3QVXA

L-myo-inositol 1-phosphate synthase from archaeoglobus fulgidus mutant k367a
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
392
structure length
392
Chain Sequence
MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFASPMDTNVINTHEQFVVLKEWYSNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol-1-phosphate synthase (Ino1)
publication title Atomic crowding drives the catalysis of myo-inositol phosphate synthase, as deduced from a crystal structure of a trapped catalytic intermediate
rcsb
source organism Archaeoglobus fulgidus
molecule tags Isomerase
total genus 160
structure length 392
sequence length 392
ec nomenclature ec 5.5.1.4: Inositol-3-phosphate synthase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qvxA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qvxA01
1QYDA 4KTTE 5CDUA 4B4UA 1HYGA 4BO2A 3TL3A 3WMWA 2FSVA 2HJRA 3I23A 4L4SA 5AXDA 3UCEA 4CL3A 1DIGA 4GL4A 4HX5A 4KTVE 4YQYA 3GG9A 4N5LA 3RQSA 2G76A 3FN4A 4GBJA 4CQMB 1UXIA 3F5QA 3E9MA 1CEQA 4YJHA 1YBVA 1BW9B 5JFOA 5L4SA 1JLLA 1DRWA 4O63O 2JCXA 1C1DA 5BR7A 1YJ8A 2I6TA 3QY9A 1ZMTA 1O5IA 1U4SA 3IP1A 4BHTA 4IY1A 3D4OA 3X2EA 5ICMA 3ZHZA 3NTQA 4IMPA 3SJ7A 1GEEA 3M2PA 1DDOA 5TF4A 5K6AA 3AY3A 5DCYA 3TZ6A 1BRMA 3KRTA 5DT9A 3LF1A 1HDRA 1UXGA 3EVNA 3H5RA 3W8FA 4OOFA 1WNTA 3BMOB 4MVJI 3VH1A 4XQEA 1WLYA 2FPIA 2PGDA 3FNHA 4IINA 3HFGA 2YV2A 1PR3A 1DLJA 4XQCA 4XKJA 2RAFA 4TVBA 3DFZA 3S8MA 3ST7A 3DZBA 2VRBA 2YFQA 1PZFA 2VUSA 3AUTA 4QO7A 5A5EA 1ONOA 1QYCA 1PSDA 1T1RA 3D4NA 4PCVA 2Q46A 2ZJ1A 2HU2A 4XJSA 1FMCA 2VHZA 3AOEA 4CLEA 4M54A 5CHEA 1NASA 4KP7A 4A10A 1R66A 5DP1A 1Q1NA 2WE7A 4XYBA 2OGUA 3ZWMA 4IGFA 1XWFA 4DC1A 3QVXA 4EEXA 5C7IO 3QIVA 4W9NC 4YRDA 3AK4A 4U5QA 2QRKA 4HXYA 4A7PA 1ORRA 4OIMA 5HM8A 3UCXA 1EK5A 1TXGA 2D5CA 3ZHXA 5DZSA 1U2GA 1LC3A 2BFPA 2Y1FA 5J23A 5CPFA 3BTUA 1M67A 3ZU3A 3LC2O 4BKUA 4BNXA 4GWGA 1EUDA 4ESOA 2VYVA 3E82A 4YPOA 4TSKA 1RM0A 2D59A 3DMTA 3JYLA 3I9KA 2I76A 3DONA 5BNFA 2Y1OA 5G0UA 1M75A 3QVSA 3NGLA 4H16A 1YRLA 3E48A 4CM8B 1PEDA 2VNSA 2C07A 4GLLA 4O5OA 1ID1A 5T8KC 1GD1O 1FDVA 5KCZA 3LLSA 2V6FA 1KEWA 3E8XA 4ZHSA 1C0IA 3WTCA 3X2FA 3OIDA 3TOXA 4IPTA 3RU7A 4U0JA 3SLKA 4GX1A 2HO5A 3KM0A 3UICA 3WOHA 5JBIA 3GNQA 1VE9A 3H5NA 2Q1UA 1HLPA 4WE3A 5AXBA 5KJEA 5LDHA 2X58A 4RF5A 2VZ0A 4C4OA 5ADHA 4AJNA 2VZ8A 4ND3A 1AUPA 4OO3A 4R16A 1SOWA 1ZZEA 1WZIA 4F6CA 4TQGA 2I66A 1RYEA 1ENYA 4GX5A 1ONNA 3ICPA 4LN1A 4WKGA 3W6ZA 1LLUA 2J6IA 3I6QA 4YBZA 1LDMA 1S6YA 4NU5A 3GVXA 1CIVA 3PPIA 2D2IA 3HHPA 3KLMX 5JSFA 5DULA 5JCXA 3PXXA 3IP3A 4GWKA 2I5PO 4MP8A 3T7EA 3IC5A 4PG5A 2OBYA 2YFHA 4ALNA 1NQ5A 1UXJA 4LMPA 1GZ4A 3NT5A 4Y98A 4ZICA 1HZZA 3F1LA 2I65A 3RUEA 1IULA 4PLPA 2WSBA 1U7HA 3JCZA 4JP2A 2VWPA 3U4IA 3RC9A 5ENVA 3PI7A 4Y6PA 1DIAA 1GZ6A 4BNIA 3ZW8A 2YV3A 1T2AA 1VKOA 3WXBA 1DC5A 4M49A 4WECA 4C7KA 3DHYA 3AUUA 3CINA 4B8WA 1E6WA 4E33A 5A9SB 1XQ6A 4KWIA 4KQWA 4CUJA 4F46A 1V9LA 4YCAA 4CM1A 5TJ9A 4TKLA 4U7WA 5KJFA 4CODB 3ZCXA 2EEZA 4IDGA 4PRKA 3K2BA 4CMBA 3UGKA 3VZSA 1BSVA 1XQ1A 2YUTA 1I24A 3C7AA 4DMLA 2VT3A 4XB1A 3PK0A 2BRUA 3JYOA 1B16A 5ER6A 1JVBA 4HY3A 4RLSA 3K96A 4BNYA 4B3IA 1GPJA 3F4BA 2IZ0A 4K6FA 5C7OO 1GZ3A 4BO9A 3FTNA 3K6JA 4U6SA 5BSGA 1DEHA 3NDJA 3PJGA 3GRPA 1ZO8A 3U4CA 4CLOA 2E49A 3G79A 2B5WA 1DAPA 3DAPA 4IDBA 3V2HA 3IOYA 3DBHB 1WAMA 3FCOA 3QA9A 4LCJA 5GZ6A 5KKCA 2GASA 3EC7A 4URFA 4KUGA 1EFLA 3AI1A 5T64A 4K9DA 2C29D 3AJRA 4LCEA 5L45A 4WASA 3VVCA 4ALKA 1RM4A 1LRJA 1MB4A 7ADHA 4CMAA 3HNPA 4HKTA 4TZKA 2NVBA 3P5SA 2VHXA 2AA3A 3D5QA 1IE3A 3FWNA 4DPLA 5B4UA 5JY6A 3BIOA 3GG2A 4YT5A 1LC0A 2O4UX 3RFXA 4D79A 1YBAA 3W8EA 2FZEA 3OM9A 3WLEA 1TLTA 4PLTA 1UAGA 4CV2A 2R00C 1IB6A 4YT2A 3PHLA 4OHUA 2Y0DA 2WEKA 1F8GA 2VT2A 1EK6A 1QSGA 1A7KA 4YQZA 1I2BA 2Y68A 3W6UA 2H6EA 1B3RA 3ETGA 1F17A 3EK2A 5JLAA 4DVJA 3K73O 4ZQGA 1I3KA 2Q22A 4JJGA 1PJTA 2FRDA 4E21A 6LDHA 4INAA 3DBLA 3GFBA 4FS3A 5JS6A 3IMFA 3DZJA 5I7FA 4I9NA 3BAZA 4FBGA 1R15A 5THQA 1K2WA 4CR7A 3QV1A 4L4XA 1UH5A 4NBVA 4ZRMA 1O0SA 2CUKA 2WYUA 3QWIA 1CDOA 1PGJA 4TZTA 4UVDA 5EESA 5IDWA 1GYRA 5CP8A 2BFAA 4WCFB 3DZFA 1OOEA 3DBLB 2IYPA 4J4BA 1RYDA 1H2BA 4E5MA 1KVSA 4FFOA 4JXKA 4XYGA 4WLVA 1R4NB 3UXYA 3GY0A 1YB5A 2ZIZA 2DKNA 1ZK0A 3PLRA 3KB6A 5F5LA 1JWAB 1YH3A 4BO1A 1NQOA 4A03A 4LK3A 2AG5A 3RBXA 4XGIA 1UDAA 4BNNA 4R9SA 5JC8A 1Z73A 1S7CA 1T4BA 3ENNA 3ITDA 4EUEA 4YYZA 5TIIA 4BNGA 2GN4A 3FR8A 3TZHA 1A9ZA 3JQCA 3OHSX 4BQRA 1IOLA 2VWQA 4IMRA 3BYZA 1LLQA 3N7UA 3WB9A 3QWBA 1DSSG 2O3UA 1PJBA 4M1QA 2W2LA 3ZU5A 1NPDA 2G17A 5I7SA 1NX6A 4KMSA 5GZ3A 4J2OA 4I5GA 4O1MA 1GR0A 5EIOA 3PWKA 3JD0A 3WYEA 1QYVA 5ITWA 1GCOA 1ISJA 2QZ9A 4BS9A 1MG0A 2X5OA 4CM7A 2UUPA 3IUPA 3IL2A 3IKTA 2J3HA 2D1YA 5F5NA 3PGJA 2BGKA 2CMDA 2G82A 1NTOA 1U5CA 3GVPA 3QWAA 4WUVA 5TQVA 5IXSA 3W4KA 4PFJA 3ZI0A 4GSLA 2V65A 3DOOA 4R1SA 1NP3A 2VUUA 1VL8A 5IAAA 5EERA 3EW7A 3MJVA 1DRVA 2JFHA 4CM4B 3UCFA 5IF3A 2QG4A 4JIGA 1P1FA 3GVCA 1T1SA 3Q9UA 5B12A 2CY0A 1OZAA 1Y8QB 2DTXA 3RC1A 4AJPA 3EGOA 4TRRA 2NUAA 3JQ7A 1T2CA 1ADBA 2IEDA 4UULA 2HKIA 4EJ6A 2AXQA 3PEFA 3WGZA 2HK7A 3F3SA 3NJ8A 2H5LA 5JDIC 1UP7A 3FTPA 3SVTA 3S55A 3QRWA 2NWQA 1E6EA 4Y67A 3HZZA 2CFCA 3KYDA 4D3SA 4YAEA 1HDGO 4DPKA 1K5HA 3GEGA 1MC5A 3DDNA 2OORA 4PVDA 3I83A 1ZJYA 5AXAA 3RJ9A 2RBEA 4W6ZA 4YVFA 2RH4A 4YRBA 2VHWA 2GLXA 1VJTA 3VKVA 4MPDA 1NM5A 4DXHA 4ZQEA 1N8KA 4NQZA 4W7HA 4HFNA 1GV0A 2AEFA 5C37A 1KVUA 3MWDB 1DO8A 5JMPA 1GUZA 5I8ZA 3I6IA 3KYDB 3NKLA 1KVRA 3LT0A 3B1FA 5F21A 3H6KA 5A9RA 1XLTA 2UVDA 3N74A 3AW9A 1TA4A 3NTOA 1B14A 5DNAA 1YOVA 3I9LA 5B4VA 1P33A 1NVMB 2HSDA 5I9LA 1QORA 4NG5A 4Y6SA 5T57A 4FFPA 1A4IA 2PTGA 1TT7A 4IXTA 2PZKA 3VPSA 5MDHA 3U5TA 4LRSB 1EMDA 1HEUA 1KYQA 2X23A 4GMFA 3D3WB 4R5HA 5GY7A 3RIHA 1ENZA 4IM7A 4OM8A 5A3JA 4MP6A 2W2LD 3VKUA 9LDTA 4UAGA 5CEJA 5FWNA 4A27A 5L4NA 4Q3DA 1AHIA 4R4JA 5ENDA 1YL7A 1YOVB 4Q39A 1Z45A 2CD9A 1DRUA 3W1VA 3COSA 4BKPA 4RQUA 3QWFA 1I8TA 4BGIA 3INGA 1E1LA 1U4OA 1Y5RA 1V3UA 4BB6A 4CR8A 3ASUA 3MWEB 3QP9A 2ZB4A 3V2UA 3GAFA 1YDWA 3D3EA 4HBGA 3Q0EA 1KETA 3L6EA 4E5KA 3ZWOA 5I9MA 4A26A 5TS3A 2NU6A 1NFQA 2ILTA 3UN1A 3DWFA 4NU6A 4J49A 2EJWA 3PTZA 2EWMA 4CMEA 4WCDA 3VDQA 3WICA 2JCYA 1O8CA 1QKIA 4OQZA 4NBTA 1L7EA 3ZWVA 2WDZA 3PHIA 2OO5A 4XB2A 3WGGA 4ONEA 3FD8A 2Q4BA 3BTVA 3LC7O 4JCOA 4R68A 3GLQA 5KJCA 4L9RA 3VTZA 5A5FA 1IZ9A 3WGHA 2HMTA 3GEMA 4YA6A 3DZGA 4K26A 2DPHA 3U0BA 3A14A 4D45A 4AJKA 2IXAA 1JAYA 1SMKA 3AY7A 3WJ7A 4B4VA 5JXWA 4CMHA 1ZUD1 4UUOA 3Q2KA 4II2A 3OECA 1WXDA 4LGVA 4PZCA 3FBGA 4B7UA 4ZU3A 1EVZA 1SCUA 1A9YA 1B3BA 4FFNA 1HE3A 4TRMA 4BL5A 1LSUA 1P3DA 4ZJUA 4C7JA 3G1UA 4ZA2A 2DAPA 2QRLA 2EW2A 2F1KA 3DHEA 4LISA 1Z82A 4GKVA 1E7QA 4DBVO 1LDYA 2J5KA 3GVIA 3VPXA 3IIEA 5EN4A 2XPCA 1OC2A 3MEQA 1GAEO 1GDHA 1JW9B 5AVOA 1T2DA 5LCXA 2EF1A 2GN9A 1I3LA 3BMCA 4PG6A 5JE8A 3JYPA 4MKRA 2E6UX 1ZKMA 1ZNQO 4L75A 3ZHBA 4CMGA 4Z0TA 1U5AA 4UVGA 3OP4A 4N54A 4R51A 4AJEA 5KWEA 5ER9A 1AGNA 3ZZNA 3PIDA 5DBGA 2HAEA 4R01A 1HWYA 1SPXA 4GQAA 4MVJG 3WMXA 2ET6A 2EKQA 3KSZO 4A0SA 2Y1DA 3JQAB 1BDMA 1P1HA 1GEGA 1JTVA 3FRJA 1BVUA 1D8AA 4UUMA 4IJVA 4FD3A 1R37A 3JQBC 3VVBA 3OJEA 4XYEA 5FI5A 1QV6A 3GN1A 1A71A 2VRCA 5T5QA 4YJGA 3SEFA 3CPSA 4RPGA 1ISFA 2X5JO 2NACA 1X7GA 3HJAA 1PIWA 5JO9A 3BMQA 4Q3CA 4CMKA 1CERA 3Q9NA 4UEJA 2V6MA 3GEDA 3H9JA 4JX8A 1XSEA 3FNFA 1G1AA 4OQYA 1R16A 4IZIA 3H9QA 1H6BA 2OP0A 4LVCA 4AJIA 4YJGB 3HB5X 2Y1EA 4Q9NA 3F5SA 4OYRA 4RF2A 1NQTA 3GRKA 2X8LA 3BMNA 3DTYA 5TNXA 4ALMA 3ADPA 2VZ9A 1C0LA 3L0DA 3JQBA 5A3VA 1FDUA 3CMMA 2FR0A 3GDGA 2P2SA 2PD4A 4BMVA 1EBUA 4NR0A 2DVMA 1DAOA 1UXHA 5THKA 5K6AC 4CM9A 5DCWA 5EMHA 3MTJA 1P74A 2D5AA 1UZNA 1MP0A 4HFJA 4OKIA 5COQA 4FFMA 1VJ1A 4CQMA 1YL6A 3F4LA 1P45A 1BW9A 3HDQA 3C8MA 4P8RA 2JL1A 4HNGA 3ZDFA 4EW6A 4EZBA 3A9WA 2BMAA 1K0UA 3TZCA 1NPYA 3D5TA 3RUIA 4BV8A 1GPDG 1MGOA 1ZW1A 2AQHA 4FSHA 3FWZA 4BNUA 1ENPA 1DB3A 2DTEA 5KVQA 1TI7A 1LDGA 1NHWA 2IEBA 3AOEC 3HB4X 4XDYA 1HTBA 3BMOA 4IUYA 4QFDA 1GQ2A 3KV3O 3EHEA 4B79A 4YAIA 1G0NA 5TT1A 1HYEA 4QEDA 4EEZA 4NJOA 1YB1A 3DO5A 2FN7A 1Y5MA 7MDHA 5JYDA 4XJTA 1ZSYA 3D7LA 4BMNA 2W4QA 3LZ6A 2VRCD 2AQ8A 3E5RA 3MCVA 2IODA 3O26A 1ZH8A 1NAHA 4NH4A 3AOGA 1QR6A 4E2YA 3ZV4A 4BMSA 5ICSA 1ADFA 4EDFA 3HQ4O 2CSUA 5IN4A 1KEPA 4NFYA 1EBFA 1DXYA 4J4HA 3AY6A 3DMTC 2YQ5A 2PR2A 2NV6A 3GFGA 4RVDA 1ADGA 1GCUA 5G0SA 2RIRA 5KOIA 3E9NA 3GHYA 5BT9A 4DL9A 2D3TA 4ZD6A 3ORFA 1E0DA 3LC1O 5G4KB 4O0LA 4D7AA 1O89A 2DUUA 1A27A 3V1UA 1XHLA 3ONFA 4HFMA 1ZXBA 3IAHA 4Q3EA 4DLBA 1I2ZA 3BTOA 3I4FA 3JD4A 1LA2A 3RUDA 4BO3A 4TVOA 2JKVA 3OEWA 5FYDA 4CM9D 3I4CA 4UVIA 4JQCA 2QIOA 4CM8A 4UEKA 2VQ3A 3KZVA 4MDHA 4J0EA 4CQMD 2B36A 3PFWO 4P4GA 1P77A 4FPXA 2UUOA 1U8FO 1ZK1A 1UZLA 4G5HA 2TMGA 1V3TA 3JYQA 1Z6ZA 3CZRA 1NVTA 4RQTA 4NFSA 1KS9A 3NRCA 2EGHA 4R1NA 1B0AA 5CG2A 1EQUA 1D1TA 2ZTMA 3GPDG 3EZYA 3GGGA 4PN3A 4AJJA 3JQ8B 3NUGA 2O3RA 2CVZA 5BNTA 4OGWA 5G2OA 5L9AA 4IBOA 4RL6A 1KEUA 2JHGA 1RM3A 1I30A 3RI3A 2GUGA 1GQQA 4J1QA 2ZTUA 4NMHA 2W8ZA 1C0KA 1T26A 4IIUA 4EJ0A 3RKRA 3RUFA 1QRRA 1NWCA 3FI9A 3OQ6A 1P0FA 5IJZA 4LSWA 3ROPA 3WG9A 3MJCA 2YQ4A 4YTEA 4BNLA 1HRDA 4FC6A 1DC3A 1OFGA 4PG4A 4U8GA 4XD2A 2B4RO 3S2FA 5T67A 4R3NA 1NFFA 3EUWA 1LDNA 2J3KA 5COAA 4QSMA 3ZNQA 1F06A 3GT0A 3VPHA 4J6FA 3OBBA 5DP2A 2JAPA 4AJHA 1E3JA 3E5MA 1HLDA 2FY8A 3JQGB 4B7CA 5J9GA 5CEEA 1N9GB 3WBBA 3TJRA 1B8VA 2P68A 2NQ8A 4UUNA 2I9PA 5A9SA 1E7YA 1SC6A 2Z5LA 2O7QA 3WSVA 3WYCA 1L1FA 3WNQA 1XYGA 1HSZA 3CKYA 3WWZA 4IDCA 4B3HA 1LSSA 3AUAA 9LDBA 1PGNA 1YQXA 3NX4A 3MOIA 1ONPA 2PD3A 3ANNA 3UHAA 5HA5A 4NBWA 1NBOA 1ZBQA 3H3FA 4GGPA 2BFOA 2VWGA 4NDNE 3ZWBA 3VAZA 3WGYA 2FP4A 2BGLA 4QXMA 1GTMA 3DXFA 2F00A 4FB5A 1PQWA 2AMFA 3E1KA 2HCTA 4JBGA 4M89A 2GD1O 2VYVD 2QHXA 5I7VA 1H2HA 4L8VA 3HDHA 3LU1A 1N1GA 3WR5A 2V6BA 3LF2A 2GN8A 1L7DA 1YB4A 1PJ4A 1SNYA 5B37A 2ZYDA 3CEAA 2P5UA 2PK3A 5JYAA 4ZQBA 3SLGA 5EQFA 1WP4A 4FCCA 2GN6A 1UAYA 2CDAA 1NWHA 4Z3DA 3HUDA 2O23A 3VDRA 2OUIA 4HNHA 2ZTVA 1F8FA 1ZIDA 4WK6A 3DBHA 5DOZA 4J91A 4BNMA 1D4FA 1JKFA 3H9UA 1PQPA 1X0VA 1LQTA 1HE2A 4L4RA 4ZN6A 5FEUA 4BV9A 2VOJA 4TMFA 4A5OA 1A72A 1D1SA 4BKOA 3BXXA 5JC1A 3QWHA 4PLWA 3U09A 1NQAO 3MOGA 2C2YA 2X9GA 1H5QA 2NVUB 3V1YA 3DTTA 1IZ0A 1GU7A 1I01A 2FHSA 1RM5A 4WCFC 3SC6A 3KVOA 2HRZA 2OMEA 1F14A 3VH4A 2C7GA 1P9LA 3GPIA 3OIFA 1PQUA 5GMOA 2CF5A 4CMIB 5A03A 3ADOA 3O38A 5CFZA 3OA0A 2P4HX 1VSVA 1PJ2A 2B83A 3IUSA 1A5ZA 3SX2A 3DZHA 4D42A 1RKXA 1DLIA 2Q2QA 4BO6A 2DTDA 4J43A 1HE5A 4OH1A 3GUCA 1ZK4A 2HMSA 2W98A 1NFRA 4CR6A 2PZLA 4YAGA 2Y99A 1GYPA 2Q4EA 4GLOA 4DIFA 5IZCC 2VTEA 1LNQA 5HBRA 4IS3A 4I9HA 4A73A 4FJ2A 2DLDA 1CJCA 1AXEA 3ZWCA 3DZIA 2NADA 1MFPA 3ZWYA 4DC0A 3CZMA 4DA9A 1IHYA 3C7DB 1R0SA 3ETDA 3G0OA 4IZHA 2EHDA 2HK9A 3LT4A 3IKVA 1A7AA 1XCBA 3BHJA 5A02A 5JDCA 2HJSA 1WZEA 2FWMX 1LI4A 2WE8A 4IJWA 2PD6A 2YDYA 4RF3A 4WCFA 1D3AA 6ADHA 2NVWA 3PHGA 4NK5A 3WFJA 3KOUA 5CPBA 3TF5A 1R4NA 4YB8A 2BF7A 1XG5A 3R6DA 4CQLB 2A35A 4YJFA 1W73A 4BNZA 4CMJA 4JJIA 3TOZA 2IDZA 1ISIA 2Q3EA 2XF8A 4AJ4A 3RWBA 3PYMA 4RCVA 5MGBA 1KERA 1W4ZA 4J7XA 4CPDA 2X0JA 2PKQO 1WPQA 3IS3A 4R1TA 1XELA 2B37A 2FOIA 5IZCA 4DQVA 2CDCA 1G0OA 4R3WA 1FF9A 3CH6A 3GUYA 3JV7A 4E30A 5CEFA 1Y1PA 4LW8A 4YXFA 4FDAA 2D8AA 3RC7A 2PFGA 4YJFB 1E7RA 3WQSB 1Q0HA 4FJ0A 5HTOA 4PLHA 1Y7TA 1NAIA 1X13A 2GR9A 1YGYA 1JDJA 3KEQA 2ZB3A 4TROA 4IQ0A 4F45A 4RO0A 3DHNA 2CNBA 3K30A 3RUAA 4IDFA 5DDIP 2OFPA 3ROQA 1E3WB 1O9BA 2LDXA 2DT5A 3UH1A 3WTBA 1PL8A 2HLPA 2O3QA 4OL9A 4I8XA 4BNTA 1Y8RB 3B6ZA 5KNLA 5C5IA 4WJZA 4D41A 1U9JA 2R2GA 4J0FA 3TL2A 1R12A 2HMVA 4IS2A 4FGWA 4LVUA 5AOVA 2X6TA 2CVQA 3KHUA 1ZMOA 3LQFA 4XRGA 4I08A 3B20A 4CM4A 2EKLA 3VC7A 4DBZA 2PWZA 3VPFA 1PGQA 1U2DA 4S3MA 3KETA 4HP8A 1V35A 2Z1MA 3ABIA 1LSJA 3PLNA 1EDZA 4E5YA 1Y8QA 1R0LA 1BG6A 1HDOA 4AFNA 2EIHA 2AQIA 4YRAA 4FN4A 1SBYA 1P1RA 4ROSA 3LT1A 1IUKA 2ZQZA 3B1JA 1QYWA 5K0ZA 4UREA 3WIDA 3V8BA 4GAEA 3RFVA 3L6DA 1P44A 1PJCA 3F9IA 4XR9A 3V2GA 1JKJA 3NT2A 3U4HA 5TSDA 1SEVA 3RJ5A 4NJMB 2NTJA 5AYVA 4QECA 1Y9EA 3GNSA 3R3JA 3TQHA 2Y1GA 1HDZA 4PGFA 4WLFA 4EUHA 3AM3A 2PNFA 3OQ1A 2HQ1A 4IJUA 4MVJA 4YJDA 4I5DA 5IDYA 2O50A 4B3JA 2WYWA 1B15A 3ZNOA 1MC4A 1HYHA 4OMUA 2A94A 5K9ZA 4ZVVA 3L4BA 4QFCA 3U62A 4O59O 4JNKA 1R0KA 3Q6IA 2FPGA 4Y9DA 2JAHA 1NHGA 1GFSA 3O9ZA 3R3SA 4W99A 2EGGA 2FSSA 2Z95A 3UVEA 2QYSA 1E5LA 3EMKA 1M76A 1ZCJA 2A9FA 2GF2A 1BTOA 3GNTA 2PZMA 3B1KA 5JNLA 5IFLA 3D3WA 2WTBA 1U28A 4XX0A 3WGOA 3PHHA 4FW8A 3WGIA 4FFRA 2Y93A 2G1UA 1FDTA 4D44A 3FPCA 4YAJA 1B8PA 5JYEA 1XGKA 4AG3A 4PZDA 4JBHA 4B8ZA 3RBZA 1PWXA 1U3VA 3MZ0A 1BVRA 1PZHA 2UAGA 1OC4A 2V6GA 3E03A 4IGEA 4G65A 4PVCA 4ZQFA 3WNVA 4CMEC 4DIOA 5A05A 4XRRA 3HN2A 1H9BA 2NU7A 4QUKA 3EY4A 1B8UA 2EW8A 2DFDA 4RZHA 4BQPA 3OEYA 3HG7A 2QW8A 5BSHA 3GAZA 5DCUA 1N92A 3L9XA 3T4XA 2NQTA 3VOSA 1SB8A 2VOEA 3WGTA 5G0VA 5KJ1A 3WX0A 3L07A 4PLCA 1EFKA 3O4RA 3KEOA 2VYNA 4JJFA 4GVXA 3GZNA 1LUAA 4E13A 4J2HA 2FR8A 4ZQHA 4L0QA 1NR1A 1H6CA 1IY8A 3QSGA 5KIAA 4NIMA 3L77A 1K3TA 1ZEJA 3IJPA 3KYCB 1HF3A 2AW5A 1GY8A 4DQXA 3C1TA 2EXXA 4ND4A 3TZQA 3FNEA 4CLDA 3Q11A 4Q3NA 2NTNA 1MG5A 1M6HA 3PWZA 1CWUA 3GZNB 5KKAA 3U4DA 4Z6KA 2ZB8A 2J5RA 5IG2A 1H6DA 4P4LA 4MVJF 2AQKA 2GGSA 3S2GA 4I5FA 2Q99A 3CMCO 4BB5A 4XGKA 3C1OA 2H9IA 2RCYA 3D0OA 3GGPA 4R1UA 2C54A 1CYDA 2OOSA 3Q1LA 1C14A 1IYZA 4WNIA 3VTFA 4S1VA 3LVFO 4ILKA 2H63A 4MVJD 1K6IA 1V0JA 2TMDA 2YHIB 4IIVA 5JPIA 1M2WA 4RVFA 5GZ1A 2YYYA 4RVUA 5CDYA 2EKPA 1Y6JA 4F6LA 3A1NA 3OA2A 3S2EA 1JWBB 2AE1A 2Y67A 3DL2A 3H2ZA 3K2EA 5TGDA 4AJ2A 5IXYA 3GVHA 1Y81A 2R6JA 3HWRA 1SZJG 3K31A 4FC7A 4BOYA 4DIBA 2Q1WA 3ZV6A 4CLRB 4NI5A 1FDWA 1PJSA 5COBA 1QMGA 4LMRA 2YW9A 1YS4A 2OL4A 4H7PA 4BKQA 3GK3A 3WFIA 2J5QA 2Z1NA 3PYLA 2DBZA 3T4EA 4MVJH 5JMWA 2AE2A 2DBRA 1J4AA 1WWKA 3GZ4A 3JQAA 2DBVO 3PVZA 3WQQA 2ZK7A 3I1JA 1UUFA 1Z7BA 1KY5A 1ZEMA 1JU9A 2OHXA 5G4LA 1I32A 2Q1TA 3DOCA 1M6WA 3QJ5A 4J1NA 4RV9A 4BNJA 4N5NA 3P2OA 3C24A 5L53A 4EGFA 4ID9A 3BTSA 3NTRA 4PRLA 1FK8A 1E6UA 3SC4A 2O4CA 4CLHA 1N1EA 4YT4A 2P4QA 1J0XO 2Y05A 1QV7A 3PQFA 4XCVA 2EJVA 4ITUA 2B4QA 4YAKA 1FJHA 4ND2A 3HE3A 2DQ4A 5I7EA 3OSUA 3ZWPA 2BI8A 2IE0A 4GH5A 4DWVA 2CF6A 2ZTLA 4AVYA 2B4TO 4WLNA 1EEHA 2DPGA 4X54A 1KOLA 3OIGA 3WWYA 3RC2A 1SEPA 3ZW9A 5A04A 1TB4A 4CUZA 3O03A 5JCJA 1B2LA 4AJLA 4RJTA 2YHUA 3ANLA 4J4TA 3DC2A 3L4SO 4PLFA 3RU9A 2P9GA 3N58A 3FR7A 4Y8VA 5F1KA 4E31A 4WEQA 5TC4A 2GNAA 1YVEI 3JQDA 2EV9A 3FNGA 1GL3A 4JGBA 4FQ8A 4DGSA 1ZJZA 4IDDA 4RVHA 1E7WA 3QVWA 4NK4A 5I9NA 1IPEA 4CJXA 3LYLA 3C1AA 3M2TA 5JAIA 2NM0A 2Y1CA 2B0JA 4EBFA 1XR3A 1J49A 4O6VA 3OMLA 2O48X 1CQIA 4TWRA 4RPKA 3ZWXA 1PZEA 3F1KA 4D3FA 3BZUA 1YJQA 3MJTA 3OH8A 4RF4A 3ZHYA 4BO8A 3ZN2A 3QHAA 3RCBA 5H83A 4DYVA 1PU2A 3QQPA 1LLDA 2PKRA 1E7MA 4RPLA 5T73A 4GKBA 1JAXA 4NHEA 4K1LA 1BXKA 1UZMA 1WDKA 4FOSA 1R6DA 3EYWA 4OXYA 3JQAD 2OXIA 1X7HA 1J5PA 2ZCVA 1F12A 2AEMA 3UAGA 1ZSNA 4LSMA 4BNVA 1PWZA 4RPHA 1OBFO 4YDRA 1M66A 3LSYA 1DC4A 3O8QB 4GMGA 5KJ6A 3B70A 5U1PA 1ARZA 1DFHA 2JCVA 4M55A 3I9JA 1TT5B 1QG6A 2E48A 3JQ9C 2BLLA 3RBVA 4JROA 4D0SA 4WNCA 1T2EA 2PLAA 3H2SA 3Q3CA 1J6UA 2DUWA 2FMUA 3ZH2A 2AHRA 2X86A 4UUPA 1TVEA 5JCJD 4L73A 1U3UA 4FIZA 4IJKA 4H3VA 3DMYA 1A4UA 2DFVA 1AN9A 4LRTB 1UXKA 3ZV5A 1DHRA 2Q2WA 2GZ1A 1B7GO 2GO1A 3AU9A 1WMBA 4RZIA 5G4KA 2PV7A 2BD0A 4D43A 2NU9A 4IQGA 4GPD1 2UDPA 4B4OA 5JYFA 4D46A 2B5VA 5C3MA 1TEHA 3JQEA 4MOWA 3RSHA 4DTIA 4M87A 3MJSA 1T2FA 1Q0QA 1XU7A 2DM6A 1X1TA 3ZU2A 4HV4A 4ZGWA 2P5YA 1O95A 1NVGA 4YJHB 3GHHA 1I3NA 3VH2A 4XEHA 4OAQA 3CIFA 3NDIA 4GSKA 1MXHA 1C1DB 2GZ3A 3JQ9A 1ML3A 3MJEA 4RGBA 3TRIA 1HETA 3QE3A 3I9NA 4UVHA 2GDZA 4CV3A 2VTDA 1DIRA 2IZZA 1EUCA 1K89A 4Q3BA 4QQRA 1MX3A 4IDEA 4E2XA 3NAQA 2NNLD 1E3SA 1CQJA 5KVSA 2NLOA 4P4NA 4PG7A 3PJEA 3PP8A 2EG9A 3I9MA 1HDYA 1E3EA 1GYQA 3HN7A 1C3VA 3JQ8A 1LJ8A 1AXGA 4H15A 1CRWG 3W8DA 4KZPA 3H65A 4CM5A 3LT2A 2ZCUA 1VM6A 2WYVA 4BNFA 1U1IA 2X9VA 2GCGA 2AEJA 3AM4A 3C3XA 2WWRA 4DYDA 3ULKA 3P7MA 2DBQA 2A92A 4IDAA 5EL0A 2P91A 3F47A 1YQDA 5EINA 4WGGA 3GR6A 1U7TA 5IDXA 2P9EA 1DFIA 3D64A 3E6AA 1PZGA 1EUZA 3PRJA 3ETEA 3DR3A 3HDYA 2JFGA 1V3VA 4ND1A 1N2SA 4BO4A 1YO6A 2JJYA 2I3AA 2E82A 1OAAA 1MFZA 3T7CA 4CV0A 1GQYA 3STHA 5F1OA 4Z3KA 4CM6A 1E1KA 1QLHA 3GMSA 2YJZA 1AE1A 4GVLA 3H4VA 4QT0A 4YWJA 1KBZA 1ULSA 3JQGA 4KUEA 1EVJA 1X14A 1N9GA 3QW2A 3OETA 3I9OA 1HDXA 1ADCA 3DB2A 3DAGA 4YT8A 2Q2VA 3H3JA 4W4TA 1N7HA 4W9NA 2A4KA 2RHRA 5EPOA 1QYXA 3SJUA 1LRKA 2BKAA 3KBOA 1MXFA 5L40A 1YE3A 1BHSA 1T24A 3KO8A 2GERA 3PDJA 3RROA 2VHYA 3IDSA 3FHLA 3UUWA 2OP1A 5FF9A 1UP4A 5DBFA 1RJWA 4J90A 4BNWA 4BO5A 5L7WA 2PY6A 4WEOA 5L3ZA 1Z7EA 4MVJP 5DN9A 3OQBA 5L95A 1ZVMA 1VL6A 5KTKA 3RD5A 4HUJA 3I5MA 3VZRA 1GADO 1P0CA 5JAQA 2BHLA 1AHHA 5IN5A 2QX7A 3W4JA 3PZRA 3W4IA 4OSPA 5CAEA 5L4LA 5EJ2A 4MKZA 1PGOA 2C82A 1ZFNA 5T8KA 1X15A 4PLZA 1ISHA 5BQFA 3G49A 3GDOA 2Q49A 2Y66A 1OMOA 4D3DA 3WYBA 3RVDA 4R54A 1I2CA 3NEPX 1LU9A 2C59A 3E18A 2D4AA 1WDLA 3PJFA 5JAMA 4XDZA 5L7YA 2YDXA 1O6ZA 3ANMA 4WOJA 1KVQA 3BHIA 4OSOA 5M6DA 4JN6B 2NVUA 3E9QA 4EITA 4L74A 3EVTA 1HSOA 2VN8A 4F3YA 3DEYX 3UFXA 3GGOA 1NR7A 3JQ6A 3M1LA 4GX2A 1W8DA 4OXKA 3QVOA 3OJ0A 4WPGA 2C20A 5B1YA 3GH3A 2RH8A 4CMIA 2C5AA 4J9VA 1KY4A 4CM3A 1YWGO 4J1TA 4XIYA 5IDQA 2VUTA 4KOAA 2FR1A 5JDCC 4DQUA 2J8ZA 4CL8A 4BGEA 1XEAA 4WLUA 4Z0PA 1UJMA 4NBRA 2Q50A 3KYBA 4XGNA 1EVIA 1WW8A 2VCYA 5JAZA 3U3XA 1I5RA 2ZYAA 2UV8A 3TN7A 5ILOA 3VHRA 1H6AA 1E3LA 4FFLA 2QYTA 4DLLA 1N5DA 2HMUA 3G3EA 5A4DA 3AI2A 4BVAA 1PJQA 1SAYA 2O2SA 3JD2A 3TPCA 4QTZA 4E2ZA 4GI2A 4OJNA 3DFUA 3F6YA 2I99A 1E1NA 4I1IA 1DJQA 4ALLA 2HRBA 4EI2A 1LEHA 2X9NA 4OXNA 4EJMA 2PZJA 1VI2A 3AU8A 1JA9A 2WMDA 4TRNA 3V1TC 3QVTA 3LK7A 4AL4A 3DBVO 4Z9YA 4CQLA 3OJFA 4DREA 2BFMA 3S1LA 3ZV3A 4CLOB 5KVCA 2JHFA 3H5AA 2JFFA 2VWHA 2X5KO 1PL6A 2B69A 4NZ9A 1JN0A 3P19A 3D4PA 4JP3A 1DC6A 2Y0EA 3H9EO 5ITVA 1ZK2A 4G81A 2XXJA 1KC3A 1Z75A 4HFRA 3KSDO 3CTMA 1Q0LA 4XA8A 5AXCA 2EP7A 3H9GA 3EAGA 3ICCA 1I0ZA 1YL5A 2HUNA 3NV9A 4BIIA 5L7TA 4U0KA 3GMDA 3NT4A 1ZSVA 3OICA 3RUHA 2BGMA 3KXDA 4G2NA 4P22A 2PH3A 3JD3A 4J3FA 2I3GA 4WOKA 1H94A 5F3RA 1E77A 3AFMA 3VZPA 4BNHA 2X22A 1LTHR 5B4TA 1U3TA 1YBMA 1E3WA 4MIEA 4QX6A 3PZBA 1OI7A 4KDEA 4NFHA 4OOEA 1I3MA 5FFFA 1XKQA 5H81A 1CETA 1YQGA 1FXSA 3PQDA 3NGXA 4EYEA 2O2YA 1E92A 3RUCA 3F46A 3PYXA 3ZGYA 2EERA 1P1IA 1BXGA 1Y8RA 4Z9FA 1PJLA 1VSUA 2VHVA 4XQGA 1T25A 4RDIA 1HT0A 3CXRA 3JQFC 2DU8A 3DAFA 3RASA 2LDBA 2GRAA 2GSDA 1EZ4A 3GC6A 3PWSA 1UR5A 2QQ5A 5A06A 1Q2XA 2IRWA 3L9WA 3RAJA 2R00A 1Q7GA 2GZ2A 1BXGB 4XYMA 1I33A 5T6BA 4ALJA 2WD8A 4JK3A 1DBVO 2WD7A 1BDBA 2D0IA 4DMMA 3TZKA 4A2CA 3BHMA 4N18A 1EQ2A 3ROMA 1O94A 2YY7A 3HADA 4E2WA 2QZZA 2NU8A 3M6IA 3OJLA 4RORA 1PX0A 3L4BC 1QP8A 4BO0A 2BH9A 3PJDA 4R41A 3INRA 4K6CA 1K6XA 4NJMA 4RPJA 4BGVA 1BGVA 4B7XA 1E5QA 4CV1A 3INTA 1IPFA 3DQPA 3U9LA 1JKIA 2WD7B 3U49A 3ONDA 5IZ4A 3K5PA 5U9CA 3JQFA 1XA0A 2X1HA 3L6OO 2OZPA 3KLPX 4PLVA 3VZQA 3K92A 4PIVA 3UKOA 1U3WA 4XZ3A 3ZWNA 1UDCA 5L51A 4MKXA 4DRYA 2ZQYA 1VJ0A 1DIHA 1VPDA 2YZ7A 3GF4A 1T4DA 4HWKA 3PHJA 2G0TA 4Q3AA 1LX6A 1PJ3A 3KUXA 3BA1A 1P1JA 3GQVA 2NSDA 1U8XX 3UW3A 2ZKLA 2CVOA 1BWSA 2POQX 1YONA 3FF4A 5BSFA 5G0TA 1NPTO 2JD2A 3RFTA 4XQ9A 3LLVA 4P38A 4J9UE 3Q2IA 3WBFA 1Q7BA 3PDUA 2GPTA 3TWOA 4E6PA 1VL0A 4JLWA 4Y6RA 1W6UA 4B4WA 3A4VA 1GUYA 1E7SA 1KIFA 3WJAA 1EVYA 3M1AA 3C85A 3ZNNA 3I3OA 1Y9AA 4E4YA 4MIOA 5BNIA 1JVSA 3AUSA 1NXQA 1H9AA 1E1MA 4J16A 1E3IA 5CDSA 1JQBA 4BKRA 3GOHA 4MO2A 3KSUA 4OKNA 5G0WA 3G17A 3ZWWA 5ES3A 4MIYA 5A1TA 4FGSA 1KEVA 5TLSA 1P31A 2ZATA 4JBIA 3ZWAA 2SCUA 5JY1A 1V8BA 4E5PA 2X0NA 1UP6A 3MJ4A 1LXCA 1XIVA 3PFFA 4UVEA 1WVGA 3EZLA 3WS7A 4E0BA 2NTVA 3S2IA 3RKUA 1EDOA 2E4AA 1MV8A 4HADA 1EE9A 1YDEA 2HMWA 3CSDA 3JQ7B 4N5MA 5DBIA 5LC1A 2G5CA 4E3ZA 3H8VA 3KYCA 1PTJA 4BNKA 2O3TA 1R4MA 3UF0A 1ISGA 1FDSA 1X1EA 4N7RA 1C1XA 4ALIA 1BMDA 4NBUA 3IJRA 4II3A 1I36A 5TX7A 2J3JA 3UOGA 1HKUA 3SXPA 4CMCA 5HRUA 4KWHA 1KVTA 4FJ1A 4E5NA 4WLOA 3AM5A 3ENKA 4UEOA 4FR5A 1KC1A 1B26A 1X0XA 2IYOA 3A06A 2V7PA 3GN2A 1MLDA 1MUUA 1R4MB 1D7OA 4R69A 1ULUA 1C1XB 5TJHA 4EUFA 3JSAA 5JDIA 4AJOA 2OBNA 4IXWA 1HDCA 4BUCA 1X7DA 2YHIA 4CLXA 3PQEA 1ENOA 2CDBA 3TDKA 4MJLA 4PLGA 4I9UA 2I67A 1GV1A 1BXZA 5DF1A 3ZU4A 3D1LA 3HDJA 2W90A 3AFNA 2XOXA 3DBRA 4J7UA 1PS9A 2C0CA 2BI7A 3FPLA 3JTMA 4XR4A 2PKQP 1P1KA 4CLRA 1WDMA 5A9TA 4PLYA 5AQ1A 1ZK3A 5ILGA 1LSOA 4KQXA 2E37A 2Y0CA 1LDEA 2O7SA 4FOOA 4Z9XA 1HE4A 3NDRA 4KDFA 3PIIA 3ZNPA 1ISMA 3WGQA 2FPPA 2H1SA 1I10A 4M86A 1G6KA 5HWSA 2C5EA 3DOJA 3WSWA 1MA0A 3DBRB 3R1IA 1YKFA 2PA3A 4L76A 1NNUA 1RWBA 2W2KA 1IL0A 4XWYA 4K28A 2Q45A 3OJOA 4GX0A 4XIJA 1WMAA 3ITKA 3LDHA 4ZRNA 2JD0A 3NYWA 2XAAA 1VLLA 5LDGA 4RLHA 3VH3A 1ZXLA 4TKMA 2EP5A 4BGUA 2JD1A 3ROKA 3WDSA 3WQRA 2IXBA 4IQ8A 4KUHA 2W2KB 3HFSA 1W0CA 4XYLA 4RVGA 1VKNA 1H93A 5DOVA 1H0KA 2YV1A 3OFSA 3HSKA 2ZB7A 4YEDA 1HXHA 3ASVA 3AI3A 4ND5A 4MINA 2PGLA 2QRJA 2WJPA 2ZYGA 2XXBA 5CG1A 1N7GA 1V6AA 3DZKA 3WIEA 1EE2A 3KTDA 2VYND 5FI3A 2PGJA 1K6JA 4CUKA 3AWDA 1DIBA 1GUFA 4GGOA 4YACA 2RHCA 1PS0A 1IHXA 1PL7A 2X0IA 3K8ZA 1QXSA 3TFQA 3TSCA 1HL3A 3C7CB 3K9QO 4BO7A 4NNJA 4PZEA 4AICA 1XDWA 8LDHA 1SOVA 4PG8A 3R0IA 1QLJA 2PH5A 3SBOA 4AJ1A 4MVJE 4I5EA 3PGXA 5HS6A 2HDHA 2Q1SA 3EDMA 1PS8A 2O3JA 3BMCB 3IQDB 3V5NA 5EQDA 3MTGA 1NYTA 3NJ4A 4DLAA 2WM3A 2O3SA 4WLEA 4E32A 5I8WA 4MVJM 3TFOA 4J7CA 5CDGA 3QLJA 3P2YA 1PGPA 1VRWA 2HK8A 5U4QA 4Z0HO 1LDBA 5TT0A 2X4GA 3FSRA 3H7AA 2C7VA 1PR9A 2CZCA 3ONEA 4J1SA 2IZ1A 5BSEA 1DHTA 1XU9A 5HS4A 1CF2O 2C2XA 4D0RA 2P9CA 4RVSA 1LBEA 4DPMA 1SO8A 4R9RA 4RDHA 3TNLA 5KVVA 3JYNA 3CE6A 2ZJ0A 1DJNA 1DPGA 3CUKA 2X7HA 3I52A 2J3IA 3O8QA 5F1PA 1SB9A 3BMQB 3A28A 5C7LO 5JO0A 4W7IA 1DOHA 3JD1A 3ON5A 3FBTA 4YR9A 1TT5A 2FZWA 5CDTA 2VNAA 1VC2A 1RPNA 1UDBA 4NPCA 2AG8A 3GDFA 4DUPA 5H82A 1F0YA 4MP3A 4QO8A 2BELA 1HZJA 2UYYA 4U6QA 4R5MA 2GYYA 2DC1A 1LRLA 3GA0A 1C0PA 4W82A 1LLCA 3BMNB 8ADHA 2X0RA 2B35A 1YXMA 3OF2A 3VPGA 3WLFA 5JW6A 4E12A 5TRTA 1Z74A 4M8SA 1LQUA 1DFGA 4TRJA 1Q7CA 3G1TA
chains in the Genus database with same CATH superfamily
1W5SA 2FAXA 3H8WA 4KTTE 2B2CA 3N8GA 5ULLA 3AV0B 1HYGA 4W6QA 4BO2A 1XEXA 5FOXA 1K06A 4L4SA 2DPXA 4CL3A 2ZAGA 2GNOA 3HY3A 4WOCA 1ZM9A 2FGKA 2GPBA 5LLTA 4LBWA 2DFPA 1IY2A 1QOPB 3CUUA 4IAOA 4IV0A 4AYWA 3PXBA 4GBJA 1CUIA 2Q5FA 5KBYA 2Y9PB 4CQMB 1YFJA 3H5LA 3REFA 2QRVB 2OCGA 4H60A 4OPMA 1AVTA 3QUAA 1JLLA 2W6ID 4O4LF 4OFWA 4UU1A 5TMBA 1MDBA 1JHPA 1NN3A 2AVDA 5CFOA 5KYXA 3SVLA 3T5TA 4ZVMA 1PFVA 2I6TA 1C3EA 2PCLA 1O5IA 1FSSA 4M36A 3WA6A 1J07A 1UMCA 2YJ5A 3NH9A 1G291 2NAFA 4BHTA 2JVIA 3D4OA 2AL7A 2NSHA 3M2PA 2GI4A 5K6AA 3ILHA 4IZOA 2P35A 2BFNA 1K6MA 4H0CA 1W34A 1JFSA 5DCYA 3R5TA 2XRFA 4RKEA 3EZGA 1BRMA 2I2DA 4C0AC 3KRTA 5DT9A 1MN6A 2E89A 3A36A 1P5JA 3H5RA 4LRYA 2PSFA 3FPJA 4H7EA 4UZSA 3ZLBA 2G7MC 1KJYA 3OM8A 1HQYE 4D6YA 1FJGB 4QU0A 1R4ZA 1WLYA 2FFQA 4L6AA 3L0CA 2YV2A 3NNDA 1Y1TA 2VQFB 4XQCA 3DFZA 2C9CA 1UMCB 3FVWA 3CLSC 1EP2B 3A6EA 4C0HA 4DLTA 4E07A 1MB2A 3DZBA 1E9SA 1S2IA 2YFQA 3LUGA 3QBEA 4MRPA 1QBKC 1X42A 4D4IA 3HACA 1D2MA 5SZHB 4I3HA 5IT4A 3WHPA 3H5IA 4QDXA 4Q9HA 4MA5A 3EDRA 1NMSA 1T1RA 3D4NA 4E11A 2NXJA 2Z3ZA 2HU2A 1CD5A 4XJSA 5LLSA 2JGJA 3SFTA 4CLEA 1G3QA 4G1BA 4WZAE 5CHEA 2WUGA 1OIWA 3EEIA 3GJ7A 3DWGA 5DP1A 3NUQA 3GO4A 3KHTA 4YCBA 4Q6BA 3WVNA 2FZCA 2QVCA 3WIBA 1KK0A 3B2NA 3GJ5A 4GG1A 5EIBD 3QVXA 1MTZA 1Q0RA 3IE0A 4CLQA 2WU1A 1T8TA 4YRDA 3IQWA 2ESRA 5DCLA 3SR3A 1COWD 1UFVA 2RJNA 1WD7A 3BDIA 3CX8A 1V2HE 1J2YA 4IWYA 4DV2B 4HXYA 4C08A 5HM8A 1IZ8A 4X61A 1TXGA 5JS8A 2CNLA 2XD9A 4RIFA 2P2GA 1U2GA 5TXGA 4CEIA 4M9ZA 4OCZA 2EFYA 1JX6A 3BZWA 3V32A 3G0DA 3DVAA 3PUZA 1QHYA 3RVNA 1IN7A 1G8KA 3Q1KA 3EEYA 4LQLA 1XTZA 3O84A 4R8MA 3ZU3A 2H2HA 3TNJA 4QJ5A 3VV3A 4DLXA 1QZUA 4R83A 3E82A 4AUMA 1T0PA 1ZD8A 3B6IA 1RM0A 1Y42X 2D59A 3DMTA 3QEJA 3M6VA 2I4OA 4JOSA 4OM7A 3TIXB 5LOVF 2I76A 4CLDA 2D06A 4YMWA 3U3OA 5FBWB 1X87A 4E1VA 5BOSB 3NGLA 3P9NA 4H16A 1YRLA 3IPXA 4PS0A 2FZGA 1KKMA 4BDTA 4O5OA 5ALXA 5JS2A 4CFZA 1Q0UA 3AXTA 2CL7X 3LLMA 4YAWA 3S81A 4RULA 4UTPA 4UTXA 2ZI7A 3F4KA 3AVPA 4M1MA 4WWHA 3FGPA 3OQVA 1DCKA 4KH1A 3Q3JB 3H2JA 4TM8A 1VP9A 2NO6A 4B40A 2ISSD 1IC6A 4Q18A 4U0JA 1AQUA 5E6RA 3P9IA 2OA0A 3KM0A 1TU4A 2CB9A 4YRQA 2E4VA 1SVOA 2DCUA 2J9FB 1VE9A 2I2WA 3H5NA 4RENA 2IEGA 4WE3A 4QYXA 3LP6A 4RF5A 2FQYA 1DBRA 1XAJA 3G13A 4MKHA 3IJEB 1AUPA 2DHCA 5EJFA 1P4AA 2IBSA 3ESAA 1SOWA 1ZZEA 4EGJA 2OHJA 1O0BA 4JASB 5FWYA 1JHAA 1JUDA 1Z2DA 3NHZA 1XNRB 2QR5A 2XQKA 1WZIA 2FH5B 3PRKE 3WK8A 1RYEA 4B4KA 2RHGB 2XSZD 3PNPA 3NVMB 3W6ZA 1CXZA 2J6IA 2DFKB 2O52A 5IMSA 3PPIA 3R75A 4F8EA 1Z0UA 3D7KA 4A0RA 1RAGA 2G83A 3PXXA 4GWKA 4N5HX 2O06A 4FDLA 3UJ7A 4LRXA 2I5PO 4Z8YA 2IUYA 1BQ3A 5ABPA 3EZ2A 3RWOA 4ESEA 3U16A 1J70A 1XCMA 3MCZA 1SXHA 4X45A 3RFCA 3T4UA 4LMPA 4Z53A 1GZ4A 2ID9A 3IEVA 5YASA 3WJ2A 1BD3A 3NT5A 2H06A 1Y4UA 1ORDA 1ZDMA 2AVNA 2QZJA 4ZICA 1ESNA 1G64A 1XDBA 3EVDA 4I50F 1QH8A 3HJTA 3R23A 3RUEA 4O4HA 1BS1A 1MKYA 1UPFA 4X8HA 3F71A 4LXQA 1E0KA 3EDYA 3GX1A 3HUFA 4AKTA 4FBMA 4EQZA 4F4DA 2P2CA 3CU5A 1PJAA 1I6LA 4Q7MB 3H0VB 1XZDA 1TO2E 3WXBA 1I0IA 3ABZA 1C1YA 3OCYA 3PHCA 4M49A 4PANA 1P2GA 3H1BA 3WRYC 1P39A 4CKZA 3IQHX 3ZHOA 4DDUA 4A36A 3O2QB 4CUJA 1M33A 3CN7A 3CM0A 1WJGA 4EY4A 2JEZA 2EKBA 2C5BA 1FXWA 5IHPA 4U7WA 2BTEA 4MRVA 1MQAA 5SYAA 3DE7X 2QORA 3ZCXA 3CZ9A 3IIJA 3DS8A 1FLNA 1A4RA 1F6DA 3K2BA 3NR2A 4IDGA 4OVKA 2XLBA 1R6AA 2V0GA 1JHRA 3BXEA 4GZLA 1T3ZA 1Y7LA 2HWXA 5CX4A 2CLFB 4XB1A 2VT3A 3HB1A 1CE8B 1NRJB 3PK0A 5AKHA 1A5TA 3UC9A 2FEXA 4Y1GA 4UAUA 4RLSA 5LB2A 1BQEA 3R41A 4B3IA 3HSYA 1GG2A 2IZ0A 1AKTA 4A5SA 2GJ9A 5KOYA 3EAQA 3WLPA 1MX1A 1UKBA 2C95A 2GZAA 2BIFA 2I8LA 3GRPA 2WQZA 3O93A 2O0JA 2PWPA 3F78A 5HIMA 5BQ5A 3D7SA 4F5DA 1N5JA 5KB3A 4QNNA 1GRRA 3U4CA 4KRFA 2IEAA 3G79A 4YIHA 1ULZA 4TV9A 1KZ9A 2B5WA 3OTQA 2TSYB 4L95C 1ULTA 1U0LA 3T3GA 3VYTB 1GTSA 3CX4A 4EJSC 3OX2A 3ZR4B 4DR1B 1OTHA 3M6UA 5GZ6A 3WK7A 3IULA 5JQWA 5KKCA 1XN1A 3EC7A 1JNYA 1RI2A 1WUJS 1X19A 2GTPA 2KYRA 2PVSA 2H2WA 3FRHA 4BFZA 2ZUDA 1CUVA 4YY3B 4NYIQ 4WASA 5T4FA 1YNSA 3CRZA 4FZ5A 4MUKA 1I79B 2NTYC 1THGA 5DHSA 4YXWD 1P2FA 2PRJA 3EUAA 1BCRA 3KKZA 4DYHA 3HU2A 3KWLA 1TYDE 1ZH4A 2XTJA 4TZKA 3Q85A 3QMMA 4OGKA 1XL0A 4HQNA 1IZZA 1EFPA 3UK1A 4CNBA 1SIUA 2X2PA 3UAZA 3I5AA 2P0YA 3OMXA 2AS0A 4IVQA 1EXMA 3NHUA 4DV1B 3IKLA 3BIOA 4YT5A 1ICEA 3GPLA 2O4UX 4Q4HA 1YBAA 3W8EA 3A6FA 2FZEA 1BKSB 2H57A 2QVZX 1QGUA 4D57A 3OM9A 4EB0A 1OXSC 3WLEA 4YCSA 1Z9BA 4YV1A 4L3VA 2V7XA 4O29A 4CV2A 4YT2A 2R00C 1IB6A 1YT5A 1XVVA 2FTKE 4ZAZA 2Z6QA 4G4SP 4NBKA 4OHUA 1BCRB 2CMKA 4MGKR 2SECE 2WAXA 5HYVA 1F8GA 1QSGA 5IM5A 3FSGD 3ETGA 3VV2A 3AONB 1L2TA 3HJCA 3OZWA 3EK2A 3ZDXB 1DPFA 4WFJA 1PN3A 4EJSA 2Q22A 2O2CA 3QIAA 4TWIA 1Z16A 5IJ0B 1R9MA 4GXNA 3GFBA 1QE5A 5IH3A 2GILA 1VJCA 4I9NA 2OCLA 4CKCB 3HCDA 1FCJA 2YJNA 3C5EA 3RF6A 1R15A 3TSAA 5THQA 5GJBA 1K2WA 4CR7A 2EKDA 2I87A 4UXIA 3ER6A 3NHRA 3KU4A 2VF4X 1K66A 1NKTA 2CUKA 5A1JA 4KGVA 3QWIA 4DIMA 4NU0A 2YJ3A 2AC4A 1F4PA 3KBBA 5IDWA 2R86A 4UFPA 4H18A 4HDRA 3MA0A 3DZFA 1BCSB 1PR5A 1RYYA 4JUCA 2Z2XA 3T1NA 3KQTA 3SZGA 2OGSA 5E8RA 4JXKA 2CJPA 1G7TA 2G1JA 3F5MA 3NEAA 2IKQA 4WLVA 5I6DA 4PFQA 1QZTA 3RYIB 1E1CA 1ZK0A 1JG2A 1UC8A 2C0QA 1FFYA 1YRAA 3LPNA 1JWAB 4BO1A 4JCCA 1NQOA 1KH3A 4XOIA 4UQLA 1BS2A 3EF0A 4LK3A 3NHJA 2AC7A 4NL4H 5DM70 1KYYA 1E69A 5TQ0B 4UQOA 4XGIA 1UDAA 5JC8A 1U3DA 4OP2A 2GA9A 3DUWA 3RTDA 1Z73A 2VPXA 4FNOA 1S7CA 1T4BA 1DWOA 2PN1A 2QJRA 2CZQA 1K08A 4HGPA 3RU2A 4BQOA 1RI1A 1YBHA 1JSXA 4EUEA 5JNVA 2EZ9A 4H7IA 1CG6A 2A6PA 2XECA 3D31A 3G02A 1TIPA 2DJ5A 4UASA 2IF0A 4YBRA 3ZW7A 3FR8A 3HO1A 1P7VA 5EKTA 4UCFA 3OHSX 4AWAA 1XJ5A 5LSAA 4RCYA 2VWQA 4HZUA 4CG1A 1Y6GA 3SD7A 5LZ4A 4BPRA 1LLQA 1OPXA 5KDLA 4ATNA 4DJFC 2J3LA 3KVRA 2W2PA 5AJWA 3ILVA 3OAAA 5LBIA 4LYFA 1OLUA 2EOAA 3TXYA 2J0UA 1TKRA 2F9MA 1NX6A 4KMSA 4NOKA 1FC0A 4KN6A 5KHAA 4ER6A 2VF7A 5CCEA 1JAIA 2G08A 3FDFA 5D8DA 2XTMA 3JD0A 4F7DA 3IALA 4HNQA 3KUUA 3AP2A 1C9MA 4PHCA 1L8LA 3M3PA 3WYEA 2P6RA 2H1IA 4BS9A 2Q0QA 4R7TA 4JELA 4HZUB 2I4MA 2JLYA 2D1YA 2ZR0A 3TFWA 1NGSA 4OYYA 1WXGA 5IXSA 3GVPA 4YONB 5TQVA 4BEJA 3QUQA 1TUEA 4C0XA 3W4KA 4PFJA 5KYUB 2XTZA 4GSLA 4JB8A 2I1QA 1VL8A 2QPLA 3DDZX 5IVIA 1H9CA 4NMWA 3MJVA 4WKCA 1DRVA 1TJPB 1EX1A 2JFHA 3EF1A 4KAAA 1UJCA 2HJVA 2O14A 2QG4A 4JIGA 1P1FA 2GB4A 4ZU1X 1DJOA 1Q7EA 4LC0A 1T1SA 4BX8A 4KFCA 5FPSA 2REQB 2CY0A 2IWRA 1UDRA 3MWKA 4DZZA 1MPXA 2OQRA 5LR6A 2JFQA 3EGOA 4O02B 1UFKA 4W1QA 4RZSA 4TRRA 3C41J 1D4ZA 3MIIA 4F86A 1FOEB 1T2CA 4UULA 1K6EA 2HXYA 2HKIA 3O4VA 4E1AA 5C35A 5DTQA 2HK7A 3PL5A 3KXKA 3NJ8A 3HKBA 2ZRNA 3EB9A 1NMYA 2H5LA 3HV0A 1UP7A 4EI9A 5JDIC 3SVTA 1D1PA 1KMCA 3HI4A 1EFVB 3L8YA 2NWQA 2VHQA 5K3EA 1D2AA 2ZUUA 4Y67A 2FUG1 1NV8A 3HXPA 4MV6A 3L4EA 4QPNA 1JEDA 3GEGA 4HRVA 1K5HA 3EPKA 2LCIA 5D01A 3B12A 3N8IA 1T36A 4YFYA 5LPNA 1VYVA 1Z08A 1MT0A 4YVFA 2IS2A 3WNZA 5LYJF 2JIPA 5LA6A 2Q9BA 1N6KA 5AK0A 1OF1A 1PFUA 3MLAA 4L8GA 1G8AA 1GGKA 4BYGA 1QGDA 3VZCA 4NQZA 4Y6GB 4PZZA 2QKYA 3PC6A 1GGJA 4DXHA 1IZ7A 3BD6A 3Q4GA 3RIYA 3C3DA 4LKOA 1LI5A 4N3BA 3RVKA 3MWDB 1PSWA 1XD8A 2M1XA 1O94D 3M33A 4Q3KA 2I7CA 1QFMA 1WHSA 2FPGB 3E9EA 1XLTA 2UVDA 3H6KA 3KKLA 3N74A 4MRAA 5A9RA 1T36B 5HGXA 5IKMA 2MOKA 3HFJA 5K8UA 5DNAA 4LJKA 4IKPA 1NVEA 3H2GA 4NG5A 3GA7A 4FFPA 2PTGA 5BNWA 3VPSA 1TM3E 5LA6B 3NIDB 5L3VA 3U5TA 3P97A 2E0IA 2J33A 1EMDA 3AI7A 2J3DA 4BMCA 4TTQA 3RIHA 3D3WB 1N8SA 3QXGA 1JRLA 4IF4A 3LUJA 4OM8A 4Q4AA 5GY7A 1DCFA 2HO4A 3EGDB 3MBKA 3ZCVA 4ASUD 1DINA 4TN1A 3AHJA 9LDTA 5CEJA 1UANA 1WHSB 4Q9DA 3TYXA 2P40A 2VXYA 5HQJA 3V8RA 1AHIA 3AVYA 1YL7A 4Q39A 1TJYA 1GT6A 5BSWA 4R84A 3R8CA 3Q7TA 4ERXA 1TLLA 4BKPA 3FYSA 1X3LA 5D51S 4OA8A 3G2KA 4D9KA 1E1LA 5K45A 1U4OA 2XUIA 4OK6A 5CB0A 4RA6A 3CSUA 2GX6A 3LHKA 4OHPA 1KK1A 2W6QA 4YO7A 3NWJA 3OTIA 3WC4A 4NMXB 2FN9A 2O07A 1K7EB 1EM8A 3O75A 4GE3A 4HBGA 5DH9A 3WLLA 1UK9A 1V4BA 2ILTA 2Q0SA 3TLGA 1R0ZA 4IVNA 2AZTA 2QVYX 3GLTA 1DL5A 3RARA 3RRJA 3T99A 3PTZA 4CMEA 3TLZA 1JMKC 1JU3A 1NI3A 3GYBA 2XB8A 1WCYA 3PXAA 4R2KA 3RTAA 3ZXXA 1L7EA 4HYEA 2OSBA 1ISPA 4MUYA 4KNWA 4CF4A 4XB2A 3GJYA 4MQBA 4X41A 3ISTA 3U48A 3W2TA 3BTVA 3LC7O 1EFRA 2J7KA 2P4EA 3UAWA 1EXVA 4L9RA 3FW1A 1QH1B 3WGHA 5HPYB 4PQFA 1JXOA 3X1WA 4AAYA 2DPHA 3EASA 5F2NA 2YV4A 4AJKA 4M38A 4B6EA 3D4BA 1P0MA 3OLZA 3I6BA 3K9LA 2H59A 1L4BA 1F2TA 1RC1A 3ECSA 5JXWA 3T8YA 4UUOA 1KZ6A 5D3ZA 2R0QC 4TPKA 3Q8WA 3WDKA 5B5SA 3L1KA 4LGVA 1JDVA 3JZFA 3DNPA 3FBGA 4KMRA 4LXUA 3FMPB 4LXYA 3ENQA 1SCUA 1B3BA 3CRQA 4FFNA 1HE3A 3K70D 4RH1A 4PHTA 1MRZA 1PR6A 4TYPA 4W5JA 5CVVA 3U7QB 3A6HA 4ZJUA 2QUZA 4LTNA 4ZA2A 1WW3A 2NYUA 1KDRA 2RGRA 2YXBA 1WPRA 2WZQA 3LQKA 5LBUA 3BC1A 4HYQA 1F2TB 2HA0A 4GKVA 4LISA 4LYJA 4XARA 5E6UA 2B25A 3GGCA 4NCBA 5KAPA 5B3JA 3VPXA 4JKOA 1IPHA 1REQA 3QV2A 2YFYA 3AIKA 2V96A 3M9WA 2IK8A 1WQ1R 2A1IA 2Q27A 2J1LA 5LCXA 3WRXC 3BMCA 2O8DA 1PZNA 2LR0A 3CWCA 4MQUA 2HSJA 1DJPA 4RIEA 2HI0A 1SQ5A 1U5AA 3SYLA 4R51A 1XJQA 3DV0B 2FW1A 4K0RA 1AGNA 3ZLUA 3PIDA 1W0KA 1HTTA 2HHLA 3G1WA 3K3PA 3WI7A 5KNCH 2ET6A 3FY4A 5K20A 3ZE0B 2QY9A 3RC3A 1REQB 1BDMA 4KHZA 3U39A 2HF2A 3FRJA 1FQWA 3BJZA 1D8AA 1R8XA 2Z9BA 3HR4A 1BMTA 1T1JA 4MROA 3RRNA 1ZNYA 5EIBC 5FADA 1O97C 3VVBA 2P11A 2JI6A 2YASA 4FYHA 4J94A 2FX5A 4K3UA 1QGED 4FGUA 4UXJA 5FI5A 2XGJA 1KI4A 2XA1A 1DEOA 3A10A 3WWCA 2KBEA 3NHSA 1G4AE 1L8XA 4PEVA 4C76A 2IY9A 4PPYA 4V39A 1JMYA 1VIAA 5T5QA 3TLBA 3V6MA 2ODNA 5FUYA 2D2EA 2FA9A 3SQDA 4M8IA 2Q29A 1X7GA 1PIWA 1SR8A 2WHXA 4MQEA 3VJLA 4BFTA 4HVTA 3Q9NA 3T9DA 4H1WA 4JENA 2IFTA 1U81A 2AN1A 3PSHA 1DXQA 1F9EA 4JX8A 4MDYA 3SBEA 1B1CA 3IQFA 1XSEA 3STUA 4C6HA 1EGAA 4OQYA 3ESZA 3D59A 3H9QA 4IZIA 5AVTA 1CIJA 2V9CA 1KGSA 3OTOB 1SJ9A 1RZ3A 4XEUA 1LWNA 4AJIA 3D1VA 4IOLA 4WA7A 3ZGNA 3T7JA 2GEDA 3FUXA 4MHOA 4W8GA 3IAM6 3AF4A 4G5YA 4MQEB 2XA2A 5ESRA 1RZUA 2R1ZA 3UC5A 2VJCA 5DX1A 1YVDA 3DTYA 1Q1GA 1J0EA 5TNXA 2AX4A 1YD7A 2ZREA 1E58A 4PNHA 5KCMA 3O8OA 1A0OA 1C0LA 1BX1A 1OSNA 2W2NA 4G8BA 4J0KA 4N65A 2QZPA 2QJOA 1Q12A 3CMMA 3GDGA 1EESA 2YBEA 4DV6B 3DE5X 1CULC 4R6XA 4NR0A 1A9PA 3R9XA 2DLCX 1MV5A 3R7LA 2PAAA 3Q10A 3SLRA 5LQKA 2HQSA 5AW8A 1ZS9A 3EF3A 3F7TA 4F91B 1TW3A 3HA5A 3MTJA 4DDHA 3H6HA 4NS4A 3CWZA 4RA9A 1WXWA 1YASA 5IBRA 2GAJA 3NWEA 3RSSA 1P45A 3C8MA 121PA 3KSRA 2AI1A 1RHQA 2HQBA 2C7QA 1GPH1 1MOSA 2YIVX 2MHCA 3D0RA 3A3OA 4OMDA 5IVHA 3TZCA 1NPYA 2WWXA 4CHTA 3UTCA 5LUBA 1MGOA 2C78A 2GYWA 2HTFA 2HHHB 4F38A 3K35A 1P2DA 3PR3A 3FWZA 4BNUA 3KZCA 1ENPA 4DDTA 3L0IB 1DB3A 2BKVA 4I8DA 1DCMA 4TLCA 2PQMA 1KU6A 5J4KA 1TI7A 2HT6A 1BFKA 1NHWA 3AOEC 4EGSA 1K63A 3D1JA 4F5EA 3EOZA 3GLGA 1EM6A 4MAMA 1HTBA 3BMOA 4IUYA 3PEVA 3EIQA 3GDWA 4LY6A 1RU3A 5F2EA 3U3JA 4YAIA 5C46F 2WWWA 2XVXA 3BBLA 4ISBA 2M98A 4NQRA 4QEDA 3WYFA 1BH2A 4MR7B 3DYIA 3TW8A 4EEZA 2P69A 2A0FA 4KG7A 4M9XA 3IUBA 2PUCA 2FN7A 1Y5MA 3TINA 5FUMA 1BDIA 1NUSA 4LVNA 1ZSYA 3ET4A 2GYVA 3D7LA 3PC8A 3LZ6A 5IKXA 1FRQA 4B3XA 4EG6A 1YZHA 2AQ8A 1JP7A 3MCVA 4LYDA 4RHYA 4CTNA 2A2ZA 2ZU6A 1NAHA 1KH2A 1Q83A 2ENWA 4CVNA 5ALJA 1QR6A 1XTVA 3D6MA 4J0HA 2ZIEA 4E5DA 1CQPA 2NPFA 4E5VA 4B1FA 4UD2A 2AXEA 4KR0A 5CLGA 8ABPA 1E1YA 3OMWA 1WKVA 4EDFA 5G3ZA 5ICSA 2QV0A 2ZLBA 1JBQA 4IXNA 4S0ZA 4ZCPA 2G8LA 4S2UA 1KEPA 1R8SA 1XRSB 2IYRA 1EBFA 3RE1A 4J4HA 1DKMA 2UVPA 4XTRA 4DY6A 3LXMA 5JH7A 4HGOA 2WABA 1KSGA 1ADGA 3AINA 1SFRA 3CB4A 3CZCA 3O9MA 3B51X 5K05A 2XCLA 5FEMA 4AZTA 1F1JA 2WFLB 1C7JA 4O89A 4PYMA 5B2FA 2BYTA 3LTEA 2QYOA 1FPMA 1QB7A 2D3TA 4WKOA 2O8NA 4LGMA 4PHGA 2VVTA 2J41A 2IE8A 2FKAA 2NV2B 2O2ZA 1T43A 4X1OA 4ZVOA 1ZC4A 2QBYB 2AOVA 1A27A 4IFEA 1EHIA 3IAHA 4HFMA 1U1DA 1QR2A 1YCGA 3AWIA 3UANA 3FIUA 3G0GA 1I2ZA 5K8VA 1M5RA 5F3WB 2XVYA 3PSAA 2DMRA 3RTEA 5AHKA 4A23A 2NQ2C 5K0GA 2GARA 4MGIR 1N25A 4P3KA 3K09C 1U5BB 1Z5PA 5EFOA 2V59A 3AKZA 1HX7A 4CM9D 1A76A 3I4CA 5EWLB 3QPWA 2WM2A 2ZYUX 1G6Q1 4UEKA 2DUNA 3KG2A 1N5LA 3TAUA 1JILA 2ZJZA 3BHNA 3P2IA 4GM0A 4CQMD 4LHEA 2VS1A 3MB5A 3RF7A 1T6XA 2W5UA 2JGNA 3DO8A 4S04A 3MSXA 1ZK1A 2VDUE 2IEYA 2ISQA 2ZJYA 4DMFA 5EZYF 4YMTA 4L8FA 1H2AS 2PUBA 1YIAA 1Y48E 3EPAB 1G7CA 1V3TA 2P8SA 5REQB 4QYWA 3RRXA 1WY7A 3ZUPA 3ADBA 1Y6QA 5AKEA 3PXEA 4L8LA 1G41A 3NRCA 1XZEA 2RK4A 3GAAA 3JXEA 2POCA 2NUTA 3VR6D 5CG2A 5LD2B 3GPDG 3H5OA 3GGGA 4GIBA 4PTLA 3R9IA 3EPHA 4Q66C 3W2GA 3JQ8B 2ASVA 2NPIA 1GARA 2CVZA 5BNTA 3SKYA 5G2OA 5KZMB 3CIOA 4IBOA 1N3LA 2PFSA 3KK0A 4RL6A 1I30A 3ILYA 3RI3A 2GUGA 1PT9A 1HZZC 5L3QA 4BZWA 1KRWA 2G1AA 3P0IA 1JKMA 1JQDA 3WL3A 3K09A 1YJBA 1NP7A 2FF5A 2H5EA 3QGMA 1C4KA 4LSWA 5BN4B 4BNLA 1Z4LA 2H2FA 1GCIA 1VB3A 1HRDA 3EFBA 4M76B 4BN5A 821PA 1U6JA 3NJRA 1MB0A 1N5IA 2H4JA 4DLKA 4H7JA 4XD2A 1JQ5A 2ORVA 2ZU0C 3O4IA 2HCRA 1IBMB 3TQOA 5C0OE 1PK7A 1SK9A 2IL1A 5BUCA 1EHCA 1I7PA 2JI8A 3MYYA 1NOIA 1OAKA 1P9WA 3GT0A 1CVIA 4UCQA 5CTJA 5E0KB 4DGQA 3VPHA 4ED9A 4F8YA 3VR4A 2HC9A 3EXAA 3UMMA 3OBBA 5DP2A 5FP0A 4R2MA 3OE1A 1U2TA 3C7TA 5H9WA 2RB5A 3AG5A 3LHDA 3GV0A 3EP6B 1DWQA 4LJRA 1JEEA 3P4XA 3V8QA 2OESA 2XNDD 2DUMA 2ONJA 3I09A 1U9YA 3JQGB 3IAXA 2G7ZA 1CUYA 2IGBA 2JJ2D 3E58A 4IP0A 5CEEA 4G1FA 2DRIA 1RNLA 3PUWA 5SZJA 3MFQA 3W05A 5A9SA 4HZGA 3TTWA 1SC6A 2Z5LA 2C5FA 5FNVA 3EULA 2NXEA 3WSVA 2GXSA 3CKYA 2EBUA 4E3WA 4B3HA 3F96A 1AQLA 2IYLD 4QEKA 1TMGE 1YQXA 3NX4A 3NBMA 3MOIA 4IGKA 1NDHA 2H1WA 4EKGA 2V97A 3C8HA 4OKSA 4UZFA 3ZVLA 2FP4A 2BGLA 4GPBA 1GTMA 4URZR 1RCTE 3TIGA 4ND8A 1JTFA 5KU1A 3KB1A 4FB5A 2CHVA 2HCTA 1HKHA 2IOFK 1UKYA 4IFBA 4BX3A 2RKWA 3GLFE 4KXMA 3DGFC 5ECYA 2NZXA 1GO2A 1R3UA 4QRIA 4RHEA 3O92A 4K81B 4DCTA 1VP3A 3HXOA 1YAJA 1E0JA 3PE6A 1RYFA 2R62A 1SNYA 2ZYDA 4QHSA 4LY3A 5M29A 3FAKA 5ANRB 3N87A 1ZHHA 1WP4A 1SZPA 2GN6A 2R6R1 4FCCA 4Z3DA 1NN1A 1GZVA 3IP8A 4TYMA 2C4TA 2O23A 1JJAA 2DHEA 4YP7A 1MU0A 5DIFA 2OPBA 3HJHA 4QXQA 3TTYA 3VDRA 1ZIDA 3TTSA 5DOZA 3NBQA 3BF8A 4BJ5A 5DU2A 1NLMA 2GZSA 3IIKA 1C9NA 4ISCA 2EYQA 1HE2A 4ZO8A 5K3DA 3S2SA 5BQXA 2XMQA 3A0RB 5FX2A 3MD0A 4A5OA 2H0QA 1D1SA 1Y3IA 2Q3CA 2Y1LA 3Q3GE 4JVMA 2VP5A 5JC1A 1E5XA 4PLWA 3U09A 3W5DA 1NQAO 4AC9A 1TKCA 2C2YA 4KPUA 4NEHB 4DR4B 1H5QA 5B7QA 3IDZA 1QFSA 4C0LA 2ZTSA 1JL3A 4L50A 3G85A 1W52X 4EMUA 2A84A 2OXEA 1MD9A 1PEAA 3O73A 3PGKA 1MQSA 3CSSA 1B00A 1TC1A 2F2TA 2HRZA 2OMEA 2XV1A 3IHWA 3GPIA 4EG8A 1T3HA 3DHVA 4OHCA 2ICAA 5AVUA 3OIFA 1PQUA 4I4TF 2CF5A 3QBTA 3ADOA 4QKQA 5FPTA 5FULA 2BSQA 3IWDB 3R5JA 1E32A 3SX2A 5DK4A 4DCMA 3DZHA 4KJXA 3K6KA 1DLIA 1GRCA 2Q2QA 4EHDA 4AZ0B 1FIUA 4XXHA 1SKUA 3O31A 3D6HA 1M9NA 4J43A 1HE5A 1YDMA 1Q22A 5AM5A 1M34E 2W98A 1NFRA 2I1LA 4CR6A 3KOYA 2PBZA 4B2PA 1GYPA 5C5CA 4A0HA 2WIAA 1D5WA 3GGSA 4G41A 1DQYA 5IZCC 2W9XA 1SXPA 2VTEA 4IS3A 3MERA 3CX7A 1K75A 3AR3A 4B3BA 4GLBA 1OFTA 1Z6AA 1CJCA 3LWDA 3AVOA 3CZMA 3C7DB 1R0SA 3ETDA 5JZMA 5KHOC 5A4FS 3QEBZ 4DKXA 1OZFA 4JI1B 5K03A 1PD1A 5A02A 4O8JA 1W5AA 1UT8A 3M6FA 1LV8A 2PRYA 4HB3A 1C7IA 4CFSA 1CZLA 3G5TA 1LI4A 1XALA 1J7KA 2C3OA 2L69A 5DWVA 2YOFA 4RF3A 4W5WA 1SCDA 3TW0A 4RMJA 4Z5XA 3OLXA 2ZAOA 2GJSA 2NVWA 1Q3TA 4NK5A 3ZG6A 4EPVA 4V1CB 2ZRPA 3SC2B 2ZPTX 3KOUA 2PHZA 2RGDA 3TF5A 3NNNA 1FU8A 5BN1A 1RXUA 4YB8A 2QT9A 5DLQC 1VE6A 4RD4A 5DMHA 4P9NA 1QUEA 4N6GA 4CQLB 4YJFA 3Q41A 4U2DA 4B3SB 4L78A 3TX6A 1YDHA 2IXGA 1DV2A 1E1RA 3ZQ4A 4MI9A 4FHFA 2ZULA 2ZSFA 2IW3A 1ISIA 5JBNA 2XF8A 4KGDA 2O0MA 3VDXA 4EHBA 3RWBA 5C9ZA 3PD7A 2GT1A 1DTSA 3V4RA 1KMIY 3VYRB 1XELA 2FOIA 1AG9A 5IZCA 4NENB 1T1EA 4HR7A 4LFAB 3FYDA 2FMKA 2CDCA 3CF0A 4UOZA 4YXFA 2ECKA 1Z68A 1BYUA 4HEA1 4YJFB 1NW5A 3RSGA 4CQJA 1E7RA 1FYEA 3WQSB 1Q0HA 5EA2A 5ICGA 4G1MB 4ZI7B 2IKSA 2O20A 4PLHA 4Z0NA 2FXIA 3ZS8A 1QP7A 1RRGA 2ABWA 4MQ6A 3V55A 4RO0A 3K30A 4EYKA 4Z4EA 1UWLA 1X8XA 2QT1A 3OOJA 4D9GA 2QVBA 2RHTA 3LV8A 3ROQA 4HD8A 2OOKA 1A98A 3A1EA 4CIYA 2DT5A 4HWTA 2HWYA 4TLBA 3SR4A 1RJ9B 4CBVA 4U9UA 2FB9A 1PDWA 5KEIA 1NYRA 1FXUA 2BW0A 3AHEA 1O77A 4I8XA 3TS1A 3K0BA 1F8UA 3NM6B 3B6ZA 1V96A 4KE7A 4RHXA 1OX6A 4FZ3A 4BFUA 4DCNA 1U9JA 4TV8F 4J0FA 3TL2A 3LY8A 4MRSA 3SX0A 2QVGA 1H2RS 3UAVA 1T13A 4LVUA 3RJZA 2QOEA 1Z7YA 1U0FA 2X6TA 2CVQA 2H9AA 3PC2A 4P2BA 3KHUA 4U4AA 3G9QA 4XRGA 1LFDB 1OLXB 2IZ5A 1VKZA 1Y5LA 2B3TA 2PWZA 3NONA 4N0PA 1P8AA 1LK7A 1K8YB 2FNAA 2JKZA 1Y3BE 2JLCA 4HP8A 4HAXA 4MIKA 4ZO4A 4RHTA 3PLNA 1UWCA 3I2IA 2QEQA 1R0LA 1HDOA 3EISA 4HN2A 2AQIA 2GHTA 2O1XA 4FN4A 3A9RA 4XAQA 4M1TA 2KLBA 1SBYA 5JECA 4DSNA 4GMKA 1M72A 1HK7A 1LPPA 3PPXA 1IUKA 5JCOA 4UREA 1MEEA 2JDIA 1DU4A 3WIDA 4AT1A 2P79A 3IUNA 2WV7A 5ELXA 5LP6C 4OMFG 2BJHA 1DBWA 3F9IA 4XR9A 1LVGA 4JITA 3NT2A 4PE5B 4MMXB 3RJ5A 2XODA 5EP1A 4EUSA 2NTJA 1E1QA 4GUAA 5SZIA 3C3PA 1J8FA 1KI1A 2R8RA 4DVGA 1ZVQA 3R3JA 1KF0A 1N57A 1NURA 3W3AD 5JZ9A 3WDMA 2EZ8A 2R65A 1IXRC 2IH5A 4I55A 4D56A 4DG8A 1C7EA 3QBDA 2G63A 3ZHVA 3PPWA 2PZBA 3FPKA 4ZJZA 5E4YA 4MVJA 4YJDA 2BKLA 3WP0A 4AQYB 1XZPA 1T35A 1F60A 2WYWA 3IE2A 3ZBTA 1MC4A 4L6IA 2EG5A 4YRZA 1FNMA 4OMUA 3L0ZA 4F5YA 2Y4OA 3Q87B 1EG2A 3U62A 4O59O 3NAMA 3TUXA 2CVHA 2JAHA 1NHGA 3O9ZA 3R3SA 4L4ZA 4W99A 3U3MA 1YB7A 3H2HA 1O6CA 2PS3A 3QLEA 3UPUA 4JYAB 2GPNA 4L5BA 2APJA 2C94A 4QQ8A 2AOUB 3EMKA 1ZCJA 2GF2A 2OBFA 3W78A 3LNTA 4DLPA 3ZJXA 5IFLA 1E1DA 5HKAA 3KR2A 2WMYA 3IEKA 4ZEVA 3WGOA 5FBLB 1H1LB 1OXKB 3OZTA 4FFRA 2CXNA 1HMPA 2VXCA 3FPCA 3DP7A 1U3CA 5JYEA 1XGKA 2BGIA 3MRSA 2ZSJA 5BORA 4P1ZA 4B8ZA 5BYAA 2WMNB 1U3VA 5J2UA 1BVRA 3DL4A 3B36A 4G1CA 1EK2A 2AR7A 2XMRA 4IQFA 3KJHA 4KGXA 1QCDA 3NHYA 4X3CA 2DHRA 3HN2A 1H9BA 3MJHA 1V8DA 3DKRA 4KLZA 5H70A 1W59A 3RS8A 5TPWB 3EY4A 3DOEA 3GMTA 2EW8A 1XZLA 4BQPA 2XQJA 1O8BA 5CIQA 4M98A 4BLPA 3HZRA 4A6PA 3C3JA 2ZSDA 1KO7A 5BSHA 3PWTA 4BAGA 4EVRA 1JR6A 4QL3A 2JGFA 1N92A 1AS2A 4PU0A 2NQTA 2M6RA 3PXGA 1RXIA 5G0VA 5KJ1A 4X95A 5DX8A 2YRFA 3ZHTA 2D5BA 3L07A 4Y6OA 4Z4QA 4C7OA 3O4RA 4W63A 2PT5A 1UBNA 3CPJB 4L5AA 3DZ6B 1EVKA 4P84A 3O0DA 4K9NA 1LUAA 5GPBA 1R5BA 4NHOA 2BT4A 1XTPA 2CXTA 2P9FA 3C14C 1NR1A 3IPYA 2XE8A 4A8PA 1RZRD 3W77A 2HX1A 2BMJA 3PLAE 3H5TA 3CE9A 3CEHA 3SQXA 1LFAA 2W37A 1URPA 3ERCA 1V25A 4D3ZA 3KYCB 5CX1B 4FD2A 3E35A 2W70A 1GY8A 4ZYVA 4DQXA 4DMCA 3T5DA 2HYIC 3C1TA 1Z2NX 2GAIA 2I03A 1XRLA 3D6UA 3MRVA 2EXXA 2IUTA 5H8WA 4C7OB 3G59A 3Q11A 2ZSBA 4YJ3A 5EMMA 1M1UA 1XU4A 5H59A 3G2IA 3U4DA 1M6HA 3AEQB 1CWUA 3PWZA 4RY2A 4RH3A 1N33B 2J5RA 4Q5IA 2OYSA 5CR9A 1Y9JA 2DX7A 1QE3A 3R6TA 1EFAA 4TYQA 5DM1A 5JZBA 2XYRA 2VPYA 3CMCO 3GIDA 2BJWA 3C1OA 2H9IA 2RCYA 1B6GA 2CXSA 3GL9A 4WFQA 4R1UA 4XPIA 1U0TA 1PFYA 1I4WA 2IPLA 2C54A 5CM8B 1CYDA 2OOSA 3ZJYA 4EG7A 2IYYA 1C14A 4KE8A 4WNIA 1TCBA 3E81A 1W85A 2NSJA 3NXSA 4FEYA 3VTFA 2O2JA 4EPYA 5KMGA 1MHTA 1V0JA 3X1YA 3EN0A 5DN6A 1D6JA 4MW9A 1L4UA 3VYWA 2YH2A 1P7PA 2WZCA 5GZ1A 4MSUA 4ZJPA 2QTGA 2WNSA 4EO9A 2BC9A 1X1DA 5HBGA 3ZX4A 1NQUA 2OPHA 3TDMA 3ZJVA 3ZWQA 2AE1A 2Y67A 2AN9A 4FLMA 4D8UA 5TGDA 1VLZA 1GP2A 1SKAA 1ZINA 4WAUA 3U80A 4AJ2A 2IXDA 5ES4B 2OFOA 1W85B 1E60A 1WZCA 3CJRA 1Y81A 2J6HA 2ZETA 4FC7A 2Q1WA 5KMGB 1DQNA 3OBIA 4B09A 4NI5A 4BCCA 221PA 1WU8A 1I6WA 1QMGA 3P2JA 2H4FA 3D7RA 1W25A 4H7PA 3ZE6A 3GK3A 2JZCA 5DHRA 1V9CA 2Z1NA 2C03A 4F06A 1TVKA 2FPPB 4OFBA 4NZMA 3HU5A 4U2GA 5EC8A 5FNZA 4E5UA 3DUFB 2E4ZA 2W22A 1OR8A 2AE2A 2DBRA 2VEOA 1WWKA 5TY0A 3QKSA 5IH7A 4DUZB 3JQAA 1F3LA 1U8EA 3ZDEA 2P6MA 3G2PA 4GDMA 2O8EB 3FI0A 1ULAA 4JBYA 4AMVA 4BXOA 4XGRA 4DAOA 3OE4A 1U1FA 2PBLA 3GUHA 3MGKA 5LZ7A 5L53A 2JAXA 4AQ7A 5BXQC 4ID9A 1J56A 2QK4A 4TKUA 3ED5A 3BTSA 3NTRA 4LGYA 4YCNA 1UEIA 5E3IA 1WZ2A 1E6UA 2F6RA 1B6SA 3MMZA 4J75A 4TSRA 4YT4A 1XTKA 1AKWA 1DEXA 2VAVA 1IVNA 3OWXA 5EJ9A 2I0FA 1CR2A 4XCVA 3QKSB 4ITUA 4IHJF 2ZYRA 4ND2A 5K0NA 1VBNA