3QVSA

L-myo-inositol 1-phosphate synthase from archaeoglobus fulgidus wild type
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
392
structure length
392
Chain Sequence
MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic crowding drives the catalysis of myo-inositol phosphate synthase, as deduced from a crystal structure of a trapped catalytic intermediate
rcsb
molecule keywords Myo-inositol-1-phosphate synthase (Ino1)
source organism Archaeoglobus fulgidus
molecule tags Isomerase
total genus 159
structure length 392
sequence length 392
ec nomenclature ec 5.5.1.4: Inositol-3-phosphate synthase.
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qvsA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qvsA01
5ENDA 3JYOA 3OA2A 1BTOA 4OXNA 4Q3BA 4UEJA 4J2OA 2G82A 4AJEA 3FWZA 1B3BA 2X5KO 4YA6A 3JD1A 5KVCA 4IPTA 4AFNA 1LDYA 3G17A 2AE1A 1YJ8A 4HUJA 2C82A 5A3VA 4IQGA 2WEKA 3VTZA 2PZJA 5C3MA 4ITUA 1LA2A 2O7QA 1DIHA 3D1LA 3KEQA 4WKGA 4FBGA 1JAYA 1LDNA 4Y6PA 5L7YA 4N5MA 4PLGA 1NASA 4D46A 2ZB8A 5I8ZA 3VZSA 5EIOA 3VH1A 2IXBA 1YDEA 1PJLA 1GL3A 2JAHA 1C3VA 4PLCA 2AEMA 1KBZA 3NJ4A 4IS2A 4CMEA 3EZYA 3UHAA 5JY6A 4RF4A 3DFZA 3RC2A 4MVJI 3FF4A 3GEMA 5TT0A 3TL3A 4E30A 4J16A 4KUGA 2HKIA 3TZ6A 1ZXBA 4NBVA 2FSVA 3U0BA 4O6VA 3AWDA 1ZZEA 2DTXA 4YWJA 2EGHA 2D0IA 1PWZA 1LQTA 1N7GA 1Z6ZA 2W2LA 4LCJA 3TJRA 4BNMA 4NBTA 1MB4A 4DXHA 3EW7A 4DMLA 1IB6A 5JYDA 1RM0A 4QO7A 2C0CA 1R0KA 3FD8A 2HMVA 5BT9A 3SXPA 3K9QO 4RZIA 4NFHA 3MOIA 1H0KA 1M75A 5JDCA 5A9SA 4RL6A 4BGEA 3L9XA 3WIDA 2CNBA 3Q1LA 1PGNA 3MJTA 2UVDA 4JNKA 3NT4A 2ZK7A 1WVGA 4DLBA 2PA3A 5AYVA 3PJEA 2NTJA 1DAOA 4LSMA 2GDZA 4AVYA 2BELA 4P38A 1MXFA 3CINA 5TQVA 3KTDA 1ZCJA 1YS4A 1RJWA 2Q45A 4BMVA 1E3IA 1T1RA 2FSSA 1HE2A 3R1IA 2HDHA 4Z3KA 3BMCA 1T4DA 1V3VA 1M66A 1VL8A 5C37A 4YJFA 4PZDA 4X54A 3WJ7A 1U4SA 2AMFA 1JAXA 4JK3A 1FMCA 4A27A 2AEFA 2CFCA 4ALNA 4ROSA 5CG2A 1WXDA 4MPDA 4GMGA 4MP6A 3ITKA 4BKQA 3FTPA 4UVEA 4PLZA 4M89A 2C2YA 4NQZA 1VKNA 2EW8A 2P5UA 4GBJA 1HF3A 3I9OA 1R12A 2DT5A 5IG2A 5DDIP 3VHRA 2NTVA 3HFSA 3B1KA 4KTTE 4BQRA 4AJKA 3ASUA 1HDRA 1N92A 4IINA 3TL2A 3GZNB 1EK6A 1UXIA 2NACA 2IEBA 3FI9A 4IXTA 1TI7A 4EJMA 4YRBA 1JN0A 3VPFA 6ADHA 2AQIA 4NU5A 3HB5X 1M76A 5IDXA 1XWFA 1O0SA 4QUKA 1ENOA 1MX3A 4CLHA 3WS7A 4RDHA 1DIBA 1AXEA 4N54A 3H3FA 1F8FA 1YXMA 3O38A 2QHXA 3CEAA 1I5RA 5JYAA 3ZGYA 3HDYA 3DHNA 1IULA 1ZFNA 1CF2O 2GLXA 1U2DA 3BZUA 2OP1A 1Z7EA 4DL9A 1T2DA 4J7XA 4PLVA 4YJGA 5CDGA 1LSSA 2P5YA 4L8VA 4Q3DA 4IDFA 4J9VA 2CDBA 1GYQA 3ZWNA 4E5NA 3NX4A 5JDIA 1YVEI 4R01A 5IF3A 4W7HA 1Q0QA 3FRJA 1CWUA 3RJ9A 3VKVA 3VKUA 4DYDA 4UVHA 4G2NA 4EJ6A 4YTEA 3DZBA 4FOOA 4YT5A 1ZEMA 2HK9A 1C0PA 1E1LA 1EQUA 5L7WA 4OJNA 4R1NA 2I3GA 3L0DA 4JBHA 2Z1MA 3GN2A 3RASA 2HQ1A 5L40A 2QZ9A 2VYNA 4K1LA 3UICA 1ZK1A 1LSUA 4CMHA 1I01A 5ILOA 4B3IA 3ICCA 4D7AA 3O9ZA 1LC3A 4E2YA 5L9AA 1WDLA 1H2BA 1E1NA 1I2BA 2P4QA 1V3UA 1MFZA 2B4QA 1U5CA 4CR6A 1EMDA 2DAPA 3K30A 1W73A 3Q0EA 1QYDA 3JQ8A 2JCYA 1VJ0A 4IDGA 1DFIA 3VPXA 3ZWMA 4B4UA 1FXSA 3NDIA 4XYGA 3WTBA 3JQFA 4NJOA 5AOVA 2I65A 5I9MA 1E77A 2JCXA 1Q7BA 3ULKA 3AJRA 3DL2A 3AOEA 1PU2A 3T4EA 1WZIA 2HLPA 4CUJA 1OI7A 4CODB 4XQCA 1LUAA 4O59O 4B79A 2CVOA 1X14A 5KKCA 1TXGA 2RH8A 1YL5A 1PS8A 3C8MA 4P4LA 4ZQGA 3DDNA 4BNZA 1GD1O 2F1KA 4RV9A 4CMIA 3PYMA 4YDRA 2NU7A 1YB4A 2ZQZA 3JQAD 2X1HA 3ZWOA 3QHAA 3RFXA 4I5FA 3QY9A 5C5IA 3EC7A 1KOLA 4RF2A 5DBFA 3ZN2A 5IDQA 1H2HA 4DMMA 4Y6RA 2OUIA 3JQGB 3WGIA 3NDRA 4FFLA 5JPIA 5A05A 1LLQA 1UXGA 2VWQA 2C5AA 1VRWA 5K6AA 3PHLA 2JD0A 4F6CA 5FEUA 2BD0A 3V1TC 4QX6A 1DLIA 4EITA 4MVJH 3ZWWA 1KY5A 2C7GA 4GX0A 3NTOA 3I4FA 4J1TA 3PJFA 4YQZA 4C4OA 2PTGA 1ENPA 1A4IA 1T2AA 3N58A 1MG5A 1V0JA 2FPGA 1EE2A 4L4RA 3LC1O 1SEVA 2ZYGA 4J43A 1NR1A 3WFJA 3GGOA 4NI5A 1EVJA 1ADCA 2A35A 2PH5A 3WSWA 2D5AA 4CL8A 1PZEA 4F46A 1O6ZA 3WNQA 1Y8RA 3ZHZA 2VRBA 4BQPA 2BI8A 3GGGA 3RBVA 1NTOA 2P4HX 3WQQA 3ROPA 1LU9A 1GY8A 3HUDA 1E6UA 3ITDA 4HX5A 1DLJA 4OM8A 3GHHA 2ILTA 4NG5A 1LRKA 4O1MA 2EJVA 3Q11A 2NVUA 1HXHA 5A02A 3JQ9A 2FPIA 4D45A 1D3AA 1B3RA 4RVSA 2RIRA 4AJOA 1F17A 1O9BA 1ADBA 3E9NA 3ZNNA 5IZ4A 3GDFA 3S55A 4R51A 2NLOA 3K2EA 4IDCA 2J5KA 4DBVO 3I9JA 3GUYA 3KZVA 3LSYA 3F1KA 1HE4A 4R4JA 2SCUA 3JYQA 2VOJA 4BO8A 4HP8A 1D4FA 3PK0A 1KYQA 3UOGA 1EEHA 2YFHA 1C0IA 1U3VA 3IKVA 1DAPA 3L6EA 4QO8A 3W4KA 3BHIA 2FRDA 2BFOA 5G0TA 1G0NA 4BO4A 3KSDO 3R0IA 3PDUA 2AXQA 4GGOA 5G4LA 3GG2A 4KUEA 4ZD6A 1J5PA 2Y0DA 2R2GA 1ISIA 1I2CA 4W99A 2HK8A 2Q1UA 3WFIA 3IS3A 4B8WA 3DC2A 1I33A 4ZQEA 5TJHA 5THQA 2ZB4A 3QVSA 4BKRA 3KYDB 3RUAA 3MOGA 1Y5RA 3C1AA 3KO8A 3WWYA 1KEWA 1JVSA 1Q7GA 3H9GA 4P22A 1F0YA 3Q9UA 1Y8QA 3W1VA 3KOUA 4CM4A 5T8KA 1QYCA 3HN2A 3K31A 4NPCA 4CUKA 1UDCA 4J49A 4NJMB 3RKRA 3QRWA 2PH3A 3FHLA 5IZCA 3GLQA 4KWHA 4DPLA 3LQFA 3NTRA 3OIGA 3DBRB 1NP3A 1BW9A 1B15A 4RPKA 4D3DA 3LLSA 5TSDA 4RLSA 1KVTA 1HTBA 4Y67A 3KYBA 4WK6A 1NFFA 1HT0A 4WLNA 1K3TA 3CZRA 4Q3EA 4CQMD 5IDWA 3U5TA 3PQFA 5BNFA 1QORA 1FF9A 4BNIA 2JAPA 3KV3O 2DC1A 1E3SA 1AHIA 5K9ZA 5EPOA 2HJSA 2PZMA 1T2CA 2GN6A 5I7EA 3KYCB 5GY7A 1E1MA 2WTBA 1R4MB 1OZAA 1EVZA 2IE0A 2VWGA 1VSUA 3MJ4A 2BFAA 4ZVVA 2X86A 1NWHA 1B8PA 2TMGA 1SC6A 2UV8A 4DC1A 4BV9A 4NBWA 3LT0A 1BXGA 4YJHA 1HSOA 2E4AA 3TZKA 3WWZA 2O4CA 1A9ZA 2VN8A 3SC6A 5G0SA 1V9LA 4I9UA 2OFPA 4DWVA 5F1KA 2D5CA 4RPGA 7ADHA 4L4SA 5ITWA 3D4NA 4CQLB 5KWEA 1EUDA 1PGJA 2D59A 2CSUA 1IZ0A 1C1DA 2JHGA 3PHHA 5DP1A 1GUZA 1ZMTA 2Q99A 3VZQA 3JD4A 1T2FA 2HMWA 4CR7A 2HMUA 2VHXA 1P77A 3UGKA 3PZBA 4I5DA 3DTYA 4H3VA 2NTNA 1PWXA 3PYLA 2QRKA 3RFTA 4AL4A 4WOJA 4PGFA 4ZN6A 1LDMA 2HO5A 1BVUA 1EE9A 3UCXA 4MKZA 2Q50A 1UDBA 4BNJA 4EI2A 3PHIA 5BSFA 1JQBA 4QECA 1IYZA 5TGDA 1C0LA 2I76A 1PTJA 4EGFA 1LEHA 5CFZA 3U49A 2YW9A 1LX6A 4OIMA 4A2CA 4DPMA 4GKBA 2NVWA 4QEDA 2EW2A 4CJXA 3PTZA 5A9RA 5TJ9A 4J0EA 4MOWA 1LC0A 4FW8A 2GN9A 3H2SA 3RAJA 3DFUA 2X9NA 2VYVA 4MVJP 3KB6A 2EF1A 5JFOA 4XR9A 4DVJA 1ML3A 2ZKLA 3C3XA 2EV9A 3ZNOA 4PG7A 1W4ZA 4F6LA 3VTFA 4DC0A 1CIVA 3COSA 4B4VA 3I5MA 3I83A 4YEDA 4UUOA 3QQPA 2VNAA 5DOVA 1EVIA 1LDEA 4K26A 3VAZA 1YWGO 1IL0A 1JU9A 4LISA 4CLRB 4A0SA 1VM6A 2ZQYA 3UCFA 1NQAO 3ETDA 1V3TA 1AUPA 3VH2A 2PKQP 1YGYA 1HSZA 2HK7A 2FP4A 4TVBA 1K2WA 4B7CA 1N7HA 5K0ZA 1XQ6A 4IIUA 2WD7B 4ND3A 3ZWYA 1PZGA 2W8ZA 2GYYA 3P2OA 4DLAA 5JC8A 1H6AA 1HYEA 4B7XA 4RF3A 3NAQA 4GVLA 4BUCA 2GNAA 4FB5A 1DIRA 1OBFO 3GN1A 4EYEA 3RQSA 1R37A 1Z82A 4YAKA 4WLEA 1BDBA 4W82A 1EFLA 4WGGA 1E3WB 3AI3A 1L7DA 1WWKA 3ORFA 1T26A 4LW8A 4R3WA 4TQGA 3ABIA 1YOVA 3JYNA 4R54A 2QW8A 4FD3A 4GVXA 1ZMOA 3GDGA 1DC6A 4A5OA 4AG3A 3HWRA 3NJ8A 1JVBA 4L4XA 4NU6A 2Y1DA 1VI2A 3MJVA 5F5NA 4EZBA 4D79A 2D1YA 1RM4A 1O94A 2X7HA 4HWKA 4BGUA 8ADHA 4B3HA 2Q2WA 3NDJA 2JJYA 1Y81A 4Q9NA 3ZV6A 4BO5A 1FDWA 4P4NA 4BB6A 4BO7A 3QWHA 2VZ9A 3R3SA 3AY7A 3PGJA 1Z7BA 4UVDA 4IMRA 2O2SA 5G2OA 3OHSX 3L4BC 4LK3A 3EVNA 4BMNA 3FNHA 3Q3CA 1VE9A 3HNPA 1DOHA 3EZLA 5A9TA 4O5OA 4FR5A 4CM9A 3OETA 1K6JA 3DZJA 3QWAA 1UJMA 4UEOA 4M87A 4MDHA 3DOCA 5K6AC 3ENNA 4MVJA 2G17A 4H15A 1PS9A 5ES3A 3WB9A 4BHTA 7MDHA 3S1LA 1X1TA 4KMSA 1PGPA 4I8XA 4YRAA 3AU8A 3VVCA 2WE8A 1SMKA 3AUTA 4MINA 3PP8A 4IJWA 3F4LA 1LQUA 1GYPA 4PIVA 2WM3A 4K9DA 1MG0A 5JW6A 4I1IA 4WOKA 2BGMA 3ROMA 2CY0A 4BO2A 1OOEA 4DTIA 2JD1A 2O7SA 4U5QA 5KOIA 3RBXA 4MVJF 3QVWA 4DQUA 1NQ5A 4OXYA 1GYRA 4DYVA 3A1NA 3JYLA 4OSOA 3H2ZA 2VTDA 1DFGA 3PQEA 3JQBA 2W2KA 4R16A 3IUSA 3DMYA 3WIEA 4C7JA 5EMHA 2Q2VA 1DO8A 4ALJA 2PD4A 2D4AA 1V8BA 1YL6A 1ISHA 4YB8A 4YRDA 1N1EA 4HV4A 1YL7A 4CM1A 3Q2IA 4DLLA 4E5KA 3RC1A 4IGEA 4O63O 3RC9A 1VLLA 1DC4A 5AVOA 1IOLA 1YB1A 4Z9FA 4E5PA 1L1FA 2DLDA 1P44A 1BXZA 3WQSB 4DPKA 3DB2A 1U3TA 3PLNA 4OOEA 2BI7A 1FDUA 3F1LA 1A72A 1D8AA 5JXWA 5CAEA 1HZZA 2XXBA 2FZEA 2OBYA 4OL9A 4CM8B 1AXGA 3CPSA 2FR1A 4WLOA 2QG4A 3D0OA 3WYCA 1Y6JA 1GZ4A 1DXYA 4XQGA 1ZK0A 2EJWA 2EERA 2B4TO 1UAGA 1WP4A 5JCXA 3SC4A 3BMOA 4L9RA 1C14A 3L9WA 4CMKA 1NX6A 1E0DA 4KOAA 2GSDA 4W6ZA 3MJSA 4HFNA 4BNYA 3KLPX 2XAAA 2Q1TA 3ROKA 1XU7A 5DBIA 4A7PA 5G4KB 1ENZA 1TT7A 3PYXA 3DQPA 4EUFA 3PQDA 1E7RA 4XB1A 1XG5A 4ALIA 1UZMA 5I7VA 2O3TA 1A5ZA 4A26A 1DBVO 3DHEA 2E82A 2JFFA 2XOXA 4CLXA 4W7IA 4A03A 1PSDA 1A71A 4H16A 1EZ4A 5IZCC 4BO3A 1ZKMA 3KXDA 4KP7A 4CMGA 3AM5A 3GVIA 3I9MA 3O8QA 1JKJA 2GN4A 2ZB3A 3F47A 2DBQA 4XYMA 4D43A 1BGVA 1U9JA 3OM9A 1GV0A 3ZZNA 1Y9EA 3E5MA 5FWNA 5EINA 1LSOA 1VPDA 3EDMA 1XHLA 4D0RA 3NKLA 4E12A 5DCYA 3RSHA 3WXBA 4N5NA 1C1XA 3INGA 5GZ1A 3FWNA 3S2FA 4ZU3A 1ISMA 5DZSA 2DTEA 4CLOB 5KJCA 5CP8A 1H94A 2EHDA 3OQBA 4EBFA 4NBUA 1SBYA 4XCVA 3IKTA 3BXXA 1HL3A 2PGLA 1P1JA 1GZ6A 5A06A 1I24A 3TRIA 2P2SA 3JCZA 4OGWA 4CV0A 5I8WA 2LDXA 2Q1WA 4Z0HO 2GGSA 5T5QA 4YT8A 2PGJA 4J9UE 4ONEA 3TZHA 3I9LA 3DBLA 5DT9A 4BS9A 5ENVA 3L6OO 1Q1NA 2EGGA 2FN7A 1MV8A 1PR9A 4I9HA 4JN6B 3ZDFA 5AXAA 4TZTA 3MTJA 1Y7TA 2Z5LA 1XQ1A 4FJ1A 3FPLA 1PJTA 1P0CA 2VNSA 4KDFA 1P1IA 4WEQA 4D3SA 4CM3A 2FPPA 3WGYA 2WWRA 2I67A 3IP1A 4BO6A 1PJSA 3JD2A 4BNTA 3WG9A 1KS9A 3IP3A 3ICPA 3ZW9A 5CPBA 2JHFA 3UW3A 2DFVA 3LZ6A 2O50A 5JYEA 1NR7A 4XD2A 4AJNA 1ARZA 3PZRA 2X9GA 4UVGA 1XLTA 2YHIA 4EUEA 4XDZA 1PJ3A 2JCVA 3TN7A 3ADOA 3DTTA 4OO3A 1NVTA 3GC6A 2DBVO 4PCVA 3CZMA 5EERA 3U3XA 2YV2A 3D3WA 3LT4A 2B5VA 1Q2XA 5F1PA 4AJJA 1VJ1A 2WD8A 1Z74A 2J8ZA 3VPGA 4ESOA 4LMRA 2E6UX 3KLMX 2DM6A 4E3ZA 3FNGA 4RF5A 4EEZA 2VRCD 2O2YA 4J3FA 5EJ2A 4YAGA 4ALKA 3RWBA 1SPXA 3I52A 5FI3A 3UXYA 4BO9A 2EKLA 1UP7A 1LNQA 5TIIA 5COQA 4AJIA 2CMDA 2J5QA 2IXAA 3I23A 1ZSYA 5FFFA 3VDRA 4CMJA 3I9KA 2J3IA 3MTGA 4K6CA 3WX0A 2C7VA 2GN8A 3OH8A 3MWDB 1FDTA 2Q4EA 1PJ4A 4GSLA 4N7RA 1RM5A 1P1FA 1ISFA 1ZVMA 2FHSA 2DU8A 2NVBA 3BHMA 2Z95A 1JA9A 4NK4A 4XGKA 5HA5A 1NFRA 4KDEA 3V1UA 4J91A 4DGSA 2WSBA 5DNAA 2YUTA 4Z0TA 5A9SB 4RLHA 1E3LA 1LI4A 3JQ7A 1R15A 1U3WA 1SB8A 3OMLA 4L73A 5L4NA 5LC1A 5BSHA 2DQ4A 4B8ZA 4J4TA 4E21A 2CZCA 1XR3A 1Z73A 1ZIDA 4OXKA 3S2EA 3STHA 1MLDA 1NHWA 3GF4A 4OOFA 1U4OA 3JD0A 1P9LA 3WGOA 1UUFA 2ZJ0A 4IJKA 3WTCA 5IN4A 1EBFA 2VTEA 3LLVA 4IMPA 4BKPA 5B4VA 3ZU2A 1R4NA 1GPJA 4R5HA 1MC4A 3WLFA 3A28A 1ZEJA 1PQPA 4BGVA 1I8TA 1LXCA 3BMCB 1QV7A 3D4OA 2PFGA 4YJFB 3EYWA 3GEDA 4WCFA 4G5HA 3LK7A 2JFGA 1U28A 3UFXA 4GWKA 3GRPA 5G0VA 5KCZA 4KZPA 1UH5A 4MKRA 4GWGA 2OO5A 4GL4A 4RPLA 4NFYA 2GZ3A 1BVRA 3NYWA 1DPGA 2JKVA 5JE8A 4E5MA 5KVSA 2Y0EA 2VOEA 3LT1A 5HS6A 2ZB7A 2CDAA 1XYGA 2P91A 3CTMA 2A94A 3DMTA 5BSEA 1I3MA 1E92A 1I3KA 2GPTA 3AFNA 4D42A 1R66A 3RBZA 2CF5A 2X4GA 1DFHA 4YBZA 5KJEA 9LDBA 1DHTA 5IXYA 1VKOA 2G76A 1WMAA 1CYDA 2DBRA 4OMUA 2EP7A 4MP3A 3FNEA 4U6QA 4RPJA 1W0CA 1QXSA 3U62A 3AW9A 5COBA 3NT2A 4GAEA 5T67A 1B8UA 4PG6A 3I3OA 4CLEA 5G0WA 1P1KA 2J6IA 3AUSA 3WNVA 1P33A 2VZ0A 2XPCA 1Q7CA 2X0RA 5I9LA 3ZNPA 4UREA 5TLSA 3TF5A 4O0LA 4PG8A 1WDMA 4WASA 4D3FA 4ND1A 5A1TA 2P9CA 4YPOA 1J6UA 1T25A 3GR6A 3W8FA 4YJGB 3ZWXA 3KM0A 4D41A 3N7UA 4U7WA 1RYEA 2QQ5A 5JCJD 4W9NC 3NV9A 1I32A 2G1UA 4CUZA 1JDJA 5AQ1A 4TZKA 1RM3A 4L76A 5ER9A 5FF9A 3OF2A 2I66A 3EGOA 2VHVA 2R00C 3DBVO 3WBFA 2NNLD 3K92A 3JSAA 5IXSA 3QWBA 4JIGA 1HDXA 4XGIA 3FPCA 1BMDA 4FOSA 4ND4A 3N74A 4WJZA 3U9LA 3HZZA 1CERA 1FDSA 3HE3A 3ZU3A 4PG4A 1GPDG 3VH3A 1T2EA 4ZRNA 2J5RA 1ZH8A 5JAQA 2E48A 3ZWBA 4BVAA 1JLLA 1BG6A 4OQYA 3A06A 3LT2A 3H9JA 3ZWVA 3H8VA 1OFGA 1JKIA 4OH1A 1BDMA 3PWKA 4TVOA 5B12A 2UUPA 2I5PO 1X0XA 2GO1A 3GA0A 3OQ1A 3JQ8B 2YYYA 4GX1A 1HRDA 3HFGA 4E4YA 3JQAA 5KJ6A 1QYWA 1XSEA 5DN9A 1JW9B 1Y9AA 2PK3A 3E03A 2J3JA 3K6JA 5T73A 4I5GA 2B37A 1O89A 4CV3A 3V1YA 3QE3A 1AHHA 3MJCA 3HDJA 4E6PA 4R41A 3INRA 2G5CA 4FCCA 4CMEC 1GUFA 3ZV4A 1IHYA 2Q2QA 1NAIA 5L53A 4XDYA 3IC5A 1SOWA 4WNCA 2O3UA 2VUTA 3ROQA 4R68A 5ICMA 2QYTA 1NPDA 3KVOA 3K96A 4BNLA 1B7GO 2IYPA 1TVEA 1ENYA 4Z0PA 4CMIB 3TZCA 4ZJUA 1MC5A 3OP4A 3C24A 1ZJYA 3OEYA 3FCOA 1WW8A 4DQVA 2IEDA 3R3JA 1H6DA 1YKFA 2WDZA 1EUZA 3S2IA 1HEUA 2B35A 4NDNE 4PLPA 4ZRMA 3M2TA 3WR5A 3OJOA 4IUYA 4RVHA 3ST7A 4CMCA 5H81A 5JY1A 3EVTA 3TFQA 1XGKA 3AM3A 1HDZA 5JDCC 3EMKA 3NGXA 3TZQA 2V65A 3FR7A 5IDYA 2PD6A 4GH5A 1ULSA 3C7DB 3NUGA 1ORRA 2RH4A 4D44A 4J2HA 2WYWA 1QV6A 1Z75A 2VWHA 5JNLA 1A27A 3T7EA 3DBHA 2BRUA 3QW2A 4XEHA 2UUOA 1R0SA 3UH1A 1ZJZA 1I30A 4OYRA 2GF2A 2VZ8A 2HAEA 3ON5A 3ETGA 4LRSB 1A9YA 1GDHA 1M6HA 5JLAA 3DAGA 3OICA 1DIAA 2YV3A 4BNUA 1X7GA 3GPIA 4BNFA 1QR6A 1WDKA 4TRMA 2NADA 2ZIZA 4KQWA 4TRNA 4AJ1A 5CDUA 3C7CB 3W4JA 2PNFA 1V35A 4G65A 1K89A 5CEJA 1Y8RB 5LCXA 2ZTLA 4L0QA 3ANMA 5TNXA 4NHEA 2UYYA 4B4WA 1B0AA 5T6BA 1U7HA 1GFSA 1E5LA 2GR9A 3D4PA 2FMUA 2V6BA 4JROA 3GPDG 3E82A 2A9FA 5HTOA 5ER6A 3W6UA 2NVUB 3BTOA 5CDSA 2V6GA 3UKOA 2H5LA 3A9WA 2PZLA 5U9CA 1U3UA 2O23A 2EIHA 3TSCA 1PGOA 3DAFA 4PRLA 2Y1CA 1I2ZA 2YDXA 3IOYA 3TPCA 2P9EA 4L74A 3BMQA 3FTNA 3IL2A 1LSJA 3C85A 1HE3A 1WMBA 2Y05A 4RJTA 1P1RA 4ILKA 3K8ZA 4MP8A 3ADPA 3PLRA 3EAGA 4Y6SA 4NBRA 3RU7A 3H7AA 4XRRA 1IY8A 3BTVA 2C20A 4UUNA 4RVFA 1HETA 2Y67A 1VJTA 4ZICA 4WCDA 4GLOA 1CJCA 4BGIA 2ZCUA 5CHEA 3B1JA 2UAGA 2P9GA 4BO1A 3GAFA 1PJCA 3RUDA 3E9QA 3M1AA 2EKQA 2X9VA 4B3JA 1QG6A 4CQMA 1UXJA 3JD3A 2CF6A 4OHUA 2HCTA 5JDIC 2OXIA 4GKVA 1GU7A 1AN9A 1ZK3A 1Y8QB 3V2GA 4CM4B 1CRWG 4Q39A 3IQDB 5U1PA 1HDCA 1YQDA 4YVFA 5EL0A 1NQOA 1IHXA 1I3NA 2AEJA 1PJ2A 4PVCA 3GG9A 5EN4A 3PJDA 3V8BA 5M6DA 4MIEA 2O4UX 3H5NA 4R9SA 1BW9B 3ONFA 5C7IO 4IXWA 2AA3A 2YFQA 3ZHXA 4P4GA 1Y1PA 1DB3A 2RAFA 2ZJ1A 1B26A 3RU9A 5KJ1A 1IUKA 1FDVA 3PGXA 4U8GA 3KBOA 1P45A 1H9BA 1N9GA 4WEOA 4M86A 2A4KA 1K6IA 1A7KA 2NU6A 4E0BA 3BMNA 2DFDA 4FIZA 2DPGA 4CM6A 1N8KA 1EK5A 1BSVA 4R1UA 3FNFA 3AY6A 5A4DA 2J3KA 2E37A 3BTUA 3LF2A 4AJ2A 2X22A 4MVJD 4OSPA 5COAA 2VHWA 3JQFC 4CR8A 3CKYA 3K5PA 2EG9A 2I9PA 1BXGB 4YJHB 2NU9A 5TS3A 5ADHA 4R9RA 5B4TA 1E3JA 2PKQO 1TLTA 3GNQA 1TT5A 3AOEC 2Y66A 1F8GA 4YCAA 5HRUA 1ZSVA 3AOGA 2B69A 3WLEA 2V7PA 4IQ0A 3RUHA 1SOVA 4LN1A 3MJEA 4IQ8A 4KQXA 4J90A 3X2FA 3QVTA 1CEQA 1XELA 2Y68A 2NQTA 5KVVA 2EXXA 4JJGA 3G1TA 1C1DB 4M54A 4WNIA 1U8XX 2NU8A 1HYGA 1GTMA 1SCUA 3F5SA 1GCOA 3C1OA 3OJEA 1M2WA 3OQ6A 3HSKA 4MIOA 2VT2A 1YB5A 1NNUA 2A92A 3AY3A 2DUUA 3CMMA 4XWYA 4N18A 1MP0A 3PI7A 3VPSA 3B70A 2BGLA 4JBIA 1KERA 3OJFA 4Z6KA 1S6YA 2OP0A 4Q3AA 1V6AA 4TWRA 1GZ3A 3MZ0A 1BXKA 2X6TA 4OQZA 4BKUA 3ANLA 3P5SA 4H7PA 2AG8A 5THKA 3VPHA 4MJLA 1TA4A 2ZATA 1WPQA 2O3RA 2XXJA 4UEKA 5DOZA 4E31A 1UP4A 2C54A 3AM4A 3IDSA 3O4RA 4PLTA 2OZPA 3V2HA 2X23A 2X5JO 4K28A 3LF1A 3GVCA 5KTKA 1E7MA 4TKMA 5G0UA 4CPDA 1LRLA 3BA1A 1AGNA 2FOIA 3U4HA 2Q22A 3I4CA 4FGWA 4ZQHA 1NFQA 2AHRA 3OBBA 5CEEA 3PXXA 4KTVE 5DCUA 3PIIA 3QVOA 1B14A 1GADO 1B2LA 2GUGA 3ZWPA 3JQ9C 5JMWA 4FFPA 1NM5A 5TRTA 1H93A 1X13A 3OIFA 1C0KA 1LJ8A 3BYZA 3HDQA 4HFJA 5CPFA 5L95A 2OMEA 1KVRA 3ZU4A 3V2UA 1LLUA 2IZ1A 3K73O 4QQRA 1LDGA 1UP6A 4XGNA 3G0OA 4BNNA 1KETA 1E7YA 3M6IA 4JGBA 6LDHA 1KY4A 2BF7A 1YONA 4CM5A 1LLDA 3PEFA 3E18A 5JAZA 1CETA 2PZKA 3JQ6A 1XU9A 3E5RA 1R0LA 2H63A 5GZ6A 1ZSNA 4Z9YA 4XRGA 2W2LD 4J1NA 2WYUA 1YRLA 4IJUA 1IZ9A 4IDAA 2ZYAA 5DBGA 3ZU5A 4IY1A 1A4UA 3F9IA 4DREA 3VDQA 2PY6A 3X2EA 1B8VA 2QZZA 4JJFA 1NWCA 2EWMA 3ZWAA 3VZRA 1YOVB 3TFOA 3PJGA 3CIFA 4NIMA 5TT1A 3GVHA 1Q0LA 2EEZA 3RUCA 1GUYA 3HHPA 1LTHR 2BMAA 3WGQA 3OA0A 4JCOA 5L45A 4BB5A 3GZ4A 5B4UA 3MCVA 3WDSA 1GAEO 5CEFA 2O3JA 2YHUA 1E6EA 1I0ZA 1YBVA 4UAGA 3KHUA 4IJVA 1PJBA 1ULUA 2ET6A 2PKRA 4EUHA 5CDYA 2YJZA 1QKIA 5T8KC 2DUWA 3M1LA 3OECA 1X7HA 1OC4A 4XKJA 5F5LA 1YDWA 3GZNA 4XYLA 1Q0HA 3RC7A 4HADA 1UR5A 2JD2A 3JQEA 2X0NA 8LDHA 1SO8A 1QYVA 1DRUA 4YT2A 1ZK4A 1P1HA 4XQ9A 1HLPA 1KVSA 1UXKA 4LSWA 1KC3A 1J4AA 3IAHA 3WJAA 3UF0A 4I9NA 4J1QA 1ISJA 4XZ3A 4RVGA 3ETEA 2PLAA 3RI3A 3AI1A 2QYSA 4BV8A 1NVGA 1UXHA 1NYTA 4GPD1 4IGFA 3GH3A 3DR3A 1AE1A 4FC7A 3A14A 4E2XA 3AUAA 2X5OA 2J3HA 3PWZA 4WECA 1NPYA 1W6UA 4L75A 3GUCA 3TWOA 4YXFA 5HS4A 1HE5A 1KEPA 3QP9A 2W2KB 3A4VA 1MFPA 4XIYA 1TB4A 4HKTA 3H5RA 1VC2A 1G1AA 2DVMA 4GLLA 4DBZA 1WLYA 5H82A 3HDHA 4Y8VA 4R3NA 4UULA 4AICA 1U7TA 1E7QA 5J9GA 4ZQFA 3VOSA 1P3DA 4II2A 3W4IA 1J0XO 5JBIA 1I36A 5BNIA 5KJFA 1HDYA 2R6JA 5TX7A 4YQYA 1A7AA 5JO0A 5HWSA 3GNTA 3ONDA 2Y1FA 4MO2A 2C07A 3H9QA 1LBEA 4U0KA 3WICA 2ZTUA 3C1TA 2NSDA 3RFVA 2I6TA 1UZLA 3CE6A 1WNTA 1ZBQA 1YBMA 2BGKA 2EKPA 5L3ZA 1ZUD1 3PHGA 3CSDA 5F1OA 1NQTA 2ZYDA 4F45A 3PVZA 4CV1A 3FR8A 1KEVA 4RORA 3OJ0A 1DJQA 3GK3A 2Y93A 2O48X 4EW6A 2DKNA 1RWBA 2IODA 3QA9A 3NGLA 3AU9A 1QMGA 3R6DA 3BMOB 2CDCA 2VYND 2NUAA 4YYZA 1DSSG 3H9EO 4C7KA 4HXYA 2DTDA 3GGPA 2B83A 2IRWA 5KKAA 3W8EA 4CLDA 1X7DA 4TROA 3JQCA 4NFSA 4PLFA 4J1SA 3PPIA 1SB9A 3SLGA 1ZXLA 1PX0A 1DHRA 3W8DA 3KRTA 1T1SA 5KVQA 5MGBA 1P0FA 2ZTVA 2D8AA 2HMTA 3M2PA 2B5WA 5C7OO 3LYLA 3DONA 1ZW1A 4FN4A 4XB2A 4XX0A 1EQ2A 3T7CA 2CVZA 3INTA 3O8QB 4MVJE 1HWYA 3GHYA 4FJ0A 5I7SA 1VL0A 4FFNA 1ZO8A 3ZV5A 1PL6A 3JQGA 1DRWA 5ICSA 2VHZA 3EUWA 4MIYA 3ZCXA 4PRKA 1NPTO 3EY4A 4FGSA 1YQGA 1RKXA 3AFMA 3DOOA 3GY0A 2WYVA 1PR3A 3K2BA 4YT4A 1MXHA 1M6WA 4QFDA 1P31A 2OL4A 2W98A 5C7LO 4IZIA 3VZPA 4R1SA 1C1XB 4GGPA 3QJ5A 1E3EA 2OGUA 3NT5A 2OORA 4RQUA 4B7UA 3I9NA 3GNSA 3ZHBA 1DC5A 3FN4A 4E13A 2Y99A 2B0JA 3O03A 4RQTA 3VC7A 3E9MA 3LVFO 4NNJA 1VSVA 4P8RA 3QLJA 4TRRA 1CQJA 4WPGA 3OIDA 4URFA 4FFRA 3RUEA 2FR8A 3ZNQA 1PEDA 1PQWA 5I7FA 3DBLB 3IJPA 1LRJA 3RUFA 3WGGA 1ZNQO 3GQVA 1MUUA 4RO0A 4BMSA 1K5HA 3L77A 3QWFA 2HRBA 2AG5A 3V5NA 4TSKA 5AXBA 3LC2O 3ASVA 4S3MA 4UVIA 4CM7A 1H6CA 2VRCA 4Z3DA 4XQEA 4ND2A 2V6MA 1HYHA 4EDFA 2H1SA 4WUVA 1DDOA 1GQ2A 3FBTA 4S1VA 3HN7A 2DPHA 3HB4X 4TKLA 5JAMA 5JAIA 4IZHA 1ZK2A 2TMDA 2VUUA 1S7CA 5H83A 1BWSA 2BLLA 4ZHSA 2RHRA 2YHIB 1UZNA 4J4HA 2C2XA 3ZH2A 4N5LA 3EHEA 2UDPA 1TEHA 3MEQA 1NXQA 2POQX 3P7MA 4DA9A 3D3WB 2D2IA 5A03A 3GVXA 4QFCA 4AJ4A 4AJHA 3CXRA 3ANNA 1BHSA 3P19A 4BNWA 5IJZA 2VQ3A 1OC2A 1PZFA 1QLHA 3GFBA 4GX5A 2H9IA 2E49A 5I9NA 2C5EA 4PLYA 4HFMA 4BNGA 4DRYA 1EDZA 4ND5A 3G79A 3H6KA 4LVUA 4ZGWA 2Q4BA 2YY7A 3RD5A 3KYDA 2GZ1A 2GCGA 3TNLA 2HSDA 2HUNA 2BKAA 1SZJG 4R1TA 2YV1A 3T4XA 5EQDA 4DQXA 3WGZA 3RUIA 3DZIA 3L4BA 1EVYA 3RIHA 1I10A 1XDWA 3JQBC 3F6YA 4U0JA 4RVDA 3DXFA 4NJMA 4DIFA 5FI5A 4BOYA 1ONPA 2B4RO 4QXMA 4JP2A 3TDKA 3DBRA 2W90A 4NH4A 4DIOA 4RVUA 1DRVA 3DWFA 4INAA 4FJ2A 4BNHA 2HJRA 3JQ7B 2AQ8A 3WYEA 1UDAA 2VCYA 4J7UA 2DBZA 1E7SA 1OMOA 2WJPA 3CH6A 3ZWCA 5ITVA 3GMSA 1GR0A 3PHJA 1O8CA 3Q6IA 3DZGA 1IPEA 4FSHA 1R6DA 5EQFA 3IIEA 3MWEB 3KYCA 2GZ2A 1R4MA 2PV7A 5AXCA 3GOHA 5JO9A 1HKUA 3TOXA 1R4NB 4EJ0A 4UUPA 4YAEA 1ISGA 4ID9A 3IMFA 1H5QA 4PZEA 3I1JA 4LGVA 1K0UA 1F12A 5GMOA 1N2SA 4A73A 5BQFA 3ZHYA 5DP2A 4WCFB 1Z45A 2QRLA 4AJLA 1ADGA 4LRTB 2VUSA 2RBEA 3H9UA 4PFJA 3GRKA 2Y1EA 4XJSA 4FPXA 3FSRA 3B6ZA 3GAZA 1E7WA 3UUWA 3DOJA 5BNTA 4B4OA 4D0SA 2BFMA 3SLKA 4PN3A 4CQLA 1H9AA 1ONOA 4JQCA 1GV1A 1RPNA 4LMPA 5LDGA 3WMWA 2HU2A 3ZV3A 4F3YA 1OAAA 3AK4A 3BTSA 4MKXA 5IN5A 3S2GA 2AE2A 4HBGA 1JTVA 4YAIA 3WSVA 3SVTA 1X1EA 1DJNA 2Q3EA 1O5IA 2GASA 5JCJA 1QSGA 3W6ZA 2QX7A 3F46A 1G6KA 4MVJG 3DO5A 4OKNA 3B20A 3H3JA 2VWPA 2CVQA 1U1IA 3L07A 4E5YA 1XKQA 5T64A 1PL7A 1KIFA 3U4IA 4CL3A 3FBGA 4HFRA 4PG5A 5IAAA 3D5QA 1QP8A 4IDDA 3DZFA 5JSFA 4GMFA 2YQ5A 3DHYA 3HG7A 3VVBA 2EP5A 3QV1A 1WZEA 3GT0A 3UN1A 1B16A 9LDTA 1J49A 5CDTA 1PL8A 3G3EA 4BO0A 3KEOA 4ZQBA 3IJRA 3B1FA 3E8XA 3ENKA 4FDAA 4QTZA 1T24A 3RKUA 2W4QA 4OAQA 5HM8A 2B36A 4NR0A 1SEPA 2I99A 2RCYA 4J7CA 4JP3A 1LLCA 4J6FA 5DCWA 5A04A 3L6DA 2H6EA 3WGHA 3NTQA 5L7TA 3BHJA 1EUCA 1XIVA 2RHCA 3GFGA 3OEWA 5KIAA 1D1TA 4YAJA 5AXDA 4FFOA 4CLRA 4IIVA 3I6QA 1U5AA 2D3TA 4PLWA 2HRZA 3HADA 4LVCA 3ZI0A 1PQUA 1ADFA 1UAYA 3AI2A 3G1UA 1NBOA 2QRJA 1HZJA 3HJAA 2WD7A 1DEHA 2AW5A 4IDBA 3O26A 2NV6A 4PVDA 1PZHA 4R5MA 3G49A 1H6BA 2OHXA 3QVXA 2VYVD 4FQ8A 4WLFA 3TQHA 1EDOA 3JQAB 5T57A 5TF4A 2PGDA 2VHYA 2I3AA 2IYOA 2X0IA 4XYEA 3LU1A 4BNKA 1D1SA 1E3WA 1YO6A 4BL5A 1FJHA 3SX2A 5GZ3A 3QIVA 5A3JA 3D7LA 5L4LA 3LDHA 4YR9A 2JL1A 4YACA 3D3EA 1YH3A 2GRAA 4KWIA 4HNHA 5A5EA 1EFKA 3GDOA 4HY3A 3UVEA 2BH9A 4JJIA 1I3LA 1E1KA 1LDBA 3EK2A 1O95A 2CUKA 3RCBA 3C7AA 1X15A 5J23A 3E6AA 3BAZA 4M55A 3KUXA 4AJPA 1MA0A 2AQHA 2Y0CA 3WGTA 5L4SA 3JTMA 4WE3A 1ONNA 3SJ7A 3RROA 4DUPA 3PIDA 4M49A 4QSMA 4RCVA 3D64A 2X0JA 1BRMA 3PDJA 1KVQA 2AQKA 1GQYA 1QLJA 3WMXA 3H4VA 1E5QA 3PFWO 3E48A 5TC4A 3OFSA 3RJ5A 2O3QA 5A5FA 4OKIA 1IE3A 3NRCA 4NZ9A 4UUMA 3E1KA 2FWMX 3CMCO 4JXKA 1ID1A 1DIGA 5CG1A 1XEAA 3Q2KA 2Z1NA 1KC1A 1SNYA 2Q1SA 4ZA2A 4Y98A 4K6FA 3L4SO 1FK8A 4RDIA 1NHGA 2G0TA 3DBHB 3PWSA 3JV7A 1YBAA 2IDZA 3UCEA 2V6FA 1QRRA 4A10A 4RGBA 3GMDA 4TRJA 2HMSA 2NQ8A 3RVDA 3H5AA 1G0OA 2BFPA 2X8LA 4QT0A 5F3RA 4GSKA 1NVMB 4M8SA 5JYFA 1L7EA 2IZZA 3OJLA 1K6XA 3U09A 4CM9D 2IZ0A 3I6IA 3H65A 2PWZA 4U6SA 1GEEA 4FS3A 1T4BA 3ZW8A 5KNLA 4J0FA 1SAYA 2NM0A 4WCFC 5FYDA 4GI2A 1PJQA 2O3SA 3SEFA 2Q46A 3PRJA 1IPFA 3HQ4O 4JX8A 5JC1A 5B1YA 4XR4A 2YQ4A 1GQQA 3NEPX 5U4QA 4WLUA 3JQDA 5DULA 3Q9NA 4XIJA 1E6WA 2JFHA 1PGQA 2Y1GA 3WBBA 1RYDA 1U2GA 4E32A 1U8FO 4J4BA 2GERA 1XCBA 1EBUA 3WOHA 1W8DA 3DMTC 4BNVA 3GEGA 4E2ZA 3BMQB 2OBNA 1HDGO 1CDOA 5HBRA 4TMFA 4GQAA 1MGOA 3F3SA 5JMPA 2GD1O 2WMDA 4FFMA 1PIWA 1DC3A 5JS6A 5MDHA 2P68A 4CM8A 4Q3CA 1R16A 4CMBA 3P2YA 4R69A 4LCEA 1P74A 4IM7A 3D5TA 4GX2A 3UAGA 3IUPA 1F06A 3KETA 1YJQA 1JKFA 4WLVA 3BIOA 2FY8A 1X0VA 3WYBA 1HDOA 3DAPA 1Y5MA 2Q49A 1N5DA 2VT3A 4II3A 5F21A 1NAHA 1D7OA 1M67A 4CQMB 5G4KA 1GCUA 3CUKA 4IDEA 2Y1OA 3ONEA 2OOSA 3F5QA 4Z9XA 4YJDA 2QIOA 4IS3A 4XA8A 4CV2A 4BKOA 4RPHA 3DZKA 2PD3A 4ALMA 1F14A 5BSGA 3QSGA 3QWIA 4NMHA 4CMAA 1JWAB 5DF1A 4BIIA 2YZ7A 1GEGA 3KSZO 2PR2A 3KSUA 3TOZA 4BNXA 3DEYX 3LC7O 4PZCA 4M1QA 4JBGA 5ILGA 2F00A 3U4CA 1YQXA 4EEXA 2BHLA 4MVJM 4Y9DA 1XA0A 2X58A 4PLHA 3GVPA 3DZHA 4NK5A 4RZHA 4JLWA 3U4DA 1CQIA 4IBOA 1HLDA 1KEUA 3JYPA 1N9GB 4HNGA 3WQRA 1KVUA 4I5EA 3BMNB 5LDHA 5L51A 4CLOA 3F4BA 2C29D 4W4TA 4G81A 4W9NA 4XYBA 2WE7A 5IFLA 3VH4A 5EESA 1N1GA 1QYXA 4Q3NA 1VL6A 3PFFA 4E33A 2XF8A 4KUHA 2R00A 1WAMA 2YDYA 3OSUA 4XJTA 2LDBA 2NWQA 1TT5B 2C59A 1PS0A 2FR0A 4FC6A 3SBOA 4ALLA 5B37A 3AUUA 3S8MA 1YE3A 2ZCVA 1JWBB 4DIBA 2FZWA 4I08A 5BR7A 2CD9A 3SJUA 2ZTMA 4E2WA
chains in the Genus database with same CATH superfamily
1PFGA 4BUZA 1OBVA 3OA2A 4OQDA 1MAHA 1BTOA 3OAAD 1TQ2A 1X3LA 4XOUA 4UEJA 3STXA 1R0WA 5LJLA 5FNVF 3FWZA 4OJKA 2R1TA 2JH3A 4YA6A 4J0CA 1LNZA 3VR3A 1SCUB 3SSMA 4AFNA 1KAQA 2AE1A 2PT9A 1M2FA 1ID8A 5JRZA 4RY8A 1TIBA 3RT1A 5EZ5A 1QZZA 1GQFA 3OLYA 4IQGA 5HBGA 4PIPA 2WY2D 4KIJA 5E4FA 2GCIA 2PRJA 3KPWA 3W5AA 4ENPA 4ITUA 1WUYA 2IZOA 1C3XA 1K86A 2BM9A 5CXUA 4RA9B 4P5EA 1M6EX 3D1LA 2B78A 4HDNB 1SVNA 1YE8A 4NWIA 2QG9A 2GARA 1I6LA 2D7CA 2ZWPA 3CF4A 4PPQA 4MDEA 1MIOA 3NV7A 1R50A 1CCWA 4GLFA 3TX6A 4PLGA 5KAPA 4DIKA 2V3VA 1AT1A 1NASA 2IW3A 4IFIA 5IBPA 2XXAA 4CG0A 3VZSA 4D46A 1RE1A 2H59A 2PX0A 3OLZA 1P81A 4HZUA 5ULLA 3QK7A 4C14A 5AUNB 5L6MB 2Y1XA 4C21A 4U7JA 2I0FA 4Y6GB 3FI0A 3UHAA 1WV1A 3I6ZA 1KI1A 2XWPA 2XVAA 4F4IA 3DYVA 2BMJA 2ZSKA 4MVJI 3FF4A 3GEMA 1QH9A 4WUTA 4E30A 4J16A 1I80A 1O57A 4NBVA 1ZXBA 2QM3A 2FSVA 4R1OA 1XVUA 4O6VA 3AWDA 3U0BA 3IEVA 3I62A 4H60A 2XE7A 2GFQA 2D0IA 4DQKA 1WMDA 4ZREA 2D5BA 3TJRA 3ZKWA 4BVGA 4NBTA 2OZVA 4BLRA 1QAMA 1OPRA 1ZN8A 3EW7A 3R77A 3U0VA 1HURA 3CWZA 3HVIA 3M4ZA 1L4HA 1R9MA 1XCGB 2C0CA 3UMVA 1G291 4B6OA 4MUIA 2AOVA 3K9QO 4QQNA 2WK1A 3MQ4A 3MOIA 2KW5A 2UZ1A 1M75A 3F6RA 4GXNA 3WGMA 2H00A 1F8XA 3C0KA 2QXTA 3DE5X 4ZI7A 2ATEA 2IY7A 1W7AA 2XCLA 4EPWA 2JIOA 1N6LA 3ZVNA 4P5DA 2JDIA 4NOKA 2DWUA 3FYDA 4GPAA 4LYEA 1WVGA 2LE0A 1JEEA 2Y0BA 4WK2B 5CJ2A 5AYVA 1YZTA 3PJEA 1HV8A 2FLWA 4JLMA 4M38A 4CFYA 1GQOA 3MF4A 3B9PA 5JFTA 1JG3A 4WZAE 2D2EA 1MXFA 1IU9A 2O7VA 2VJNA 1YBFA 5TQVA 3R7BA 4E3WA 1RP1A 3HO6A 4US2R 1ZAKA 1T1RA 3CV3A 1HOXA 1UT5A 3QFHA 3QU7A 2V58A 5H59A 5LZ8A 3PPVA 1VFPA 2HDHA 2QAGA 2ZFUA 3BMCA 3OWOA 4ZVUA 4DM3A 3U80A 2HMYB 1N2CB 2QLJA 3PNLA 2QRUA 4L95C 1XMPA 3CC8A 4ZVPA 3GPBA 1R9NA 3WJ7A 2AMFA 1U7DA 2EP8A 2OWEA 3N9IA 4JK3A 1OLSB 4MRMA 4PPYA 5KYUA 1GPKA 2FZ4A 4GBGA 1VCNA 2CFCA 1B00A 2HO4A 3ZVLA 4MP6A 2EG5A 4YRRA 4BKQA 3FTPA 1J0EA 3DLTA 4PLZA 4NQZA 3V33A 2GXUA 3W6OA 4GBJA 2ZANA 1IJBA 3VDXA 1TM5E 1A5BB 1QH8A 1BD4A 5DGCA 3AF1A 1VECA 4F38A 2DT5A 3V1LA 3I1FA 1X94A 4G1VA 1P4HA 3B52X 5IG2A 3WP1B 5JOQA 4KBFA 1CB7A 4TQUS 4C30A 3HR4A 3VR6H 4BQRA 3ASUA 4RTPA 1HDRA 1QQ6A 1N92A 4IINA 2ZWVA 1C3LA 1N5LA 1EK6A 1VJ5A 3GZNB 3R6LA 3MUFA 3FI9A 1WF6A 1SVKA 5GV7A 3RUPA 4D96A 1SD1A 4EJMA 4ER6A 4YRBA 1IOZA 4LJ4A 5FTWA 2PU5A 2VT7A 3V8PA 1SUBA 2J67A 1ZA2A 5H5JA 4LQLA 5IDXA 4D9JA 1DJLA 2G1AA 1ENOA 3DKRA 3JQQA 1DIBA 1D6JA 4Z53A 4UD6A 3LLCA 2I6XA 2GXAA 4N49A 1F8FA 1QGAA 3QEMB 4Y2QA 1YXMA 1VG0B 3MPOA 3VZDA 2BFWA 1UBUS 1MABB 5JYAA 1OAOC 3TKAA 1RHJA 3DHNA 4H4EA 1T43A 4RQAA 5ESXA 3OBIA 3DYIA 3QX8A 3T0FA 5CLFA 4Q4AB 1V5WA 1E62A 1MH9A 1C3OB 4OFZA 4QICA 1Z2NX 2GS9A 3IEXA 2J6BA 4YRGA 2O57A 2BTEA 4HYEA 4KXVA 2CDBA 2W43A 3I5UA 1C7FA 1CQZA 2V7WA 5J2TF 3PC4A 1JLSA 1DT5A 1YVEI 2VXYA 4M21A 4FT4A 1OTYA 4R01A 5JDIA 1JIQA 2QEQA 4H4CA 4X24A 3RJ9A 3VKVA 1GPH1 1FEZA 1EFRD 3NIFB 4D6XA 3D2LA 4RIFA 2QQ0A 4TVSA 1UADA 2FW9A 3UJPA 4UDXX 3HU5A 2RARA 1C1HA 4IHJB 4MQUA 4MW5A 4JBHA 1VHQA 2Z1MA 2OQRA 5JI2E 3RASA 1RJ9A 2G9RA 4HK4A 5L40A 2QZ9A 2QR2A 2IX3A 5IWAB 4ZAZA 1QRSA 1KHTA 1P75A 3IESA 3BFKA 4IEFB 3O3MB 2HWUA 2J59A 5ILOA 3R7AA 4B3IA 1FMLA 3VX4A 2ZRJA 4GKKB 2AR9A 1LC3A 1Z07A 5LDDC 3KGDA 3DMHA 5KYYB 4DFDA 2QTWB 4J0HA 1OJLA 5ALZA 1V3UA 3G5MA 3IWCB 1GNQA 1N9KA 5CW1A 1MPXA 2BSQA 2O8BB 3IUMA 2OHVA 3GPLA 2JFUA 1OFTA 1C8BA 4HAIA 3QY0A 1OIVA 1NY6A 1NSFA 3Q0EA 1QYDA 1Z35A 2JGKA 4EJSA 3GRZA 1FY2A 2CVPA 4IDGA 4JEIA 2A9VA 2P8JA 3NTXA 5EZ6B 3VPXA 2NYAA 1IG3A 3IIKA 4NJOA 5ADWA 4UTNA 2HD4A 1N2CE 4L22A 1FJXA 5I9MA 2RGYA 1Z0AA 4B2PA 4HX9A 3CY6A 2WTXA 2DHDA 1Z3IX 3O4GA 4S35A 3C41J 3CO5A 3BXFA 4ZOLA 5B1IA 3FPAA 3BL6A 4ZO4A 2FV8A 3T4EA 3BK2A 4X1IB 4CODB 4Z7NB 1T9GS 5MF6A 1Z5OA 4FDUA 4ENQA 3UK1A 1HY3A 1YCHA 1LTKA 3II6X 5AJZA 4B79A 1X14A 1MOPA 1YL5A 3C8MA 2F55A 4P4LA 4DCCA 4ZZ3A 3ZGZA 1GD1O 2QKYA 1R6BX 4N6OA 3E9YA 2XCTB 2BBOA 1S2OA 1DE0A 5K5EA 2AZ4A 3NBAA 3QKTA 3DFKA 4G0XA 1YB4A 4KG7A 1YR6A 1BE0A 2QUAA 1E2IA 2ZQZA 3W9UA 5IHXA 3T54A 4RXUA 3W77A 3KWMA 2AIRA 3WI7A 2EAUA 2PLWA 4XX0B 3QY9A 2VSFA 5FA8A 3K1AB 2IYAA 1WCV1 1YSCA 2EOAA 2X42A 1ORIA 1KOLA 4C4YA 1QMIA 3M49A 3ED5A 1CE8B 1SXGA 2YHBA 3LFUA 4DWWA 3AL3A 2OUIA 4MQEA 2WA2A 3JALB 5CJPA 4B9AA 3WGIA 4FFLA 5FHQA 4D25A 1KPIA 1LLQA 2H4ZA 2VWQA 3TG2A 2LWIA 5KSYA 2C5AA 1EP1B 5CD9A 3HRIA 1QK4A 2DOKA 1L9KA 2G6TA 5FEUA 2EQAA 2VEDA 2PWPA 1ORHA 2ERCA 1IHUA 5HE9A 1P9RA 5IP5A 4L0CA 2VP2A 1CUVA 4GX0A 3NTOA 4J1TA 1QHFA 1UDXA 1ENPA 2ZUDA 1ZD4A 2O2CA 2KQUA 4KAAA 1JAHA 1Q20A 1EE2A 1PT6A 3LC1O 1SEVA 2ZYGA 5C35A 1V5GA 1NR1A 3BFVA 3LZDA 5CFRA 2XNJA 1KDRA 1UXOA 2BFBB 2A35A 2D5AA 4N9WA 1PZEA 3A1CA 3TL6A 3W3AD 5EUBA 3ZHZA 5CB0A 4ZV9A 3U26A 2XUQA 1NUUA 4BQPA 2X9QA 4IIFA 4EG4A 1MJGM 1NW8A 2O5VA 4KLZA 4YH1A 3ROPA 3ER8A 1MT3A 2XUKA 3AL0C 1ISSA 1E6UA 4UMVA 2WHPA 4HX5A 2ZE6A 1ATIA 1ECPA 3ZHSA 1DLJA 4GMXA 4JUFA 4OM8A 5CU7A 4CDMA 1DS6A 4NG5A 3TQCA 1NR5A 3JQ9A 3Q11A 4HDMA 5A02A 3FCCA 1OT5A 4C06A 3A6KA 3O8CA 3OZIA 1SKMA 4TOIA 1AO0A 4P7FA 5EIXA 2YFYA 4QTYA 1GFIA 3HMKA 3HBLA 2CE7A 1ADBA 1KDZA 2Z6QA 1G6OA 3HWX1 2QMQA 3U3OA 2HBYA 3S55A 1KXJA 1SHZA 1JEQA 3FJYA 4L50A 4IDCA 5JJ5A 2GLUA 2XKJE 2WJ4A 1XCMA 2PUWA 3TLAA 4QDKA 1L5KA 1TYDE 1C8LA 3OCYA 1FRZA 3F1KA 2SCUA 3A4LA 1NI4A 3UOGA 3IKVA 4FKBA 3UJ3X 1JILA 3W4KA 1R0XA 2Y2VA 1KSGA 3BHIA 3HYSA 4BO4A 1YKGA 2FETA 3B1ZA 1P18A 2NZJA 3KSDO 1NRWA 1NVBA 3PDUA 3W9YA 2XRYA 4GGOA 4C6HA 1PUXA 4LF8B 3GG2A 2J6HA 5AVJA 3NVKI 1J5PA 4ZO6A 2R2GA 3N39C 1XJCA 3EP4B 3HN6A 3K53A 4W99A 5GPBA 3BWXA 4WAUA 4B8WA 3IS3A 1VYUA 2M2IA 1JHOA 3DT8A 4MQFB 1I33A 4P53A 1MTOA 1E9BA 1YB6A 2OHJA 5BQOA 2IH5A 2A5YB 2TMYA 4D8VA 4D9IA 4DNOA 2I4RA 3AG5A 2GI4A 3OQVA 4K9LA 3UHJA 3C1AA 4WESA 1RHUA 1E9AA 4YY3B 4P22A 3DKVA 3AEUB 4LXHA 4MCJA 3FOEC 4CM4A 1AX9A 1N3YA 2GNOA 2B99A 2HZBA 3HN2A 1Q2UA 3K31A 4NPCA 4MQ6A 3V4SA 3EEOA 1KO5A 3LA6A 4RMIA 5C52B 4J49A 2ARKA 4IQ4A 3L1JA 3TLKA 3RKRA 3PUWA 4OB7A 1PCXA 1NW6A 3JAWA 5KZMB 5BO5A 3AHEA 3GLQA 4KWHA 4Y2TA 5IZCA 2GK7A 2FJUA 3GWZA 1Q74A 1QE3A 4V03A 1QRUA 3H1PA 3G2IA 4D9KA 4O4IA 4RPKA 4D3DA 3FNQA 3R0XA 4KAXA 1HTBA 1BEUB 4AMBA 1SVUA 2VYFA 4BRUA 3Q8KA 3Q10A 1OASA 3IKJA 3CZRA 1N0HA 4G23A 3PQFA 5BNFA 4EB6A 1EIWA 2OBMA 4WL0A 3V3KA 3KV3O 2DC1A 2ZVQX 1P2TA 4GI3A 2X4DA 1G9SA 2PZMA 3UMRA 1QHYA 2GN6A 3A9VA 3OLCX 5HOEA 5I7EA 2JI6A 5B7NA 2BCJQ 3M8KA 4NTZA 4XI9A 5JAOA 3IQWA 3VV2A 4AULA 4CL0A 4OSEA 2RB4A 4QYSA 4AY6A 2RHMA 2BFAA 1KI6A 3EDQA 4RFVA 5EAIA 1NWHA 1HG1A 5FPKA 5JS1A 1SC6A 4TMKA 4JQZA 3AEKB 3HCWA 3M9WA 2H1IA 3H6GA 3WWZA 2E4AA 3ELUA 4MB6A 2KHZA 3WKCA 4RK4A 3WGUA 3CLRC 2VN8A 2O2DA 5A62A 1YT5A 4JBNA 1XZJA 4X6YA 4LRXA 1NRIA 1PFKA 1FRQA 1E6CA 3JVVA 2ZSUA 2AMYA 1K7CA 3EHDA 3O84A 1KK1A 1ZI8A 4L4ZA 2C7OA 3CONA 5HUHA 1XEWY 3JY6A 5JHGB 2R1ZA 3HCPA 4YJ3A 3WDMA 2HFKA 1Z12A 2DCMA 1V11A 2HU5A 2PNJA 5GONA 2P79A 4H08A 3T3NA 5CXXA 1ZMTA 5EXXA 2CKMA 1VE5A 2DUJA 2J0UA 4OQFA 4PBTA 1JBKA 1GNVA 1NUPA 2VK4A 2WJ3A 3G68A 1T13A 2CLCX 1YRAA 2F1RA 1C29B 2RHLA 5D3KA 1P77A 2IPOA 4OX9Y 4F1KA 3WBJA 5B58T 1BGWA 5D85A 4OQ4A 2ZXUA 4I5DA 1TM7E 4G8JA 4ZCLA 1KMCA 4R1QA 2GO7A 3TNYA 3PWTA 1RZ3A 4H4DA 1KU0A 2A9PA 4ZN6A 3RABA 1G59A 3N8DA 3EODA 4PZ9A 2GHQA 2Q50A 3AETB 1CB0A 3L46A 3N86A 3R7SA 4EI2A 3BX1A 3R7NA 4QEKA 3H1GA 4U2BA 3JR7A 4JC8A 5C4GB 3BSFA 3O92A 3FKJA 1LEHA 4AKIA 2BKEA 2G9UA 1ULZA 4GF5A 4C7BA 4DPMA 1XP5A 5KDDA 5IK2A 1YRQA 2WKPA 4B2YA 1VE1A 3BF8A 2OXTA 5DX8A 3CPJB 2ZGVA 3D3KA 4QM7A 2XYPA 1VA5A 3H2SA 1WTCA 1USVA 2MSKA 4HDKA 4B73A 1SCJA 2I2FA 3WK9A 5I7UA 4IL5A 4QM6A 4D4GA 1JE0A 5JFOA 2C77A 2JC3A 2PX5A 3TQTA 4DRXA 4KR2A 1BYUA 4F6LA 2B7LA 5KSWB 4Y2RA 1ZHOA 2ZYUX 1GNTA 1BXRA 3IODA 1ECGA 4YEDA 1NBIA 3CT6A 1EA5A 1W25A 4UUOA 1MV5A 1U99A 2L69A 1EVIA 2XBMA 1XV5A 4P3OA 1IL0A 1JU9A 4UFNA 4CLRB 5DK6A 3RTDA 2IBMA 1VM6A 2ZQYA 5AK4A 2JCSA 3UCFA 1NQAO 1GZUA 4L28A 4WOBA 2G8NA 2Q6LA 1M2HA 4AO7A 4DEXA 4ROTA 2PKQP 1IUPA 1WU7A 2R96A 1P1CA 4TVBA 1J0BA 2CLLB 1ZNXA 2QP4A 2PKEA 3BSWA 5DHAA 2P65A 1TC1A 1S02A 1Z2AA 3GRAA 421PA 3ZWYA 3KS9A 1JQ3A 1PZGA 4M1OA 4TTJA 5GM1A 2FDRA 5SZKB 2WU1A 1P9NA 5JSZB 4MS4A 4RF3A 4AMGA 1JEAA 1W0KD 2IOFA 3ESBA 3RIGA 2EYQA 3UGJA 4IDOA 4XJXA 4BUCA 3RG2A 4X6XA 2NO0A 1ZA1A 3PGKA 2GEFA 1DIRA 1ZVKA 5C1DA 2FFAA 1CUYA 1NI5A 4N8EA 4F5ZA 4EZEA 2X8JA 2G6BA 4TMWA 3BQ9A 5GOZA 5LQMA 6CHYA 2AFHA 4YAKA 3IRVA 1BDBA 2AXNA 3IEMA 1L7DA 4B44A 3UAZA 2XOKA 1EUYA 1MKYA 2R5FA 2W2NA 3S1SA 1TADA 2ROQA 5JT1A 4FD3A 2QV7A 3X44A 4GVXA 5E9WA 3NIBA 1ZMOA 4HPWA 2P5SA 4H6XA 5DLEA 5G40A 4KGZA 1ZN7A 1KMHA 4NU6A 2N0SA 5DYYA 1K1EA 2O9JA 4DDKA 2YY6A 4EZBA 3I2IA 5B1HA 2D1YA 2QTLA 4LVNA 5AM0A 4HWKA 4MQ4A 4OUDA 4HRYA 2FQQA 2Q2WA 3NDJA 1QTRA 4BGUA 3MTAA 1FDWA 1ORTA 3PXAA 4KV7A 3HBFA 4P4TA 3ZLJA 3P2KA 3RYCB 1GU0A 2AOWA 3PGJA 2M6LA 3WL5A 1LS6A 3OHSX 3G0BA 3FGPA 3EVNA 3L4BC 3VZBA 1QFYA 2Z2YA 4EWLA 5A4JA 5C80A 3I0MA 2GJ4A 3M1YA 1E2MA 2XIJA 4QVKA 5JNUA 2UU9B 2MINB 3KJIA 4M9SA 2GHTA 4FR5A 4O5OA 5BNWA 2HPVA 3CVJA 3FDXA 1CSEE 1OSNA 1SK8A 5F9MA 4LWZA 4UEOA 4M87A 3RYHA 2QORA 4MDHA 5CX4A 5K6AC 3OD5A 5ES3A 4C0XA 2RHJA 4FP9A 2Y9MB 2PV0A 4KMSA 1PGPA 2CHQA 2GF9A 2AZTA 2VUHB 3I4LA 4TKUA 2CNDA 4PX2A 4WKPA 2UYHA 3WRYC 1ODTC 3AU8A 3BWYA 3VVCA 2WE8A 3AUTA 1CZNA 1YI8A 4JL8A 5DHFA 2OVBA 1KJNA 3PP8A 4DNPA 3GYBA 5AW1A 2R6HA 3Q3VA 3HB7A 3EQ2A 2W6PA 1K97A 2VPWA 3T15A 3ICWA 1DP4A 5AHRA 4M0MA 3E58A 5JARA 5I7RA 3RRXA 2C98A 4DJJA 2FZVA 1M72A 3M6UA 3WMRA 4HN9A 3JRXA 4H1WA 1JVNA 4ZC8A 5IEBA 2JD1A 5KOIA 4FHGA 4Y1GA 3IPLA 1CUJA 4TWIA 3OFNA 2RDMA 1N6KA 4HG2A 3RHTA 1XRQA 4DSOA 1DEAA 3GPCA 4UMDA 2I2AA 3PGVA 4N3NA 5TMBA 4LGYA 1QP0A 3KDSE 3MT9A 3LJKA 3UA3A 3KU4A 4NCKA 3HV2A 3KSRA 2R3SA 3PQEA 2ILVA 1DKMA 2QRZA 2QVGA 4OB6A 3DLAA 1O6GA 3ETNA 4A9AA 4E08A 4NZPA 1QFXA 2XQKA 5FHRA 5K6TA 5ALJA 3ZQUA 1G41A 5ECGC 1V8BA 4DCVA 4Q3OA 3HLTA 5ILQA 1X74A 3AONB 4X94A 5CDFE 5ETJA 3Q2IA 4QU0A 3RC1A 3LYHA 2VYCA 4IGEA 1K6EA 1M3SA 2WWXA 5TR9A 4M83A 4OREX 4GI7A 5AVOA 3WDKA 4DLUA 4E5PA 2CB0A 1BX3A 2DLDA 2JCBA 1IAQA 1V5EA 1BXZA 2IP2A 3OMWA 1A9OA 3ECAA 4HX2A 2PUTA 2XZTA 4ZCIA 4G37A 4WXMA 3OOSA 1IQ0A 3PLNA 2B8WA 4L07A 2WIKA 1A98A 1EFAA 1FDUA 3QOXA 3V4PB 1K06A 2ZUUA 4L7VA 3KAPA 2FRDC 1VCIA 2ETXA 4QGSA 5CAEA 1NLUA 1YRYE 2V55B 3QLVA 1KJJA 2XKAA 4OK3A 5AKGA 5DFAA 1DADA 4CM8B 3GJ5A 4C7OA 3JZDA 3MK31 4CI9A 2QT1A 5P21A 1WV0A 3TAUA 1E2GA 2IPNA 3DPSA 4XQGA 3WYCA 3LQQA 1DXYA 4Q7EA 4EELA 1NW4A 4JT9A 2EERA 3J81A 2B4TO 3HCAA 1JENB 1UAGA 1GTL1 2C4VA 1X70A 4L9RA 2YWRA 3CR3C 5FLYA 3SN6A 3SR3A 1IWOA 1M7BA 1LVUA 2PCLA 3O91A 5DYTA 1E0DA 3OO1A 4MGKR 1KI2A 2HDOA 3NEAA 1TYBE 4JVNA 4PX5A 4ZEMA 2PJUA 4DV3B 1J5EB 2Q1TA 1WB6A 4C29A 2AOUB 5DBIA 5A2QA 5JQGF 3B8HA 4DB2A 4BP1A 4G25A 5BVHB 2OGZA 1S7GA 1UZMA 4I55F 1E6MA 1QP4A 3QF4B 3RJTA 5K0JA 1IB0A 1DBVO 3NHSA 2E82A 2JFFA 2XOXA 1JIIA 4W7IA 4AD8A 4QPDA 4CLXA 3HXOA 2G3YA 3BBLA 1KJ9A 4H7FA 3ZIDA 3SD7A 4C04A 1THMA 3I05A 1NKTA 2OFFA 5BQXA 3L4KA 4K86A 4OHRA 2FPLA 1K66A 1L5VA 2IELA 4S0ZA 5IBQA 4FCWA 4V3CA 1ZHFA 1K75A 2Q8QA 3TBFA 1JKJA 3CUUA 4URUR 4AMUA 2XKKA 1TTTA 2C2WA 1KGSA 4K6GA 2Y3IA 2ZB3A 3AIIA 3F47A 4U3JB 5E2AA 4GVPA 4MJ3A 1QHHA 3ZZNA 1ZVVA 4ZOAA 3EUEA 2VI5A 2Y0PA 1U3GA 1GXSB 3GCZA 2PZBA 5AHOA 5EQJB 5GGXA 3J80A 3NUZA 4I4TF 1AURA 1LSOA 3W3AH 1VPDA 2E5FA 3G5TA 1RBQA 1XJ5A 3EDMA 3G13A 2BBTA 4Y2JA 3ONVA 3WXBA 4B32A 4BMOB 5AUOB 2HZ7A 3INGA 4Q19A 3T35A 5GZ1A 3F0TA 3FWNA 1Z39A 4YK7A 5G41A 3KZKA 2Q5HA 2XMQA 2XWSA 2ZB2A 3MJRA 4OBEA 5DZSA 4CLOB 1PQ4A 2ICAA 4YECA 5KSZA 4DLSA 1H94A 2FCRA 3F74A 1K2VN 1N6HA 1SBYA 2R6FA 3ASYA 3LRTA 1JALA 4UNPA 3BXXA 5DTEA 4B3GA 2PGLA 4AKGA 3I2KA 2JIZA 1P1JA 1IZYA 4QA9A 3JCZA 4CV0A 5BOSB 3CRW1 2C95A 2QMEA 1I4OA 1Q1GA 4R0MA 4Z0HO 1JHMA 2GGSA 4YT8A 1GGHA 3E4DA 2ZJ6A 2P2LA 3TZHA 3QPWA 2QG6A 4TWBA 3SJBA 1LBQA 3DBLA 1SKQA 2I4MA 2G9VA 3AKYA 3FUTA 1ZNWA 2JZCA 4QBTA 1GA1A 2AJCA 2P2NA 1NP6A 3NNNA 4JQYA 4JVMA 4YALA 4EPVA 4O1IA 5B64A 5IJ9B 3EQ6A 4QXAA 4RADA 2A9OA 2Z5LA 1K4MA 4J0QA 4TZTA 1O95C 1P0CA 2D0PB 3CG0A 3W5BA 4CM3A 4D99A 3WGYA 3DGEC 5EGNA 2QL5A 2WWRA 3C16C 4DILA 3WYDA 2YN2A 3JD2A 4NAHA 4BNTA 2R1TB 4IKEA 3UK2A 4D97A 4AN1A 4QXOA 2UYQA 1OR8A 4MS1A 3IAFA 1G3QA 3F9RA 2ZYSA 2PPVA 3TAXA 2EC5A 2PVCA 4QXQA 1LS1A 2RAPA 3ZDZB 4K7JA 4GRIA 2O50A 4XOIA 3L7LA 4AJNA 1E99A 3MWFA 3IX7A 3NRJA 5LQDA 3OURA 1T10A 1LPMA 5F7JA 4C07A 4XDZA 1VLHA 4MUJA 3BWEA 4DCNA 3ADOA 1IBRA 4JH0A 1NVTA 4PXSA 5K03A 1MIOB 5EERA 3U3XA 2DKFA 2YV2A 4E22A 4NCBA 4KE9A 4AJJA 2XXAB 1Z0DA 4CKXA 2WMNB 2VBGA 3FCAA 1DKRA 3QBVA 2J0QA 1QGUA 4LMRA 2E6UX 4TXLA 4HZUB 2EZ4A 1Q1ZA 2GD2A 1WCXA 1E2PA 3FNGA 3QE2A 1B4DA 3AQ4A 4PS0A 2WNIA 5EJ2A 2G4CA 2LRHA 1SPXA 1G42A 3ZWQA 4EG3A 1EP9A 3T1NA 2RMKA 4AP9A 3FMFA 4YCJA 1VI6A 3UXYA 1L5FA 4ZK6A 1Y7IA 4DLVA 1UP7A 5TIIA 5IKPA 1KOFA 1T6ZA 1CLEA 5COQA 2C8JA 2ZS7A 1A76A 5EPEA 1N6PA 1YR8A 2IXAA 3BT7A 5FFFA 4LHZA 1K5GA 2ONCA 1TJPB 4ZYTA 2OLEA 3I9KA 4HQFA 4I3GA 5CCEA 3MBKA 3ZKWB 1M2VA 3LVRE 2GVDC 3MTGA 4K6CA 3RSOA 1NN1A 4HNVA 3T1HB 1EPUA 1ZGAA 4UTRA 4MR9A 3BHMA 1ISFA 1ZVMA 4XWKA 4I66A 4BX8A 3IQEA 2XY4A 5HA5A 3V1UA 4KO4S 1TZKA 3DVLA 5IT5A 3A26A 3AR7A 2NOAA 2UZ1B 1PQYA 1FFEA 2QTAA 5EP3A 2D1SA 2JJ1D 4ZI7B 1ZMXA 1R15A 3K8QA 4MI3A 3OMLA 3LKZA 1SBCA 2QAJA 5BSHA 1S8NA 4J4TA 2HB6A 3OT5A 3LQ2A 1Z73A 4OXKA 5AM2A 3W5JA 1JFSA 3SZMA 4B4KA 2CJPA 4LRYA 5FFNA 1PLJA 3JD0A 5EGSA 5C81A 2BVNA 4AIRA 2QTRA 1YJBA 2ZJ0A 3T7IA 1YA6A 4GZ3A 2FLVA 4OHCA 2AVDA 2VTEA 3V3TA 5L9AA 2PUEA 1X8LA 4IMPA 3WFZA 4X7BA 4KR6A 1KP3A 2NTYC 2BSXA 2BEJA 5IU6A 2IYLD 3NDPA 4CIBA 2O8NA 1GITA 1ZEJA 4MV7A 2AKEA 2QAGB 3BMCB 4G67A 1GJRA 4H7JA 5KTOA 1QV7A 4KVZA 3PNOA 1M74A 4F3RA 3EYWA 1LY1A 4KGXA 1IDN1 1NJGA 5BPHA 2LVBA 3VI3B 4NC9A 3PXGA 5AVUA 4MRMB 3ZDAA 3UFXA 4R0NA 1W4RA 2ORYA 2YWHA 3GRPA 2HDWA 1FLAA 4ICIA 5KYUB 5KCZA 5DO9A 3C6QA 1J1ZA 4MKRA 5BSMA 3T0GA 1G5RA 1UJ6A 4IEIA 4JJ7A 3MRVA 3V34A 2OFXA 2JKVA 4QZVA 1QH8B 1SZPA 3GMIA 4E5MA 4D6YA 3A9CA 4EI7A 2ZB7A 3E5HA 4O4JA 2H16A 2VL7A 4EG0A 3IAS6 3LK6A 1QHIA 4AAYA 1TD1A 1W88A 1E92A 4D42A 3AFNA 3S8EA 1NQWA 2KLHA 4AT1A 4MI9A 1N1DA 2QS9A 3RBZA 1E3DA 4MITA 2DBRA 4H7EA 4OMUA 1M7HA 2P9HA 4ZO9A 3V7YA 1I4EB 2V5AA 2DFNA 1QXSA 2RK6A 1PEYA 3KXLA 5HF9A 3U62A 4OQQA 4D02A 3NT2A 4RYDA 4B87A 3H13A 4CLEA 3RK4A 1HDIA 4DLAA 3A6ZA 1ZWKA 5LZ2A 2PDAA 1OHHD 2J6IA 1UC5B 3LPNA 5GVSA 5CBPA 1Z47A 3A7EA 3T1TA 2ZS8A 2HPZA 2XPCA 1UWKA 3QXHA 2C5FA 1GPYA 4WDRA 4PYQA 5TLSA 3MN1A 3TF5A 1Q0PA 3GJZA 1WDMA 2BMDA 2QNBA 1V2GA 3HL0A 1T5LA 3MLBA 2PRSA 2WSYB 4ND1A 1J6UA 4N5IX 3GR6A 4NOLA 3W8FA 2F3QA 3ZWXA 1KI9A 4EAAA 3KM0A 1Z34A 2D3WA 1ZM7A 1COWD 4U7WA 4D41A 1U6IA 3EZ2A 4W9NC 1G38A 1OTHA 2B34A 2AZMA 4IFBA 4DNQA 4WXYB 1YVPA 1JB1A 1JDJA 3LHDA 2IT1A 5DTQA 5KO2A 1Q7EA 1FSFA 4IIYA 3EGOA 1ANKA 2FPOA 4WN3A 3UANA 2R00C 3RRNA 4F97A 4JCCA 3UK7A 2WYIA 3K92A 2NNLD 3JSAA 3TLXA 4DF3A 4JIGA 1HDXA 1BMDA 4P86A 1QVRA 1KK3A 4HVLA 3HZZA 1L5OA 1LW6E 3DEAA 3CKMA 1FDSA 1EX7A 1RJ9B 4R8RA 3ZU3A 3X0DA 3JPYA 3VH3A 1G55A 3OX1A 4QL3A 3ND7A 4RESA 1VSTA 4ZRNA 3HU1A 5M2QA 2ZUCA 3UPTA 2VXBA 4ZVQA 1CUWA 1KXZA 1ZH8A 4UM7A 1OFVA 5EA2A 5JAQA 4AG5A 1WDTA 4D98A 3OCCA 2G5GX 1ECFA 3FE2A 3UQZA 2IY8A 4R6WA 1JKIA 1KA9H 4OHFA 1AQJA 1QHNA 4BFSA 4RZSA 4L1KA 3G0HA 4X91A 4ZRDA 2WB2A 3T3MB 2YYYA 4EJSB 1HRDA 4M1YA 3WSTA 5BRAA 4HSGA 3E23A 3NOOA 2QM8A 3IT2A 5DN9A 1Y9AA 2OHOA 3FPSA 3NASA 1SXQA 2VSOA 2X1VA 4M60A 1JHZA 3HA5A 2DUMA 5DTRA 2B37A 3TNFA 4EA7A 4JKIA 3CW8X 3LW7A 3B5EA 2NSJA 4RJKA 4ZOLB 4ZU1X 4CV3A 4X65B 1TIKA 1G3UA 1NUTA 1SBZA 3MJCA 4R6XA 3NP7A 4HD8A 1V1JA 1L6RA 3N8NA 3DEIA 3INRA 3JTEA 4QRIA 3AH8A 4Q9HA 4BFCA 4CMEC 3ZV4A 5C9ZA 1RRKA 1N78A 1NU8A 2P9JA 2F62A 5BY2A 2FPNA 1AVTA 5C1IA 4EMBA 4XDYA 1U9ZA 3FH0A 2MU1A 2R5WA 4DJDC 3F5DA 2E4ZA 1XEWX 1J21A 2VLIA 3DPIA 4DS3A 1GZVA 2X1LA 3M70A 5ICMA 3PKJA 5CFMA 2JRLA 4BNLA 4Z0PA 3GEIA 1ENYA 1JG2A 2AN9A 2PXXA 5D01A 3TG8A 1MC5A 2QSJA 2A5FA 1KYTA 3W0LB 5KNDA 5CB6A 1L4NA 4GG1A 3BIXA 2XQVA 3KAKA 1M1UA 3H1EA 2B92A 3KOYA 4HH1A 4QOIA 4YCBA 3UUEA 5K8VA 4KQMA 1JPJA 1YKFA 2AEEA 1O1YA 1ZISA 3S2IA 4ZRMA 4BASA 1I72B 4P2BA 4ASUA 5BV7A 3FFXA 1KFKB 4JXZA 1F6DA 1I9GA 2ZT6A 4MQEB 5JY1A 4MNTA 1UJ4A 1WUTA 4PTLA 1QZXA 3VHLB 4JI2B 3AM3A 4D3ZA 3CISA 3EMKA 3SXJA 1EX1A 1Y6GA 5IYZA 3IQZA 5IDYA 2PD6A 1MRSA 3AP1A 4ALKA 5FOWA 4ZKDA 1XZIA 1ULSA 3KU1A 2OCDA 1UBNA 3N87A 3ONNA 4JI3B 4D44A 2V03A 2BM1A 4C4XA 5JNLA 1ECBA 2ZI5A 4BMDA 3S68A 1AF4A 4XEHA 5AI9A 1R0SA 3PXBA 1R27A 2GF2A 1H8HD 3QEOA 2VZ8A 1GDHA 4F0JA 3EIUA 3DAGA 1DIAA 2YH2A 4BNUA 2K5UA 3G8AA 4OPMA 1TFUA 4CKEA 3E2IA 4AJ1A 3VC2A 5B55A 4KQWA 4TPKA 1HMYA 3W4JA 2PNFA 1U6KA 4G65A 1D8TA 5LCXA 2VNIA 4E1VA 2A59A 3N28A 5J40A 1Q44A 1TCUA 2W6QA 1SG0A 3W5VA 1V4NA 2UVPA 5CXSA 1E5LA 3DTNA 4Q7JB 2FMUA 1MVLA 2WHPB 4CQJA 3GPDG 4LRUA 4C4PA 4E14A 2W2VA 3I76A 3S40A 4QXRA 4DUGD 2H7CA 4OA5A 1L7QA 3W6UA 4HDMB 3VBEA 3GLTA 2XUIA 3IR5A 4HB0A 4KO2S 3UKOA 4HNTA 1OFHA 4Z4HA 1IN8A 2PKYX 3KR1A 5ALXA 5U9CA 4LEIA 5KTTA 1LPSA 3H2BA 2EIHA 2GBCA 5ALRA 3QBEA 4LFCB 3TSCA 1XMOB 1VMIA 2WIDA 3DAFA 3MAAC 1JEQB 3EDYA 1KYWA 1IK6A 3DH0A 4C03A 4EK9A 2PO5A 2IOFK 4L74A 3R3YA 2DHRA 3FTNA 1LSJA 4X3OA 3C85A 4R7GA 2O2XA 2SCUB 2VBFA 3TAHA 1GUBA 4NEHB 4BATA 2ZRHA 1NI4B 2Q7OE 1P1RA 4BPRA 3LGXA 3OZFA 4MHOA 3W34A 3PLRA 4BFWA 3L05A 1U3FA 5FTKA 2EEPA 4JLSA 3WO1A 1AG9A 3X2SA 1GZ7A 2OCPA 4C4AA 4Y0AA 3TVTA 4CKWA 4ZICA 1CS0A 2PRKA 2QE7A 4GLOA 4EUSA 1CJCA 1XE3A 3PQ8A 5CHEA 3FPEA 3QUTA 2B6NA 2H4FA 1SQ5A 4QPZA 5DB4A 5IARA 3BF7A 4A1OA 3L0BA 1CF9A 3H5WA 3UAWA 3O8RA 3ZCRA 4JXXA 1NF3A 3CRRA 2EKQA 1BS1A 4R2HA 2A58A 1WOYA 2X9VA 4KO1S 4P93A 4QOGA 3U39A 4B3JA 4CQMA 4EGCB 1QG0A 3GT4A 3E7PA 3MUOA 4PPGA 4WESB 1V41E 3W2IA 3FIJA 3FBWA 4RELA 2WICA 4GKVA 3LPMA 2B8NA 2D1FA 3V2GA 4CM4B 1EP3B 4WXRA 1HDCA 3EPLA 2Q6IA 4YVFA 1MO6A 3ITEA 3MQ2A 3WP0A 2IEZA 2VF4X 4R2LA 1I3NA 4WERA 3SF8A 3SXUA 5KBYA 1T9DA 4L3WA 1PJ2A 4NBSA 3JAWB 3GG9A 4GI1A 3GJ3A 1GP2A 5EN4A 4KEAA 5LP6A 2UXCB 3L06A 1K88A 3GJ4A 3UENA 1KL7A 1PV1A 4R9SA 2GD0A 4O4IB 1HFEL 5C7IO 1EXNA 1OV6A 3ZHXA 3H99A 4P3NA 4P4GA 1G3IA 2O6LA 3NZEA 3PUHA 3DXZA 4UHDA 5LZ5A 3UWMA 5A7FA 2ZJ1A 2R60A 1WG8A 4KITB 4XWOA 4ARUA 3G5UA 4U8GA 4EB6B 3WYGA 3EP9B 1H9BA 3PVCA 4WEOA 2NO6A 4M86A 2A4KA 2I1WA 1MO3A 1K6IA 1MO4A 1ZD1A 2N3ZA 3K1YA 4GM1A 2NU6A 4IIJF 3BMNA 2BBSA 4DKXA 3AC0A 2DPGA 4ARVA 2ZIXA 3N05A 1N8KA 1KFBB 1BSVA 2QX9A 2WFZA 3LW8A 4B75A 2ZU6A 2ZI6A 2J3KA 2XMGA 1R8SA 1WCIA 1KI6B 3BTUA 1KZ6A 4K9PA 2NXCA 4PM4A 3ZLTA 4AJ2A 4EFNA 4MVJD 4LJ7A 3SZ3A 5F35A 5CITA 2NU9A 3AZOA 5FPSA 1JYFA 4WVLA 4YPVA 1TLTA 1F4PA 1NOIA 1F8GA 4BV2A 5BYAA 4C20A 1ZSVA 5HRUA 2B69A 2IZ7A 4MB0A 3F3YA 4A2PA 1G8MA 4KXUA 2CNOA 3QUCA 3LXXA 4DSAA 1HO3A 4BLOA 5K0GA 3HXQA 1IUOA 2B94A 2O06A 5ELMA 3X2FA 2Y68A 1XTUA 1I51A 4E51A 2H5EA 4RSGA 2A5GA 2MDTA 3FDIA 1RWXA 2BEKA 4JJGA 4YJ3B 1P73A 2F8SA 3P9KA 3U4GA 4L5AA 1V11B 3SKVA 5GONB 2OV1A 3GFFA 3CM0A 4INOA 5DHRA 1JIJA 3B6KA 1HT1E 2A7QA 4Y7DA 5DNVA 1GCOA 2V9ZA 3K0BA 4NP6A 2J0UB 5G3ZA 3W8NA 3Q3GE 1PG0A 1S96A 1M2WA 4HDRA 2IYQA 1TLFA 3PNSA 1CIJA 3N3BC 5DVZA 5I3CA 1MB0A 1ZGGA 3OUUA 1NNUA 4RH0A 4E5DA 1CW2B 2M9MA 4B48A 2DUUA 1LI7A 1W0JA 1YZHA 3COPA 4N18A 4XWYA 1ZUHA 5B7GA 5IF9A 1XQYA 4N47A 1CD5A 2VDQB 4AF8A 4Z6KA 1KPGA 4GXTA 3QBDA 5KU1A 1IXRC 3C3PA 5EEGA 3SE7A 1YQQA 1LKZA 3AFGA 1T34A 3TTTA 2IS6A 5GIOE 1Q1AA 4P6VF 4A8HA 3DFIA 2NN3C 3E7XA 3EUAA 1EINA 3I1IA 3ANLA 1HC7A 2EQ5A 1P2UA 3AF5A 4FXPA 5ICGA 4H7PA 5IC6A 2KWIA 3HCNA 2QL9A 1WPGA 2VJBA 3VR3D 1Z56C 5FADA 2WYOA 4E31A 3B60A 2O07A 1XFDA 1ZQ9A 2C54A