3QVXA

L-myo-inositol 1-phosphate synthase from archaeoglobus fulgidus mutant k367a
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
392
structure length
392
Chain Sequence
MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFASPMDTNVINTHEQFVVLKEWYSNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol-1-phosphate synthase (Ino1)
publication title Atomic crowding drives the catalysis of myo-inositol phosphate synthase, as deduced from a crystal structure of a trapped catalytic intermediate
rcsb
source organism Archaeoglobus fulgidus
molecule tags Isomerase
total genus 160
structure length 392
sequence length 392
ec nomenclature ec 5.5.1.4: Inositol-3-phosphate synthase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qvxA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qvxA01
3PK0A 4F6CA 2ZCUA 5BSHA 1NQAO 1HF3A 4PVCA 1I32A 3B20A 3UVEA 1I5RA 2GLXA 4BNNA 4MKZA 1LRLA 1NVMB 4MIYA 3DEYX 3CZRA 2QRKA 5JO9A 3KHUA 1P0FA 2Y1OA 1EVIA 2UUPA 4HFJA 1KS9A 5IG2A 4CJXA 1P9LA 4OQZA 3H4VA 3HB4X 1ZXLA 2RCYA 3KYDA 1NWHA 1SB8A 1BW9B 1H9AA 4AJOA 4Q3NA 1WMAA 4AL4A 4QFDA 1RJWA 1S6YA 1ADCA 3ZGYA 4CMIB 4YYZA 2BF7A 2H9IA 5BSFA 2HAEA 5LC1A 5EQFA 1HDXA 4D45A 1H9BA 1PU2A 1N8KA 1UR5A 3DZGA 1DLJA 4MP8A 3TDKA 2Y0EA 2AQIA 5GZ1A 1QLJA 4WCFA 1YJQA 1T2CA 4DMMA 2QZZA 1UAGA 3QE3A 1MXHA 1E7MA 4NU5A 3W6UA 4BKPA 2CF6A 5CEJA 8LDHA 4MP3A 2J5RA 3AI2A 4PLTA 4RDHA 3RUIA 3C1OA 3JQGB 1FDTA 4AJNA 2QIOA 4OHUA 2DAPA 1E0DA 4TMFA 5ITVA 2GN4A 4N5LA 2PGJA 3ORFA 3K5PA 3NV9A 3HDHA 1M6HA 3BMNB 2DC1A 3WXBA 1KEUA 4LSWA 5JCJA 2BRUA 2W4QA 1NPDA 2DTDA 5C37A 3DBRA 4NNJA 4MJLA 3DC2A 3H3JA 5G0UA 5I7VA 1EE2A 1LDMA 4QEDA 2HU2A 4GWGA 5G2OA 4EZBA 4C7JA 1LLDA 2VT3A 4JP2A 2OL4A 4BNVA 1T24A 2Q1SA 3C1TA 3F46A 2DVMA 3GVXA 2C29D 4BO7A 4Z9YA 1HYHA 1P33A 3K30A 2AMFA 3NDRA 1VC2A 4FR5A 1UZMA 4XQCA 5EIOA 3UN1A 4ZHSA 4QFCA 4UVGA 4K1LA 3BTSA 2EW8A 5JYEA 1YH3A 2XXBA 5F21A 1P45A 1NVGA 2XPCA 4KWIA 3PP8A 4R1NA 3SC4A 4E3ZA 2AEJA 4N54A 2CDBA 2G0TA 2RHRA 3QWBA 3PHJA 4IDDA 3ZWBA 2HMWA 3AOGA 4U8GA 3ONFA 5EN4A 3D0OA 4UEJA 5KTKA 3ZNPA 3GDFA 1Y5RA 4BNHA 3K9QO 3MEQA 2FR8A 1PGNA 4ZA2A 3TZCA 1IPFA 1W73A 4BMVA 2IEBA 4XIYA 3GUCA 2BFMA 2DKNA 3VTZA 3SVTA 1WWKA 1YDWA 2VUSA 4IDGA 4YRAA 2IODA 1H6DA 1AHIA 1WMBA 1T2FA 2NTVA 1U3VA 1EBUA 1SZJG 3GMDA 4J9UE 3LC2O 4B4UA 1TXGA 3WTCA 1R4MB 1JN0A 2O3SA 3LF1A 3B1KA 3LYLA 1PSDA 3WGQA 4R1TA 1EVJA 3DXFA 4XKJA 1ENPA 2VUUA 4UREA 4CQMB 3NRCA 1T1RA 3KV3O 4TSKA 2D3TA 2IXAA 2VOJA 2HK7A 2IRWA 3IOYA 1Z75A 4GX5A 4LISA 5JDIC 3D3WA 7ADHA 3VPSA 3ZHBA 4FSHA 5A9TA 3DBHA 3W4KA 4DBZA 2GN8A 4PLPA 1I24A 5F1KA 2AQKA 4DLAA 5JY6A 5B4UA 2X22A 1E7RA 1A72A 2BGMA 2I9PA 3IDSA 4JBHA 3ZCXA 4Y67A 4AVYA 1JAXA 4CV2A 5I9NA 1ZJYA 5HS4A 4Z0HO 1Q7BA 2B4TO 3FN4A 4DL9A 1LDNA 4XIJA 4BNZA 4Z6KA 3K2BA 3WNQA 1KVQA 4OIMA 4L8VA 2HJSA 2PLAA 1P77A 1U1IA 2YY7A 4PGFA 4W7IA 2X5JO 4GH5A 3PGJA 3TOXA 2BLLA 4J1NA 3DMTC 5A03A 2O2SA 3K8ZA 1HEUA 3VH2A 3TZHA 2FZEA 4DVJA 4E4YA 4BGUA 3TWOA 1PTJA 3EMKA 1PGOA 3DBLB 1XQ1A 2OO5A 2WD7A 4E21A 2ZJ1A 4P4NA 4D46A 1GL3A 1XA0A 3PJDA 3RUDA 4O6VA 1P1JA 2DPGA 3OA2A 3HJAA 3U3XA 4B3IA 4W6ZA 2JAPA 4DC1A 3BHMA 2PFGA 2BGLA 2BKAA 4ALNA 1E92A 3KLMX 2LDXA 1UDAA 2PTGA 3ZU3A 4BO6A 1IYZA 2A35A 2VWPA 3TZ6A 3FNFA 3ZWPA 3JQFC 2OOSA 3WX0A 1ISJA 3D64A 1RM5A 4EUFA 5G0VA 2YV1A 2QW8A 4DWVA 1DRUA 1O94A 1Q0LA 2D0IA 2NTNA 1ISHA 3KSZO 2JFFA 3AUUA 1WVGA 4R69A 5TNXA 1XLTA 4I9HA 3R3JA 3QQPA 4JQCA 4NBTA 1N9GA 1PS8A 3H9GA 1B0AA 5T57A 3DB2A 1GDHA 2BFOA 1KETA 1MG5A 3GF4A 3TL2A 4J7CA 4IIVA 2AQ8A 2NV6A 1X0XA 3QW2A 4OSPA 2W2KA 4U7WA 4K28A 2IEDA 2JCYA 4TRMA 2C07A 1U5AA 3ZZNA 1HDOA 3PYLA 5HRUA 2JJYA 5JBIA 1JAYA 3EC7A 4GKBA 2G76A 1HLDA 1UXIA 2QRJA 3WQRA 3R6DA 4QECA 1ISIA 3AFMA 4S3MA 1GV1A 1O8CA 1O95A 4UUPA 4WGGA 2NVWA 4D79A 4ND4A 4D0RA 2QHXA 1F8GA 4N18A 1F8FA 2V6BA 5KVSA 4WKGA 4YQZA 5F3RA 1LI4A 3NAQA 5TF4A 5JYDA 1EBFA 3QWIA 4RPHA 2FRDA 3QWHA 1HKUA 4ESOA 3L4BA 3S2FA 2P5UA 4J1QA 4CMIA 3QVSA 2B35A 4IS2A 1GU7A 3O4RA 4TKLA 4Z9XA 2F00A 1P1FA 4NDNE 3FR7A 1ZIDA 2WSBA 1PJSA 2AG5A 4RGBA 3O9ZA 3PEFA 2GUGA 4J49A 4PVDA 4LRSB 4KDEA 1G0NA 4ONEA 2Y68A 4YCAA 4EBFA 3IMFA 3OEWA 1XQ6A 3GEMA 3E9MA 3E5RA 4OO3A 4J16A 3PWZA 3IL2A 3TSCA 5JS6A 3JQGA 1T2EA 3IKTA 2B37A 1LDEA 4OKIA 2FMUA 1CDOA 2NM0A 3LT2A 3AI3A 1VE9A 3BMNA 2SCUA 3NDIA 3GVPA 4CR7A 2ZB7A 3GFGA 1C14A 4RV9A 5TQVA 4JLWA 5MGBA 4CMKA 4CLEA 5KOIA 2Y1CA 4NR0A 3T7EA 3ROQA 4ROSA 1VJTA 1I2CA 3RBXA 1NR1A 2O48X 3PWKA 1NHGA 1E6WA 2ZIZA 2FWMX 4M8SA 1YL6A 1BRMA 3MJSA 5U9CA 4OQYA 1AGNA 4IDEA 3IIEA 3W4IA 1PX0A 3WJ7A 1UDCA 1JU9A 4WLUA 3EHEA 4OXNA 3WQQA 3JTMA 5IN5A 2NU6A 3FSRA 3MJVA 3GLQA 4X54A 4DC0A 3NTOA 1H0KA 4E6PA 1V35A 3ADPA 1DIHA 1KVRA 3KM0A 5JCXA 3LZ6A 4Z9FA 4FFLA 1OBFO 2VZ8A 3JD4A 2IZZA 3A14A 3GZ4A 4Q3CA 3AM3A 5HWSA 1H6AA 3NT4A 1SOWA 2DBVO 1SCUA 4AICA 2PZLA 1DLIA 2W2LA 3H7AA 2FPIA 2YFQA 3VPGA 3WSWA 5GZ3A 4EEXA 4PN3A 3L4SO 4TVBA 5EL0A 5AXCA 4DQVA 4J4HA 1WLYA 3TRIA 3GN2A 3FWNA 3NGLA 1ZW1A 4IGEA 5L40A 2OHXA 3JD3A 4QXMA 3WGIA 1TT5B 4PG7A 4BGIA 1GCUA 3IJPA 2GYYA 3UF0A 3VKVA 1ISGA 1D7OA 1NFQA 3U4DA 2W98A 3RJ5A 3ITKA 4CQMA 4E13A 3BMQB 3RUAA 1PR3A 5KVVA 1ONPA 3N74A 4IXTA 4TRRA 4XQ9A 4B3HA 5I7SA 1E5QA 5L51A 5BT9A 3GOHA 3N58A 1YBAA 3EK2A 3U09A 1U7TA 1C1XB 3RBVA 1X1EA 4I8XA 4ALLA 4Z0PA 3RAJA 3TOZA 4RQTA 5JAMA 1I3KA 5THQA 3SJUA 4R3NA 2Y1EA 3OFSA 3AUAA 2OFPA 4F46A 4HFNA 4Q3DA 2OZPA 1T1SA 1OOEA 5A04A 1DC4A 2C82A 1OC2A 4NFHA 1BXZA 3RKUA 1BWSA 1SOVA 3AJRA 3FWZA 4UULA 5IXSA 1NFFA 5G4LA 4GX2A 4AJPA 3L9XA 1DJQA 3VH3A 5IZCC 2OGUA 1D3AA 2NADA 4LRTB 3FNHA 4TRNA 5AYVA 1DRVA 2CVQA 2B4QA 1IUKA 2H1SA 2V65A 4ZQBA 1VSVA 3TZQA 2EGHA 1I3NA 1O9BA 3LQFA 4P38A 1NXQA 1E7SA 4OYRA 4RPKA 1Y7TA 1DC6A 3Q2KA 3RFXA 4YJHA 1LX6A 4G2NA 1EDZA 1UZNA 4MPDA 3ETEA 3QWFA 5FI3A 3OM9A 4YRDA 1F06A 2HSDA 3ZWWA 1EZ4A 4L4XA 4Q3AA 1TVEA 2JCXA 4CLDA 3O8QB 3DAGA 3VVCA 3ZNOA 3KEOA 4H7PA 1P1RA 1HWYA 2ZTLA 1KIFA 2WM3A 4NK4A 3S2GA 4D44A 3FI9A 3H9UA 1DIGA 1D1TA 2ZTUA 1IULA 5L95A 2J8ZA 3C7CB 4K9DA 2C0CA 1IOLA 1M66A 3I6QA 1PS0A 5TC4A 2A9FA 3MJCA 1M2WA 4IPTA 1DFGA 4OM8A 3TF5A 4J3FA 3OSUA 5BR7A 4MVJP 1ISMA 2NU8A 5I9LA 3Q0EA 1I3MA 3WGOA 3NYWA 4BO8A 1U3UA 3RC2A 2ZCVA 1UZLA 3ZHYA 4XGIA 1NYTA 1E5LA 1DAPA 3E18A 1LSJA 4BKUA 1ONNA 4XYGA 1VL6A 3WGGA 1ULUA 5CG1A 3OA0A 3BHIA 4CR8A 1O0SA 1OAAA 3GNQA 4ZN6A 6ADHA 1MP0A 4GX1A 4E33A 1LRJA 4A27A 3UKOA 4B8ZA 3VH1A 3JQ8A 1JKIA 1RPNA 2AXQA 3T4XA 2BI7A 1K2WA 3JQDA 3OECA 3DO5A 1EUDA 2Q99A 5AVOA 4YVFA 4IXWA 1BXKA 3D3EA 4WASA 3GAFA 4I9NA 4YT4A 3GVHA 3WGZA 4WE3A 1TEHA 1WDMA 3ADOA 1BSVA 1O89A 4RVGA 2NU7A 3OIFA 1UXKA 3RI3A 5JO0A 1VM6A 1XR3A 2FSVA 5IFLA 1HDRA 2VRBA 3OIDA 4RDIA 3U9LA 2Q2VA 4GSLA 3E8XA 2C5AA 3RKRA 4BNUA 2G82A 2DUWA 4BQPA 4DYVA 3ICCA 3BMOA 1KY5A 4LSMA 1W6UA 2X8LA 2UYYA 4RCVA 2NTJA 2X0NA 3JYLA 3CE6A 4XRRA 4CR6A 1BXGB 3GPDG 1ARZA 1JDJA 1LDYA 3GA0A 4Q3BA 4DMLA 4Z3KA 4YJFA 1HL3A 3ZN2A 3OJFA 4I9UA 2DM6A 3T4EA 3ONEA 1P1KA 3KRTA 3R0IA 2EKLA 5A05A 1JW9B 4QSMA 4L73A 1SPXA 2OUIA 1IB6A 4O1MA 1X7GA 4D0SA 2O4UX 4ITUA 4HKTA 1UH5A 1X1TA 5L3ZA 3PHGA 3D7LA 2C59A 2J3HA 3VPHA 2P9GA 2X9VA 2RH4A 3PTZA 3AM5A 4YB8A 1N1EA 1EMDA 2YUTA 1HXHA 4XYEA 2EEZA 4J7XA 4YAEA 2NVUB 3PDJA 4N5MA 4ND5A 5CAEA 1N5DA 3RSHA 3WS7A 5C3MA 2GPTA 2Q22A 4RZHA 1SMKA 2ZATA 2Q45A 1AUPA 3Q1LA 4D41A 3PYXA 5H82A 4RPLA 3AM4A 1VL0A 4R4JA 1KEPA 4MDHA 1PJ2A 2Y66A 3I9JA 5B12A 4NJOA 4KWHA 3RU9A 3OEYA 2Q2QA 1H2BA 2NVBA 4PRLA 5I8ZA 2NLOA 3C3XA 1WNTA 4NH4A 4YWJA 3GG2A 1ZO8A 2J5QA 2UVDA 5HM8A 3I23A 1HE5A 1Q0HA 4GVXA 4G65A 5DP2A 2GGSA 4BV9A 1TI7A 3QV1A 4L4RA 1WP4A 3G0OA 1HZJA 3P7MA 3O26A 4MKRA 3RUEA 3RUHA 4DQXA 5LDHA 8ADHA 4QO8A 3EVNA 5THKA 3B6ZA 4BGEA 2I76A 5L53A 3DZKA 1PJCA 1B7GO 1HDYA 3I4FA 4B4OA 5IDWA 4IY1A 3WQSB 5JFOA 3VTFA 1UAYA 4XJTA 3CXRA 3ZHZA 4DLLA 3BTUA 4R41A 4DPMA 3K96A 3CZMA 1QV6A 5L7TA 3GGGA 3IKVA 1CYDA 3UGKA 3PLRA 3GG9A 4NI5A 1TT5A 4KOAA 4E5MA 1OZAA 2X23A 3OP4A 4E12A 5BSEA 3DL2A 3F1KA 3ENNA 5COAA 3M1LA 1ADFA 3G49A 3BMQA 1HSZA 3U4IA 4B7UA 4DPLA 4NMHA 1GCOA 4RJTA 4AJ2A 1ENZA 4RO0A 4ILKA 3BA1A 2CD9A 1V8BA 1R12A 3Q11A 3VHRA 3GNSA 2P2SA 4PG8A 1FDUA 2DTXA 2I5PO 2V6FA 1JTVA 3LF2A 4PLWA 1QMGA 4U6QA 4BGVA 1MUUA 3RIHA 4Y6RA 5FFFA 4K26A 4O63O 4D43A 2X9GA 4RORA 1E6EA 3WIEA 2YJZA 4RVUA 1XSEA 1GUYA 4E5NA 3NEPX 5CHEA 3PWSA 3DONA 4OSOA 3K73O 5DN9A 4O5OA 2GERA 2B4RO 4WPGA 2CNBA 3MTGA 4IUYA 1IL0A 3TL3A 4R9RA 1MGOA 4MVJG 4Y6PA 1S7CA 3OETA 4B8WA 5JAIA 4R5MA 4BKOA 4WOJA 1E1MA 3BXXA 2HK8A 3JQ9A 4F6LA 4PRKA 1CWUA 1Q7CA 2Z95A 4TKMA 3I1JA 1YOVB 2NU9A 3W8FA 4BQRA 5I8WA 1ZK1A 3HHPA 1V6AA 1CF2O 1EK5A 1V3VA 3D5QA 1H6BA 1DHRA 1OC4A 3Q2IA 1MC5A 1ZH8A 4MINA 1YE3A 1I2BA 2CY0A 2UUOA 1DDOA 3JD0A 1VJ0A 1TLTA 3DBVO 1E3WB 5AXBA 2AEMA 1GZ3A 5CDYA 1Z82A 1JKJA 5DCUA 4BHTA 4YBZA 4WK6A 4MIOA 3ZDFA 1NR7A 2WYUA 4HFRA 4BS9A 5IDQA 4PG6A 2PZJA 2AG8A 1DSSG 4RPGA 2DTEA 1WDKA 2Y0DA 3DHYA 4J6FA 2PKQO 4ND3A 4XYLA 4D7AA 2UDPA 1F17A 3EVTA 4ZQHA 1QKIA 4LMPA 1B26A 5IZ4A 3L77A 2WTBA 4E30A 4UVIA 2FPPA 3H2ZA 2GF2A 4YDRA 1LXCA 3UHAA 4UUOA 3WBBA 3OJEA 1J49A 3K92A 4L75A 4IJVA 4BL5A 3QRWA 4NJMB 4B7XA 4DGSA 3JSAA 2G1UA 3PQFA 4WECA 2YZ7A 2EXXA 3WLEA 1L7EA 1HTBA 2EKQA 4BO5A 3JYOA 4J0EA 4R9SA 1U3WA 3RCBA 1CERA 4UAGA 5GY7A 2Q46A 4DIOA 4EUHA 3RJ9A 1E1NA 1I2ZA 1K6IA 2Y0CA 4LGVA 4BB6A 2HKIA 4R1SA 2A94A 4YQYA 3HADA 3DDNA 3U49A 4BNKA 3GQVA 1A4IA 5C7OO 3GVCA 3QLJA 1P74A 4R1UA 2QX7A 3JYPA 1DC3A 3EW7A 3AK4A 2FZWA 3GGOA 4XEHA 4A10A 5J9GA 1YGYA 1JVSA 3IC5A 4XB2A 1GZ6A 1M75A 4TVOA 1N7HA 4CMJA 1B14A 4F3YA 2QYTA 1YB4A 3F5SA 4HNGA 2VT2A 2NWQA 1BXGA 2YDXA 3LVFO 4R51A 1ZMOA 3IQDB 4DRYA 4BO0A 1VL8A 4GMFA 2WYVA 3L4BC 4W9NA 3GAZA 3GEGA 5DOVA 4ALJA 5CG2A 5L4LA 4ZD6A 5EERA 1R16A 5A1TA 2GSDA 4J4TA 2JHGA 3ETGA 1AXGA 1O5IA 1ENYA 4I5EA 1DOHA 1ZFNA 1UDBA 1Q1NA 1EFKA 1ZCJA 1X13A 1OFGA 2YW9A 4J90A 4MO2A 3QJ5A 3UCXA 3PIIA 2C2YA 1ZJZA 2C2XA 1NX6A 3ZI0A 4IM7A 3KSDO 1GTMA 3VDRA 1PGJA 4E32A 2D1YA 2NVUA 2ZQYA 1HDZA 2PA3A 1U2DA 4IQGA 4L0QA 1PJ4A 4IIUA 4LCJA 4D42A 2X5KO 2FHSA 4MVJM 1D1SA 2VWHA 2AEFA 2PGLA 4U5QA 4YT8A 2VNAA 1IY8A 1HZZA 1QRRA 2RHCA 5IN4A 5JNLA 4PLVA 3GDOA 1QYXA 1WZEA 2X1HA 3RROA 4E2XA 2Q1WA 4GKVA 4CM9D 3T7CA 1Z7EA 4JROA 1QXSA 2X58A 3CSDA 2EWMA 3K6JA 4CM8B 1DB3A 3EYWA 4RF5A 3A4VA 4OXYA 3ROMA 4MVJF 1YS4A 3PHLA 4BB5A 1C0IA 1Y8QB 3LC7O 3LT1A 4YTEA 3SLGA 1E77A 4W82A 3INTA 1YDEA 4HADA 3X2EA 3FNEA 2AW5A 2IZ0A 1FMCA 2J3IA 1LA2A 2EP5A 3ZNQA 5JDCC 2FSSA 1KYQA 4ZVVA 5T67A 1H5QA 1PJLA 4AG3A 1FJHA 2HJRA 5KJ1A 4XR9A 1M76A 5CEFA 5T6BA 1J5PA 5JDIA 3ZWOA 4BOYA 1ZKMA 4CQLB 5KVCA 3PDUA 3BHJA 1JQBA 2H5LA 3IUPA 4HWKA 2DFDA 1PS9A 2O50A 4BKRA 2X86A 5C7LO 1GY8A 3QVXA 2OP1A 3NGXA 1CRWG 4CUZA 2NSDA 3VZPA 1HT0A 1GAEO 1BW9A 1RM0A 1ID1A 3KXDA 4R01A 4XQGA 4CV1A 1W0CA 4P4LA 2XAAA 3R3SA 1LU9A 4XA8A 1B3BA 1DXYA 1PIWA 2AE1A 2DBZA 4MOWA 3UXYA 1XU7A 2JD2A 2AE2A 4DBVO 3P5SA 4PLCA 2OBNA 5A5FA 2D2IA 5CDTA 1PL7A 2Y1FA 2I66A 2JFHA 3ZWAA 1UXGA 2VCYA 3GH3A 1JKFA 4QT0A 3CIFA 2IYOA 1YQGA 1EDOA 2PV7A 3E9QA 5EMHA 1VKNA 3KLPX 4JBIA 5BNIA 4I5GA 4L4SA 3I5MA 3SX2A 2G17A 3DMTA 2WE7A 1T4BA 3UCEA 3SEFA 1AE1A 2WWRA 1LC0A 2FP4A 3ULKA 5B1YA 4DYDA 3F5QA 3PGXA 3QVOA 6LDHA 4RPJA 5FEUA 1QV7A 3B1JA 5HBRA 4XWYA 3CUKA 3FTPA 3HNPA 3HDJA 2VZ9A 4KQXA 1L1FA 2DFVA 5JAZA 4R16A 2P4HX 5A9SB 3NX4A 1EQ2A 4AJKA 5BNTA 3W8DA 4R3WA 4EW6A 1YOVA 4IDCA 4NBWA 5U1PA 1PL8A 2CFCA 3DZIA 4E2ZA 3INGA 4BNMA 4IJKA 4BO9A 4P22A 3BMCB 4FDAA 1YO6A 3JQFA 5H83A 3QIVA 3RFTA 3STHA 2YFHA 3I3OA 4CV3A 1XU9A 1DBVO 1GEGA 4J1TA 1KVSA 5MDHA 3RC9A 4UVHA 2JAHA 4QUKA 1YL7A 2FY8A 2HDHA 2WEKA 2GZ2A 2HO5A 3GRKA 4YEDA 3MJEA 1H6CA 3QVTA 5JLAA 4CM3A 2JFGA 3ROKA 5JPIA 3DWFA 4YJDA 1R0KA 1YB1A 5KIAA 5HTOA 4C4OA 2VTDA 5COQA 3E03A 3EZYA 3AW9A 4NIMA 1WAMA 4PCVA 4L9RA 1E3SA 1HE3A 3HN2A 4Y9DA 3ZU5A 4XDYA 1K6JA 1GPDG 1A5ZA 5EESA 1DAOA 1LLQA 1PQPA 3S55A 4NK5A 1EUZA 1B3RA 5C7IO 1ADBA 1T26A 5TT1A 1LEHA 5DNAA 3DOJA 3L07A 2QZ9A 5G4KB 5EINA 3C8MA 1R4MA 4YACA 4NJMA 3WB9A 1ZK2A 5A3JA 1EK6A 2PH5A 1CIVA 2EP7A 1KEVA 1ZVMA 1XYGA 1I10A 4LK3A 1MXFA 4OJNA 4B4WA 2ZYGA 3OJOA 3HE3A 2VWGA 3WMXA 1U9JA 5IDXA 3GT0A 4DIFA 1NTOA 5CFZA 1G1AA 3I9KA 3ZWNA 5M6DA 4J9VA 4FJ0A 4JXKA 3H9JA 3AUSA 3ZHXA 1UXHA 3WOHA 1V9LA 3PZBA 2VHVA 2PZMA 3EY4A 1T25A 3OJ0A 3TQHA 1HYEA 2HRBA 4FW8A 4IMPA 3KOUA 1OMOA 3M2PA 4CMEA 3GHHA 4H15A 1C1DB 2EJVA 3BZUA 2I6TA 5JAQA 4A03A 4IMRA 4EEZA 3NT2A 3ASVA 1LTHR 1QYCA 3E48A 4LW8A 3NDJA 3MJTA 1R0LA 4GBJA 1B16A 3NUGA 5KKCA 1R15A 1YXMA 3S2EA 3EAGA 3V2HA 1KC3A 2JKVA 4GLLA 4ZRMA 4R5HA 1DPGA 3GHYA 3DBLA 3KYBA 3GPIA 1Q7GA 3JQ6A 5T8KA 3HUDA 4Z3DA 3SBOA 4IZHA 3A9WA 1MX3A 3UOGA 2CDCA 1HSOA 1SO8A 2YQ5A 1EQUA 4OKNA 4FS3A 5ILGA 3KO8A 1I8TA 5DT9A 2O3TA 2VWQA 4KMSA 4M1QA 2ZB8A 4M87A 3I9LA 4UUNA 2Y1DA 1U8FO 3ZU2A 4ALIA 5JYAA 1IZ0A 4BNGA 3C7AA 2DT5A 2ET6A 4OL9A 2DBRA 2ZYDA 5ADHA 1QG6A 4ZGWA 1KVUA 2ZTMA 1A7AA 2B83A 4Q9NA 1JLLA 1GEEA 5DF1A 5JY1A 3OBBA 1YQXA 4CLOB 3NJ4A 2ILTA 1U4OA 3W6ZA 1XGKA 1Y6JA 4G5HA 1IHXA 2GN9A 1NHWA 4MVJI 1YQDA 2Q4BA 2VNSA 3TJRA 3HQ4O 2CVOA 5ES3A 3GVIA 2CUKA 3AFNA 4LMRA 3WGTA 5COBA 2X0RA 3H8VA 5F1PA 9LDTA 3RVDA 4CMGA 4YAKA 4H3VA 4CM8A 3RUCA 4AFNA 1LUAA 1Y8QA 1NM5A 2IE0A 3A28A 3E6AA 2TMGA 4MVJD 2FN7A 1Z74A 5CPBA 2I3GA 5DBFA 1SBYA 3GRPA 5TRTA 1VJ1A 3H65A 3KYCB 5GZ6A 4OXKA 3JQ7B 1A27A 1M6WA 1YJ8A 2QYSA 3EGOA 4YT5A 3F4LA 2DU8A 1BDBA 4OH1A 4AJLA 4PLZA 2Z5LA 3E9NA 4XYBA 3AI1A 3K31A 5G0TA 5A5EA 2YHUA 4GMGA 1UP4A 4ZRNA 5AOVA 4GQAA 1AHHA 2V6GA 1E7YA 5ER6A 5DULA 4KTTE 2Q50A 3CTMA 1FDVA 2VHZA 1EVYA 4HFMA 5IXYA 1YBMA 3U4CA 3A06A 1A71A 2YDYA 4XB1A 3OF2A 4E5YA 1P0CA 5TJ9A 2WDZA 1ZMTA 3OHSX 2JD0A 2ZQZA 3RBZA 3H9QA 1F12A 2X5OA 2GASA 1K5HA 4J2OA 1EE9A 3ZH2A 1T4DA 2ZB3A 1I01A 3PIDA 5JYFA 4NFYA 3ANLA 3MZ0A 3HB5X 1NQ5A 1J4AA 2VYND 2O3QA 4HV4A 2CZCA 2O3JA 1D8AA 3HFSA 3LLSA 5L7WA 3NTRA 5JMWA 3FCOA 1Y9AA 5KJCA 4TZKA 1VLLA 2BH9A 2VYVD 4KUHA 4WCFC 5TGDA 5JW6A 2GZ3A 1XEAA 4WLFA 3X2FA 4YAJA 4HBGA 3NTQA 3CPSA 4OOEA 1RYDA 3ZWXA 2Q2WA 4CMHA 1LSOA 4CM4B 2IDZA 3QP9A 4E2YA 4NBVA 3H5AA 3G3EA 1G0OA 4GL4A 1Y1PA 4OAQA 2HLPA 4DPKA 3PJEA 4PLFA 1P44A 2PY6A 3QA9A 4R68A 3DAFA 4B3JA 3AOEA 2WMDA 3OICA 1QORA 3I9MA 3V2GA 4PLYA 1U7HA 2JCVA 4PIVA 4FPXA 1SEVA 3BMCA 3D5TA 3MWEB 2DQ4A 2QRLA 3PHHA 4NFSA 4Z0TA 2IXBA 1KY4A 2ZTVA 2WE8A 4RLHA 4BNTA 3LT4A 2WD8A 2DBQA 1SB9A 2VRCD 1HETA 4XGNA 1DFHA 3KBOA 4FOOA 1NBOA 3IUSA 5AXDA 4H16A 2CF5A 2C20A 4FFPA 3WFIA 4Y98A 3QVWA 4JX8A 2OORA 3M6IA 4FFMA 4DXHA 2P5YA 1V0JA 3GDGA 4EITA 2ZKLA 1EVZA 1XIVA 3F4BA 4GSKA 1P1IA 4FOSA 1GUZA 1NPYA 3FBGA 4BVAA 2GNAA 3N7UA 3PXXA 1BMDA 2WJPA 4AJHA 5K6AA 1ENOA 3GEDA 4EJMA 5G4KA 3DZFA 3AY6A 3WTBA 4E5PA 2W2KB 3RC7A 2C7GA 4FC6A 3ZW9A 4ND2A 1MFZA 3TN7A 4LN1A 4I1IA 3H5NA 1EUCA 3JCZA 4F45A 3RASA 2FPGA 4YT2A 4M89A 5JSFA 4PG5A 5TX7A 1BTOA 3KETA 4A26A 2FR1A 3ONDA 3AUTA 4M55A 2P91A 1W8DA 5LCXA 4L76A 1C1XA 4WLNA 3WFJA 4PZDA 1XCBA 1U3TA 4XZ3A 4FC7A 2O7QA 3E5MA 5L45A 4GX0A 3WGYA 4XX0A 3U62A 3HWRA 5KJEA 4BNXA 3ZNNA 4BNWA 1TB4A 3D4PA 4NBUA 3ENKA 4KTVE 2X7HA 4D3SA 4TZTA 4RVFA 1LQTA 3AU9A 4YA6A 1X7HA 5CP8A 4CM9A 1QR6A 3HFGA 1C1DA 1YRLA 2VHWA 2VN8A 3HN7A 4RF4A 2VQ3A 3LSYA 2Q1UA 3VC7A 1CQIA 3UH1A 3MTJA 1KOLA 2YV3A 3DTYA 2B0JA 3Q6IA 5KKAA 4TWRA 4GI2A 3FRJA 1DHTA 1ORRA 3P2YA 4Q3EA 3COSA 2OXIA 1NAIA 3JYNA 1O6ZA 4GGOA 3VH4A 3AY3A 3WDSA 2R00A 4DTIA 3OQ6A 3I4CA 1Y8RB 1F0YA 1ZK4A 2JHFA 3BIOA 1DIAA 3CMCO 4M49A 3PFWO 1BHSA 1NAHA 4QX6A 3F1LA 4DQUA 2PWZA 1E7WA 4W9NC 3E1KA 2AA3A 3TPCA 2HK9A 2GRAA 4DA9A 3GNTA 3Q3CA 5TLSA 1DJNA 1ZEJA 1VI2A 1ZUD1 2I65A 1YKFA 3VZSA 5CEEA 1JWBB 1BGVA 2VHYA 4CM6A 3O8QA 3OJLA 2HMTA 1VKOA 1YVEI 2B36A 4IJUA 2XXJA 1K3TA 1J0XO 3MCVA 4BO1A 7MDHA 3I9NA 3UCFA 4BNYA 3WNVA 4FGWA 4CLRB 4B4VA 2D5AA 4IDBA 1Y81A 5DCYA 3UUWA 1K89A 3JQBA 4XGKA 3D1LA 3HZZA 4CLOA 2BD0A 1T2DA 1XKQA 3U4HA 5DDIP 1DRWA 4IQ8A 2ZB4A 1MB4A 3GR6A 2BELA 5HS6A 3S8MA 2BMAA 5A9RA 1I0ZA 4ND1A 3GGPA 3WR5A 3DOOA 4CLHA 4NBRA 1GR0A 1E6UA 4II2A 1N2SA 5DCWA 3PI7A 1H2HA 3WSVA 3UAGA 3L6EA 2PR2A 3SLKA 2O23A 3JQAD 4P4GA 3RD5A 3O03A 3V2UA 4JP3A 5KCZA 5DBGA 4TRJA 1KEWA 4K6FA 4BIIA 1R4NB 3QHAA 3WIDA 3ZV4A 2O2YA 3ANNA 3INRA 5EPOA 1NVTA 5J23A 1WDLA 2NQ8A 1GFSA 1CEQA 1FK8A 3FTNA 1WPQA 5DOZA 3DAPA 4ALKA 3KYCA 1GUFA 2XF8A 2HCTA 3ICPA 3JQ7A 4CODB 1R66A 4GGPA 4CM5A 2YHIB 4BKQA 3V8BA 2RAFA 1XDWA 4RLSA 1L7DA 1B8UA 3QWAA 3LLVA 3OMLA 4WNCA 1ISFA 4MIEA 1GD1O 4UEKA 4RZIA 3LT0A 1CJCA 1MG0A 3Q9NA 4NZ9A 2HUNA 5GMOA 5IF3A 5G0SA 4EDFA 1DC5A 4INAA 1VPDA 3I9OA 1NQTA 3DR3A 3BAZA 4IS3A 5TJHA 5FI5A 4EUEA 4EGFA 4NG5A 2DUUA 4AJIA 5IDYA 4KUGA 4U0KA 3GK3A 4J7UA 3WGHA 2NUAA 3CMMA 4BV8A 3KTDA 2EGGA 3VVBA 3ON5A 2UAGA 3RWBA 4WLOA 4XYMA 3L6DA 2WYWA 1MLDA 2C5EA 2O3RA 1LSUA 2QG4A 5H81A 4BNJA 3LU1A 4UEOA 3VZRA 4B79A 3GY0A 4JJGA 1BVRA 3U5TA 1ZSVA 3GUYA 3F9IA 2BI8A 3WJAA 1PZHA 4FFNA 3GMSA 5T64A 4CM4A 1NNUA 4E5KA 1U8XX 5C5IA 4BMSA 1WXDA 2Y67A 3DHEA 2RIRA 5ER9A 1FDSA 3F3SA 1G6KA 3H2SA 1IPEA 5CDUA 5AXAA 2CVZA 4YJHB 4PZEA 1FXSA 2OBYA 4FCCA 3B70A 3KEQA 1GPJA 4CMBA 3ABIA 2I3AA 1K0UA 1B8VA 4AJEA 4E2WA 1H94A 3C85A 1YB5A 2Y1GA 4AJJA 4XD2A 5JXWA 1C0PA 1ONOA 4ZQGA 4PFJA 5FWNA 1Y9EA 4MKXA 1A9YA 4YRBA 3PJGA 4FGSA 3W4JA 4TROA 4WEQA 1P1HA 4ZICA 1E3EA 3W8EA 4S1VA 4W4TA 1HDCA 1EFLA 1F14A 1BDMA 2PKQP 2J3JA 2Z1MA 9LDBA 1QP8A 1W4ZA 2VTEA 3QSGA 2A4KA 3R1IA 4WCDA 1RM3A 3D4OA 4FN4A 4LCEA 4AJ1A 2Y05A 2EG9A 2CDAA 1PWZA 4N7RA 3KSUA 5A06A 3OIGA 3HDQA 2YYYA 3I6IA 4GPD1 3GZNB 1ZSNA 4II3A 2PNFA 5JCJD 1LNQA 4ZU3A 1B2LA 1VSUA 2GO1A 1TA4A 2X9NA 2BFAA 1GQYA 3P19A 2GCGA 2VZ0A 4IDAA 2P4QA 5HA5A 4YJGB 4FB5A 1N92A 3ZV3A 1PQUA 2HMUA 3PJFA 4AJ4A 2CMDA 1ZEMA 3ZU4A 4FQ8A 3ZWYA 4PLHA 2GR9A 4JCOA 3SJ7A 1T2AA 3VPFA 5CDGA 1DIBA 2A92A 1YONA 2X6TA 5TSDA 5KVQA 5ICMA 4BNFA 3JQ8B 4U6SA 2D8AA 1PGQA 3MJ4A 4RVHA 1U5CA 1SNYA 2X0JA 1N1GA 1I33A 1QSGA 2EV9A 5DBIA 3DTTA 2E6UX 1ZSYA 2F1KA 4A2CA 4XJSA 1QYWA 1PZEA 4XQEA 4JN6B 1FDWA 1LQUA 1D4FA 4UVEA 4E0BA 4CUKA 5ITWA 5BQFA 4N5NA 2Q49A 5JC1A 2PZKA 2FOIA 5A4DA 2ZYAA 5T5QA 1Z73A 3JQEA 3JQCA 2QQ5A 2OMEA 4Q39A 3C1AA 5L9AA 5F5NA 3BMOB 5KWEA 3H6KA 1P3DA 1PZFA 2G5CA 1V3UA 3DFZA 5JE8A 3I83A 3DOCA 4EI2A 2TMDA 1A4UA 3VKUA 4XDZA 4YAIA 1WW8A 5ICSA 1MA0A 3JQAB 4YJFB 4CMEC 3FPCA 1SEPA 4OOFA 4LVUA 4PZCA 1PGPA 4KDFA 5L4SA 2JD1A 3WWYA 4J43A 5ILOA 3H3FA 5I7EA 1HYGA 3FF4A 3Q9UA 5IJZA 4MP6A 3SXPA 4MVJA 5B4VA 3FD8A 4GVLA 1Y8RA 3G17A 4KQWA 5A02A 4JJFA 4NU6A 5DZSA 2E49A 1GQ2A 4XR4A 3RU7A 3CEAA 2NNLD 4J0FA 1PJQA 3WYEA 3CINA 3UW3A 3BTVA 1R6DA 2PD3A 3LDHA 3RQSA 2BFPA 2Y99A 1DIRA 1E3WA 3D4NA 2R2GA 4CL8A 4FIZA 4DIBA 2HMSA 4XRGA 5T8KC 3VDQA 1ADGA 3PZRA 1E7QA 4J1SA 1XWFA 1EEHA 1UJMA 5TT0A 3E82A 2BGKA 2E82A 3P2OA 2C7VA 4I5FA 3ASUA 2PD6A 1Q0QA 2D4AA 4IDFA 4K6CA 4CLRA 3JYQA 2HMVA 4RVDA 3WYBA 4BUCA 5I9MA 2IZ1A 4QQRA 1GYPA 3L6OO 1R37A 1WZIA 2EKPA 2VHXA 4MVJH 2D5CA 3CH6A 5BNFA 4EJ0A 1E3JA 4WEOA 2JL1A 3GN1A 3DQPA 1A9ZA 3FR8A 2PD4A 1TT7A 5JDCA 5KJFA 1X0VA 5AQ1A 1OI7A 2B69A 1E1KA 4IGFA 2BHLA 3ROPA 2VYNA 1HRDA 4CL3A 3V1YA 2PK3A 1PJTA 3IP1A 4CM7A 5IAAA 3DMYA 1V3TA 2VYVA 5T73A 3PFFA 1DFIA 3I52A 1R4NA 3L0DA 1YWGO 2V7PA 4RF3A 3EUWA 3JV7A 4G81A 3LC1O 1X7DA 1B15A 3NKLA 5JMPA 1ZK3A 2GN6A 5LDGA 3DZHA 4L74A 2EJWA 4LVCA 3WYCA 4OMUA 4U0JA 4HNHA 3WBFA 5U4QA 2YHIA 1NP3A 1UP6A 3NT5A 2E48A 4DLBA 1YBVA 5FF9A 1JWAB 3KYDB 4A73A 2X4GA 3VZQA 4D3FA 4GWKA 1KBZA 1LLCA 1ZBQA 2VOEA 2Q4EA 4DREA 3BYZA 1HE4A 1LBEA 3DZBA 5TIIA 4IZIA 4PG4A 5EJ2A 1Z6ZA 4HUJA 2RBEA 4NHEA 1H93A 1ZXBA 4J91A 3WMWA 3HG7A 4D3DA 5B4TA 2VRCA 1LRKA 4WCFB 5TS3A 3B1FA 4HY3A 4YR9A 2B5WA 4WJZA 1B8PA 1BVUA 2AHRA 4BMNA 3G1UA 2Y93A 5KNLA 4YAGA 2EERA 4QTZA 3ZV5A 2H6EA 1NWCA 1Z45A 1PJ3A 1C0LA 1GZ4A 4J2HA 3V1UA 3DFUA 4JNKA 3FHLA 1Z7BA 3M1AA 1KVTA 1ULSA 1UUFA 4W99A 1X15A 3PQEA 4QO7A 3RC1A 2PKRA 4FD3A 5EQDA 3ST7A 5F5LA 4MVJE 1PZGA 1XELA 3UICA 1HDGO 3DBRB 1GQQA 3OQBA 1LDGA 3VAZA 3G1TA 3MWDB 3O38A 4OGWA 1FF9A 4IBOA 3S2IA 4XCVA 1LSSA 3PHIA 3F47A 2NQTA 5G0WA 1LDBA 3L9WA 4CMAA 3PYMA 1LC3A 2X0IA 1P31A 2O4CA 2O7SA 1MC4A 4A0SA 3WLFA 3ZW8A 3AY7A 1PEDA 3JD2A 1QYVA 4FBGA 4CLXA 2PH3A 5DP1A 1PL6A 3FNGA 1M67A 4IJWA 3RFVA 3AOEC 1VRWA 4M54A 4P8RA 2EHDA 3AWDA 5CPFA 4ZJUA 3KB6A 4A5OA 4KUEA 3S1LA 1CQJA 1PQWA 2W8ZA 4EYEA 3KZVA 1KC1A 4IINA 4HP8A 1PWXA 2FR0A 1PJBA 3U0BA 2VUTA 4O0LA 1ZK0A 3F6YA 4IQ0A 3IP3A 3HSKA 3FBTA 5L4NA 4ALMA 1KERA 3H5RA 3OH8A 4B7CA 3KVOA 3DHNA 3C7DB 5L7YA 1GYQA 3WG9A 1AN9A 3TNLA 1UXJA 4ZQEA 4BO2A 2HQ1A 4RVSA 2CSUA 1A7KA 1HE2A 2W90A 2AQHA 1YL5A 3KUXA 2UV8A 5ENDA 1LJ8A 5F1OA 3GZNA 4CMCA 2V6MA 5CDSA 4M86A 4KP7A 3ETDA 2HRZA 4WLEA 1IHYA 5K0ZA 4A7PA 4CQLA 4I5DA 1QYDA 2DLDA 1Q2XA 2YQ4A 3FPLA 2B5VA 3EDMA 4YJGA 2P9CA 3PPIA 3SC6A 2EIHA 1E1LA 1MV8A 4O59O 4URFA 4FJ2A 4CUJA 5K6AC 1AXEA 3D3WB 2J6IA 3W1VA 4BO3A 2ZJ0A 2H63A 1RM4A 2GD1O 3DBHB 3EZLA 3UFXA 4ZQFA 3IS3A 3PLNA 3K2EA 1SAYA 3H9EO 2J3KA 3A1NA 3AU8A 5A3VA 3RUFA 4EJ6A 2YV2A 4Y8VA 5FYDA 4BNLA 1RKXA 1HLPA 1MFPA 4UVDA 1E3LA 1U28A 3GC6A 1ML3A 4JIGA 3ANMA 4FFOA 5IZCA 3JD1A 3C24A 2RH8A 1NPTO 4HXYA 1GADO 2O3UA 4NPCA 4Y6SA 2C54A 1N7GA 2W2LD 1ZZEA 4ID9A 4KZPA 5BSGA 4BO4A 3ZWMA 4GAEA 2E4AA 4C7KA 2I67A 4W7HA 1I3LA 1SC6A 3JQAA 5KJ6A 2Z1NA 5A9SA 3V5NA 1E3IA 3PVZA 4RQUA 4E31A 2D59A 1ZNQO 4RL6A 2WD7B 3IAHA 2DPHA 2IYPA 4GLOA 4JK3A 5ENVA 4FFRA 4J4BA 4CQMD 3LK7A 2PGDA 1J6UA 1JA9A 1QLHA 4WOKA 4YPOA 3JQ9C 3OQ1A 3V1TC 3HDYA 4HX5A 3WICA 2J5KA 3PRJA 4CM1A 2P68A 1GYRA 2R00C 3TFQA 3ZV6A 5JC8A 5B37A 1X14A 1BG6A 2EF1A 1XG5A 3M2TA 1NFRA 1C3VA 3VPXA 1Y5MA 2OP0A 4BNIA 1IZ9A 2XOXA 4R54A 3WWZA 2I99A 3ZWCA 4CPDA 1NQOA 1GV0A 2GZ1A 3ZWVA 3TFOA 1I30A 1I36A 3DZJA 4JBGA 4JJIA 3NJ8A 3CKYA 3MOIA 1IE3A 3VOSA 4RF2A 3TZKA 4WNIA 5K9ZA 1PR9A 1R0SA 2R6JA 2LDBA 3PQDA 1N9GB 1U4SA 4DUPA 4YXFA 1RYEA 4WUVA 2E37A 3GFBA 2EW2A 3G79A 4TQGA 2POQX 2Q3EA 1LLUA 2Q1TA 3MOGA 3JQBC 1NASA 4I08A 3BTOA 1C0KA 1U2GA 3ITDA 4CV0A 1CETA 4WLVA 4JGBA 2GDZA 1DEHA 3IJRA 1RWBA 1K6XA 4FJ1A 1JVBA 2P9EA 2NACA 1XHLA 1DO8A 2ZK7A 5I7FA 4NQZA 3QY9A 1UP7A 4UUMA 4PLGA
chains in the Genus database with same CATH superfamily
1FTWA 4F6CA 3SQLA 2ZCUA 3M5WA 1V5EA 1KRXA 1HF3A 4PVCA 2IHJA 1I32A 3AFOA 3UVEA 1I5RA 2GLXA 1A3CA 1LRLA 1BN6A 3W2EA 3CZRA 5FAKA 3WLAA 4C3VA 2PRIA 2UXCB 1E6MA 2UUPA 4JIMA 5K0TA 2AK3A 1FFSA 4HFJA 5ALYA 3HFJA 4IO1A 1P9LA 1T4CA 2NZJA 4OQZA 3UQYS 1Q91A 3O4VA 5FUWA 4EHKA 5TMEA 4ZDIA 1P81A 4RPCA 1BW9B 2ZVQX 4Q3NA 4WZAE 3LBHA 5A3RA 5IRCD 2YBEA 3P4YA 3RC3A 4YCNA 3CYFA 3NOOA 1L6IA 4FYHA 5DKFA 7MHTA 1I14A 1G5FA 4YYZA 3EASA 3I12A 4QYSA 2Y2VA 2A9RA 5DBEX 1OXVA 4BQNA 1HDXA 2VNJA 4D45A 1CUSA 1H9BA 1MJGA 1P4SA 3DZGA 4JAVC 2XZDA 4MP8A 1Q3HA 4RQAA 4UXJA 3M3HA 1US8B 3TDKA 4O8JA 5GZ1A 2AWNA 2EFEB 4PO9A 4XX1A 2YOGA 1UAGA 5CHYA 1E7MA 2HQOA 3KZOA 3K0AA 1LNZA 4E1AA 3OC6A 3OY2A 2J5RA 4FUTA 1NW4A 5EIEA 4NDZA 3D3NA 3THYB 3H8JA 4D0LB 3QVVA 4WUTA 3JQGB 1WO8A 1V7CA 1ZC4A 3ZKAA 5LPNA 3AVYA 2M2IA 2MOKA 2LVBA 4QGSA 3LGSA 4IUCS 2VDLB 1K9VF 3LIIA 3WXBA 5JCJA 1UPUA 4I99A 5FJJA 1MB3A 2ZQ5A 3L8MA 3HMKA 4DLRA 3GDHA 2J7KA 1G5IA 2VJPA 5C37A 3FMIA 3UAYA 1NR5A 4EMSA 1EE2A 3L1UA 1KYYA 2ZZKA 3B48A 1XXHE 5G2OA 4QU8A 4EZBA 2DCUA 3FPSA 3RTAA 4RTSA 2X2OA 3NAGA 4M9CA 3RH0A 1JEJA 3LNTA 3RTGA 3DVRX 4BO7A 4Z9YA 4Q3OA 3CXUA 1W85B 3FYHA 2XUZA 3ORYA 4CG1A 3CG0A 1UZMA 4Q66C 1FRZA 4IIJA 5EJFA 4LWPA 5E7MA 4JSRA 4LBYA 3ET4A 4JKOA 5D7BA 4A82A 4QFCA 4UVGA 3QEMA 3WBKA 5T41A 2OV4A 5ALSA 3ANYB 4LWOA 5F21A 1KJWA 2HFKA 1GPAA 1LWNA 3GUHA 1XHEA 1NVGA 2XPCA 3Q7EA 5FUQA 1PCXA 3SS9X 1WBDA 3LZDA 2RGXA 2ATEA 5IT0A 2RHRA 2UVQA 3QWBA 3H97A 4IDDA 4WY5A 1ANKA 2WMOB 4TV9F 1OVMA 3SDSA 3AOGA 1XTRA 2ZUWA 3FDZB 4PZAA 2P4SA 3IVRA 5EMLA 3ZWQA 4UEJA 4YV2A 4I3FA 2D1SA 5DNEA 1RFGE 2A5LA 4ZPJA 5DHRA 4YWHA 3VNQA 1RZ3A 2FR8A 4G4JA 1KAOA 1VIAA 4G84A 4JU9A 3YASA 4ZIRB 3U1BA 1W73A 1XTZA 4ZCIA 2ECFA 2JFUA 3GUCA 3BQMB 3IR5A 4X24A 3VTZA 5LMUB 1SCUB 2YICA 5GPBA 1U2ZA 2FUG1 2IODA 1H6DA 1AHIA 4PXYA 1WMBA 1T2FA 4EPXA 3WLQA 3VHXB 1U3VA 2B7LA 2NW6A 3VYSB 3CH7A 3GMDA 4BCDA 5HK9A 3E35A 4ND7A 1TXGA 3WTCA 5JS8A 2W6JA 3S2UA 1RBYA 3LF1A 3ZCPA 3B1KA 4M0KA 3UK0A 4R1TA 3TB6A 2UUAB 1VQ1A 3D8NA 1OGJA 3UENA 2O5RA 4XSVA 4BMOB 4U2EA 4UREA 4TMZA 3NRCA 3KJIA 3RHFA 3A4YA 3OUUA 1FDOA 4TSKA 3I1FA 5FDFA 2HNBA 2VOJA 2LKCA 1L3CA 4EKEA 2YHSA 4URVR 1E1YA 4CIWA 1IQ0A 7ADHA 3EB9A 3T7TA 2PMBA 1GU1A 3EZ9A 3QV2A 1NJ1A 3HP1A 1J25A 2H1IA 3NTXA 4FSHA 2CHUA 3WP1B 4D8WA 3B1WA 1WCIB 1ESCA 3C15C 1AQNA 4G8CA 1UPXA 3CEMA 1ML4A 5A0VA 5JASA 5CNKA 3OZAA 2J48A 2XSZD 2CMHA 4GI3A 1ZHHA 5IABA 2GN2A 2AXNA 5F1KA 3A10A 3GOQA 5B4UA 5IJ0A 3UK6A 2X22A 1CUHA 3K1ZA 3OPVA 1V1MB 4TM8A 4P3PA 5KNDD 3IDSA 3OTIA 4RBNA 2VCHA 3DEAA 5I9NA 2AYXA 1VCOA 1ZJYA 5HS4A 1DAFA 1C9JA 5TY0A 1Q7BA 3MA0A 3W79A 5DGIA 2B4TO 3ZIDA 5K01A 4C0QC 1OWPA 2XNSA 4GP7A 3WNQA 4Y30A 1IBMB 2X9QA 4OIMA 1E2PA 2B8NA 2IH4A 3DW3X 1CU1A 3DQQA 4JHXA 2YY7A 4PGFA 4RA6B 4QJ3A 4W7IA 4ZEXA 1YVDA 2OO3A 1JR2A 3MJRA 4KRYA 4NZMA 1KPGA 1TW3A 3SFTA 1TM2A 3DMTC 3QENA 4LXXA 2AZTA 3K8ZA 2R25B 2JA1A 3FWKA 1CG6A 3HKEB 4KN6A 1UM9A 2FZEA 3VH2A 3DZ7B 1NJ8A 3CNQS 2CLOB 3MCAA 1PGOA 2Q7XA 4J3NA 1AHNA 3DT9A 4F91B 2CXUA 2OO5A 2WD7A 3VSDA 1ID8A 2F1IA 2VG8A 2J9RA 4RLFA 3IQHX 2GPWA 3BA6A 2AFRA 2UYOA 3ML1A 2ZG6A 4KZKA 4P4NA 1XA0A 2I7CA 3QJGA 2DPGA 1S2MA 1XK7A 3HYRA 3HJAA 4LX8A 4O6VA 3NVMB 3BIXA 2AG0A 1MC8A 3GLIB 5J9FA 4EHDA 1BA3A 2AG1A 2GAOA 3BHMA 4AMGA 3STWA 1T1GA 2PFGA 2BWJA 1NJ6A 1IXKA 1XLUA 2BKAA 3EOZA 3H1BA 1YUBA 4FDUA 4G5XA 4NE9A 3RSSA 5C4MA 1IPHA 2HHHB 5B7PA 5E8JA 3NCHA 4M8LA 3ZS8A 4LF4B 1OY1A 1I94B 3BX1A 4N5DA 1IJEA 2OFWA 2B8TA 2RC5A 3FNFA 2JGFA 3JQFC 1JZQA 2LD4A 1P8JA 3L5KA 5EWLA 4AQYB 4MDFA 4ITVA 1WVMA 2W4MA 5C1PA 1UK9A 2VP3A 3FI0A 3I58A 4B32A 2ZIVB 1Q92A 4BATA 3RV3A 4ZAWA 3ROFA 1DRUA 5B57C 2NTNA 1Q0LA 2BMEA 4EH1A 2FDCA 1RSZA 5DNUA 1WVGA 3N2IA 2CJYA 3KU1A 4ZZ3A 4XTCS 5HJ5A 4P33A 3R3JA 1N0WA 1TU3A 3EXHC 3FMVA 4NBTA 2ZTSA 3E1GA 2J0VA 4UD6A 4KN8A 3BQ9A 4OMCA 4WINA 3ZUGA 3DB2A 6NULA 2I87A 2YWEA 3NIDB 2BP7A 5LVAA 1N75A 4KV9A 1ZNWA 5JTTA 1IN8A 1TYCA 1Y1KE 2W5UA 3GA5A 3L7YA 2P9HA 4GRAA 3H2JA 4HAYA 1TW2A 2PKYX 4TRMA 3IEPA 2WHEA 3F6RA 4INJA 1I7QB 2HJGA 4UTOA 2QOEA 3IVAA 2YMMA 1MJNA 1J9GA 2EL7A 1GL9B 4G67A 1AKMA 3ZDXB 2GJKA 3EWAA 1GNQA 3IB6A 3GV0A 3P9QA 2WJJA 1XAJA 1BN7A 1C3JA 3COWA 3QELA 3U4MA 1Z34A 4P53A 5TPWB 3R40A 4UUPA 1UJNA 1UL1X 1OH6A 4GKJB 1KMHB 1FMFA 4N18A 4I9FA 5BSKA 1X3LA 1F8FA 2BFEA 3TBFA 1EP1B 3D6FA 3HJBA 3HKBB 4YMUA 4FKBA 1MEEA 2VHTA 4I66A 3FJ1A 2O52A 2ZPAA 4HDSA 2BDUA 5TF4A 3AHGA 2FRDA 2QMEA 3QWHA 4C2AA 2YWHA 3RARA 4ZVTA 3S2FA 1LPAB 1SKUA 2LUOA 3C6MA 1XRNA 2P5UA 3HCBA 4W9MC 4CMIA 2EW1A 3QVSA 2NO5A 3NEJA 4FMDF 3DEHA 1GU7A 4TKLA 4XH9B 3P9NA 1HY3A 3RV4A 1CT9A 1H1LB 1J8MF 4NDNE 1KMQA 1GUDA 3TQTA 1Q22A 4L7QA 3CY6A 2EGUA 5E95A 2O8FA 2WSBA 1PJSA 2AG5A 3O8BA 3R5JA 3VO1A 4M1MA 1O97D 3HS3A 4LRSB 2PKWA 4PVDA 2EBFX 1P61B 4OHCA 5B6JA 1G0NA 3J7TA 4R0NA 4YCAA 1MO2A 3ESXA 3OG9A 3IMFA 2Q3MA 4RTOA 2VJNA 4CM9D 3FYUB 2YX1A 4LGMA 1NMEA 2YZGA 3EGIA 3EPPA 3O2QB 3R0XA 3IKTA 2B37A 3RJMA 1LDEA 1E2MA 1NATA 4LXHA 4ZZ0A 3NFYA 2NM0A 2FW9A 2VSOA 3FOAA 4NFLA 3AI3A 1CR4A 1Z0JA 2HK6A 2Z2YA 3BMNA 4W5JA 5JXGA 1XZCA 3BCSA 3L1JA 3PUWA 1J2UA 3CO5A 2PXCA 1QZXA 4FX2A 4K86A 1YK1A 4GI5A 3IBYA 3ZQKA 1DUIA 1GCIA 3BJRA 2VJQA 4CLEA 5BV8A 5MGBA 3O8CA 1T3LA 4B87A 2PT6A 3EVFA 4TS3A 5FQNA 5G3ZA 4KQ6A 1Y4UA 3CHYA 5SY4A 1VJTA 2ZIGA 4M4SA 2FW1A 3T5GA 3TTYA 1P1BA 4QOSA 1NHGA 3IJ5A 1E6WA 2BT4A 1T8SA 2DLNA 3HH8A 1MEOA 1TZJA 1WU7A 1RXEA 1NUHA 2QE7A 3BGSA 1FXUA 2X3YA 2PANA 4PIPA 1PX0A 2WAOA 5FH9A 3FLMA 5CYPA 1AZTA 1GL6A 1D1QA 1JB1A 1QV9A 3ICOA 3FB4A 3E7PA 4I8DA 1K7YA 2NU6A 3E0XA 2A1UB 3GLQA 3MJVA 4LA4A 4X54A 5IN5A 5IFKA 3WE7A 2BY4A 1KVRA 3KM0A 3OTQA 5J2TF 3V8VA 4FFLA 1OBFO 2AV6A 2V7BA 2VZ8A 2HSGA 2IZZA 2KLHA 3QUBA 4P3KA 4DUZB 1MZPA 4Q3CA 1OLUB 3PUJA 3BXZA 1RWVA 1H6AA 4OP3A 4PSVA 3N3AC 1LGYA 5JMOA 1DLIA 4HGRA 3VPGA 4KE6A 1K8ZB 4MW9A 1X8JA 4TXMA 4YV1A 5AVYA 4WXRA 1PLKA 1L6RA 4DQVA 4FB4A 1JVNA 2PE5A 1TKAA 1VTKA 3CRMA 3FKQA 1WCWA 3LG2A 1S1CA 3LIPA 3GN2A 4I0WB 5FHRA 2X2EA 2ZI4A 5B53A 1ZW1A 2PGNA 2QTRA 5L40A 2XT6A 1ZCBA 1T36B 1IZYA 3JD3A 1CKEA 1NSFA 3X1MA 2VDUE 1GSHA 2JH3A 4CETA 2VDPB 3BH0A 2OXEA 5JD4A 1GCUA 1ZZGA 1AQ6A 1KDZA 5T3YA 1ISGA 1MW9X 4O4JA 1P2DA 1NFQA 2WAAA 3LW7A 3M89A 4H77A 4L57A 1KU0A 1V25A 4BQSA 5JZVA 4E13A 1C3LA 2OHIA 2FEWB 3BMQB 3L6UA 3RUAA 4CV1A 4F72A 1RPZA 3ER8A 5KVVA 3IE1A 4XCQA 4IXTA 2H4ZA 3UMMA 2XUKA 1E5QA 1O94D 4U7PB 4V03A 2ZI5A 4D3YA 2F55A 1SVNA 3EK2A 1ZQ1A 1X2BA 4XQ0A 1V43A 2ZBDA 1LPPA 4I8XA 4MUGA 4YJ2F 4ALLA 2C7RA 4JHLA 1YFJA 1VLVA 4MVWA 4W5WA 3CGGA 5DTEA 1WUHS 3HR7A 3N2YA 3V6LA 1AKTA 1ZICA 1DTWA 4CKBB 4CWAA 1XVUA 3M9WA 3OFSA 3W77A 3FDJA 3VZBA 2WZCA 2Q07A 3KHTA 2CXSA 1YMQA 4F46A 2VPTA 2OZPA 5H68A 5A04A 1PUJA 1OXXK 2HGSA 1BWSA 3DR5A 3EEYA 2RK3A 5KQGA 4URXR 3SHTA 3HXTA 4JB2A 1E9BA 1YA6A 3VR5A 2Q4DA 1I7SB 1R6TA 5G4LA 2D3WA 5FOQA 4DBLE 2WD9A 4AJPA 4C4ZA 1WPXA 1H8ED 1A2QA 3L9XA 4TL8A 3WZLA 3U7HB 1OLXB 2OGUA 2XMSA 3NHUA 3ZCSA 3C6BA 1U80A 4REQB 2NADA 3P0EA 3HRKA 1VRVA 2B8JA 4EHIA 4TRNA 2F3TA 2BV3A 1E8DA 2CBGA 2OKCA 3A4IA 3V4SA 3AB3A 2B4QA 2H1SA 1KH2A 4ZQBA 3RRNA 1VSVA 1W19A 3E53A 2PSJA 3PT9A 2XQFA 3LBAA 5DB4A 2QT9A 3WRXC 4P38A 3I5AA 4TXNA 2XMBA 4C14A 1AS2A 4Y1EA 1NXQA 1E7SA 1OWNA 2FEMA 3GRVA 2J0UB 4LHSA 4HB4A 4OYRA 4V38A 1DC6A 3Q2KA 1N0UA 5A7HA 1LX6A 5AMXA 4G2NA 1EDZA 1FRFS 4QUEA 1EPUA 4R8MA 2I4RA 1YVPA 1RBZA 2WG2A 5FI3A 1X3SA 4P3YA 1RI4A 2H1LA 2D0OB 3A6GA 1U63A 2HSDA 2AX3A 4LRYA 1EZ4A 3QXXA 5E9JA 5H5JA 1WCYA 1TVEA 3VR5H 3LI2A 4CLDA 3PPWA 3RAPR 4HDCA 2BFCB 2IU3A 4TWJA 1RP1A 3QVLA 5EJEA 1YR7A 4FGJA 4RD3A 2ZTLA 1KIFA 4NK4A 2WJGA 2XNKA 2ETXA 3FI9A 1EVKA 4KDCA 1NOKA 1QC5A 5DSTA 3MAGA 4JC4A 3IJEB 3VPBA 5LXTB 4EI9A 2QLMA 5SZKB 2C3PA 3VJKA 2NUPB 2J8ZA 2POCA 4NHOA 4X7MA 2JBAB 2F7SA 3PT5A 4EKNB 2K7ZA 4K9DA 1BDHA 2O8BB 4G1VA 1IHPA 1Q0ZA 1L2TA 4GBGA 1IG3A 2FPPB 5AJYA 1NF8A 2DQZA 4P2GA 4P5PA 1EK2A 1WXQA 4Y2GA 5TVKA 2NU8A 4QBIA 1IMJA 5CA0F 3NYWA 3ZWKA 1N7JA 1EFPB 2JCSA 3HZRA 3IEKA 3QKWA 3KPYA 4RMGA 3S68A 4C4PA 4BVLA 1G8PA 1XNHA 2XVMA 3E18A 3FWHA 1RDFA 1LBTA 3F74A 3WGGA 3L06A 4RD4A 4M1OA 3UAWA 3SHWA 4I8IA 3OA0A 3AHFA 3NRBA 3T4UA 6AT1A 3DEZA 3T5MA 3FCEA 2AOXA 4L4ZA 4HQOA 5GM2A 1UQTA 2G0AA 1H1TA 1E0SA 2C03A 2XTJA 1LRJA 4NOJA 4D4JA 2PX6A 5CT5A 1ZD4A 4B8ZA 3VH1A 3JQ8A 1MO4A 4WXMA 4JV5B 3T4XA 3ADKA 1V37A 3NTVA 3JQDA 5CR9A 3I04M 4K1XA 5CM8B 1P39A 1EUDA 3CWCA 3LBFA 4PPGA 5AVQA 4YVFA 1UJ6A 4IXWA 4ESVA 3D3EA 1BA2A 3EXFA 3LYAA 2DHRA 3O2SB 3ZLBA 4LFCB 4N49A 4B4KA 1S3IA 1VKZA 4GR5A 5EE3A 3TW6A 4PO3X 3DZ8A 3RI3A 5JO0A 1VM6A 1XR3A 1KQNA 4MAAA 1HDRA 4M8NE 4GSLA 3QFCA 1Y9JA 2BF4A 1NIPA 2C1XA 2DUWA 2WV9A 4BQPA 4E46A 1XZKA 3ICCA 3F5DA 1KY5A 4Z7JA 2UYYA 2GCIA 4FHFA 4P08A 4MI1A 4B2LA 1BXGB 4E09A 1ARZA 1JDJA 1LDYA 2RGEA 2B1JA 3ZR4B 1Q7RA 1J70A 221PA 3OLXA 1RQGA 4I4TA 1JHDA 3EA5A 4K03A 2JW5A 4RS3A 4Z3KA 4JSYA 2RGRA 3ZN2A 1TECE 1HI9A 2QI9C 4NV1A 3T4EA 2QTFA 1W1WA 1P1KA 2DMRA 1KE2A 3L3BA 1JSRA 4QSMA 3ZY3A 1SPXA 3CN7A 1ZLYA 1KI9A 4D0SA 4KPGA 5I9IA 1G18A 1X1TA 1UC8A 1V8OA 4LSGA 1F1BA 2PEYA 4GOXA 3VPHA 2X9VA 1JJIA 3QVJA 3UXEA 4QREA 3DWGA 3QF7A 5CJ2A 3TRDA 2VQDA 1N1EA 5KYYB 2YUTA 1HXHA 1DEOA 2EEZA 4PHTA 2BJWA 2WM8A 3QF4A 3FAZA 1N5DA 3D4BA 2OFFA 1XMSA 1CB7A 3IPLA 4V0LA 3QXGA 1SMKA 2Q45A 3Q1LA 4C7VA 4NE2A 2GBLA 5H82A 1FNNA 4E07A 3AESA 1G3RA 3R0QA 1YIAA 3SXUB 3DZ5B 5BW8A 4R4JA 5IP5A 5ESWA 3I9JA 3RG2A 3AINA 4B8YA 1V5GA 1YZYA 1I4TD 3FTCA 4EHJA 2Q2QA 3GYGA 4MV7A 1NUUA 2NVBA 3R09A 4KH0A 4RKQA 1KHHA 5I8ZA 1T3ZA 3UATA 1DELA 2G88A 2NLOA 3LHIA 4NWIA 1ZWKA 4F85A 2J5QA 1UK7A 5HM8A 2BR5A 1Q0HA 1T15A 4BN4A 3U7QB 1WQ4A 3WOVA 2J9XB 2XHZA 3H13A 4X0EA 2D13A 5ALGA 1TI7A 2AR7A 2WPNA 3DNFA 4RDXA 3RB8A 3SJZA 1SQ5A 2WIFA 3A0RB 3KJZA 2ZWVA 4DQXA 4LZLA 4RAOA 1VGQA 1WABA 2VDKB 4FDMA 1T9CA 3B6ZA 5EZ6B 5THKA 3EPJA 3DZKA 1HDYA 5SYNA 1Z33A 4HXEB 3X1DA 4BLRA 1DL5A 5E9AA 2CLMB 4WI1A 3B52X 4B4OA 5I01A 5FOXA 3RTDA 3UKDA 1A77A 2QD5A 4XJTA 3ZHZA 3BOSA 3CPEA 4M38A 2ZIXA 4R41A 4DPMA 1T6XA 4GSYA 5REQA 3BKXA 2IU0A 4JLNA 1M33A 2ZWPA 3X3HA 2VDQB 3UGKA 1KAGA 2Y8EA 3FSJX 1SFRA 3FE2A 2WP8J 4QARA 2ZXUA 4NCJA 1TT5A 1C4OA 1K9SA 3OP4A 3IBCA 3CT6A 4YV7A 1GDDA 5DH9A 1OYWA 3ENNA 3G0IA 4P32A 4MR7A 4X6YA 2XT9A 1KDPA 1XK6A 4EATA 4C4TA 5TS2A 4JD5A 5JQWA 4RJTA 1OU4A 2FMHA 4NVRA 3QFTA 1ENZA 4ILKA 1OJ7A 2CD9A 1V8BA 3BA1A 3C97A 4G89A 1SK9A 4PYJA 1C2TA 1R12A 4DIKA 3Q11A 1Q15A 1QH1B 3GNSA 2P2SA 5A62A 4PG8A 3RVQA 2QVZX 3WL5A 3DAHA 1W30A 3M6LA 2V6FA 2H1WA 4RANA 1C8LA 1QMGA 4PLWA 4RVNA 1N5IA 1AO3A 1QOQB 1N5JA 2GKGA 4JWKA 2W43A 1X1DA 3PNLA 2IZ6A 1TM1E 4OB8A 5DYYA 2REQB 2ZGVA 3DT6A 5E2BA 3V3KA 2FF5A 2YJZA 3ZDCA 2A0YA 2X0KA 1XSEA 1GUYA 4TWZA 5LOVA 2F90A 1T5OA 1CRPA 2QLNA 3HJUA 3K73O 4GMXA 3ZNNA 4IZOA 3G7SA 2B4RO 4WPGA 2CNBA 3MTGA 4I55F 1YCHA 3GPCA 3E3LA 1XZIA 4R9RA 4ZVLA 2A5YB 3TL3A 1MGOA 4MVJG 3G2QA 3VDNB 5KYNA 3ZDDA 5B30A 1DWOA 1E1MA 3IDZA 3RK4A 3RVLA 3BFPA 4JBLA 5CB8A 1MO5A 3C4VA 1YOVB 3BFVA 3W8FA 3KELA 4BQRA 5I8WA 3HHPA 1GT91 3LYUA 2V45A 4GBED 4B3BA 4HEA1 1EK5A 4G23A 2HTFA 3E22A 4JLPA 1OC4A 3NBMA 3OBIA 4MINA 3FA2A 2KHZA 1HX7A 1RXSA 2ZI6A 2YXDA 5HKBA 1RZRA 3WIUA 5LKAA 3JD0A 2ISQA 4TVKA 5DGCA 1E3WB 5LB4A 1RI3A 1GZ3A 1PL0A 2WJ4A 4WX2B 3TTVA 5CYGA 5E6SB 3A6FA 5DCUA 4WNAA 1MH9A 4YBZA 1AK2A 3E4DA 1M2EA 3ZZTA 4MIOA 3ZDFA 1NR7A 2BMJA 3BUSA 4HFRA 2CCGA 2GCPA 3V8PA 2R84A 3ZI7A 4BS9A 5D3KA 4DCSA 4EHLA 2WB2A 1MIHA 4BKMA 2QLLA 1U9IA 1DSSG 3ORSA 4Y2YA 4PNPA 5EXXA 5GVRA 5ECGC 4RV5A 1E2HA 2GAJA 3A1VA 3RNOA 4J6FA 2OQ2A 1GZDA 4YCJA 1KS2A 1NI5A 3R7LA 4BX9A 3GLFB 3PCRB 3ETLA 4ZYTA 1KJZA 4I46A 5IZ4A 3L77A 2WTBA 3RVJA 2AHOA 4UVIA 4B6EA 1P9RA 2AMJA 4YX9A 3H2ZA 3QZUA 1CB0A 4LZWA 1DUVG 1LXCA 1L7XA 1Z5NA 3UHAA 4EJSC 1FU4A 2AJCA 3M4ZA 4YYEA 1CUGA 4P4UA 5IT5A 2VS1A 4BVKA 1JBEA 3R3ZA 5BPHA 5C8VA 1OSNA 1M2FA 1EGMB 2E5WA 4GM1A 4L75A 5CB4B 1K5GA 1S5PA 4NJMB 4DGSA 3JSAA 4RZSA 2NZXA 2OPHA 5J4KA 2BZ0A 2XCLA 2OM6A 4UHKA 4B81A 3FCAA 1FZQA 4LOAA 3RCBA 2DLCX 2R7MA 3BIJA 2NN3C 1RC1A 3N3BC 2XWPA 4QPCA 1PT5A 3L05A 4UAGA 5IKOA 2Q46A 3AIKA 4RLQA 1I1NA 2IZ5A 5KINB 2RB5A 2RCNA 4FHEA 1JJAA 1C9DB 1F3LA 3GFFA 4X1KB 5AH0A 1I2ZA 2WWYA 1K6IA 1CJTC 2Y0CA 2CEAA 3AVPA 1ZNYA 4TGLA 4AY3A 3D6NB 4ASUA 1N0IA 1C0EA 4GYJA 1HOTA 4FEYA 2RGNA 4PQRA 4BNKA 5K3FA 2JPDA 3GQVA 1B4DA 1ZNZA 4RKRA 2FW8A 4GXRA 3CZCA 3G82C 3GVCA 1P74A 2HXSA 3LFTA 2I4OA 1Z56C 2IYNA 2G36A 1QG0A 5GONB 3D02A 3T3MB 5H9VA 5EJ4A 4Z4QA 5KTKA 1WB6A 5DLQC 4MAMA 2WQ6A 3UHJA 3W7BA 4BASA 3VNBA 2V96A 4FQ7A 4UHBA 4BAZA 5JT1A 2FZWA 1LI7A 4IH9A 1YGYA 1EFVA 3RS4A 4C43A 1GZ6A 1CVLA 5CH5A 1B41A 4QGHA 1BCSB 1LPMA 1W93A 2ZPUA 3QMPA 1SG0A 1V47A 2OG1A 4TWIA 1TM3E 3ZE7A 5DFAA 4QOGA 3KOWA 2PYDA 4HNGA 2GJ4A 2C2MA 5HIMA 3LVFO 2CNWD 4YONB 3K70C 1OV6A 3EWIA 3OX1A 3L8EA 5F33A 1AC5A 3FZQA 4LG1A 4W9NA 5IAGA 2I91A 2VIIA 1NZFA 3GAZA 5CG2A 3EULA 1RHJA 4ZD6A 3G2LA 5JQGF 2FK7A 5KDOA 2BMWA 5IJXA 4RD0A 5A1TA 2UU9B 4QEKA 2P1DA 3UW1A 1ENYA 3BD8A 5E3JA 2L69A 4YS6A 1DOHA 3DZ3B 2QM3A 2YR0A 4Z4FA 5EZYF 3H1AA 1T3SA 1UDBA 3UHOA 2JK0A 4J90A 3TUTA 2BEWA 4NOMA 4D8XA 4DOMA 4UNQA 2GXSA 1YJBA 3GQBB 3N7AA 4IM7A 1S4MA 1G8AA 5D3ZA 1JR3A 3NC4A 3KSDO 1USUA 1RBQA 1PDVA 1PGJA 2NVUA 4HEJA 2O1EA 4LJSA 4OAOA 1HDZA 2QM8A 4KMRA 4QODA 1PJ4A 3KOYA 1PQ4A 4ME6A 1U7UA 4D42A 3Q8KA 2X5KO 1QRUA 1CZHA 5HNKA 1DQSA 1Z5VA 1D1SA 4P0TA 1AUXA 3T95A 4RY0A 1QRRA 2BEUB 3OF3A 3HCRA 1C7RA 1RLTA 3OLQA 4PLVA 1QYXA 1KKMA 1EGHA 1QGDA 1ZUWA 2HL6A 4AS1A 2D0PB 3SJAA 4GKVA 4JI6B 4RUKA 1P7CA 1CEYA 1ZW6A 2UVPA 1F8XA 1WCV1 2PAAA 2X58A 1UPFA 1UAAA 1Z2AA 2EWMA 3RYHB 2ZYWX 4YRSA 4TKVA 4CM8B 1DB3A 3BE4A 3EYWA 1SD1A 3QGMA 4KIWA 1OLSB 1EDBA 3PG5A 4YC7A 4B85A 1YS4A 1M1ZA 2AFHA 2K2QB 2IS1A 5AK0A 4KQCA 3SLGA 2CLLB 5K3CA 4AECA 2YZNA 4W82A 1YDEA 4HADA 3X2EA 5A7FA 1E2GA 2PJDA 3FNEA 3VU8A 5HP4A 2ZJ8A 1E1CB 2ZSDA 2J3IA 3DWEX 1QG4A 3ZNQA 4B3RB 3JW8A 2J6HA 3CNEA 5E3IA 1H5QA 4QBFA 2FMIA 3NYIA 3I72A 4AG3A 4X5OA 1PD1A 2VDWB 2Q9CA 3SZLA 1SCNE 4XR9A 5T4BA 4C5CA 2YVQA 5T6BA 5AKLA 1DBPA 1U2PA 1J5PA 2C61A 3MGAA 3ZGXA 4EF6A 1Q84A 1ECPA 3ZGVA 4CQLB 5AJXA 1E8MA 2R7KA 3PDUA 3M6UA 5DU2A 1SU6A 2AJTA 4WIAA 5EWMB 2X86A 3MB8A 5C7LO 1TJNA 2OP1A 2RHGB 5NLLA 1RMQA 5J2UF 3PEYA 4NYJQ 5FBWB 5C34B 5CCBA 4MQBA 4G36A 1QX4A 2WYOA 1HT0A 5CRIA 1BW9A 3ETHA 2IYRA 1ID1A 2JASA 4QIHA 1QFZA 1UBOS 3HZOA 4R01A 1D0VA 1SC4A 3UMSA 3R3SA 4W5HA 1M7HA 4NV3A 1V3QE 3PB3A 1E9DA 3DVAB 3U4QB 2QP9X 1R0CA 2JD2A 4M0UA 4WESA 4ZWNA 2CB0A 4X45A 1EWVA 1NF3A 3QLVA 1JTFA 5CDTA 4NG4A 1OFUX 2R11A 2OZEA 4FFVA 4HDKB 1JKFA 1EVQA 2PU5A 4QT0A 3WYGA 3CIFA 2IYOA 5D6OA 1KO7A 3EXEA 1PHRA 1VKNA 1RABA 1WW2A 2H1RA 3KLPX 2WWXA 5LZ7A 2JZCA 4HDMA 3TRIA 3U3ZA 3OJCA 4RPIA 4ZOQI 5BNIA 1B0UA 2WPDD 4L5IA 4L4SA 4KR0A 3EQ9A 3I5MA 5THXA 3SX2A 4AMUA 2AB0A 5EJ9A 3DMTA 2XZTA 3WRYA 1W36B 4EPYA 3UCEA 2SNIE 2ZE5A 2AS0A 4PSCA 1R8QA 2GLTA 1LC0A 1II8B 3E1SA 1U2QA 4HN9A 5C5CA 2FP4A 4F86A 1K5PA 3R6TA 2XYPA 1KJYA 3QVOA 1ZU4A 1SXIA 1V2GA 2FOLA 4IQFA 4H4CA 4RY8A 2NYRA 5HBRA 3G23A 3MRTA 4YMTA 4S04A 2VZ9A 3HDJA 3CX7A 4YJKA 5DNDA 3U31A 1OXTA 2DFVA 2QXUA 2VZEA 4QULA 2DPMA 4TLEA 4LF6B 1E1DA 1YK0A 5BN5B 1A82A 3W8DA 4R3WA 3LKBA 3ZI4A 4UDYX 5C2JB 1PV4A 5DK4A 2WR8A 4G4SO 4NBWA 5U1PA 1C9MA 3OTWA 5HFJA 1O4VA 3MUOA 1JR3E 1SWVA 4C5BA 4BNMA 4E2ZA 4P22A 1N0VC 3BMCB 2WSYB 3TE6A 2J41A 4FDAA 3WRWA 3JQFA 3DGFC 3HWWA 1K68A 3CLUD 3QIVA 5G0TA 3QPUA 3TIVA 5KHAA 3STHA 1KAHA 2PGAA 2YFHA 3EODA 5K8TA 3T1YB 4GUDA 1VLQA 2D5IA 3IIKA 3EQ7A 4QUKA 3THWB 2FY8A 4YRZA 2WEKA 2HO5A 3IOBA 4DRXB 2OV1A 2X1MA 2H9AA 1C9EA 2YH2A 3FWPA 3PRYA 1OWLA 4YEDA 4M7OA 1HRKA 4TV8F 3H7IA 3MJEA 1H6CA 1EHYA 2Q5OA 4QWWA 2EWWA 1N6IA 2FQ1A 5ESDA 4ER7A 1YMUA 3ZOZA 4C2TA 2G5TA 3DWFA 1G4UR 4AY5A 3KPWA 5HTOA 2IXFA 1MX5A 1TPZA 2W2NA 5COQA 4UUAA 1LS6A 4GYKA 3EN0A 4MR8B 2J3EA 3C8DA 4ZVSA 1VG0B 3LZCA 3V33A 3E5HA 1GPDG 2AFHE 3EP4B 5EKSA 4ZCTA 3DKPA 2OBMA 1B3RA 5C7IO 3HLTA 3G59A 3SF8B 2WT8A 3VHXA 1JR6A 4FWIB 4WZBA 5CLGA 3DOJA 3DE3X 4R2HA 3R5TA 1YHZA 3S99A 2XY4A 1E99A 2PS3A 1Z7GA 4Q12A 3W0LB 4FMCF 3ISVA 2BCEA 2P6NA 4MUIA 5HZHA 3K4PA 5B7GA 3Q87B 1ZMBA 5JCZA 1XDDA 2GXAA 2ZS8A 2JEZA 1EK6A 2PH5A 2FPGB 5HSGA 3OM0A 3R5KA 3JWHA 1FFYA 3AL2A 4CN9A 4Q9LA 2ZYGA 2E3JA 2J4CA 3KPJA 2VWGA 3D7RA 4IJ6A 5EKTA 3WMXA 5EJ8A 5IDXA 3GT0A 2GK3A 1KAEA 4HHEA 1NTOA 4ETIA 2ZSKA 3BDAA 5HXAA 2F8TA 3OAAA 1QYIA 1FUKA 5HCUA 1Q6YA 1WPRA 4BY9E 1G1AA 5EJ7A 3LKZA 4IMIB 3W2GA 4A6XA 5M6DA 4J9VA 3R74A 2XOKA 4W1SA 1GTZA 1UBNA 3VC1A 3LX8A 3ZHXA 3N8HA 4EJFA 1F1JA 3SJCA 1RWXA 1XVTA 4MKIA 2OC9A 3PZBA 1NRWA 2QSYA 2Q5CA 2WTNA 1KI3A 1T25A 2W6ZA 1MW8X 2JJ1A 4MYHA 5HQ3A 1SXJA 3GGDA 1OMOA 3ZHRA 1KDYA 2FG5A 3T1OA 3IV7A 2PCJA 3RR2A 1WL8A 1QPZA 3M5CA 3MS2A 3W9UA 3C3JA 1EGQA 4ZOCA 3S27A 4PHCA 3MWYW 3K09C 4DEXA 4LMBA 5A4AA 1PWYE 4TQAA 3VU9A 1KP9A 3NWEA 2CDRA 4RA6A 4HT3B 1QYCA 3UJ3X 4M46A 2C92A 4O2BA 4N47A 4ENVA 4LC0A 1R0LA 1JEYA 1JSLA 1C80A 3NUGA 2Y0BA 2F1JA 2PSHA 2B1GA 4KOEC 1O3YA 2ZJ2A 3S2EA 1NRJB 4CHGA 1Z6TA 3ABZA 1OGYA 3D3QA 4PYIA 5C3UA 2WICA 3IVCA 2QB5A 2YMPA 1V8FA 3EUAA 4R5HA 3RUPA 5FKJA 1R10A 3PENA 2D54A 1L4NA 2HRRA 4PTZA 4RK0A 2QTLA 3LUCA 2QMHA 3VTKA 1NRXA 1Q7GA 3WWOA 1CS0B 2IC5A 5TMDA 5T8KA 4NX2A 5IBRA 4KBYA 5IVIA 3QMWA 1Z29A 3TMYA 2I7VA 3UK2A 4I6JA 5JXWA 4MQFB 5DEOA 1MX3A 1Q44A 2ZSBA 2B98A 2I22A 2JDID 1HSOA 1TFRA 3ZD6A 1EQUA 1A76A 1E79D 3C5HA 1GSOA 1E0AA 3EJWA 1UBSB 3NONA 5DI9A 2OK8A 4ETWA 2NSYA 2VSYA 5DT9A 1DX4A 2ZB8A 3I9LA 3NBKA 4NBSA 1U8FO 3B9BA 3I53A 5JYAA 1TUGA 2G3YA 2PAFA 5AOAA 4BCCA 1HFKA 4LQLA 1TLFA 2HMYB 5IHXA 1RR6A 2QMUA 1J9ZA 5JVDF 3N2NA 4EO4A 2IU6A 4JJ7A 4P7BA 2J3DA 1CUZA 2GKSA 5HF9A 1Z12A 4Q9NA 3R8CA 1U7WA 4GRDA 5EE9A 4CTJA 4PZPA 4EMBA 3R76A 3OBBA 4H3KB 1OBOA 2H4YA 2ILTA 3HB7A 3IUMA 2W6OA 3NJ4A 3TPFA 1XGKA 2ZDHA 3W6ZA 4CYMA 2IQIA 3M9LA 1XCJA 1XEXA 4X94A 5JAPA 4K9LA 4I50B 1NYQA 1YQDA 1C30A 4XUDA 2CVOA 3AV0B 5DM0A 5AIBA 5KPDA 1SVWA 4QLOA 1I2AA 3DOIA 4KFUA 1UBCA 2JARA 3VYVA 3E9RA 9LDTA 3RYCA 4DLKA 2X4LA 2XUOA 3RVDA 4EO9A 2P0YA 1L7MA 1WUTA 3FCSB 3HCCA 4M60A 2C5GA 2LCIA 4X60A 4YRTA 5IK2A 3BGIA 4WZBE 4LBVA 4AFNA 5C4IA 4LVNA 4RMIA 4MUAA 2XDWA 4OBBA 3EZXA 1O5TA 5IVHA 1UJ2A 1Y8QA 4KXNA 4UMDA 2I2CA 3L8HA 1OV4A 1Q3TA 3O93A 2QX6A 1T0JB 3CB4A 2AG6A 4FR2A 2QD2A 3G9XA 2Q3BA 4PPNA 4KL8S 5J5AA 1F0PA 1GZ5A 1SBCA 1J2RA 3H65A 4XD7A 2EEPA 3SR4A 3T9DA 1AF4A 2IOQA 3KSAC 1A27A 1M6WA 2FDRA 2QYSA 2ZANA 4CFZA 4QJ4A 1EK0A 4OH1A 4L28A 3ZIAA 5JR3A 3A58B 1P7PA 1TKCA 4LZPA 4EM6A 5KC9A 5LJIA 3E9NA 4CEIB 5FUMA 2PMEA 4Q01A 3EIHA 5IJ9A 4U8HA 3HBFA 2WG1A 4LC1A 5ICGA 1UP4A 1GPWB 2Z2IA 1WY7A 2V6GA 3F2VA 4YRFA 2R0QC 1U4NA 3BQNB 5DULA 5ER6A 5IXYA 1AY0A 1FDVA 5EXSA 1TRKA 1NUTA 2HHCA 1A71A 2C5SA 2BSAA 3AEQA 4XB1A 3DYIA 4JEUA 2V98A 1P0CA 4UHDA 1NTRA 1YZGA 4TTJA 2A59A 1GM5A 3TG2A 2ZIEA 4LXIA 4JFRA 2A0UA 2BFDB 1SXJE 4D9EA 3PPXA 1QPGA 2VXBA 2X8JB 1XMQB 3LX6A 1F12A 2Q6TA 4YGXB 2QRQA 4J2OA 3K9HA 2UXDB 1GWNA 2PZ8A 2ZI9A 1EE9A 5FOVA 3ZH2A 3SCZA 2OT3B 4PSAA 4DCPA 4G8DA 3V8QA 2NXNA 1FP1D 4EBBA 3HB5X 1NQ5A 2VCEA 1J4AA 3PCXA 4IG9A 2WIGA 5IJAA 5PNTA 3F7NA 4F21A 1FLDA 1OD6A 4R0MA 2OLKA 2CZCA 3HFSA 3L1KA 3N07A 1BROA 1IATA 4QA9A 3NTRA 1MENA 1U0LA 2CHFA 2HC9A 2QD1A 3KJXA 1BRTA 4QRHA 4AK1A 5DM60 2O5EA 2JGIA 2Q4OA 4M98A 4TMVA 5K0CA 1Z39A 1XNRB 3KCNA 4C7XA 5JNVA 4WLFA 2ZWMA 4FMPA 4YI3A 3WRXA 3IWBB 4HBGA 1JIUA 1V1RB 3LY7A 5CNJA 4OOEA 2QLFA 2FUNB 1MJGM 4Q3KA 3ROZA 2FG7C 1KO8A 1XOIA 1QMIA 3A1TA 1D5CA 3B5EA 3L8DA 4FWBA 1VKJA 4YJ3B 4WBXC 4CM4B 3FW1A 1MAWA