3A 1Z5GA 1NF9A 3D1JA 3DV9A 1BCSB 2HJGA 3PX7A 2FKNA 4BKMA 2JGLA 3NUZA 3EXG1 3TRJA 1JQKA 1G7RA 4G8BA 4BNUA 4QT4A 1EP1B 3DS8A 3DLCA 4CNQA 2CLKB 2ZI7A 1P1BA 2GK3A 4Q39A 4XDYA 4ZJZA 1E1RD 3A1VA 2WVJA 4IDCA 5C52B 1JG2A 2QRUA 3QQ5A 2V8OA 3F0TA 2IDKA 3E4CA 1OT5A 4A8JB 1FFBA 1IG0A 1RYZA 4HAWA 2V0CA 2Q3FA 4U3JB 4C03A 5I5EA 5JVDF 3TQQA 3AUUA 3ZCUA 4WCVA 3AP3A 2F9LA 3W90A 4HP8A 2Z4TA 4MW6A 2SKDA 4ENTA 1G3MA 1WEHA 2ZITA 1CY8A 4RFSA 4ZOBA 2H3HA 3N8KA 3OTQA 4G1FA 1AHHA 2YJZA 2H7VA 3HFGA 1E99A 5IDWA 3WGNA 2WJZB 1IB6A 2WZCA 1XPUA 3KV1A 1H4QA 2CJWB 3UK6A 3ZGOA 1O6FA 4I36A 5DI9A 1DP4A 2WVGA 2YQZA 3AW9A 4HD8A 1L4MA 1NXQA 1OYYA 3OU2A 4BFSA 3UAOA 2IZ6A 5HQTA 1M6HA 1V3TA 3HXQA 2F8SA 1P0IA 3OH8A 4JR2A 2GA8A 4YT2A 4ZC1A 3PKZA 1U8AA 1ONOA 3JVUA 1XK7A 3BDVA 3BG5A 3JU3A 1KO1A 4YAFA 3QITA 3O3MB 1TECE 3PE4A 4I4LA 1UMCB 1F12A 3HFJA 1ECJA 1Y1LA 2BCJQ 4X6UA 1IBKB 1ZL2A 2DYKA 2A57A 1TB4A 3ANLA 2G9ZA 3DPIA 3NKVA 4HVAA 2NMVA 3LI2A 3P71T 2CJXA 4OB6A 3C24A 5U1PA 4NZOA 3OX4A 3R9KA 4YGXB 5HF9A 3TD2A 4OI4A 4DLBA 4UUMA 5LFAA 5E7JA 2ODNA 3V55A 3RTGA 3UAVA 2FP3A 1Z34A 3ICCA 4PSKA 4MJ3A 4JELA 3CVJA 1U1CA 2GD1O 4HNAB 4UE2A 1UBLS 4WX2B 4AJPA 5TMEA 1XD9A 1U0JA 1ZNXA 3SCZA 3B6KA 5JD5A 1V1MB 4RIHA 1B4DA 3QVGB 2ZYDA 4WLVA 3WJ7A 3OQMA 2CHFA 2VNHA 3WLJA 3R5KA 2ZB4A 3KELA 5D1NA 1OGIA 4IJKA 1BS9A 4GOJA 1O89A 4J0JA 2AZTA 3CINA 1WW2A 4KRXA 3COPA 4M1YA 1X7XB 5CT6A 5EVJA 5LA6B 2ODEA 4CV2A 4RZSA 2QUBA 1YKGA 1D6MA 2QUIA 3RAFC 1BOFA 4FVTA 3HSYA 1UJCA 4XDHA 2EOAA 4V1CI 3KR1A 3ZD6A 1B73A 5LBUA 1ZCZA 4QJ3A 4L28A 3OIYA 5KOYA 4NR0A 3FFWA 5JNLA 3DL4A 4TUYF 1CJBA 1K1EA 4G0XA 4RLSA 4P38A 1OVMA 2QVGA 1V11B 4P6VF 3HRHA 1AXGA 2REQA 2VUIB 4DXHA 2HWUA 1DS6A 1YA8A 1F2UB 1L7XA 2BT4A 3JR7A 2WHRA 3RC9A 3OZBA 2BHRA 4IFEA 1RPTA 4IJMA 5J4YA 2AEMA 2WMYA 1SVIA 4V2IA 5TMDA 3L40A 3REGA 3VO8A 2BMAA 3T7EA 1FFAA 2QPAA 3OD1A 1NKSA 1RVDA 2V7VA 1QRSA 3GUVA 5I9BA 1PK9A 1QG0A 2BKEA 1NBME 3UWPA 1KIAA 2WJWA 3ZLBA 5KQSA 3A1UA 4LYYA 4BNDB 2OK7A 1OI4A 2P77A 4M36A 4HKTA 1CB0A 1EFHA 1PD1A 2QD1A 3H87A 1GN8A 1SUIA 3PNVA 3N3AC 5AKYA 3C1OA 5SZIA 3VSDA 3CUUA 3SX0A 2FN9A 3GNQA 4BNIA 2I67A 3H5TA 4ZP1A 5EFZA 3ZVLA 5FWYB 1USGA 2HLPA 3WV5A 1UT5A 3M82A 4B6JA 3KT8A 1BROA 3DAGA 1NW8A 3CLTD 3I9V1 4DLWA 2CEAA 4EY8A 1QC5A 1TRKA 3GZNB 3IL2A 3I4LA 3GROA 3D6UA 3SQMA 3MF4A 5DEIA 3JYLA 1Q7TA 2FW9A 3QYJA 2VL7A 2A84A 1YIAA 3KJXA 1Z5OA 3ZTYA 1Z6YA 1JAXA 2QP9X 2EKBA 3HHPA 3QHPA 2HEIA 2VXYA 4K87A 1DADA 2V4UA 1UEJA 3EYWA 3SZGA 3J7TA 2W2OA 1R9JA 4FT4A 4K6FA 1OLOA 2OZKA 2J9YB 2A78A 3SYLA 5KUTA 1UOPA 4L5AA 4B6OA 4NBUA 4ND1A 1HDEA 2JEYA 2JBHA 3DMDA 3MBIA 3R3UA 4G37A 4I4IA 3X1YA 2UXCB 3L6CA 1ODJA 4G5HA 4HL6A 2P2LA 1XRSB 3KFXA 1JXAA 2XV1A 2PUEA 4CIBA 1T5DX 3PGKA 4RD1A 3JRXA 5FOUA 4A0QA 4BU0A 1UPTA 5CDFE 4TV9A 3SPXA 1CUIA 3ECCA 4QBKA 5K6AA 3WLQA 1CHDA 1XVAA 2VSXA 3VR3A 2PMDA 4ZDWA 3KR0A 3JASA 3ZHSA 4TLMB 5K6AC 1SBTA 2O0JA 3ROKA 4YJ3F 5EZYA 1ZJ5A 2GBPA 2HV9A 3U56A 2W0MA 1JDZA 2I3ZA 1S4QA 3E9DA 1MOPA 4QUGA 5AT1A 1ZP6A 3W3ZB 1X15A 3KQLA 3BIXA 2OPBA 3LQ1A 4RM2A 3MWKA 4MRAA 2XTAA 4Q6BA 3VTZA 5HNKA 3WMRA 1MGOA 5D3MA 1GTJ1 4B09A 4EX7A 1CV2A 5TT0A 5B2FA 3IB3A 3E23A 3K09A 3KL4A 3HL4A 4GGPA 3E70C 4NFYA 2OQVA 1OPRA 3HPQA 3K09C 1PFKA 3OAAD 1BX0A 1PWZA 5JD4A 3MB8A 1ORVA 4AM8A 2XJ4A 4DLNA 5IFLA 3PA8A 4XWGA 4PQGA 5LIRA 4H16A 4MR9A 1Y1SA 1KEKA 3DZ5B 2Q46A 4A15A 4CF5A 5CM9C 3QGMA 2EBFX 2IUEA 2JLUA 4HWGA 4QQNA 5AVQA 2DFKB 4XQGA 2L0XA 1JLKA 2QPOA 2XNJA 3KJHA 4KRGA 4DV0B 1GPUA 1J5EB 1NPYA 3BA1A 4L74A 1RJEA 2Z57A 3BK2A 3KYIB 5H59A 1X3LA 2KMLA 4OMFG 1E3DA 2UZ1B 3O6VA 3A1SA 2EC5A 2FRXA 1FYFA 3AUYA 3LXXA 1KDVA 3KEMA 5CP8A 2DE0X 4BEWA 4XFDA 2DX7A 1BDMA 4BCCA 4HWPA 2I91A 3EGXB 3HI4A 4LC1A 2HMUA 1PQWA 1RWWA 2PWZA 2ZSBA 3KK0A 3QEOA 3TM4A 4DA8A 4E1BA 4WV3A 3WZLA 5A62A 1UXJA 3GG9A 5ITVA 1IDOA 4KYTA 2FP4B 2A86A 5HFAA 1PKEA 2Q5QA 1NT4A 1KMIY 3U1TA 2JLSA 3CUKA 4DLSA 5AFSA 3I6IA 2FEKA 3IQHX 5FV7A 2D2EA 3S2SA 4F7DA 4URVR 3VYTB 1PS0A 5AVRA 1HZJA 4H1VA 1KAQA 1Z36A 4Q3AA 1DQRA 4HMOA 4QELA 4RKRA 2PS0A 4ZO8A 1NBHA 1T8WA 4OH1A 2EDAA 5CB8A 4W8OA 4MYSA 5KSYA 2Q7OE 4Z0TA 1J0CA 3SZMA 5BUZA 1R66A 4EPTA 1VL1A 5FWNA 1V8OA 2GN4A 4BYGA 4P58A 5J1TB 2E5LB 5F7ZA 3G8CA 4D9IA 3DAYA 2ERCA 1HYGA 1ZXLA 2D5AA 4KIFA 3UMGA 5AW0A 1UH5A 1XKTA 4L6IA 1XALA 2DC1A 2PL9A 3L06A 4FDMA 5FOWA 2L42A 3TIIA 1QKKA 3AM4A 3UJ9A 5CA1A 1NMSA 4CKXA 3O7MA 1P8AA 4LY0A 4FC6A 3ZHYA 2ZSUA 4BRZA 4UFPA 5KZMB 4UMDA 2R66A 2MINB 4MV1A 4XWTA 1I4DD 2CB0A 2CLEB 2D1FA 4RAOA 1UMDA 1N2JA 1UZUA 4IMRA 4W63A 4BUCA 4OX9B 3BT7A 2H1CA 5I4CA 1OKKD 1Z6XA 2IS1A 3QX9A 2C2MA 4C05A 1GHTA 2JBWA 2ZYGA 3D6NB 3LWDA 3MZ0A 2DWQA 3IESA 3UV3A 2RHDA 1PL0A 1UXHA 5BUSA 4IMIB 2F43A 5EJ4A 3QEMB 3KYJB 3MSXA 1ADGA 5SZKB 2WIGA 3RROA 5DTQA 3U81A 2PRIA 3C3MA 4OUDB 4WL0A 1KDZA 1HE2A 5D6NA 2R0QC 4C2UA 1Y3HA 2G67A 2R8OA 4JJKA 3VHXA 3PQ7A 4BDTA 2VA8A 5JMWA 1I80A 4POAA 3NVMB 1UMKA 4RK4A 4FMDF 4EKNB 5IJXA 1ETHA 1JDUA 4GOKA 4NSNA 3IV9A 1WDWB 4WOPA 3TI9A 5IDQA 2J67A 2ZAIA 3RYHB 1EXNA 2FWBA 3I2FA 3KLNA 4PFQA 5DHRA 1OH5A 5I7AA 1VXRA 1DTEA 2HRQA 3A9RA 4RFSB 1X9IA 1EGHA 4JJEA 1PI3A 3UWMA 1V43A 1R64A 3C3XA 4HR7A 3PFCA 1ZG3A 1ECCA 1TJNA 4FR0A 3AM5A 5FBWB 4C88A 1W36D 3A37A 3DDUA 3FCSB 3LBIA 3WWPA 3TFOA 2GEFA 1G5TA 3OM1A 1KQOA 1J1IA 1N2CE 1EYZA 3O1HB 3I6BA 3MTJA 5IYZA 2P9FA 1NQOA 3MBOA 3Q7TA 5FDFA 5ALHA 3T5MA 3M4NA 2I7TA 3ABSB 2OSBA 3AY7A 4IVQA 4J7XA 4UVEA 1Z7YA 1PZXA 3SM3A 3PITA 3FPHA 1E2JA 1AGNA 4C08A 4C7BA 3PQCA 1PEAA 1YRQA 4CKWA 1M66A 1PEYA 3ITNA 3F9IA 1P81A 3MT8A 1ZICA 4Z4EA 3L0SA 2YUTA 3RJ9A 1T9KA 1E1NA 1RPZA 2A8YA 3HZRA 1V7PC 1HM5A 3ABOB 5ELMA 1UWKA 2FJPA 5LQKA 1MGPA 3E8MA 2FW6A 3R9XA 3T3OA 2XCIA 2H11A 2WG0A 5ECWA 5FUWA 2HU7A 4HI0E 4UCXA 5IKOA 5FV4A 3WGZA 2OE2A 3MOGA 4Q1VA 2P9YA 4KPFC 3Q6MA 1DCMA 1V8PA 1V25A 1C7ZA 3HADA 4TPKA 4DQLA 4KE9A 4RD4A 3BC1A 4FZ5A 3BGVA 1RCUA 1DRKA 4FEYA 5E6RB 3C6QA 3OP1A 2GN2A 4IAOA 5B1DA 4YV0A 4X6YA 4D8XA 4JROA 1XZLA 1F0KA 1CS0A 3H13A 3ZY2A 4X93A 2B2NA 1CUVA 2C29D 2P4EA 1J8QA 2MYNA 2VDWA 3A26A 3FYTA 1EU1A 1SUPA 2AFIA 3K0CA 4ARBA 1Q84A 3JWPA 2ORWA 4ISBA 3WQRA 4R1OA 4YRZA 2VWQA 3K0CC 5BOSB 3DMFA 1PSZA 2IFTA 5CEJA 5A5DA 1T0BA 4TWIA 1ST3A 1WXFA 1BE1A 3JQAA 3PFWO 3MGBA 3GUUA 3O4FA 1BHQ1 2V6JA 3GDOA 1J1ZA 1W8IA 4DV1B 4P5EA 3T0FA 1NUTA 1AUOA 2X0RA 3G9UA 3OFJA 3OX1A 3OBIA 4O8JA 2J3DA 3KKEA 3GN2A 1N78A 2I5PO 1A1SA 1CQJA 1XA3A 2VPWA 3IDFA 3M6WA 2IODA 3ONFA 2HGZA 2GBIA 4Y6OA 3RAEC 1VGVA 2FEMA 3NV9A 5F77A 3LUAA 1IZ7A 2J5QA 3PFKA 1YB7A 2HPAA 2O23A 5HKKA 2NVWA 3A2KA 5HE9A 3H4VA 1T8SA 4UATA 1UKBA 4EZIA 4F9FA 3H7IA 3A4TA 2QVZX 2IEYA 621PA 1OLUA 4I4NA 3CNLA 4FP9A 5G0SA 2W6ID 4HDRB 1I1HA 1WCIA 4PN3A 5ENDA 3QWIA 4BO4A 4UAUA 4XYLA 4IWYA 2B4YA 3N2IA 4AICA 5BW8A 3WNZA 3JZMA 5E8JA 1RACA 1JKJB 4X20B 3FCAA 3ZBQA 3BHJA 4KQ9A 2KBFA 3DXYA 4QTZA 4KU4A 1VBFA 3AVYA 4AL4A 2PUTA 2AYYA 3KB8A 1VPVA 1JWAB 1ZUHA 4X1KA 2IHBA 1ZI8A 3DQQA 3GAZA 3B82A 3AERB 4L8FA 3K9HA 2TYSB 3RNLA 3ZK9A 4D5GA 1NHWA 4KWEA 3GDWA 3NHJA 4MV9A 5AW9A 4D0RA 5C35A 2UUAB 4LFAB 1KOFA 3B9BA 1YAJA 2SCUA 4BO2A 1JEOA 1MOZA 5BWMA 1HE4A 1M1YE 3H1GA 4ZRDA 2EBWA 3GO4A 2CZCA 3VPHA 2C4HA 4JLVA 4WY2A 3LP6A 5TQ2A 3G8BA 3IAAA 4QARA 3TNDA 1S2DA 3LG2A 1T4DA 1GQSA 3ZGVA 1W36B 1JNXX 4KKXB 4JU9A 1QTRA 1RRKA 1UJ2A 5EHGA 2ZAYA 4IIYA 5D5QA 5FUMA 1E59A 2CW5A 1V5GA 3CF4A 3KJZA 1ATIA 4JC5A 3VC3A 4GBMA 1M2OB 1YDFA 3BQMB 1KU6A 3IXLA 5BORA 3C4VA 2ZIUB 3SJUA 1XLWA 1GPJA 3CYFA 4NESA 3R7WB 3V2UA 2IITA 5E1DA 2XCRB 1YOBA 3UBMA 1GUYA 4BV8A 5IKEA 3HY6A 3ONEA 2Y0DA 4IL5A 1SVKA 3L4BA 4NZPA 1ZU5A 2E6UX 1WUKS 3FW1A 4FYKA 3SEAA 4ZGGA 4FCTA 3AEUA 3BRQA 4GVPA 1X8KA 3L4BC 3HU5A 2FWRA 4Z5XA 3T3GA 1E2QA 1T91A 4FKZA 4DGSA 3E84A 4F2PA 2XSZD 4A26A 2NO7A 4A7PA 3WLIA 1HKHA 1C1YA 3UW1A 2VK8A 5DNDA 3NDBB 1QO0A 2VAWA 1Z3CA 2RB4A 4EHNA 2VWGA 4HPXB 4N03A 2A7QA 2DTXA 4AECA 4C0BA 2VLIA 1I7DA 2C2XA 3RUIA 1U9IA 4OF4A 4E94A 3Q2OA 3VO1A 1ZMOA 2K4MA 5B3LA 1ZM4A 1U9IC 2ZULA 1DIBA 3CCCA 1XQ6A 3VI3B 3CURA 1TMOA 3VUEA 3KYCA 1QF7A 4F2HA 1NXOA 2VI5A 4PWYA 2XVYA 3LT1A 3ZWNA 4F5ZA 2PT7A 5CXQA 3MCTA 3OU7A 1U2ZA 5G4KA 5AD1A 5CH3A 2B1JA 4L02A 3WC4A 3GUCA 2BH2A 1MQSA 5GPBA 4F93B 3E9ZA 4BE4A 4Q3BA 2H4HA 1DTSA 3KB6A 3IUQA 3WFIA 4PZYA 4YAKA 5DP1A 1XPOA 2FEWB 4FOPA 4GSYA 4WQMA 4Z7NB 3USZA 2HNBA 3WZ2A 3IPYA 4P92A 5JNVA 2D2FA 4LXYA 4LWOA 4X3CA 4B3RB 3A4NA 2HMYB 3ONNA 3EZXA 3RS7A 1FMFA 1XZQA 1PLKA 1FBNA 4NEHB 1BC5A 3R3HA 3STHA 5CRIA 4ZOQI 5JDCA 4RZQA 1O5IA 2D0IA 2YHSA 2XIQA 4F3YA 2O3RA 1M2GA 3DBRA 5TC4A 5JDCC 2CK3D 1WXIA 2I1LA 3RAPR 1XRQA 4A0SA 3ZD7A 3RS0A 2O5EA 3CA8A 2JBAB 3DOOA 1VOTA 4TTQA 4TSRA 3R6TA 2W6JD 1TAQA 3RRJA 2VK4A 3F2VA 1ZCFA 2EKLA 2ACKA 4JL5A 3DMHA 3OO1A 4IBOA 4MUMA 1J39A 5IUNC 1E3MA 3BRWD 5CG1A 4JC4A 2O3QA 3F6YA 2AG6A 2LCQA 4BHTA 2HCRA 2INGX 3BF8A 3EXHB 4CDMA 4JI0B 1IMJA 2IEGA 2MMGA 3NOOA 3OIFA 2IPAB 5CT8A 5FO0A 3WB1A 5HQ3A 4YFYA 1WDKA 5L9AA 1KJQA 5KTKA 4QFDA 1YZKA 3ZLUA 1VG0B 2V5VA 3NU1A 4LI3X 1ZRHA 1INLA 3N59A 3WNDA 1BFDA 4UCWA 3GA0A 4RJTA 4IIUA 3B9QA 3C87A 4KPUA 3ZDQA 1X87A 1ZO8A 2GT1A 2DKFA 3ONWA 5H3LA 5HJ7A 3AV0B 3OE7A 1FE8A 1NVVR 1UODA 4CEHB 2AJBA 1QU3A 3W1VA 3HM9A 4V03A 1YR8A 1Z73A 3EVZA 2FMKA 3N6XA 4F60A 1XEFA 3MXOA 1PBTA 5CLLA 2QW8A 4LK2A 4MQMA 3TSYA 1XOIA 1JEDA 1P2TA 4NNJA 2R9VA 5EPEA 1LX6A 1ACJA 2F43B 1RPJA 4MWZA 3WQHA 2WJPA 3GT3A 2J8ZA 5IZCC 4Q66C 1Z0JA 1EFCA 3COSA 4DLZA 3Q2IA 2GNPA 3H3XA 1LRKA 4OHBA 4DXDA 1KDRA 2O06A 4AUNA 2QRZA 2Q6LA 3FAKA 2GPNA 5LLSA 4DQXA 1XXLA 4JJAA 5AIBA 1A9RA 3HEAA 1NC1A 2PKEA 3OQJA 1XP8A 3G2HA 4CLHA 1I1NA 5CHEA 1YGPA 1RT9A 2CD9A 2ACWA 3OJEA 4UDOA 3UM9A 4XI9A 5KYVA 2XUFA 1GU1A 2W00A 3AV3A 4GXTA 3SHOA 3I05A 4BNKA 3F3MA 3ICVA 1LPAB 2RGRA 3EP5B 3CHYA 3HCNA 3JD4A 3LBAA 4LRWA 2VZLA 3RODA 5HVNA 3NXKA 4P7FA 3FWPA 4FBGA 1D1TA 2HJWA 1EK2A 4E30A 4LVNA 3KKQA 4LECA 2WKPA 3P94A 4JWKA 1L4YA 4GZMA 2QZ4A 1SC1A 3AG5A 4Q9KA 5FUVA 5ESWA 1BE6A 5AR1A 4RESA 2OV8A 1Y1PA 3PT9A 4IILA 4AN4A 1HZZC 3GP8A 1I5OA 2BM8A 1CT9A 1WNTA 1YR9A 2OLEA 3BXZA 1WKVA 3E9YA 4K26A 2TMKA 4KE6A 2IWHA 2QIOA 2RHBA 1XVLA 4M22A 3UUFA 5EAIA 3LFTA 3ZQUA 3SY8A 3EASA 3DR3A 1KNXA 2B4KA 4M37A 3H5AA 1ODSA 4MW4A 1Y6JA 1U0TA 1GNSA 3CX4A 2YVQA 1TTHA 5TXGA 1HFKA 4WXYB 3GFTA 4LXHA 3DE5X 3U7QB 2NZ8A 2VSFA 2AXNA 2V4MA 3NTLA 1G2PA 2W8ZA 4XARA 2XCUA 5EKDA 3OSZA 3R9XB 3JQQA 4O3FA 1OLSA 4W5JA 2V0NA 4Q7MB 2EFEB 4IDHA 2GFHA 4G25A 4ZV4A 1P5HA 4XTRA 1OB2A 2I4IA 5TPZA 2FRDA 3LPLA 4CW7A 4JYZA 2CMFA 4BQOA 2X4DA 2WM8A 1S2IA 4JOSA 3KU1A 2FRDC 1RYEA 5AHWA 5AW4A 5AVUA 1EG2A 1NP3A 4BKOA 3PQ4A 1FUYB 1JP7A 1WXHA 4YAWA 4MKRA 3NVDA 1JEQB 1N6OA 2NACA 1XTUA 2V7UA 3F7NA 1AV6A 1A7JA 3GLTA 4LZZA 2JHPA 3EWAA 4MB6A 5IAEA 1UDAA 1ISHA 1XCLA 5BMVB 2BD0A 3KUDA 4YRJA 4CIAA 4PR0A 5JH7A 1T0IA 3A7EA 1CUGA 2YJ6A 3M9XA 1D9ZA 2HIMA 1Z9BA 4KQ6A 5BN4B 4WZAE 1VE3A 3O21A 5BV1A 4IIJB 3OC6A 2P2GA 2Z4RA 3SE7A 4L2IA 4BC0A 2AQHA 4BX0A 2CNWA 2ZSIA 3DBIA 2FXIA 1T13A 2Z2YA 1IOVA 2QENA 3OWHA 2P2ZA 3NM4A 3QFTA 4P4LA 4PSUA 5IAKA 4AKIA 1GL3A 2DPMA 3P4UA 1SXPA 1DAKA 3H5WA 4XIYA 1DLJA 3PTAA 3CVXA 3O84A 2P65A 1MT0A 3F3SA 4H17A 2IELA 4CM1A 3AINA 1YQXA 1PYGA 4GM1A 2RHHA 1SG0A 2RGCA 4MZXA 2HLDD 4PNHA 4U9IS 5AM2A 2PL5A 1GPYA 1P7CA 2C5FA 5ALXA 2ZRDA 1SUFA 4M46A 3SEFA 2WVAA 2CUZA 4JI6B 1WMSA 2VS1A 3VR4A 3R7FA 5E2IA 2BFMA 1J97A 1JIVA 3E18A 2RGGA 3BB4A 3CG0A 4QU5A 1J0AA 3T3HA 4C0HA 4DVJA 3ZQKA 1YASA 1TM1E 4UHFA 3N28A 5CNMA 3MCVA 3IC5A 2G6BA 2LP4Y 4G0NA 1A95A 3O94A 3I8SA 1YQWA 1MD9A 3K5PA 5EPUA 2ZIXA 5JYEA 4EKIA 3FKJA 1AGRA 4K9QA 3J80A 4FWBA 4JLBA 4MS4B 1F0YA 1ICEA 1I2MA 3LYLA 1OCEA 2O48X 4RVUA 4H4EA 2HBZA 5ESDA 5ALKA 5EIWA 4KJZA 5ILOA 2FCAA 3AU9A 3E22B 3EWSA 3HWWA 3OQOA 1Q57A 1TMYA 1X0XA 3ZWPA 1LNZA 5AUOB 4IDGA 2OFWA 1EP9A 3O8LA 3GJQA 5EINA 2LE0A 1JUDA 3N8DA 3WK4A 1KETA 5ETJA 4IDBA 4QBFA 1TU4A 1G8MA 3I76A 3A6GA 2N3ZA 3BWDD 1F2DA 1XJ0A 5TQ2B 4WBNF 2BTEA 2C3MA 3KEFA 3T7JA 1ZNWA 5LMZA 1YTUA 1YS2X 5AJTA 3H1AA 4CFYA 4EPRA 2FSFA 2WD8A 3ZK7A 1T4MA 1ANKA 1ENPA 1I2AA 1LVGA 2WFLB 2OG2A 2ZT8A 5T4EA 3FWZA 5M7EA 2QM7A 5A4IS 2AJDA 4OLJA 4DABA 1XG5A 4DS3A 4U8HA 5AK5A 3K0AA 2VSYA 1UQRA 5CBPA 4QU8A 4FDVA 4BJ6A 2PWPA 3C3AA 3TGWA 3HJUA 3PPWA 2IHZA 3K70C 1E3WA 3CC8A 3TD6A 3IHWA 1YVEI 1E32A 3AEZA 3IUPA 4K9SA 1TOAA 3EJ6A 2XQIA 4MAFA 3ADCA 1E2BA 4JC0A 3G2IA 4BFTA 1O9HA 2JCGA 4IIFA 2HRDA 2ZJYA 2PXAA 1QQBA 3IDQA 2FFBA 3GJZA 1D8AA 3QENA 1HE8B 2G7ZA 5ALDA 5ICMA 1P62B 1OX4B 2GDJA 3D7RA 3IVCA 2AI2A 1AQ6A 1K9VF 3K5WA 4Q7JB 5DU2A 3ZCSA 3LVRE 4DB2A 2JGDA 4DNOA 2HCBA 1NZFA 2QTRA 4FOTA 1I2CA 1RWVA 4PPGA 2W70A 3QBVA 4MJ7A 2ISSD 2QRGA 1L1FA 3UOGA 4JOCA 4II2A 4PQEA 1PK7A 5IABA 1FK8A 3PPXA 2ICAA 5G0TA 1XV5A 2JI7A 2QE7A 2CBZA 3CZ5A 4N0PA 1E0DA 1Y3FE 5JS7A 1MJGM 4G5RA 4MH0R 4LOHA 4RXTA 3TL3A 1CLEA 3WWYA 4DYDA 1S02A 1JEYB 2QP4A 1LJ8A 3PIRA 5CH8A 3H0CA 3LX6A 1SK9A 4I19A 2PH1A 3IIEA 1DMRA 3QYAA 2R8YA 4FQ5A 3STXA 1FNNA 3WICA 1GNPA 1SCUB 3I53A 3VZPA 2O2SA 1CZRA 3RGWS 4IVPA 4PZCA 1RC1A 2Z2ZA 4PRZA 2OBYA 1PF7E 1PFUA 1QHNA 1B74A 2A14A 3AJDA 4L5IA 5IM4F 1PNRA 4GWLA 4D46A 3FCCA 2VHCA 2C9ZA 2CMDA 3AEYA 4HB3A 3ACBA 2O6HA 3I4FA 2ZT7A 5E6SA 1O5OA 4EYGA 5JSQA 2YY7A 2WYOA 4ZAZA 3NUQA 1FLVA 3BTSA 2VZ0A 3SQXA 4Z7JA 5B30A 5BSKA 2PMFA 1SZJG 5CVVA 5SY9A 3V7WA 1ECLA 2PKCA 1Z82A 4H4DA 2PEYA 2PTGA 3NATA 4AJIA 2H92A 4OYRA 4LV6A 1TC2A 1PKXA 3D8TA 3IVAA 2GJ4A 1L8AA 4DZTA 1B16A 5DN6D 3X1XA 1V16A 4LOLA 2F9FA 5H81A 4MVJF 2QMQA 3AHHA 1NVGA 1U0GA 3HUEA 1ORTA 2V9PA 3MJDA 4GI3A 3VZRA 4GX0A 4D4GA 3Q8WA 3WLEA 4HUQA 4BZXA 3O4VA 3WRVA 2YVLA 1M0TA 2BONA 2I99A 5I45A 3EN0A 4MWCA 1ND5A 2HMVA 3F7OA 4GDFA 3W78A 2O2EA 1M2KA 3VU1A 3V8PA 1HDOA 1G1AA 1HLDA 3QLEA 4F1JA 1GQOA 4GXNA 2IZ0A 1IXKA 4GD3Q 4MUAA 3RRFA 4YCCA 4KHZA 5F64A 3IFSA 3GN1A 2H0RA 2J45A 4B3BA 5LZ5A 4WSOA 5IBQA 1F8FA 4HDSB 3N75A 1LPMA 2XVXA 4ZOLA 5AH0A 4E6EA 4J1TA 3SXUA 3C7TA 1VJTA 5BYJA 1VM6A 1QIKA 3OY2A 3C0KA 3ZH9B 3ZTWA 1AJEA 4F72A 3UV7A 4YI3A 1JHOA 3D6JA 5J59A 4D6YA 1DFHA 2ATCA 2QYTA 2Q2NA 3B6EA 1OUMA 1V48A 5KKCA 3VKHA 1N0WA 3WP1B 1GZDA 1D4ZA 2ZJ1A 2XCQA 4ND5A 5DTJA 2O7RA 4UNSA 1RLIA 3RTBA 1VDZA 2FSIA 3TPZA 1GTRA 3EOBI 4KWHA 3CUEF 3HBJA 4MAMA 4OQXA 5FNVF 1YQTA 5FI1B 4WRRA 3GJ4A 3PZRA 3AR6A 1WMDA 3LQRA 5LBIA 3ILVA 3W2EA 5KYNA 1TK2A 3EPBB 5K6RA 1GTVA 4IQ4A 4DADA 1EFPB 1FL9A 5FD8A 4ECEA 1JQDA 2YKGA 4P98A 4LWZA 1RP1A 3UANA 3FFBA 4OBBA 2C31A 4P3YA 1V1JA 1QB8A 3ZHUA 1WCV1 1E0KA 2QG9A 3PXUA 1NLZA 2PA0A 2G63A 5T4HA 4N6GA 2I80A 5LQNA 1GLGA 1P31A 3CUTA 3RREA 1JBKA 1K89A 2Z4SA 2H57A 3UCXA 4CR7A 4ZIRB 5DGCA 4R1PA 1VLHA 3I0NA 4F71A 4KHPB 4OK5A 2FN4A 1RMTA 2RSLA 3MWJA 3RS9A 4PRKA 1HTWA 4ZOEA 2R47A 1RYYA 2ZIEA 4ALMA 4HLCA 1WY5A 4XLZA 3DYBA 1X7ZA 3MD0A 4K86A 3LO5A 5ALWA 1B6RA 4Q5IA 3T7AA 4COOA 4D25A 1SB9A 2RBEA 3QJ5A 4WNIA 1IUKA 4JFAA 2E49A 2WSIA 1T35A 3LMKA 4CWAA 5DX0A 2DUJA 1P1FA 2AGVA 2J1LA 2UVQA 3GIWA 5DM2A 1R50A 3RUFA 2CSUA 2VOJA 4QATA 5FYQA 4IJ6A 3I8XA 1MX1A 4EI9A 4KAJA 1RI5A 2JGAA 4UQPA 1YXMA 4ZVSA 4XPIA 2I54A 4A2QA 5HRCA 3U3DA 2Y0PA 2R8RA 3H97A 5CLQA 4MVJI 3W0LB 3BKXA 1QFMA 1TM2A 4N5DA 1NF8A 4RENA 2AWOA 5TVOB 1MLDA 5COQA 3VDRA 2LPMA 3BD8A 2FHPA 1BAPA 3FG9A 5KYUB 5G4LA 2JLQA 3K4QA 1UP7A 4HAXA 3QOYA 4RXUA 5KREA 4JA0A 2R5WA 3OX2A 4F3TA 1C2TA