3QVTA

L-myo-inositol 1-phosphate synthase from archaeoglobus fulgidus wild-type with the intermediate 5-keto 1-phospho glucose
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
392
structure length
392
Chain Sequence
MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic crowding drives the catalysis of myo-inositol phosphate synthase, as deduced from a crystal structure of a trapped catalytic intermediate
rcsb
source organism Archaeoglobus fulgidus
molecule tags Isomerase
molecule keywords Myo-inositol-1-phosphate synthase (Ino1)
total genus 161
structure length 392
sequence length 392
ec nomenclature ec 5.5.1.4: Inositol-3-phosphate synthase.
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qvtA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qvtA01
2GDZA 5EERA 5IZCA 1LLDA 1X7DA 3DOJA 1P77A 2B4TO 1CDOA 5CDGA 3Q9NA 2YFQA 3I6IA 4EITA 4JBGA 1BGVA 3ICCA 3QLJA 2QRKA 1N9GA 2FSVA 2BI7A 1QYVA 2EKQA 4R5HA 1K0UA 4ZVVA 3TF5A 1ZEJA 1I3LA 1PU2A 2B37A 4NBTA 5L4SA 2Y1GA 3S55A 3RFTA 4Z3KA 4XIJA 1VLLA 1NWHA 5TLSA 4CR7A 1XIVA 1CWUA 1PGNA 2EGHA 1GCOA 3WQSB 1H6AA 1GQQA 4FFRA 3EVNA 4PG7A 2GNAA 4B4WA 4WLVA 1HWYA 2WJPA 1GZ4A 4RCVA 5G0TA 4PG8A 3GGOA 4F6LA 1C0IA 1IE3A 4K9DA 3FPLA 3W8FA 1DB3A 2DPHA 4OOFA 3GG9A 1EVZA 3GAZA 2IDZA 4XRGA 1ISIA 3ABIA 4MVJP 3G3EA 1NHGA 1B8UA 2Y0EA 2Y93A 3GUYA 3OH8A 4IIUA 3ASVA 3VH1A 3JQ6A 4EBFA 2OXIA 2A4KA 1C0LA 1ZNQO 3IKVA 3O26A 1MP0A 3CZMA 1P31A 4CQMD 3WWYA 5LCXA 1CERA 2Y1DA 3E18A 3KSZO 2G17A 5KVVA 3JQ8B 3OIDA 3V5NA 3D5TA 4LN1A 3RUHA 1R6DA 4DVJA 2PGDA 3BIOA 3EGOA 1QYCA 2PKQO 2DFVA 2WE7A 4XD2A 3DZFA 4K1LA 1X1TA 2RHCA 4CV1A 3K73O 4OKNA 2IEBA 3OJEA 3F6YA 3H65A 1SEVA 3NV9A 5G0SA 5A9TA 3JYLA 4B4UA 2Q1SA 2Q4EA 4KUHA 3JSAA 3RC9A 3JQAD 3QE3A 1PZHA 4CMHA 1PL6A 2NQTA 3E9MA 2FHSA 1WMBA 2WD7A 3AOGA 5L45A 4D3FA 4IS3A 3H9QA 3PYXA 1YDWA 1YDEA 4WLOA 4BV8A 4U5QA 3O4RA 2JAHA 4HKTA 2NWQA 4RPJA 2RH4A 1SBYA 2VOJA 3MOGA 1U4SA 5L53A 1B3BA 3QQPA 4G81A 2DUUA 1EUDA 1P33A 1YH3A 1VL8A 4WOJA 2FZWA 4ZU3A 4RGBA 2AW5A 1HE4A 5JO9A 4IBOA 5TGDA 1U5AA 3ANLA 4NJMA 3SJUA 4E6PA 3GK3A 3SLKA 1PL7A 3FI9A 1EK6A 1V35A 4KZPA 3C7AA 2JD1A 2WYVA 3PI7A 5A03A 1ZFNA 4WEQA 4FPXA 2X0NA 4GLOA 4LCEA 2O3UA 3GPDG 5B1YA 4N7RA 5A9SA 4A26A 5IJZA 1GPJA 3AU8A 3ZV3A 4CR6A 4BNZA 4UVGA 9LDBA 2PK3A 4NFYA 1PJ4A 2VTEA 1RM5A 1PJTA 3HFSA 3OQBA 1BW9A 2DFDA 1UDBA 2O2SA 1EE2A 1HDZA 4GGOA 4LSWA 3W4IA 5FEUA 2CVOA 1YO6A 2G1UA 4KOAA 2UYYA 3E82A 2BH9A 3QVWA 4E4YA 4IJKA 5J9GA 3LC7O 2DBVO 4BMNA 4WCDA 3U09A 1FDVA 1T2EA 4PLGA 3H9JA 1F14A 4XJSA 1V6AA 3BMQA 3PQFA 2B83A 4BGVA 1YL7A 1KC3A 2FSSA 4NU5A 3IKTA 1GZ3A 4FJ2A 1YB1A 4UUNA 1SCUA 1K2WA 4DA9A 4BNHA 3LK7A 3NGXA 2OP0A 3DBRA 5EINA 4ZHSA 1XELA 4NNJA 4PZDA 4J2OA 4KMSA 1DIBA 4ZQFA 1A9YA 3K8ZA 1BVRA 4S3MA 3DB2A 1KEPA 3JQGB 2NNLD 3WFIA 4J7XA 3EY4A 1ZSYA 3WGHA 1D1TA 3C1OA 3RC7A 3CEAA 3LYLA 5IG2A 2JCYA 1NPDA 4OYRA 5COBA 4D45A 4HFRA 3WJAA 4YJFB 1QMGA 3JQ9A 3GMDA 4DTIA 1YB5A 3AM4A 3ZGYA 3MTJA 2E4AA 5C3MA 4CLRB 3DZJA 4KP7A 1LDYA 1T24A 2Q3EA 4L75A 3DXFA 4CMEA 2VQ3A 3L6OO 2VZ0A 1GTMA 1P1RA 5HRUA 1U3TA 3ORFA 4NG5A 2DTDA 2EP5A 2Q1WA 5TSDA 4CV2A 4WNIA 4FC6A 5ENVA 1M6WA 1DHTA 4XQCA 2BF7A 2WD8A 8ADHA 5CEEA 3OETA 1A27A 2EERA 4IDEA 3ZHYA 2W8ZA 4IXWA 1BXKA 3JD4A 4DQUA 4IDBA 1NXQA 3WGYA 3RKRA 1I30A 4QECA 2X7HA 1CQJA 3FR7A 5BT9A 4FCCA 4GX2A 4RPKA 1ENYA 1O0SA 5BSEA 3JTMA 1U2DA 2J3KA 2P4QA 5F5LA 3U4DA 5DT9A 3PWKA 4PLYA 2Q49A 1GQ2A 1VL6A 1BVUA 3E9NA 3QSGA 1VSVA 1E3WA 3AOEA 5DP2A 3OECA 3QVSA 2HU2A 4RPHA 1K6XA 2ZQYA 1B8VA 4OAQA 2CZCA 1E1NA 1SB8A 4TZTA 2PR2A 1PR9A 3GRKA 5IXYA 4H16A 1KEUA 3TL2A 4WLNA 1RKXA 3RUCA 3F4BA 3A14A 4II2A 2NUAA 3I9NA 2AXQA 4GSKA 4XWYA 3P7MA 1XSEA 4Q39A 5THQA 2WSBA 4Z0HO 2VUTA 1HL3A 3LZ6A 3NDJA 4OH1A 4O63O 2PY6A 1X0VA 3F4LA 1YJ8A 2DM6A 1R4NA 2VWGA 3RIHA 3F47A 3ZWXA 5JXWA 2E48A 1QG6A 4YPOA 2VRBA 1ZEMA 4JJFA 4RQTA 1FXSA 1XKQA 4BQPA 4QQRA 2G76A 3JD0A 4GX5A 4DC1A 3DBHA 4E3ZA 5ITVA 3WMWA 4YRAA 3PDJA 1MUUA 4WOKA 4BNFA 3ZDFA 3WYEA 1HEUA 1VI2A 2EJWA 2BFAA 2BFPA 3GNSA 3RBXA 3SLGA 1LSSA 3A9WA 1WWKA 5JW6A 3H3FA 4RVDA 2H6EA 3RROA 5TT1A 1EDZA 2CDCA 4BKPA 3R3JA 4MO2A 4CM7A 4OXKA 2YHUA 1B26A 2TMGA 3QP9A 1N7GA 3ENNA 2NTNA 2WMDA 5TJ9A 1J0XO 3JD1A 5LDGA 3ZWMA 3TWOA 3CXRA 4ONEA 4PG6A 2F1KA 3CE6A 1LLUA 1MFZA 3I5MA 3GFBA 2EIHA 1VJTA 3RU7A 3RUIA 2X1HA 4Y6RA 4BNVA 2I66A 3BMCA 1GUFA 1UZNA 1WPQA 3HE3A 3PK0A 5FI5A 2YFHA 1Y7TA 1AUPA 3I52A 4J1SA 4MIOA 2Q1TA 4BOYA 3R0IA 3JQ7B 4M87A 2VTDA 3GA0A 3HDYA 5DCUA 4B79A 3U49A 4R1UA 4YCAA 2D2IA 3PEFA 4W7IA 1CETA 3IL2A 3N7UA 5U1PA 3BHMA 4ND2A 2VYNA 5IZ4A 2Z1NA 4Z9FA 5BSFA 4YEDA 4XYGA 1WDMA 3OICA 1ZK4A 4K6FA 4D79A 2EHDA 3DONA 3PRJA 1W8DA 5TS3A 1QLJA 4MVJE 5DNAA 3NEPX 3NRCA 4ZICA 2W98A 3Q3CA 5I9MA 3VTZA 3UFXA 4BO8A 2CF5A 3Q2IA 5MGBA 2E6UX 4BGIA 2ZATA 2B69A 1DC6A 4BNJA 1ZIDA 1PSDA 1Y5RA 4NFHA 4TVOA 1OMOA 2OMEA 5ES3A 1S6YA 5H81A 1XYGA 2NU6A 4NBVA 2QG4A 1T2CA 3KXDA 5KOIA 1EBUA 4KDFA 4YQZA 3V2UA 1HETA 2NVBA 5EN4A 5EQFA 4YAKA 1Q0HA 1PS0A 4Z6KA 5AVOA 3JQ8A 4E0BA 3O8QA 4RVHA 4IZHA 1I33A 4IINA 3V8BA 1DLIA 3Q9UA 4PLZA 4J1NA 4A5OA 1ZMOA 1V3TA 5T73A 1XR3A 1W0CA 5C5IA 2VN8A 1WP4A 1YKFA 2VZ9A 1R37A 3DZBA 4BB6A 4FFMA 2OZPA 1XDWA 3BXXA 3ZWAA 3IJPA 3TZ6A 5T5QA 3I9OA 4CM4B 5G2OA 1YE3A 3P2OA 3R3SA 2CMDA 3IQDB 3RFXA 4ZN6A 2ZJ1A 1Z7BA 4P4LA 1K6IA 2Y0CA 1WLYA 3C7DB 4J4HA 4GSLA 2Q2VA 4IY1A 2JCVA 3HADA 2PKQP 3I9MA 5DULA 5CFZA 4HX5A 4J91A 4YA6A 3CSDA 4M54A 4PLHA 4BL5A 4DMMA 4E5PA 1BWSA 3HN2A 2HJRA 4AJOA 4BO2A 4RJTA 5JSFA 2AG5A 3W4KA 2B35A 4ND5A 2VUUA 3W1VA 1HLDA 3G1TA 1XU7A 2QRLA 5A02A 3OF2A 1NR7A 4CMKA 3ZWPA 1HDXA 1N2SA 1NR1A 1NVTA 2X0JA 5A04A 1B8PA 4BO6A 4ILKA 3ZW8A 3VPGA 2QYTA 1UXHA 3H3JA 3FBGA 4GKBA 3GC6A 1AE1A 5K0ZA 3OA0A 1C1XA 4LSMA 2YHIB 3JQBC 4RLHA 3UN1A 3JYQA 4AVYA 5JCXA 3BTVA 1EVIA 4KQWA 2ZB4A 4CR8A 1Y8QB 1BSVA 4WGGA 4OXYA 4GI2A 1C0KA 2UUPA 3VKVA 4U7WA 2I5PO 1WXDA 3LT1A 2V6FA 2P68A 1N1EA 3EZLA 3PHGA 1H93A 2VYVD 3H2ZA 2PZJA 3PTZA 1U5CA 3OEYA 3JQFC 1NQOA 1Q0QA 1I3KA 4BO1A 3BHIA 3HQ4O 1EQ2A 3ONFA 3F46A 1W73A 4Z0PA 1I2ZA 2PZLA 3M1AA 4IUYA 4WPGA 4I9NA 4U0KA 2ZKLA 3CMMA 4MIYA 2X9GA 5M6DA 1MA0A 4XYLA 4MVJA 2B4RO 1XWFA 2GN9A 2VUSA 5L51A 3DOOA 4FFNA 3X2EA 4GLLA 4QFCA 3WGIA 4AJPA 1BXGA 1GEGA 1P45A 1SNYA 1RYDA 1H2HA 2CFCA 1GY8A 4QO7A 3GAFA 3MJCA 4HFNA 4F3YA 2GPTA 1MG0A 3FWZA 3VPFA 1NFFA 5JPIA 3TDKA 3NTQA 4KUEA 3DZIA 1DDOA 1SMKA 1V3UA 3P5SA 1LLCA 1NX6A 2C7GA 5G4KB 2C2YA 1EUCA 3RC1A 3N74A 4K6CA 3TFQA 4KDEA 3ZNQA 1I36A 4CM8B 5K6AC 4CMGA 4B4OA 1FDTA 4NJOA 4MVJH 3INGA 4W82A 3BAZA 2Z5LA 1Y6JA 4Q3DA 1HKUA 5JAZA 1P0FA 2OO5A 1GYPA 4R54A 4O6VA 1TI7A 2J6IA 1F8GA 4TRJA 2GERA 4J0FA 4TROA 2X5KO 2B36A 1PZFA 5TRTA 1ISFA 4N54A 3PYLA 3TSCA 1A5ZA 1G6KA 1O8CA 2WWRA 4R3NA 5KTKA 1EFLA 5JMWA 3CZRA 3F9IA 3PP8A 4RV9A 3F3SA 1ZK2A 3ASUA 4IDAA 5JLAA 2CVQA 3BMOA 1X1EA 5A05A 1LSOA 2CSUA 1A71A 2WYUA 3KYCA 3SVTA 3SC6A 2V65A 4BNGA 3GZ4A 5BNFA 1GADO 1HE5A 2O3RA 3GVPA 4HP8A 3I3OA 3D7LA 4ZQBA 2PLAA 2HAEA 2C0CA 5TX7A 1HYGA 1LRLA 3PDUA 5G0VA 5HM8A 2FRDA 5AQ1A 3TL3A 1ADGA 1U1IA 3OM9A 3D4NA 3GZNB 1HE2A 3VVBA 1VM6A 4B7XA 2OP1A 4B7UA 1E7WA 5L4LA 3B1KA 1KC1A 5EMHA 4LW8A 2ILTA 2QZZA 4XKJA 3UCEA 2GZ2A 4AL4A 1U9JA 1I0ZA 3WSVA 4NQZA 3ITKA 1Y8RB 2AEJA 1A4IA 3QV1A 1RM3A 3QRWA 5T67A 4ITUA 5AXBA 3LSYA 1UXKA 4GWKA 1VJ0A 1J5PA 1DAPA 1RPNA 1UZLA 3VKUA 4MVJI 3WICA 3D1LA 3COSA 2RCYA 4U0JA 1JAYA 4GKVA 1L1FA 3VZSA 4R69A 2VHXA 3HFGA 1SO8A 2BLLA 3JD3A 1H0KA 3U3XA 1YBVA 4YQYA 3N58A 4L74A 4LRTB 2GN6A 5DBFA 2WYWA 4XR9A 3P2YA 1PJLA 3HZZA 3LDHA 4WLFA 3ZU5A 1KETA 5G4KA 5ADHA 4L76A 1VJ1A 1GYRA 1GCUA 3PHHA 5U4QA 3W8DA 4BMSA 2J3JA 1B0AA 4A7PA 3MJVA 4OM8A 3LLSA 2JD2A 2NU7A 2HMWA 3G1UA 2IZ0A 5DCYA 3RD5A 3IIEA 2ZTUA 4R01A 1Z75A 1DC4A 4AG3A 1JDJA 2X5JO 4RF5A 2O3QA 2C29D 5JY1A 4RVSA 2GF2A 3DAPA 1UR5A 2DBZA 4CUZA 5CPFA 2CD9A 5GMOA 3VC7A 5IDWA 3KUXA 1LBEA 2R00C 1YQGA 2OORA 3AUAA 5IXSA 4UVEA 1E3JA 4INAA 4JIGA 1SEPA 4WCFB 1B7GO 5CP8A 4GGPA 1KVRA 4QXMA 5ICSA 2EG9A 2Q45A 1JKIA 4N5NA 5B37A 3QJ5A 4CLHA 2EW8A 1GAEO 3MJEA 1PGQA 4OGWA 5ITWA 3GNTA 5BNTA 4ZA2A 5KJ1A 5DBIA 4LMPA 1I01A 4BKQA 3WGQA 3Q0EA 4JGBA 4TWRA 1VPDA 2JKVA 4ALNA 2JHFA 3SJ7A 5A9RA 1H9BA 4BNYA 3AY3A 3NGLA 3ZWBA 1UP7A 4E21A 4ZRMA 4C7KA 2NU9A 2J5KA 2GYYA 3ADPA 1CF2O 1HDGO 2O4UX 4NZ9A 4DWVA 5T57A 3FNGA 3VOSA 1YQDA 3JYPA 5DOVA 2HMTA 4D46A 4RVUA 3DBLA 3JQAB 4OO3A 5I7VA 3CKYA 5BNIA 1MXFA 2HK7A 4E32A 4E30A 1YBAA 1IUKA 5A1TA 2C54A 4CL8A 3ZU4A 4YT5A 4JXKA 1F8FA 4FGSA 4RLSA 4D44A 3NDRA 4B7CA 1T2DA 3UHAA 2RH8A 1PX0A 3T7EA 4JROA 4IMRA 1ZK3A 3KVOA 3BMQB 4CMBA 1Y1PA 2I9PA 3LC2O 3H5RA 4JQCA 5JDCA 5CDYA 4YJDA 2J5QA 3QWBA 3R1IA 4O59O 2YV2A 1WAMA 2J3HA 2IXBA 2VYVA 4LGVA 4MINA 1CQIA 1YS4A 2VWQA 3LU1A 2ZJ0A 1LTHR 3F5QA 4LVCA 4IJUA 4KTTE 3M1LA 4DC0A 4DIFA 4PG4A 4CLOB 3MTGA 1R4MA 4BKUA 1L7EA 3FRJA 1MGOA 3H4VA 4N18A 5JAMA 1GD1O 1HYEA 3SBOA 2NTVA 4Q3EA 3NTOA 3CUKA 1DRUA 3UICA 5JCJD 3BA1A 4MJLA 1HE3A 2OBYA 5A06A 4I8XA 1HT0A 4JK3A 3AI2A 4PZCA 1BRMA 1DFHA 1MV8A 4EDFA 3KO8A 1QR6A 1N7HA 1DIRA 3C7CB 1NWCA 3TN7A 4YAJA 2W90A 4XEHA 1P3DA 3L6DA 2IRWA 4CV3A 1R0SA 1M75A 1G0NA 4HNHA 4W99A 2DBRA 3ETEA 3NJ8A 1JVBA 4U6SA 4IDDA 5IZCC 4CUKA 5L4NA 2UVDA 2YQ4A 4M55A 1KY5A 1IYZA 4AJLA 1HDOA 2CNBA 3PJEA 4QEDA 3ZWYA 2QZ9A 3VZQA 1N92A 2DUWA 1BW9B 1P1KA 1M66A 1OFGA 2P5YA 2Z1MA 3ST7A 1GL3A 3KOUA 1VRWA 1DJNA 5L7TA 3UOGA 4JBHA 2JFHA 3WFJA 4NIMA 4NBUA 2DT5A 1I2CA 3RASA 1Y5MA 2JFGA 3RBZA 4OSOA 4XQ9A 4A10A 1PZEA 4PVCA 4B3IA 1ARZA 4JLWA 2PV7A 3JQ7A 3RBVA 5DP1A 4Y8VA 4J9UE 5IDXA 5HS4A 3AM3A 3H9GA 3O38A 3MJSA 3E5RA 1LU9A 1O94A 4OXNA 4CM8A 1D3AA 4A0SA 4EUHA 2HLPA 5IDQA 2AHRA 3WB9A 4BKRA 4YXFA 2Q99A 4XCVA 1ZO8A 1YOVA 3RUEA 1ADCA 1ONNA 3WGZA 1KERA 4OJNA 3PVZA 3QA9A 2YYYA 2ZIZA 4M86A 4UEJA 4XA8A 3WYCA 1KVUA 5KIAA 2NVUA 1V3VA 5AOVA 3WG9A 1U28A 1XLTA 2AE2A 4UVIA 9LDTA 3OHSX 1PL8A 1XG5A 5L9AA 1SAYA 2PA3A 1DIHA 2O7SA 5L7WA 1R4MB 2PH3A 1PZGA 2O48X 3OMLA 3FN4A 4ALKA 1A7AA 1ONOA 4EJMA 1DLJA 4NR0A 2H5LA 2OHXA 3IUPA 2FPPA 3L07A 1E3EA 4QO8A 3M2TA 4UAGA 1X15A 1I3NA 4MVJM 2AQHA 2BFOA 3LC1O 4PIVA 3ULKA 4PLFA 4MVJD 2AQIA 4P8RA 3JQEA 1NM5A 4LRSB 5KVCA 2O2YA 2BD0A 4UVHA 7ADHA 3DBHB 1BMDA 1ZW1A 1YJQA 3DZKA 1XQ6A 2QYSA 2ZB8A 1H6BA 4XDZA 4EEXA 3MOIA 1R4NB 3HN7A 1LQTA 2PTGA 2X9NA 4OKIA 5J23A 2Q2QA 3OQ6A 1PJSA 2FPIA 4YR9A 1B15A 1DEHA 5DF1A 1H2BA 3SC4A 3KRTA 1X7GA 4ALMA 3DBLB 3JV7A 4Z9YA 2VWPA 1R15A 4BO5A 1E3SA 4QT0A 4I08A 4YBZA 1IZ0A 4JN6B 1KEVA 1X14A 1X13A 2ZK7A 5IF3A 1GZ6A 2D5CA 5CG2A 5AYVA 3AUTA 1P1JA 3KYBA 2BGKA 4YT8A 4ND4A 1Q2XA 3QY9A 1KEWA 2ZCUA 3FNEA 1IL0A 2XOXA 4AJNA 1OC2A 5A3JA 3FWNA 2B4QA 4JP3A 4YAEA 1QSGA 4CMJA 3GLQA 4AJIA 4DLBA 1P0CA 1DAOA 3AUSA 1IB6A 2I65A 3KB6A 3QWFA 4G5HA 4ID9A 1ZUD1 3E6AA 1FMCA 5TJHA 5B4UA 4M49A 4DL9A 1PWZA 4GX1A 4J0EA 2BELA 2NADA 4BNUA 2EEZA 4BQRA 2CDAA 4XGIA 1VE9A 1K3TA 4LCJA 2H9IA 4CUJA 1MXHA 3GVHA 3U0BA 3PHJA 3RUFA 1HDRA 3L0DA 5I9LA 1O6ZA 1HLPA 2HK9A 3PXXA 2W4QA 2X6TA 3EHEA 3PZBA 1EEHA 1ISGA 1PWXA 4IDCA 3IC5A 3QVOA 3V1TC 3VDQA 2I3AA 3L9WA 3NUGA 5GY7A 4BNLA 4BNIA 2GN4A 1YB4A 4ALIA 4LK3A 3ADOA 4LMRA 2GLXA 2TMDA 4YVFA 4AJEA 2VNSA 1E7SA 3ZU2A 3G17A 1TA4A 5GZ3A 2NLOA 3QIVA 4J43A 4B8WA 2GGSA 1G0OA 2I3GA 2NVWA 2FR1A 2Y1EA 3RUAA 4BV9A 3WBBA 1WDKA 2DQ4A 3HSKA 4PGFA 4R9SA 4L73A 2I6TA 1D4FA 4J1TA 4PG5A 2VHWA 1WZIA 2EKLA 2V6MA 1P1IA 1AHIA 4O1MA 2WDZA 4D3DA 4RVFA 4ZRNA 4L4XA 2Q46A 2AQKA 2Y1CA 4MVJF 3DFZA 3BZUA 3V1UA 4W9NA 3JQDA 1LRKA 1YRLA 2QHXA 3IMFA 1DOHA 4NBWA 3SXPA 3DBVO 3RSHA 1X7HA 2Y1OA 4BO3A 2UDPA 4W7HA 2CY0A 4GPD1 1NYTA 2ZTMA 4R4JA 2FZEA 2Q50A 3TOZA 4OOEA 3P19A 3AFNA 1NVMB 1KY4A 2FR0A 1ISHA 1ZBQA 4IJVA 3ZWCA 5FWNA 1A9ZA 2BMAA 3DHYA 4JX8A 3EC7A 1UDAA 1LDNA 3GZNA 1AXGA 2XPCA 5ENDA 4B4VA 3V2GA 2NU8A 3L4BA 4YAGA 2HSDA 5AXDA 5C7IO 3KBOA 3OEWA 1IHYA 3BMCB 2PKRA 1UDCA 3L77A 3DTYA 1GV0A 4PN3A 1H94A 5JFOA 5CDUA 3VZRA 4PLPA 1WZEA 3GDFA 3Q2KA 2PZKA 5H83A 1P1FA 4YRBA 3KYCB 3NYWA 4MP6A 1YGYA 3K9QO 1MX3A 1TEHA 5A9SB 1MC5A 3BMOB 3GH3A 3ZNPA 2C2XA 2RHRA 3C24A 4GMFA 4FW8A 3HDHA 5EPOA 1FF9A 5L3ZA 3T4XA 4A27A 4F45A 3ENKA 1JWBB 3GVXA 5JBIA 5DCWA 3D0OA 4NJMB 4CM3A 5CG1A 1OBFO 1V8BA 4E5KA 2HKIA 3ETGA 1M6HA 3WLFA 4GH5A 3NJ4A 3EZYA 3FHLA 3K2BA 1VL0A 1XHLA 1PQWA 5C7LO 1UUFA 5ER6A 4N5LA 1LQUA 2ZTVA 4HBGA 2Y68A 3G49A 4RF4A 3DWFA 4OQYA 3K31A 1GU7A 2PNFA 3HDJA 3HUDA 1JVSA 3IJRA 3CINA 2PFGA 1Q7BA 1SC6A 3BTOA 2BGMA 1Y9AA 2D4AA 3FR8A 4D42A 2Q1UA 3ETDA 3QVXA 4EUEA 2P9GA 3I23A 1BXGB 1ZMTA 3PIIA 5B4TA 4DBVO 2A35A 3E03A 4TQGA 4FFLA 5T8KA 2H63A 1U3UA 2E82A 4UREA 1OI7A 5T8KC 3GDGA 3ZWNA 1ULUA 1QP8A 3NT2A 3WNVA 5JCJA 1PGJA 2FOIA 4FIZA 3GPIA 4UVDA 3AW9A 3K5PA 4CLEA 5KKCA 4IMPA 4B3JA 5HWSA 2WE8A 3ZHZA 3PWZA 3O03A 4JJGA 2POQX 5L40A 1N8KA 5COQA 2XXJA 2OGUA 3GG2A 2GUGA 2VRCA 4R51A 1VSUA 1OOEA 2FN7A 2GR9A 2P9CA 1GPDG 3GN2A 1DBVO 1DC5A 3ROMA 2RBEA 2YUTA 3GQVA 3OSUA 4QTZA 3S2FA 4IDFA 4BO9A 3L4SO 3ZV5A 4D43A 2HDHA 2GN8A 1T26A 2YHIA 3F1KA 1DC3A 4DYDA 1T1RA 3V2HA 4IQGA 4Y67A 4DMLA 3M2PA 4G65A 4M8SA 2DAPA 4E5NA 3F5SA 4H7PA 5GZ6A 2YQ5A 3GR6A 1NPTO 3FF4A 3RJ5A 3JD2A 4YAIA 1HXHA 2I76A 3FTNA 4M89A 2X86A 4CODB 1I3MA 1MC4A 4FFOA 4XIYA 2R6JA 3D3WA 1NBOA 1D8AA 2VHVA 4W9NC 3WR5A 4FS3A 1VKOA 4WUVA 3DO5A 4R5MA 5BQFA 4XZ3A 2DTEA 2PD6A 3ZN2A 3I9KA 6LDHA 3GEMA 3HHPA 1N5DA 3QWIA 1EZ4A 4MDHA 1DFIA 2A92A 4IPTA 4HWKA 3DAFA 1T25A 3H8VA 1ID1A 1ENZA 3TZKA 1IOLA 5GZ1A 4F6CA 1X0XA 3GF4A 4DPMA 1T4DA 1C1XB 3I6QA 2EV9A 2X0RA 3NX4A 1NPYA 1NQTA 4TZKA 4RF2A 3I83A 1NAIA 3PJFA 5K9ZA 3EMKA 4Z9XA 1ZK1A 2GZ3A 2D5AA 4YT2A 4PLTA 3NT4A 4UEKA 2JHGA 1J49A 1TT5A 2Q4BA 2HQ1A 1BDBA 1HYHA 3KM0A 4IQ8A 4CV0A 1ZSVA 1KVSA 3OIFA 5KKAA 3VVCA 3HDQA 3TZQA 1D7OA 1FK8A 1P44A 5TF4A 3IP3A 1H9AA 4NDNE 2GZ1A 1YL5A 4BHTA 2CDBA 4NI5A 3Q11A 1XA0A 4ZGWA 1JLLA 3IP1A 3S8MA 4PRLA 2VZ8A 2PGJA 4Y98A 5KNLA 4J16A 3O8QB 5U9CA 4BNNA 1LJ8A 1HTBA 2ZB7A 3PPIA 1U4OA 3D3WB 1KOLA 2IZZA 3S2EA 1PJQA 4GAEA 1FDWA 3C85A 1PQUA 2AQ8A 5I7SA 2D3TA 4MVJG 3A28A 1E6UA 1F12A 1LXCA 1H6CA 1Z82A 1Q1NA 4DREA 1Z7EA 3HB5X 5G4LA 5IFLA 3K6JA 3ZNOA 4EUFA 1CJCA 4XR4A 3AOEC 2VHZA 2Z95A 1T1SA 3GOHA 3TZHA 3CIFA 5TIIA 2Q22A 1U8XX 1QRRA 1GR0A 2P91A 2NVUB 5TC4A 1HZZA 5JO0A 3AY6A 3DMTC 1HDYA 3GEGA 3DHEA 1GQYA 1C3VA 4MP8A 4YDRA 5TQVA 3WMXA 4BO0A 1YOVB 5KCZA 3W6ZA 1G1AA 2G5CA 2HRBA 3IAHA 2O3SA 4J7CA 2XF8A 2EWMA 1QKIA 4FSHA 2P5UA 3DEYX 1LX6A 4J90A 1ADFA 3I4CA 2R00A 5F5NA 3CPSA 4R1SA 4YTEA 3GGPA 4TKMA 4A03A 1TLTA 1NAHA 5I7EA 5EJ2A 4O0LA 4YB8A 2QX7A 3GVIA 2O50A 1Z45A 4M1QA 3X2FA 2W2KA 3JQFA 3PJGA 3WYBA 3RVDA 5HBRA 2GRAA 3ANMA 4R68A 5CEFA 2UV8A 1KYQA 3DQPA 5ILGA 4DIOA 4H3VA 1BXZA 5AXAA 4IS2A 3LT2A 1O95A 1ISJA 1HSOA 3ZV4A 5ILOA 4BO7A 1KVQA 4RPLA 2X4GA 2IZ1A 1LEHA 4QFDA 2ZQZA 3MCVA 1IULA 4FBGA 4ZD6A 3UKOA 2EF1A 4EEZA 1UXJA 1UZMA 4CMCA 4DYVA 4FQ8A 2G82A 3UXYA 4D3SA 3CTMA 1ZCJA 1PJCA 5F3RA 3UGKA 4DLLA 1GV1A 2UUOA 2YJZA 2BI8A 5A5EA 1RJWA 1T2FA 2PH5A 4YJGA 4GL4A 3OJOA 1TB4A 3AK4A 3PLNA 4KWHA 5G0UA 1ZZEA 2IEDA 2BGLA 3DAGA 4AJ4A 3PFFA 3EVTA 3H6KA 3K30A 3VHRA 4Z0TA 1JU9A 1Y81A 2DKNA 2NV6A 3PZRA 4OIMA 1Q7GA 4CM9D 2VNAA 4AJKA 4XYBA 4J6FA 5MDHA 2YDYA 2RAFA 1ULSA 3RI3A 2NTJA 3DL2A 4BMVA 3UVEA 1E7QA 2X0IA 3ZWVA 2Y99A 3DZGA 3OJ0A 1TXGA 1AXEA 4R41A 4NK4A 2C5AA 4OMUA 2ZYAA 3ON5A 3VPXA 4CPDA 3VAZA 5LDHA 1K5HA 3D64A 4WASA 3RAJA 2FMUA 4E2XA 1JTVA 2EW2A 1R0LA 4CLOA 2PD4A 5KWEA 1I24A 4BNTA 3WLEA 1M67A 1QYXA 1B3RA 5CAEA 5JDIA 1U8FO 3ZWWA 4CMIB 4WNCA 3BTSA 3I4FA 1IZ9A 5KJFA 3L9XA 5DOZA 3TFOA 4J2HA 2NSDA 4BVAA 4J7UA 4R16A 4RVGA 4BNXA 1YONA 3EAGA 4R3WA 4DQXA 3LF1A 5IAAA 2RIRA 1VKNA 2D59A 1E3IA 3JCZA 4YACA 3A4VA 3FSRA 1ORRA 1Q7CA 2OL4A 1IHXA 2VT3A 1Z74A 3ZCXA 1P1HA 1KS9A 3ICPA 4EZBA 5JDIC 3KZVA 4FJ0A 2V7PA 3AUUA 3WGOA 2PWZA 1PS9A 1MFPA 4IGFA 1LDEA 1PS8A 2FY8A 3PGXA 3JQCA 5HTOA 3AWDA 2NQ8A 1LC3A 4RDHA 1KIFA 4ND3A 4RQUA 4L8VA 4D0SA 4Z3DA 1E1MA 4CQLA 4Y6PA 1JKJA 3D4OA 1RWBA 3TRIA 4D0RA 2IODA 1YVEI 3K2EA 4UEOA 1KBZA 1ZJYA 2BRUA 1UAGA 4DBZA 2P4HX 4Q3NA 4W4TA 1OC4A 2CVZA 4UULA 3U9LA 1DIGA 1U2GA 3ZU3A 4CQMB 4Y6SA 5KJCA 1MLDA 1E3WB 4TKLA 4QX6A 3WGGA 5JS6A 3UF0A 5CDSA 3KEQA 3AU9A 5DDIP 4IIVA 4ZQEA 4XDYA 2O4CA 4J49A 1V0JA 1E0DA 2PZMA 2JAPA 2V6BA 2GCGA 2XXBA 1HZJA 1CRWG 2HUNA 2J8ZA 2Y67A 2F00A 5FYDA 4AICA 4RL6A 1E77A 5BR7A 4FOOA 3EUWA 1QV6A 3GGGA 4CQLB 2DLDA 3S1LA 5EESA 3E1KA 1LUAA 3ONEA 2HMVA 1NTOA 1H6DA 3JYOA 1F06A 3D4PA 1GDHA 2D8AA 4Q3BA 3ZHBA 4CLDA 4DPLA 3OQ1A 4KUGA 4CL3A 1EMDA 3ROPA 4YT4A 3IDSA 5CEJA 3DBRB 4GMGA 4AFNA 4MPDA 3ROKA 4IQ0A 1LDGA 4AJ1A 1LDMA 3HNPA 2BFMA 1BDMA 2ZYGA 1O9BA 3TNLA 5I8WA 5EQDA 3BTUA 1JAXA 3PYMA 1I10A 1EQUA 3DC2A 3LQFA 3GNQA 3SEFA 3NTRA 1D1SA 4ZJUA 4CLRA 3WTBA 5ER9A 2C07A 2VCYA 4FR5A 4XYMA 4DPKA 1M2WA 1A4UA 4YJFA 3RQSA 4CMIA 2YZ7A 3KLPX 1TVEA 2AEFA 4I5FA 3S2GA 5JYDA 3DR3A 3O9ZA 2FWMX 5HS6A 3E5MA 3RUDA 1UP6A 5JAQA 3AM5A 3JQGA 2DC1A 4GBJA 4IGEA 5H82A 1ENOA 2NM0A 3JYNA 1CEQA 1FDUA 4ALJA 4CM1A 3DDNA 3C8MA 4PLCA 5K6AA 3Q6IA 3LVFO 5DN9A 4JCOA 3U5TA 4WLUA 1IPFA 3PIDA 2C82A 4W6ZA 4GQAA 1Z73A 4MOWA 5JY6A 4K26A 1B2LA 1HRDA 1PJ3A 1YXMA 3SX2A 2LDXA 3RWBA 3KYDB 4FDAA 5FF9A 4U6QA 5AXCA 2PD3A 1V9LA 4CM9A 2D0IA 3VH2A 1GYQA 3PWSA 1E7RA 5LC1A 3VPHA 3WNQA 1B14A 3G79A 3B6ZA 3BYZA 3FNHA 4RORA 3EDMA 3FTPA 1XEAA 4CMAA 2QW8A 5I9NA 5L95A 4N5MA 1DFGA 3KHUA 3B1JA 1EUZA 2B5VA 5KVSA 1EFKA 3GUCA 1EVYA 3GY0A 2WD7B 1GUZA 2EJVA 4YJHA 1EVJA 2YV1A 1PJBA 3MEQA 4Q3CA 4HXYA 2JD0A 5FI3A 1NNUA 3WWZA 1R16A 1C0PA 3DTTA 2ET6A 1GFSA 5CPBA 4L4RA 4K28A 4CMEC 4XJTA 2Q2WA 2UAGA 6ADHA 4CLXA 3PHIA 2AMFA 3W6UA 4DUPA 3UH1A 3AY7A 1DRVA 1BG6A 1I2BA 1LI4A 1S7CA 1A7KA 4RZHA 4YJGB 4I9HA 1E3LA 5JYAA 1ISMA 3V1YA 1XGKA 4MKZA 2DVMA 3H5AA 4WK6A 4II3A 1FDSA 4XYEA 2VHYA 1PIWA 5THKA 1LNQA 2X9VA 1UXGA 5I7FA 4P38A 2H1SA 4PRKA 3E9QA 2X8LA 3K96A 3VH3A 3GN1A 5TNXA 2PGLA 4MP3A 1U7HA 4YJHB 5JE8A 4BB5A 5T64A 5B4VA 3WS7A 1LRJA 1JWAB 1SPXA 4TSKA 1LLQA 1LC0A 1YWGO 1M76A 4A2CA 3NKLA 2HJSA 2AA3A 2JL1A 3OIGA 4AJJA 4FD3A 4IM7A 4QSMA 2E37A 1WW8A 4S1VA 3IS3A 2CF6A 4E12A 2VRCD 1E7MA 1E1KA 3VTFA 3QWHA 1O89A 4OL9A 4HY3A 1UJMA 2HK8A 4E5YA 1WDLA 5IN5A 3L6EA 1JA9A 1F17A 2ZCVA 4FJ1A 1N1GA 1N9GB 1ZXLA 5JYEA 4XGNA 1UP4A 4E13A 4EYEA 4WJZA 1Y8QA 2R2GA 3HB4X 5TT0A 1J6UA 2AEMA 1E92A 1PTJA 2JFFA 5KVQA 5JMPA 4D7AA 3FBTA 3KEOA 3U4HA 1ENPA 2YY7A 3GFGA 1NFQA 1XU9A 2V6GA 3CH6A 2O3JA 3C3XA 4IZIA 4DLAA 8LDHA 3H9UA 4DGSA 4E2YA 4GX0A 7MDHA 3TQHA 2A94A 1T2AA 3PHLA 3MWEB 4OQZA 3NAQA 4WLEA 3T4EA 1JKFA 4U8GA 1RM0A 2HMSA 1DIAA 4WKGA 3OA2A 3GMSA 4NHEA 4ND1A 1QYDA 1K6JA 2B0JA 1LA2A 1PGPA 4BKOA 3UCXA 4TRMA 3L4BC 3RU9A 3TPCA 3BMNB 4KTVE 4HUJA 3VPSA 4AJHA 2NACA 4Q3AA 2OBNA 1H5QA 2QQ5A 2WEKA 2OUIA 3TOXA 1K89A 3KSDO 4P4NA 1YBMA 4IJWA 5F1KA 3FNFA 3WIEA 2WM3A 3GT0A 2O3TA 3ZNNA 3H5NA 4L0QA 3JQAA 3FPCA 4JJIA 4C7JA 3ZW9A 4I1IA 3CMCO 1Z6ZA 4EI2A 4YRDA 4NBRA 2HO5A 5COAA 1I8TA 3GRPA 4H15A 5JAIA 4KQXA 3KV3O 2Y0DA 4CM4A 2YV3A 4Q9NA 2VT2A 5A5FA 3UW3A 4PCVA 3OFSA 4HADA 4CM5A 3UUWA 3STHA 2X58A 1PR3A 3HWRA 1T4BA 1P9LA 1HF3A 1ZK0A 2OFPA 4HFMA 4UUPA 2I67A 4LISA 2HCTA 2AE1A 4J3FA 3C1AA 1PGOA 4MKXA 3WBFA 1R66A 4WEOA 3ZWOA 1E1LA 1BHSA 1IPEA 1ZKMA 3INTA 4NH4A 4CQMA 5T6BA 5EIOA 3KETA 4E2WA 3RFVA 1I32A 5DBGA 1SOWA 4KWIA 2AG8A 2XAAA 1PQPA 3BHJA 3B20A 1R12A 4WCFA 4FGWA 1C1DB 2Y1FA 1F0YA 4WCFC 1MB4A 1U3WA 1LSJA 3NT5A 4YWJA 1KVTA 3E8XA 1EE9A 4XRRA 4RO0A 1U7TA 1NHWA 1WVGA 3DHNA 3H9EO 4ESOA 1RM4A 2E49A 3ONDA 2C5EA 2Y05A 1SZJG 2FP4A 3D5QA 4WE3A 3QVTA 3GEDA 1QORA 3TJRA 4XB2A 1ML3A 3F1LA 4UUMA 1AN9A 3AFMA 4I5GA 2B5WA 2DU8A 3H7AA 4E33A 1YL6A 3WDSA 3JQ9C 2DTXA 5F1PA 2EP7A 3EW7A 4RDIA 2WTBA 3QWAA 2J5RA 3D3EA 4NMHA 2DPGA 4PLWA 4WECA 1NVGA 5F1OA 2W2LD 4YYZA 2IYPA 1TT7A 5G0WA 1JN0A 4CM6A 1NP3A 3VH4A 3MWDB 3WXBA 3A1NA 4X54A 3U62A 1WNTA 1SB9A 3UCFA 2Y66A 3ANNA 5B12A 5ICMA 3OP4A 4PFJA 3AI1A 3GHHA 1DO8A 2C20A 1PEDA 2IYOA 1NFRA 5F21A 3OJLA 3RJ9A 4BGEA 4EJ0A 1QXSA 1QV7A 1ZSNA 1E6EA 3TZCA 2P9EA 3WQQA 4A73A 4FB5A 3ITDA 4QUKA 3WIDA 3U4IA 2ZTLA 3WX0A 1OAAA 3T7CA 5BSGA 2ZYDA 4MKRA 3QW2A 4NFSA 4Y9DA 1CIVA 3OBBA 4XQGA 5HA5A 4BGUA 5JC8A 5JC1A 3MJ4A 1W6UA 1I5RA 3PJDA 4JP2A 2EGGA 4HNGA 4XB1A 1DPGA 1CYDA 1EK5A 3W4JA 1SOVA 3FCOA 5A4DA 1Y8RA 2VOEA 2O23A 4J1QA 3PLRA 1GEEA 1QLHA 4B3HA 4PZEA 1UH5A 1UAYA 2A9FA 3ZHXA 3DOCA 3H2SA 3KSUA 1GUYA 1AHHA 3GHYA 3INRA 1DXYA 2C7VA 4BS9A 2QIOA 1LDBA 1BTOA 2C59A 4J4TA 4DQVA 3RCBA 3Q1LA 3KYDA 1PJ2A 4UUOA 5KJEA 3W8EA 1NASA 1XCBA 1ZJZA 3UAGA 4TMFA 5IDYA 3I9JA 4E31A 4OHUA 5IN4A 4R1NA 3I1JA 4MIEA 3WJ7A 1LSUA 1XQ1A 1IY8A 3M6IA 2O7QA 1EDOA 1VC2A 1JQBA 4G2NA 4R1TA 3GVCA 3DFUA 4ROSA 1EBFA 3S2IA 2DBQA 4P4GA 4PVDA 5JDCC 1DRWA 2I99A 2GASA 2GD1O 3DMYA 1HDCA 1WMAA 3KTDA 4I5EA 4E5MA 1HSZA 4GVLA 4I5DA 4IXTA 5FFFA 4DXHA 1UXIA 4FN4A 1RYEA 3R6DA 1ZXBA 4FOSA 4ZQHA 4CJXA 5CDTA 5L7YA 2YDXA 2QRJA 1C1DA 1E5QA 3DMTA 3WQRA 2G0TA 3LT4A 5JYFA 2W2KB 4IDGA 3PFWO 4URFA 2OOSA 2W2LA 4AJ2A 2BKAA 1DSSG 4RPGA 3B70A 3ZV6A 3K92A 4LVUA 3GDOA 4B8ZA 3DZHA 4F46A 2D1YA 3WGTA 2ZB3A 3EYWA 3JQBA 1ADBA 4FC7A 2GSDA 4XQEA 2GO1A 3PGJA 4P22A 2X5OA 2J3IA 4FFPA 4J9VA 1J4AA 1NQ5A 4JBIA 2FPGA 2JCXA 3HG7A 4NK5A 4L4SA 4BIIA 4NU6A 2CUKA 3PQEA 4J4BA 3RKUA 3ZZNA 4HV4A 3KLMX 2VWHA 4NPCA 4L9RA 2IXAA 3B1FA 4ZQGA 4BO4A 1ZVMA 3MZ0A 3WSWA 4E2ZA 5CHEA 3G0OA 1E6WA 4JNKA 5BSHA 4D41A 4RZIA 5A3VA 1R0KA 3MJTA 1DJQA 1QYWA 4EJ6A 3HJAA 1P74A 2EKPA 4RF3A 3ZI0A 3VDRA 4PLVA 5C37A 4ALLA 4XGKA 3EK2A 3FD8A 1W4ZA 4GWGA 1YQXA 4O5OA 4BNMA 4TVBA 3LT0A 4I9UA 3AI3A 3WTCA 4HFJA 4GVXA 1MG5A 3LF2A 3OJFA 4XX0A 1E7YA 4DIBA 1B16A 1O5IA 2JJYA 3BMNA 3E48A 1Y9EA 4BNKA 2SCUA 3ZH2A 1DHRA 1NQAO 1OZAA 1ZH8A 5I8ZA 1Q0LA 4DRYA 4EGFA 2X22A 5KJ6A 5EL0A 1A72A 2BHLA 3I9LA 3VZPA 2X23A 4BUCA 2LDBA 3LLVA 1L7DA 4TRRA 1AGNA 1C14A 3IOYA 1ONPA 2IE0A 2P2SA 1TT5B 2VYND 4EW6A 5DZSA 3A06A 4R9RA 5JNLA 5C7OO 3IUSA 3WOHA 3PQDA 2FR8A 4OSPA 3RC2A 2HMUA 2HRZA 1JW9B 3QHAA 1U3VA 2EXXA 3ROQA 3NDIA 3U4CA 3C1TA 1FJHA 2YW9A 4C4OA 3AJRA 1E5LA 4TRNA 4BNWA
chains in the Genus database with same CATH superfamily
3D3NA 4CCYA 3AP2A 3PR2B 5HIIA 2JLRA 4NESA 2FQ1A 1ZCBA 2YWCA 5I4BA 3A9VA 4FSXA 1GPMA 5BWBA 2QDKA 2BHTA 1CDOA 3F98A 4HBZA 3I6IA 3OPYB 4EITA 3WAJA 2FEAA 3I32A 1T5BA 4C3UA 2QRKA 4NRDA 1IRXA 1L4EA 1GUAA 4DG8A 2EKQA 3HPQA 3IKMB 2AJTA 2J87A 1S2NA 1GLVA 3OM0A 4Y2VA 2TSYB 4M1MA 1I3LA 2B37A 2W6ZA 4S1TA 4HS9A 2Y1GA 2XCOA 5ENZA 5H3LA 1ULTA 4XIJA 4Z3KA 1LPMA 1RKVA 2DZDA 3CUEF 2EGHA 1XQVA 3U16A 2ON6A 2R1TA 1GQQA 2JI9A 1E2IA 2P9ZA 4FFRA 1Z07A 4WLVA 4XCXA 1FFEA 4BZXA 2WF5A 2R6ZA 2WJPA 3AVYA 2VF5X 4PG8A 2YUIA 3GGOA 3HU5A 3TWOA 5LIRA 3C3CA 4TMXA 2F59A 2E5LB 1DB3A 1ZOOA 3P71T 3LJKA 3PL1A 4OAOA 3RTAA 4V03A 2P9JA 3VNUA 1CY7A 3IUMA 1CFJA 2IDZA 4G5QA 1J8MF 1SXJB 1ISIA 3ABIA 2I2WA 2XOKA 3B38A 4HQKA 2ZS9A 1NHGA 2UYQA 2Y0EA 2W43A 3OH8A 3ZCQA 3J7TA 1RXYA 2QVCA 3JY6A 1M0WA 1NBAA 2HWWA 3GD7A 3QKUA 5ALQA 2OXIA 3UJBA 3KPYA 4DIMA 3OZXA 4EBFA 1J39A 2A4KA 2BE9A 3IKVA 2FJUA 1E2EA 4D2IA 4LHYA 1Y3DE 2G3YA 1JQLB 4Q7KA 4CQMD 2VLIA 3NNSA 3EMBA 3STTA 3WV4A 5DLDA 5AMXA 4P4SA 4KIWA 3JW8A 4Q16A 3E18A 3LRPA 4YMIA 1ABBA 1U99A 3R7WA 5KVVA 1X39A 2PZAA 3ZXYA 2BFFA 3IHLA 3V5NA 1XTZA 4FVTA 3SEZA 3CLKA 1JDUA 2PGDA 3EGOA 2PKQO 3G8CA 2DFVA 5EP1A 3BZBA 3DZFA 2QV7A 3L7LA 2GYUA 3NHZA 1RXSA 1BE6A 1ZVKA 3TBFA 1YHYA 4ABYA 1TJ5A 3HLYA 5EHZA 1X1AA 5C51B 2FE1A 3K09C 4NX2A 4EAAA 3QBDA 3TTUA 2PS0A 3FPGA 1BYUA 3OJEA 1QOPB 3EG9A 2H59A 1QRSA 4B4UA 2HMAA 1RADA 1FJ2A 2Q4EA 3D7RA 4KUHA 3A1FA 1N8NA 3I64A 4HAUA 4IIJA 3E9MA 1IM5A 3V32A 2OSVA 2WD7A 3AOGA 5L45A 2QAGB 4QLAA 1NUHA 3NV7A 2RE8A 2B99A 3M5CA 3W3AA 2YRFA 1NJ6A 2B8JA 1YDEA 2ORVA 3JZAA 1H5UA 2EFYA 1A9XB 3EXHB 3K9BA 1P2SA 2JAHA 4IV8A 1AC5A 1VXOA 4RPJA 1V4NA 5ALEA 2RH4A 4TT3D 4F6RA 1P7ZA 2ZXUA 3GB9A 5K6TA 2Q7XA 1KK3A 1YV9A 2XQJA 2OR3A 2J3QA 5DHAA 2J31A 5CCBA 5L53A 1B3BA 4X24A 5J40A 1NQXA 5KC8A 2DUUA 1EUDA 1T1IA 1TCAA 1VL8A 1ZN2A 2LR0A 3HJUA 2PWBA 3H0EA 3R23A 4LXHA 1XPUA 1HE4A 2C9OA 1RWWA 4XGQA 4CRWB 1SKMA 1I7BB 2UZIR 1KFKB 2ZJZA 3ZYZA 3FI9A 3C39A 3DZ3B 1EK6A 2NQ2C 2RSLA 1QVVA 3C7AA 5AK4A 4B2LA 2WYVA 4Y1EA 4QQ8A 2WJZB 5G1OA 3PXGA 4G09A 4KB5A 3BL6A 1G64A 3GPDG 1THZA 2O3UA 1GILA 3M4JA 4J07A 3I2YX 2ZJFA 3ZV3A 2QM8A 4BNZA 2ONCA 3I6BA 4UVGA 3IT2A 4KPEC 5JWRA 1RM5A 4M0DA 4OXIA 3OQBA 5LP1A 1LBHA 3V4SA 1XZEA 1BQ3A 2OPBA 4XIGS 3SPXA 2GEBA 2H54A 1A2OA 2XGMA 3OPXA 4LSWA 5E8RA 3T1OA 4RVOA 4LXQA 5ED0A 2JLWA 2Y1LA 3FYDA 4BLVA 1YO6A 4F86A 3E81A 5TQ2A 5K0BA 4KOAA 4N3NA 3QVWA 4WZ6A 1JR3E 3MQ4A 1E6LA 3L6BA 3AFIA 4IJKA 1Z5UA 3EBPA 3SK0A 2DBVO 1T8PA 4DIEA 4UMDA 1KOGA 1FDVA 1YB6A 2PH1A 1C9NA 3DV0A 2I91A 3PQFA 3VHXB 3PUXA 3I4LA 2QXYA 5TY0A 3OEED 1XD2A 4RIIA 3NIFB 4TT3A 4BGVA 4BKMA 4C0HA 5CA0B 2AN4A 4FJ2A 4RMGA 4UUNA 1R10A 3G9TA 1VHWA 1NVVR 2HFKA 4IGKA 1FRZA 4G8DA 2X0EA 4CKCA 4BNHA 4TM8A 2XYHA 3HSYA 4DLZA 5AFSA 1M2NA 3QE0A 3FMPB 6YASA 5KQGA 1AUQA 1J25A 4OB8A 3L7CA 3OFKA 4XVQA 4HI0E 4NNJA 3WL5A 3M6FA 4J2OA 5BPFA 4OHMA 1KO5A 1Z39A 2PX0A 3EEQA 3GJSA 3LY5A 1VQ1A 5DNVA 1TCUA 3ZZ0A 4M1WA 1LPPA 2XCLA 1YJAA 4WH0A 2XZPA 1KEPA 4Q9LA 3GGDA 1TK9A 4M7RA 1KORA 2AVDA 2WLTA 4NARA 4YHBA 1TUEA 4ZEWA 3EY4A 2QX6A 3WFIA 1IFXA 1QKKA 2EBUA 2QRMA 1D1TA 1RNLA 2W6ID 3L6UA 2P2GA 1YDGA 2P4SA 5DYGA 3LYLA 4YP0A 4JJ4A 3S68A 2R86A 1L3IA 1V7QA 3DVSX 3OIWA 5IG2A 1EX7A 1SVUA 4FILA 5TS2A 4A92A 1NZDA 3AEKB 2ZIGA 3ZBUA 4TUYA 4FE7A 4HFRA 3WJAA 4BLOA 3K70B 3TUXA 2XZDA 4DTIA 1C7RA 1A5TA 2ZU6A 5C3MA 3G2KA 1UADA 4IFEA 1RAHA 5JH7F 2P8JA 1L5HB 4KP7A 4LS3A 2G9QA 4LZNA 1JG2A 3TQOA 4L75A 4Z4FA 2MR5A 2NAPA 3O91A 4RMHA 2VQ3A 3L6OO 1W4RA 3IODA 4G5SA 3V3KA 4FEEA 5JNSA 1GTMA 3LWNA 3PDHA 4L3OA 4LX0A 3JTEA 1GKUB 3UOAB 2FHPA 1U3TA 4G89A 4D9EA 5A6SA 1M1XB 4WVLA 2Q1WA 3MN1A 4FC6A 1M2GA 1VGVA 1K75A 1HTWA 3DD1A 3SXUB 3JAWB 4HZIA 4OXXA 2J7KA 2V03A 4XQCA 2WD8A 4UDXX 1EINA 2QUKA 5CEEA 3VV3A 3IGFA 4WDRA 3DDHA 4IDEA 3H0CA 3E0QA 4DB2A 1T6NA 3GLHB 1G63A 4Q05A 4RFSA 3MMNA 5CVCA 3U7FB 1YIOA 2ADMA 2QE7D 1CHNA 4J16C 3BJEA 4JXJA 5A0TA 1RSZA 3CZ4A 3LBAA 1N78A 4BDTA 1JFVA 2FH5B 2FPXA 1F9EA 1OI2A 1EHCA 1HT1E 1V1RB 1L1RA 1VPEA 4V0MA 4MSUA 3S5JA 4QVIA 4Y18A 1Y89A 3IP9A 4PTYA 1ULZA 3D9QX 3O5AA 1SD1A 1ORIA 3NG1A 3P4YA 3HEBA 5DT9A 2GHTA 3CH5A 4EJSC 3PWKA 3DR5A 5ALVA 4KYIB 1GQ2A 1NUSA 2DPMA 4O5AA 5DP2A 1VTKA 2CB9A 2HU2A 2EWVA 2XWJI 4RHCA 5FX2A 3EIEA 3V8NA 2FFRA 2DLCX 2PLRA 4MW5A 1T13A 3DZCA 1E1NA 4IG9A 4DM4A 2ZRBA 4KX5A 4M3NA 1PR9A 2HHJA 3P9IA 4CIAA 2Y4OA 4WFQA 1JQEA 4AMYA 4CNBA 5IXYA 1KEUA 3OTIA 3PPVA 1YS6A 2VBGA 1RKXA 2WC1A 3K8QA 4Q4JB 3RUCA 1ZBDA 3F4BA 4D8VA 4F60A 2NUAA 3T0FA 4F85A 2AXQA 4P3PA 5EY5B 3KGDA 3A26A 3KHKA 4D9HA 4G56A 2VUTA 4K2HA 1HL3A 3NDJA 2B6HA 4OH1A 2O8CA 3SM3A 4BFLA 2BTOA 3PDWA 4WK0B 4QM6A 1JFFB 2BFDA 2G7ZA 4YLGA 1R4NA 5C80A 4Y1GA 2PFSA 2OCAA 3KZKA 4DZTA 3C1UA 3PNBA 1YMUA 5KOHA 1ZG3A 2RG1A 2IYAA 1QGDA 2XTMA 4JIMA 4O4LF 4QQRA 4XH9B 5HKAA 4UNPA 1X6VA 3DBHA 1GNTA 2J6CA 5JHHB 1OV4A 4NS1A 5F23A 3T5PA 4RDCA 4Q7MB 1OY1A 1WULS 2YICA 2OG1A 3H8SA 6REQB 3KZ1E 3CZPA 1OREA 2IOYA 4YI5A 1E6MA 1PFYA 1OZ0A 2BFAA 3P9PA 2BFPA 2PVCA 3GNSA 1G2PA 1LSSA 5L3SB 3K0BA 4W5RA 2YNMA 1BN6A 1E9AA 2ZVDA 3DEHA 3C6YA 3HVIA 1WWKA 2NSYA 2HLNA 2IP2A 4HGZA 3W9UA 3H3FA 1DADA 3RROA 2Y9MB 4BTVA 1QQTA 3DLCA 2YWEA 1MZPA 4HAZA 2FPMA 1NM5C 1ZH4A 1JHXA 2XB9A 4JB2A 4AZTA 4PYLA 4MWTA 5JNVA 1QOQB 3OU7A 2JJMA 1IMJA 1RJDA 2Z57A 3QP9A 1R0XA 3PJRA 1QU3A 2NTNA 2ATIA 3EOZA 2XMRA 2GD2A 2FX2A 2JLYA 4KK4A 2O8DB 2OO5C 2GI4A 4PG6A 3CE6A 4YNBA 1AY0A 2PJUA 2MSLA 3GFBA 3PGKA 2HTFA 2EIHA 4CMIB 1Q1AA 9MHTA 3T12A 4AXXA 3VPBA 4QOEA 3DZ7B 1OBVA 2OM6A 3GH1A 3H0KA 1Q74A 1JFLA 3K53A 3WA6A 5K0NA 4NV1A 1CR4A 5HQ3B 3FNIA 2F9FA 2PGAA 3UIEA 2NO7A 3L2OB 4ACAA 1WXFA 4J1SA 3D8RA 2JLAA 2D7DA 1FBNA 2F1IA 4BOYA 2Q1TA 2OHFA 2X0DA 2RARA 1IWPB 3R0IA 4I36A 2WNSA 3MWDA 3JQ7B 3VKGA 2PO7A 4M87A 2XY4A 1KAQA 5DCUA 3FTFA 3HO8A 3NEJA 4YCAA 1K3FA 4ARZA 4GXQA 3IILA 4REMA 2YC2C 5CIQA 2C78A 3IL2A 4LWZA 1IY9A 2AUMA 3KUKA 3BHMA 3NVMB 3C5WP 3W9BA 3DDCA 1CRQA 4YEDA 3GLGB 2FSFA 3LIIA 4D79A 4YRFA 1UWCA 3SY8A 3DONA 5E6RA 2BW0A 2ECQA 5TS3A 2NUTB 4PNZA 4MVJE 1LJUA 2YWXA 3D6MA 1A95A 1XTVA 1SBTA 2IF2A 3Q3CA 3LRTA 4F4JA 1FUIA 2CF5A 3HUUA 3URMA 2E6UX 1W36C 3HA3A 4BGIA 3M0EA 1MW9X 1I7DA 5FWYA 4NDZA 1DC6A 2XOKD 4QJ5A 1QIMA 4NZPA 1XPOA 5GONB 1D4AA 3LCCA 4MV8A 4NFHA 4TVOA 3BC1A 5DTEA 1J21A 5ES3A 3D8BA 2XE6A 4NBVA 3ZLVA 4BVJA 5KOIA 5C31A 2ZBFA 3V2UA 1HETA 2JFPA 2NVBA 4P7JA 1NVEA 5EN4A 4YV1A 1A50B 3EXIB 3RAEC 3D8UA 3ROGA 5EIXA 3ZDAA 5F4BA 1QFYA 4MLCA 3JQ8A 4E5DA 4E0BA 1YCGA 1IEXA 4RVHA 4P0QB 4L22A 4IZHA 1K8RA 4KFSA 1I33A 3IP8A 4IINA 3V8BA 1NYQA 4A5OA 4IL5A 4YV2A 2PR7A 4M9UA 5HGXA 1H66A 3H83A 5C1PA 3IAXA 1YKFA 2XW6A 3CBGA 1W34A 3DZBA 3HRHA 3TIXB 4FFMA 4BB6A 4C4RA 1IHPA 3PNQA 4H7KA 1KO7A 1F1JA 5JTUA 3P2MA 1C3XA 3JWPA 1PT5A 1L3BA 4CF6A 2VSFA 1O03A 3I9OA 3TLEA 2FWRA 1XRNA 1G7CA 3LH5A 3OD1A 3OZUA 1YE3A 3ZC3A 2JK0A 3R3SA 4BMOB 3KWJA 3W77A 4BFTA 4P86A 3FNRA 1Z7BA 3OPQA 4F3KA 2CLIB 1WLYA 2DUMA 3C7DB 3I04A 1MB3A 2SNIE 3OZBA 4N3GA 4X61A 3IB6A 2XODA 2Q2VA 2OO7A 1EJ6A 3HADA 5CB8A 4KN5A 2PKQP 3I9MA 4KQHA 4ND8A 5DULA 4BVFA 4F5ZA 4LQCA 5JR3A 2VDWA 4MI6A 2BHRA 3MJDA 2NIPA 3BF7A 1H8HD 3CSDA 4BL5A 2J9ZB 1O8BA 4HAXA 1FFWA 1R5BA 4OGFA 2BZGA 1N33B 4AJOA 3L7YA 1MIOA 4ZJYA 5JSFA 4YRSA 2A58A 2IL1A 4PZPA 4P32A 4XTRA 3TCKA 1FNSA 2BCGY 2JIMA 3GBVA 4TXHA 1EFVB 3IP7A 2ZT6A 1U2RA 3H5VA 1X7XA 1VP3A 2QRLA 1MDFA 2H3EA 3B89A 1GZVA 3OF2A 4TMKA 3ZWPA 1TLFA 4DTCA 4EHFA 5JD4A 2H00A 3L8EA 1HDXA 2H8GA 2YOGA 2XMDA 4OQDA 5F73A 3ZY3A 4P7FA 4Z54A 4OTZA 1NVTA 3SF8B 3EWNA 5DM0A 3RS0A 4AAYA 1IWOA 4AQYB 4AK9A 4QYIB 1SN7A 2R8XA 2D2FA 4BO6A 3FA2A 3GO4A 4ILKA 3ZW8A 4B0OA 3VPGA 1K2VN 3RTBA 3O95A 2KJQA 4WX2B 1CE8A 1UXHA 2ZXFA 1YU9A 3H3JA 2D74A 2GM9A 2P3QA 3NHWA 3PUIA 4ZCSA 3TPZA 2CNKA 1XPRA 3GC6A 1MO3A 4RWEA 4A5SA 1NOJA 3H7IA 3LVBA 3OFNA 4Y2XA 2YZNA 1C1XA 2WP0A 5K0GA 3UN1A 2XVYA 1EVIA 1AS3A 4KQWA 3SF8A 2F62A 3QPCA 1AKNA 2PX3A 1UDXA 1UBGA 1UBLS 4M46A 3HDGA 3Q7EA 2V8BA 3ESDA 1C0KA 2UUPA 4F4IA 4ZYTA 4KXFB 2I5PO 3GT7A 3SYNA 1DV2A 2P68A 1X7XB 1Z0IA 4PY2A 3DP7A 4HLCA 4AUEA 2Y1KA 1TK2A 1H93A 3TKAA 5JZOA 3H2ZA 1CNFA 2QTVB 4GBMA 5AI9A 3M4NA 3LP8A 3MFYA 4P36A 3HCOA 2GSWA 4MS1A 1DPFA 2QTHA 4OMCA 2W6QA 1ZUNA 4ZQIA 2OB2A 1JPUA 3SYLA 1MRSA 1W73A 3AUKA 5EHIA 4Z0PA 4W5OA 3IIMA 3KJNA 1UPAA 1Y6RA 4ZYXA 4IUYA 5L3QB 4ND8B 1VE6A 4OJTA 4D0LB 2VDUE 4BRWA 1BMTA 1MA0A 1O87A 2PGOA 1CUXA 1E9VA 4MVJA 2B4RO 2IWRA 2YVUA 2HLHA 2VUSA 2Z2ZA 3P9KA 4QTUB 3RTDA 1JR4A 4LE1A 3LBYA 5SY9A 3BUSA 1DWOA 1J09A 2X0KA 3FDZB 3FLEA 1BXGA 5SICE 4Z1OA 4D99A 3UB3A 4QM7A 2CFCA 1NULA 2WKQA 1IY1A 3MJCA 4PINA 4F3YA 3QOYA 2GPTA 2AJBA 2H2HA 4NICA 4ZZ1A 3FWZA 3ABRB 1G5FA 3VPFA 3QENA 3ZJUA 3VFDA 2FLWA 4B6SA 1MNQA 1NFFA 2NXNA 3AFOA 3TDKA 4CYMA 4NE2A 3NTQA 3BT7A 2A6PA 1QLWA 1E8DA 1V3UA 1Z5OA 1EWKA 5G4KB 3E9DA 1ZCZA 1O6CA 2HF9A 3N74A 3O0DA 2A5FA 3TFQA 3KKNA 4CM8B 2VJMA 4CMGA 2EATA 1RYZA 4EP1A 3UWKA 3NR2A 2XUQA 3PEEA 3O73A 1D9XA 1FDTA 4MVJH 2X40A 3OCZA 2BEVB 2V9ZA 5KSWB 2ISCA 2Y71A 5KTOA 2VK1A 2Z5LA 2UYGA 5JSHA 1HKUA 3KG2A 4DANA 5BN5A 4O6VA 5EGNA 2J6IA 4KL8S 2OEPA 2GERA 4TRJA 1NN3A 4EA8A 2B36A 1RHQA 5TRTA 4DV4B 3WBJA 3PUVA 5AQEA 5GONA 4BN4A 1E2BA 1A5ZA 3NHMA 1RLIA 1EFLA 1UL1X 2YN2A 4YP9A 4RV9A 1L7AA 3P9NA 4IDAA 1ZH0A 3L0ZA 3BMOA 3FDFA 3K0AA 4JVNA 5A05A 1BCRA 1C3OA 4N39A 4NZZA 3ZLJA 2CYCA 3TMAA 1QUFA 3SC6A 2ZWOA 4I6GA 2V65A 3JWIA 4BNGA 4EYGA 4YV0A 4WDQA 5AKXA 3AJ8A 3GVPA 2JARA 3S27A 2MSWA 3GLGA 3I0NA 2O52A 4IRMA 3D5EA 4RX1A 1GWNA 4OHVA 2CFRA 4OQMA 2PLAA 4OP1A 3B36A 2OY0A 3U4GA 3UWSA 4I4IA 1HYGA 2VBCA 4RNDB 4W8OA 1H2XA 4U3JB 1G20E 4FI3C 3G9XA 5CT4A 3PLAE 2F8SA 1U2ZA 4Q0MA 3P32A 4MR7A 5DH9A 3SHTA 1ZAYA 1LBTA 3Q3GE 5EMHA 3D8NA 2QZZA 2ZZNA 4RD2A 4UHJA 1G5PA 3NZEA 1A9RA 4JJZA 2OG2A 1VYHA 4A4DA 5A3RA 3FUWA 4X45A 1YFJA 2P5TB 5H3CA 1UDRA 3QRWA 5T67A 4JU9A 1JHUA 2I7DA 4LQ4A 3MMZA 3KQUA 1R5NA 1YDFA 2PS9A 3ZVMA 2XMGA 4BP9A 3MQFA 3E53A 3WZLA 4JBNA 4NXMB 1EFPB 4N8DA 3I42A 3WBKA 1CUAA 4FWBA 3PBKA 3QJYA 2VPXA 5M2QA 5KSYA 2G5TA 2ROQA 1OZGA 1WRBA 3N2YA 1W1UA 1L4BA 2VSOA 1DTEA 4MVJI 3TFWA 5FR1A 2RCYA 4U0JA 4JT8A 2XF2A 2GESA 2CBXA 5HQJA 3FAKA 4CLQA 4G8CA 4FBMA 1XTIA 4R69A 1SG0A 1J0CA 2VHXA 3GJXC 421PA 4AWBA 2BLLA 1H0KA 3ZEAA 1JHMA 2IYRA 5EMLA 1TIKA 2YOHA 5AKZA 2Z08A 1MVLA 2FEKA 3EDQA 2ZE8A 3QTBA 3AQIA 4HVCA 4TTTS 5C1DA 1QMPA 4ARIA 4KIGA 3FFBA 1X1SA 4S1NA 1VJ1A 4J0JA 2CLEB 3TIIA 4NU0A 4H0NA 1DQNA 5A4FS 2A8YA 1GYRA 2NYRA 2WA1A 1KFBB 3P2IA 5DNWA 4ZVPA 2HV9A 2FXVA 2J3JA 3SSNA 2AFHA 3VR1A 4O3MA 1B0AA 5IJ9A 2RMKA 1UOEA 4D4GA 1SD2A 3KDPA 4OM8A 1M3SA 5BN3B 1D2NA 2JD2A 2NU7A 3IEVA 3RD5A 1GAJA 2PL3A 1XTRA 5DCYA 3BBLA 4JVLA 5FI0B 5CX1B 2PZBA 3FYUA 1DC4A 4UEWA 4B17A 3UMJA 4JV5B 3Q3JB 3W6PA 1Z4MA 2NT4A 1XMIA 4JAVC 1IQPA 1IN6A 2QX8A 1P18A 4QKQA 4RVSA 2WU8A 4EKNB 1W35A 5GMOA 5FOXA 5IDWA 3N2NA 2YN0A 1LBEA 1DKPA 5D3MB 3BXGA 1K5GA 3QVJA 1G3QA 4JIGA 2LKDA 3N8DA 1SEPA 3BL5A 3WWPA 2Q1XA 1IVYA 4FX2A 2C7RA 4WV3A 3OAAA 1TJNA 1SUPA 2C99A 5DWQA 5EJMA 1GTSA 1NBMA 4XLTA 2OYRA 5ERXA 2Q45A 4N5NA 1N0HA 1PRYA 1T5SA 2FWJA 3MTDA 5GV8A 1RRVA 5B37A 3RLIA 3X1MA 2EW8A 3RIGA 4D4JA 4HVTA 5ICFA 5AKHA 4C07A 1PGQA 3I0MA 5ITWA 3EFHA 1RCUA 1PV2A 2ONYA 2QOEA 3K8OE 1QJCA 4YREA 1GCGA 5CB6A 1I01A 4ZEOA 2N47A 4BKQA 1M8KA 2AR0A 4JGBA 4N0PA 1X80A 2BMVA 1PZNA 1F2TA 1E9CA 2W6JD 1RHUA 2JNWA 3PVCA 4OGKA 5FBRB 3SQMA 4X84A 2OHGA 1MQSA 1OLXA 5A9RA 1H9BA 4N0QA 4E21A 2XQIA 4BFZA 4MQEB 1YE5A 3PFIA 5DGDA 3GJYA 1O94C 1CQWA 1Y1RA 2O4UX 1G42A 3ADPA 4M38A 4R6WA 5T57A 1L5GB 2WWVD 2FE4A 5I45A 4INZA 4XSVA 4CDGA 1JE1A 2R1ZA 4D96A 2WQ7A 5KWIA 5BNIA 3QIAA 4KVFA 4MQ5A 2XJ9A 4HN4B 3K6SB 3EQ9A 5A1TA 1FFBA 2C54A 3HKBA 2QM3A 2Q0HA 4HH1A 4CL8A 4YT5A 3C14C 2GX6A 3SMVA 4HMOA 1F8FA 5B7GA 2XZTA 3OOYA 4FGSA 1VCHA 4KBYA 3RS3A 4D44A 4B7CA 1T2DA 4U2CA 2P6UA 2WJ6A 3AR5A 2QJOA 4HDNB 1R0CA 5J2UA 3A9RA 3CPJB 4IMRA 1ZK3A 2P27A 3HCCA 1I6MA 4HF7A 2I9PA 3B6KA 4L4YA 3KEMA 3LC2O 4F2HA 3QLUA 5JDCA 1DUSA 1G8GA 3OUUA 3QU5A 5CDYA 2Q3HA 2ZUCA 3TQQA 1FEZA 3QU2A 4OP2A 1GG8A 1NKVA 2CNLA 2J5QA 2NXJA 2RC5A 2VI5A 2YXBA 2I7TA 4O59O 2YV2A 3IBCA 3R1IA 2IXBA 4LGVA 4L15A 1CQIA 4CDRA 4MV9A 4K9MA 3LU1A 3T1YB 3E5NA 3KQOA 4LVCA 4BVGA 3Q41A 4KTTE 3ZWDA 4ZCIA 2E0IA 4KAJA 4CLOB 3A1DA 5HKBA 1R4MA 2IY8A 4QHSA 1SK9A 2E89A 1CVIA 4U5XA 3VBCA 1MGOA 3H4VA 4RGQA 1M2OA 2XYPA 1E2FA 3C6ZA 3T8YA 1U63A 3PR3A 3PWTA 5FPYA 5CRIA 3TSAA 1WX1A 1KQPA 1XQ9A 3KUCA 4CKWB 1BOFA 2GCOA 1TK3A 5E9AA 5JCJD 4NZOA 3BA1A 3ETLA 5DLQC 1J07A 2FSIA 4I8XA 3WK9A 3AI2A 2ZI3A 2QX4A 4MS3A 1UOPA 1ICEA 3CLTD 4DR3B 3FSEA 1DIRA 1XD2B 5JS1A 2UZ1A 2G63A 2E55A 1P3DA 3L6DA 5JNRA 2ZFUA 1NJ2A 1P0QA 2B1RA 2XDQA 4UOZA 1Z0UA 2DBRA 2DJ5A 1JVBA 3NJ8A 1UKBA 3Q6NA 2ZUTA 2VSQA 3CN9A 2HQRA 4L5CA 4MUJA 5FA8A 4GI5A 3GLFA 3OHPA 2UVDA 4HYQA 4QDJA 5L4NA 5DPMA 1KY5A 2H2AA 5DN6A 1GQFA 2IUEA 5FBHA 1EAYA 4X1KA 2VHUA 1AA9A 1L0BA 3HVJA 4MUHA 2VPPA 4BJ5A 4C2BA 3R9XA 3V4OA 3W06A 2P5YA 3PL5A 4YONB 2Z1MA 4DEVA 4ARUA 2C4UA 3R4CA 5C8ZA 3KVNA 4WKOA 3C6KA 3FMIA 4FYPA 1DJNA 3OCJA 2VKTA 3D4IA 2ZYIA 5ALJA 3H2HA 3UOGA 1R64A 2FZKA 5F4ZA 2JFHA 1C4KA 4N76A 4U63A 4JI5B 5FBZA 3W5BA 1T1GA 2GEUA 2Q2OA 5C35A 1KQGA 4XSGA 2GK3A 3VNQA 2JFGA 3RBZA 2AV6A 3TRKA 2ZRIA 3MMXA 4KOEC 4B3IA 1K6MA 4QQFA 4EK9A 5K0CA 2AI2A 2PV7A 3WNZA 3RBVA 4IOJA 4L3VA 1FSZA 1PUJA 5JJIA 1VSBA 1ORTA 2H11A 4LRYA 3CT6A 2CHEA 1YAJA 4H1UA 3PENA 1QAOA 1DBSA 2WSMA 3Q4GA 3LKZA 3O82A 4P3YA 5FNVA 4CTOA 5EE3A 4EUHA 1DWUA 2HLPA 1WD5A 2BR4A 4DR4B 2RJNA 2AHRA 2OFXA 1FYDA 4UW9A 2Q99A 5DGXA 3H8WA 3VPDA 3IUBA 3ZS8A 1VL5A 3VZCA 4BQOA 4JR1A 5FCDA 1XMSA 5FD8A 1MORA 2LVBA 3K0HA 3T7RA 4JP1A 1XHEA 3WGZA 1DBWA 1KERA 4WY8A 3SZLA 2YYYA 2DSTA 3TD6A 4UEJA 3G2PA 4YS6A 5KIAA 5AOVA 3QU9A 3RVLA 4ZPJA 4R7ZA 3H6GA 4MPJA 4QOJA 1PL8A 2VXOA 4HNTA 4UNRA 5AVVA 3WLHA 1SAYA 4U02A 2CKMA 2O7SA 4LDQA 1Y9ZA 2ZAGA 1KH1A 1WOYA 2AH5A 2CCKA 1PZGA 4OYLA 4MRMA 1JEDA 2JCSA 3INNA 5DSZA 1QUEA 2CE2X 2FPPA 1E3EA 3DFMA 3G7SA 3IUPA 4NYIR 4ZXFA 3QH4A 1XTUA 1I3NA 1EX6A 4ZAVA 4PIVA 5HG0A 5AW0A 4BX2A 1X9IA 4PLFA 3NALA 3KE9A 4EATA 4GOOD 4BZWA 1NM5A 2XDQB 4LRSB 3BEDA 5KVCA 5H9VA 1VIDA 1Z7WA 2M6KA 5EJ5A 1EHYA 3CLTC 2ZCJA 4Y2GA 1J2YA 2DR0A 2AHOA 4HDOB 4Q6BA 1H6BA 1BH2A 3HJRA 3ETNA 3HN7A 5BXQC 2FG6C 2X9NA 5EVJA 5J23A 2Q2QA 3P97A 1XTJA 4EHJA 4CKWA 2WIDA 1NVBA 2ZIXB 5DF1A 1JIIA 1H2BA 4ALMA 5LP6A 1SOAA 3DBLB 2GFHA 4AP9A 3PQ5A 3KAPA 3PSHA 3EFBA 5HK9A 4QGHA 1K9VF 1W9HA 3ZY5A 2G1PA 1J56A 1MBZA 2XIJA 2BUAA 5TQ0A 4YBZA 4GG1A 2QAJA 3UMCA 1LTQA 2ZK7A 4JN6B 1C41A 2PM8A 2GCIA 2ZAMA 3I6YA 3QHPA 4QPNA 3UHJA 3NKFA 3O1LA 4RK7A 4ZO6A 2R1TB 1AQUA 1ZAKA 1AU9A 3O6VA 1DC7A 3KYBA 5CG2A 4MROA 3PC8C 1XN4A 4QUJA 1IL0A 2C4WA 4EG0A 1OC2A 1Z5GA 1QR2A 2CHUA 2P6PA 3PC8A 4G3XA 4B2YA 2OVFA 3KB8A 3F7NA 5EYPB 3GLGE 4DC9A 4HQ6A 3BK2A 5CT5A 3HYSA 3L3BA 4WNAB 4HB0A 1DAOA 1IPHA 3QWFA 1SUDA 1SK8A 1ULBA 1C5KA 2P9FA 1Y6QA 1P1BA 4F3RA 3VKHA 1Y1TA 3RTCA 4Z7QB 3QV2A 1SVLA 2Q5EA 4DHWA 4OJKA 4DL9A 1Z83A 1PWZA 3OPYA 4J0EA 1M8PA 5JD6A 3BG5A 4N4AA 2BELA 1ZIPA 2HBYA 3DE0X 3DG9A 1KSGA 7YASA 2QN7A 3OCCA 2CDAA 3RSZA 3ZQ6A 2ISQA 3C70A 1UM9B 4HSEA 4LCJA 4V0RA 3R8FA 2H9IA 5FBWB 4CUJA 4ES6A 3U0BA 3DLTA 1AQYA 4AKTA 3OG9A 3QLEA 4IG4A 3RUFA 4YRZA 3V8MA 4QPJC 4I8DA 2YRXA 4AO6A 1PJZA 1IJBA 3R3HA 1HLPA 1VDZA 2X6TA 3EHEA 3LUFA 3PZBA 3WYDA 1PWXA 3LNTA 4FQ7A 2WIAA 2H7VA 5FTNA 5GQSA 2FMKA 2I3AA 3IFSA 3NC1C 3TQSA 1TM5E 3V1TC 4Q1DA 5GY7A 4BNLA 4IXNA 2EKZA 1TKBA 1YB4A 3AVQA 3E15A 4DLVA 3B8HA 1JQKA 3PDIA 1HRKA 2C9DA 5E7IA 2Z30A 4LMRA 2GLXA 2TMDA 2W2XA 1E1QD 3ZDCA 1E7SA 2VYQA 1LVUA 4NCHA 3G17A 1TA4A 5FEMA 3P26A 3BB1A 3HXMA 3RRMA 2I3GA 2W6OA 2EX1A 4HXFB 1EX9A 4KE7A 3WBBA 5ADWA 4G0WA 3MWFA 3ZKAA 4WGFA 1T9ZA 3NNNA 3P0RA 2DQSA 4A1FA 2W5UA 5J1SB 4QUIA 1G5RA 1UIRA 4D3YA 5KPJA 4PAQA 1WZIA 1XRQA 1BE1A 5LMUB 2HMYB 4WOPA 2I6QA 2Q07A 3QLTA 5ALZA 3WLPA 4O1MA 4D3DA 3N87A 4RVFA 4GPEA 4ZRNA 2WMYA 2AQKA 5E4TA 3GDWA 4GXRA 5CFNA 4L6AA 4LNUB 3PUHA 3V1UA 4K3VA 3OX1A 3DW3X 3JQDA 5SYAA 2QI9F 4O2RA 5EI5A 2FUG1 1LRKA 4IVRA 4JI7B 3HVUA 1SCQA 3PHBE 1GAXA 3F7OA 5FBKA 2D1TA 3VU8A 4G6ZA 1E2UA 1DOHA 3U7RA 4GR4A 3DBVO 4CIDA 1KO4A 4CW7A 4E07A 3ECCA 3FYUB 3A6PC 1L6RA 3Q10A 4BATA 3FVVA 1G8FA 4DCOA 4O4LA 1NXPA 1P91A 1I72B 1NYTA 3A6FA 2RK3A 3ZGVA 4LZOA 1JHZA 1R5OA 4UE6A 2GMWA 3X1ZA 1ID8A 1RWVA 3L40A 2HYIC 1ZJWA 1YZQA 3FMVA 4CN9A 1ISHA 5FWNA 4NNOA 3RRNA 1FRNA 2C9CA 3HA2A 3SHWA 2BMAA 3DHYA 3V8QA 4C78A 2C57A 2IE8A 3LBFA 5LQKA 1BFKA 2BGGA 5C32A 1IZYA 3F6EX 1KYYA 4B4VA 5HX7A 4HJXA 4FTWA 4JYPA 5KTYA 2X4DA 5CW1A 4TLMB 3STVA 5BW4A 2WPDD 3OEWA 1OLSB 1RZUA 4N9WA 3U19A 1P9WA 4G67A 3QELA 4LKRA 4EPYA 2X15A 1Z13A 5C4MA 1GV0A 4PYKA 3D2LA 1I79B 3NTLA 2LZ0A 3GDFA 3G9QA 3Q2KA 1S9DA 4PX2A 5H83A 5I01A 5KYWA 2OPHA 3KYCB 4I3GA 2WP8J 1G3UA 3NYWA 5BVHB 5HJEA 2P9HA 1YGYA 3Q0IA 2R84A 4O2AF 3RGWS 3VYSB 5A9SB 1K7XB 1N3BA 1MC5A 1Q21A 3ZNPA 1OUMA 3X1JA 5BMVA 4ISBA 3JARA 5DLYA 3WMFA 1XEWX 1E3QA 4MLZA 3ZDQA 3HDHA 4F45A 4GXTA 5FOSA 3T4XA 2HSGA 5JBIA 3BGSA 1RI5A 4IUBS 5DCWA 4D25A 2KSQA 1TAQA 3ZGXA 1V8BA 3B7GA 2IITA 2PSJA 2WJYA 3HYNA 2ACEA 3DMHA 4WXEA 2IHBA 1XL1A 1EU1A 4MR7B 3FHLA 2VAPA 1AQLA 4DLSA 5C7LO 3TLYA 1SZPA 1VMIA 3G2OA 2ZTVA 3GJRA 2Y68A 4HBGA 4W5JA 3Q8MA 4AS1A 1HFJA 3CZCA 2F8TA 4RKEA 5FTWA 1GU7A 4P4UA 3CUWA 3HDJA 1NMXA 3WDLA 3H2IA 1SC6A 1P6UA 1DAMA 4RM2A 4L85A 3R7DA 5JU6A 1D2AA 1VCNA 3TVTA 2OXCA 2ZOSA 4DCMA 2AOTB 2WG0A 3PC7A 2VDKB 1UBJS 3L0BA 4QPDA 2D4AA 3FR8A 1CUBA 2IHTA 1IY0A 2DHEA 3ETDA 3R8XA 3GAMA 3QVXA 2IJGX 4TLBA 4MKIA 5JI2E 1RBYA 2OZLA 3NOXA 1HQDA 3PF8A 5B1IA 5KYUA 3PIIA 2ZVJA 2YZKA 5BUZA 1DAGA 2WICA 3E03A 4HDRA 4L4UA 4S2EA 5HKKD 1C7ZA 2QLMA 2ZRJA 1ZA1A 2E82A 3QOWA 3DHWC 4JY7A 3DT6A 5CTJA 3GA5A 4A3SA 1CVLA 1QP8A 1JEOA 1WUYA 5JCJA 1HLFA 1L5QA 5AK0A 5JEEA 5LN1A 2FOIA 1F7VA 4FIZA 1AO0A 2CEAA 2R68A 1AX9A 3S7ZA 2JG3A 3K5PA 4QATA 2O8FA 3LUDA 3EZ2A 5BQ5A 5FPSA 4HATA 1KJYA 1YJ5A 2QRZA 3N8NA 3PWZA 4TT8A 5DYNA 3UK1A 1XTKA 1DL5A 1NJFA 5BN1A 2POQX 1OIWA 1VJ5A 2CKDA 2FMFA 1PVOA 3KPWA 1V4BA 3GG2A 3R7AA 3BD8A 5CT8A 4JYCA 5G4KA 2P9CA 3KQYA 3PXCX 2C0PA 4QT4A 4M8IA 2RBEA 2GM5A 2YUTA 2B7CA 3GQVA 2EZ8A 1DCFA 2Z04A 3DE6X 4EL5A 1CUGA 3B8EA 3DE1X 4PNHA 3TEMA 3EDYA 4D43A 3QUCA 4A0FA 3HL0A 1BGXT 1KMCA 1CQJB 1UMBA 2GN8A 2R25B 2W37A 2WAYA 2YHIA 5ALIA 5MN4A 1RAAA 4CL0A 4G65A 5A71A 3RE1A 3FDZA 1RRPA 3WDKA 1TM2A 4H7PA 4DLNA 3AVWA 4HGQA 5GZ6A 1LGYA 2YQ5A 2G9NA 3AT1A 3O0TA 3DQQA 3U7QB 4F12A 1NVKA 1X7WA 1R6TA 4TQAA 4B6EA 4CODB 3PCRB 1I2DA 1ZOLA 5CCEA 4UATA 1AKWA 4RELA 4NOKA 4X1YA 4DSUA 3O31A 5L3QA 1WKCA 2DB3A 2FDCA 1NBOA 1S96A 4LECA 3WR5A 1JV2B 4H0FA 2IPLA 2WIJA 1F6DA 3ESZA 2FR8C 2ONKA 3DO5A 4TGLA 4G1UC 3WKCA 4LC1A 2ZI7A 3GLIE 3D7MA 4XZ3A 2DTEA 4S12A 2QTVA 3ZN2A 6LDHA 5FBQB 2K6GA 3IR7A 3QWIA 1DFIA 4LZZA 1L4KA 1JQ5A 5JTTA 3VC3A 2BF4A 2BMEA 4HWKA 3CKLA 1ID1A 4AZVA 3LCMA 1WXWA 4LCBA 1V41E 4DPMA 1MAAA 2Q4RA 1C1XB 3M5WA 2W2PA 1NDUA 3AFHA 1ISSA 1DXOA 1NQTA 4TZKA 1EUYA 4AKGA 2OGZA 2PU5A 4EMTA 1L5YA 1Z2EA 3EMKA 1Q14A 1N6HA 1WXHA 1ZK1A 1RPTA 1ZC4A 2CXUA 2GEFA 4TKLA 2OHHA 3MQ2A 4JR0A 5IMSA 4WK4B 4H7FA 4R8VA 2JHGA 4ENVA 4EGSA 3IUJA 4GR9A 3WLOA 2HQ1A 2MTBA 4I4LA 5H68A 4G4GA 4URZR 1V1MB 3ZJYA 4CV0A 4YR7A 2N0SA 3KAQA 3HDQA 2ZDQA 1FK8A 1P44A 1Z2CA 1Z18A 2WKPA 4WSOA 3TZQA 2GQ0A 1SC1A 4CIVA 3E9ZA 4BHTA 3D8HA 2FNAA 1GZSA 3DEAA 1Z4JA 5ALDA 3QX8A 2B4KA 3IP1A 2ZJ3A 3MJHA 4H7EA 1FMTA 2AG0A 2H0QA 2RJ3A 4O8CA 1P5RA 2B94A 2B8NA 2F4VB 1ODKA 3HBNA 5U9CA 3U17A 1MIOB <