3QVXA

L-myo-inositol 1-phosphate synthase from archaeoglobus fulgidus mutant k367a
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
392
structure length
392
Chain Sequence
MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFASPMDTNVINTHEQFVVLKEWYSNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic crowding drives the catalysis of myo-inositol phosphate synthase, as deduced from a crystal structure of a trapped catalytic intermediate
rcsb
source organism Archaeoglobus fulgidus
molecule tags Isomerase
molecule keywords Myo-inositol-1-phosphate synthase (Ino1)
total genus 160
structure length 392
sequence length 392
ec nomenclature ec 5.5.1.4: Inositol-3-phosphate synthase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qvxA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qvxA01
5J9GA 3RWBA 3GMDA 4OSPA 1P1FA 2RCYA 2X9VA 3BMOB 4A73A 1GYQA 3GAZA 4BHTA 1UZLA 2VUUA 3E03A 1ARZA 4Q3CA 1NPTO 2Q99A 2NM0A 3EDMA 4C7KA 1MXFA 3CMMA 4LCJA 1DDOA 3G1UA 1UAGA 2H1SA 1YGYA 3OM9A 4ILKA 4LSWA 5B12A 4MP3A 1LJ8A 3TZKA 5F1OA 3QVWA 1NR1A 3LK7A 5G4KA 5C5IA 1NQOA 4BNKA 3LT0A 4DA9A 4TRJA 1LRLA 4W9NA 1IE3A 1DJQA 4DYVA 4D43A 1B8UA 1P33A 1R12A 4AJ4A 4ZQHA 1HDZA 5T57A 4ALIA 1H9AA 1ID1A 3LC7O 1FDWA 1I01A 1YXMA 1K6JA 4NR0A 2PGJA 1NWCA 4NK5A 5AXDA 4A10A 4D3SA 3WYBA 1YOVB 3AK4A 4UULA 2X0IA 4PLYA 3T7EA 5IXSA 1Y1PA 2GF2A 4J4BA 4RLSA 2IEBA 1Q2XA 2C2XA 1LDBA 1O94A 4QT0A 3H7AA 1H2HA 1KS9A 2E6UX 4IJUA 4CMIA 1DFIA 1E6WA 3ZWBA 4D42A 1JAYA 1PR9A 3DFZA 4FCCA 1DC6A 4OH1A 4TVOA 1YJQA 4BNVA 4BKRA 2BFAA 5JS6A 2NACA 2O4CA 2XXJA 2ZYGA 3NEPX 2DFDA 4IGEA 5BNFA 3GR6A 2R2GA 1G0NA 1LSJA 4E5PA 3DMTA 1EE9A 1KVTA 2GR9A 4IUYA 4I8XA 3PJDA 3GG9A 3KV3O 3QY9A 2BKAA 3L07A 3BMNB 2VHXA 4DXHA 5DULA 3WGZA 1NASA 4D0SA 2VNSA 1SOWA 2X5OA 1SB9A 4XEHA 5JW6A 2Q2VA 2C59A 4NMHA 2QRJA 4GVXA 4PZCA 3H3FA 5EJ2A 3FNHA 3OSUA 1NFQA 4F46A 4CLXA 3RAJA 3OBBA 5T5QA 4AL4A 1PGPA 2VT2A 1RPNA 2CY0A 2YHIB 1PZFA 4MKRA 1A4IA 1QYWA 4JJGA 5A9TA 4MVJH 5MDHA 4U8GA 3A06A 2P5YA 4CM8A 4UUPA 4IQ8A 4QFDA 3HN7A 4BO0A 1KY5A 4EITA 3H5RA 3GRPA 1NHWA 4D3DA 2X7HA 2FR1A 3IJRA 2VOEA 3OQBA 4WPGA 4L9RA 1ADBA 3I83A 1MG5A 1U5CA 3VTZA 4XGNA 4BNFA 1EQ2A 5F21A 2G17A 4WLUA 4BNHA 3V1YA 1BTOA 5IZCA 1FJHA 1VL0A 1WW8A 1TB4A 1DEHA 3AUAA 2CDCA 4I5FA 3H5AA 3HADA 4E32A 1GPJA 1P1JA 1E3WA 1ZBQA 5T8KC 4GKVA 4B7XA 4MP8A 3I1JA 5F1PA 3Q0EA 1Q7GA 1AUPA 2OORA 4YJGA 3JD0A 3DWFA 3E8XA 4RDIA 4IDFA 4JX8A 2RH4A 2Y0DA 1HE5A 1GYRA 5C3MA 1ULUA 3JQGA 3TZCA 3D5QA 2HO5A 1IHXA 4GGOA 1XSEA 3DBRA 4RGBA 5TT1A 3EMKA 2VTEA 4PZDA 3CZRA 3MWDB 5KJ1A 2VRBA 3LF1A 3UKOA 1NFRA 1Y8RA 4GLOA 1QV6A 2OOSA 3BMCA 5A06A 4DRYA 3IUPA 4EUFA 3AOGA 3ASVA 2I3AA 1PJQA 3GEDA 4X54A 1R4NA 4YJGB 1UZNA 2YV2A 5GZ6A 1NP3A 1QYDA 1PJBA 4GX5A 4CM6A 4KZPA 4E2WA 3BTOA 3WIEA 1GFSA 1HYHA 1HSOA 3JD3A 4RLHA 1Q0LA 3K96A 2BGLA 4BNMA 3H9EO 1ZNQO 1V0JA 3GZNA 3TN7A 3LT1A 3ROQA 3EVTA 1H6CA 4P38A 3D3WA 5JCJA 1T2AA 3L6EA 3I4FA 1LXCA 2CMDA 4GSLA 3A1NA 4XYGA 1QMGA 4IZHA 2Q1WA 3RJ5A 4J0FA 3OETA 4A2CA 2Q49A 4PZEA 1O0SA 3VZQA 1R37A 3GK3A 3NDIA 3PVZA 4L76A 3BTSA 3X2EA 2B35A 4DMLA 1HDYA 1EFKA 1I36A 1Y7TA 1NYTA 2WE8A 1VSVA 2GDZA 3DZHA 3FBTA 2AEFA 4YQYA 3WS7A 2HMTA 2FPIA 3E18A 4MINA 1W0CA 2V6GA 4R1SA 4LGVA 2QRLA 5TSDA 3VHRA 1CWUA 3CSDA 3K92A 4WLVA 3PI7A 2WJPA 3PQEA 5C7LO 4LRTB 4YRBA 1S6YA 4FB5A 1LQTA 5IDQA 2UDPA 5JLAA 2WDZA 1IZ9A 1FDUA 3JYQA 5I7EA 4B7CA 4L4XA 3KYCA 4OJNA 4Q3BA 1ZK3A 3PDUA 4DLAA 2VYNA 2DUWA 1SEVA 3I9LA 4J2OA 5JDCC 4AJNA 1YRLA 3U9LA 1PZHA 2A94A 1E3LA 3DXFA 3H6KA 2PZJA 2DTEA 1KVSA 3RROA 3D4NA 4O5OA 4FGSA 3DONA 8LDHA 1MFZA 2WD7B 3EW7A 4J6FA 4AJJA 1R0SA 4B8WA 1A5ZA 2RAFA 3F3SA 4XGKA 3RVDA 1VL6A 3PQFA 5A05A 2C5EA 1RKXA 4IBOA 1T1SA 4WEQA 2Y0EA 4XYEA 1RWBA 4Z0TA 5BNIA 3A28A 3PEFA 1ZJYA 1V8BA 2ZCVA 1R6DA 3OQ1A 4GH5A 1XR3A 3DTTA 4FSHA 1ZXBA 4Q3EA 3DMYA 4KWHA 4BNWA 3F4BA 3H4VA 3WNQA 2G1UA 3PHHA 2FY8A 3DAFA 1WMBA 1ORRA 3W6ZA 5IJZA 3JQBC 2NVBA 4YAGA 1YBVA 4F3YA 1B2LA 3OEWA 3V1TC 4D44A 4ZGWA 4BIIA 5ICSA 1VI2A 3ZWXA 1HYGA 3NJ4A 2JFGA 2IODA 3ZV5A 5KJEA 3KOUA 4KDFA 1U8XX 2BFOA 5BSGA 1H6DA 2YW9A 4MVJP 2CFCA 3HWRA 3MJVA 2QRKA 3RUDA 1BMDA 4FW8A 2OP0A 3ON5A 1HE2A 5FEUA 2DVMA 3E9QA 4YCAA 2ZQZA 1HZJA 4HNGA 2R00C 4RDHA 2JCYA 2YZ7A 4JJFA 1BXZA 4GX0A 3PPIA 1GZ6A 3WQSB 3SLKA 5JC8A 1Y8QB 3W8FA 5BNTA 4HKTA 3R6DA 4JLWA 3K2EA 3TOZA 3SC4A 4WASA 3WX0A 1PS9A 3KEOA 3BHJA 4EI2A 4WLEA 4BO1A 3FHLA 1E77A 4Y8VA 1JU9A 3PJEA 4QECA 4GAEA 3JD1A 4UEJA 1HDRA 1J49A 2BGMA 2NUAA 1PZEA 3E9MA 3OQ6A 2GD1O 1VPDA 2Y1CA 2HJRA 2D3TA 2FP4A 5KJFA 4B4UA 4LSMA 3ZU5A 4Y98A 3WDSA 5T67A 3UAGA 4GMGA 3TL2A 1OAAA 2P68A 2Q1TA 1PS8A 2B37A 1M76A 3DZKA 1KY4A 2PKQP 1RJWA 4HWKA 3DL2A 1CQJA 1SBYA 1F17A 3ANMA 3H3JA 4J9VA 4B3IA 4BNJA 1DPGA 1D1SA 4IQ0A 1MLDA 2ET6A 5T64A 3JQ9C 5GY7A 4CR8A 4RPHA 3AU9A 3ZHXA 3OA2A 5BT9A 4FPXA 1Z74A 1IULA 3JTMA 1ZIDA 2VHYA 4UUOA 3QWBA 5G0SA 2FR8A 2BMAA 1T2EA 3A4VA 3V5NA 3INTA 1E5QA 2GSDA 2G76A 3IL2A 4KTVE 3PZBA 1C3VA 4HXYA 3U49A 3U4HA 2YY7A 1JN0A 5FWNA 3HZZA 2Z1NA 4FOSA 4JCOA 2UV8A 4I08A 3RBZA 3I23A 1GU7A 5TLSA 5DOVA 1Q1NA 4HNHA 5L3ZA 5CPFA 2PLAA 1PEDA 4ND4A 5A5FA 4Z0HO 1FF9A 4B4WA 4XJTA 6ADHA 5KVVA 2XAAA 3H2SA 1VRWA 5ITWA 3CMCO 3ONDA 1ONPA 2AQIA 1JWBB 4GX1A 3GEGA 1PR3A 1KERA 5BSFA 2QX7A 1V35A 4ND5A 1BVRA 2E49A 2VZ0A 4LN1A 2O3SA 1NQAO 4JROA 1PGJA 1YVEI 1U4SA 2JCXA 1CIVA 4B4OA 2P4HX 5AXCA 3HHPA 3N74A 3F5QA 2ZYAA 1Y81A 1PL7A 3TPCA 3ZW8A 1QLJA 1CETA 2POQX 5ICMA 3UCXA 4AVYA 3TFQA 3ZNOA 4CM1A 3HE3A 4JXKA 2DAPA 5THQA 4LCEA 1K89A 4JN6B 3QE3A 4K6CA 3WSVA 2I9PA 1Z73A 1PS0A 1WPQA 2WSBA 4MKZA 4XQ9A 3GA0A 1PL8A 3JQ9A 2QIOA 1YKFA 3BMNA 3OIGA 4OL9A 1FK8A 5U1PA 1UZMA 1U1IA 2VHZA 3KM0A 1E6UA 3KTDA 4S1VA 2B5WA 1WWKA 2ZYDA 4TKMA 5DOZA 3OJFA 4AJLA 1FDTA 4E2ZA 5JAMA 5JO0A 3E48A 4KUEA 3GDOA 4O59O 3A9WA 3QWFA 3RCBA 3U09A 4YAJA 3ZU4A 4E13A 1D8AA 1Y6JA 4NH4A 1HE4A 3O4RA 1LC3A 4J43A 3VDQA 3JYNA 3C85A 5U4QA 1VJTA 4EBFA 3L6DA 3UOGA 2WE7A 5A02A 2NU7A 1PSDA 1DAOA 5I9NA 4ESOA 4TROA 3M1LA 1V6AA 4ZN6A 1GADO 5DBGA 5A9SB 1Y8RB 1YL5A 1ISHA 5ENVA 3UF0A 1EUDA 3WTBA 4WE3A 3JV7A 4BB5A 4YYZA 4ND2A 1X7GA 2BELA 4C7JA 3FD8A 2EG9A 1DRWA 2J5QA 3DMTC 3GDFA 3I6IA 1ZSVA 2A92A 3ANLA 1ADGA 4ZQBA 4A26A 4E31A 1ISFA 4AICA 1PQPA 3IP3A 3DZGA 3DEYX 2VWHA 4NBUA 5A5EA 4YPOA 4J49A 3K30A 2C20A 3SJ7A 3IIEA 3RUEA 1T26A 1ZK4A 1Z45A 2ZIZA 4IDAA 1B26A 1U3VA 2EGGA 2Y67A 3HDYA 4RPGA 2UUOA 3C8MA 1HF3A 4MVJE 1C0KA 4OHUA 4AJ2A 5A9SA 1IPEA 4E6PA 3SBOA 4BQPA 4OOEA 4UVHA 4KUGA 2IXAA 4R1TA 3NJ8A 3TF5A 4J90A 3LZ6A 4GMFA 4II3A 5FI5A 3ST7A 1E5LA 2X0NA 1EVIA 2AW5A 4NU6A 5I9MA 4P22A 5TF4A 2ZTUA 4BUCA 5HA5A 3AOEC 4RF3A 1EVZA 1ZMOA 3LQFA 1R16A 3ZV4A 3ETDA 1M6HA 4BNTA 4YAKA 2BH9A 1GV0A 3F4LA 4PLFA 3GVHA 3ZWYA 2Y1DA 1UXKA 1BGVA 3QWHA 1SB8A 1HRDA 4WNCA 1PQUA 3M6IA 4E12A 2VWQA 5I7VA 2UVDA 4OXYA 3SJUA 3C7AA 2HMWA 5JY1A 5IXYA 5U9CA 3K31A 4CMEA 4CV2A 1H6BA 2I3GA 2PKRA 1WVGA 5L7TA 2QZ9A 2VHVA 1Y8QA 5DBFA 1I10A 3D4PA 4FGWA 4AJEA 4EYEA 2HMSA 1GPDG 3ZW9A 1AN9A 1GTMA 4I9HA 4Z9XA 3FWNA 5JAZA 3E5MA 1LNQA 2OHXA 3X2FA 2W90A 4YXFA 3VKVA 4XQEA 4ND3A 1ZK0A 4G5HA 4J7UA 3D7LA 3ZHZA 3QWAA 5JO9A 5A3JA 2B5VA 3PGJA 5JPIA 5EL0A 1AHIA 1KIFA 2WYUA 5KKCA 5FYDA 1NPDA 4CL8A 1X7DA 3L9XA 1HSZA 1U3TA 4JP3A 5EESA 3OECA 2VZ9A 4RVDA 2YDXA 5I7SA 1UDAA 1EEHA 1KC3A 1XQ6A 2B0JA 1WDKA 2P9CA 4GBJA 5EINA 1IUKA 1D3AA 2X5JO 2D0IA 1K3TA 2DBZA 3KUXA 5DF1A 5JDIC 2HSDA 4P8RA 2B83A 3VPGA 4INAA 2D5AA 4PG6A 1X14A 2EV9A 4AJOA 3B1FA 4I5DA 1R66A 1UUFA 4FFNA 1KOLA 1C1XB 2IE0A 1H9BA 3H65A 1P0FA 1E1LA 2NTNA 3CUKA 4CV3A 5C7IO 2EF1A 1IOLA 3CXRA 5HM8A 1LRKA 2DPHA 2WD7A 1TA4A 1YDWA 1LDEA 2P5UA 4J2HA 2WWRA 5DP1A 4CMGA 4EEZA 4WLNA 5JYFA 4HP8A 4YJFA 2ZTVA 1T24A 4FQ8A 4BO5A 4HUJA 5ENDA 4OSOA 3PRJA 3QVOA 5B4VA 5A3VA 1UP6A 4MPDA 2GZ2A 3QP9A 1X13A 1E7YA 2FMUA 2W2KA 2JKVA 3WSWA 1PL6A 3G79A 2NVWA 2AE1A 2PY6A 1ZMTA 1DIGA 3TQHA 3WGYA 3I9KA 5C37A 1SAYA 4LISA 5TJ9A 2E37A 2HMUA 1BXGB 1HWYA 3FBGA 2EGHA 2Q1UA 3ZV6A 3GGOA 1DC3A 1NAHA 3HJAA 3VPFA 1EMDA 4URFA 3KYBA 4KQXA 5JMPA 5TIIA 1PJTA 1DIBA 2ILTA 2PH5A 1A71A 3AI3A 4ALLA 3NGXA 2PKQO 4XYMA 1QLHA 1LEHA 2O3UA 3O03A 5IDXA 3ZGYA 5CG2A 4B3JA 3E6AA 1YO6A 4IDCA 5JE8A 3VTFA 1UAYA 5JXWA 3DHEA 2VWPA 2AG8A 4E33A 1UH5A 3FNFA 1IYZA 4BO2A 5GZ3A 1U2GA 4Q3DA 3GH3A 4K6FA 3RUFA 1I3KA 2FZWA 1I3NA 1XELA 2O50A 2EKQA 1H6AA 3V2GA 3OIDA 2RHRA 4JJIA 4BGVA 3L77A 4TRNA 3L9WA 1YQDA 3AUUA 3DC2A 4CPDA 1ZEMA 2BFPA 2W4QA 4J4TA 4E5NA 1FDVA 5ITVA 1BHSA 1RYEA 1R4NB 4XX0A 4BNYA 1YWGO 4TQGA 3LF2A 2FPPA 4NK4A 3KSZO 3PWKA 5JC1A 2R6JA 1E92A 3JQCA 4MKXA 1K6IA 4OQZA 3MJCA 3JQAD 2FHSA 1MV8A 3S8MA 4O63O 3H2ZA 4II2A 2HAEA 4CR6A 1YB4A 1BXGA 3K8ZA 3S2IA 1F0YA 3BHMA 4PLGA 4P4LA 4UREA 3PTZA 3KYDA 1TVEA 3KETA 3DBLA 3ROMA 3WGQA 3LLVA 3NV9A 4CUJA 5F3RA 4R1NA 3TSCA 3INGA 2RBEA 2NNLD 2PV7A 1KVUA 1YS4A 9LDBA 3JQ8A 3FI9A 3CZMA 5H82A 4XIJA 5HS6A 3RFVA 1Z82A 3RC7A 4GPD1 4I5EA 1C1DA 4FFOA 2GZ3A 4IDGA 2AEJA 3IP1A 2EIHA 3FR8A 5DNAA 1GD1O 1JQBA 4G65A 4YVFA 4EW6A 1ISJA 1XG5A 3WMXA 4CMIB 1M6WA 1ZK2A 3ULKA 1E3IA 2D5CA 2TMGA 4BGUA 4DBZA 5IN4A 2PNFA 2NU8A 3CINA 2HUNA 2YQ5A 1YQXA 3R0IA 4TRRA 3GFGA 2ZTLA 3F46A 3RUCA 5IZCC 3KYCB 3TJRA 2DQ4A 1WLYA 1GY8A 1ULSA 4DLBA 3AFNA 2QQ5A 4J1NA 5AXBA 5L45A 4KTTE 3C1AA 2GUGA 1C1XA 1GUZA 2OL4A 4GWKA 2NVUB 2NQ8A 1KBZA 3B1KA 2CDAA 1GL3A 2W2LD 3TZ6A 2BD0A 3NYWA 5CEEA 3BMQB 3JQFC 2UAGA 2PR2A 3QVTA 4I5GA 2Y66A 1IL0A 3AOEA 5CDYA 5GZ1A 1AXGA 4UVGA 3SLGA 2YV1A 4QFCA 2NSDA 3G0OA 3LSYA 4CLDA 2CVZA 1CEQA 5G4KB 2C29D 2J3KA 4S3MA 3A14A 4ALJA 3DBHB 2PD3A 2JHGA 5TGDA 4CLRB 4E30A 2D8AA 4IJVA 2PD6A 3ZNPA 3ZH2A 1GEGA 3WYEA 3D0OA 1YDEA 1LQUA 3TWOA 3AM3A 1T4BA 3F6YA 4WEOA 2NVUA 2Y05A 4XJSA 1I0ZA 4KP7A 5JY6A 1KYQA 3EYWA 3U0BA 3JQBA 5A03A 2BF7A 1ZVMA 3EC7A 1MA0A 4Z0PA 3VOSA 4Y9DA 3UHAA 4DWVA 3GMSA 3RKRA 4CLOA 5JSFA 5I7FA 4YJHB 1JA9A 1U5AA 2B4QA 3GZNB 1XLTA 3VH1A 4FFRA 2Y1FA 3SC6A 1GEEA 1C0PA 1N9GB 3RI3A 4AJKA 2Y0CA 1UDCA 3GT0A 5BSEA 1BDBA 3OEYA 1EDZA 4PIVA 4XR9A 1LSUA 4N18A 3PYXA 2X4GA 1CRWG 3PQDA 4XCVA 4Z9FA 4XD2A 1MB4A 1OMOA 2OZPA 1SOVA 4WCFA 2O7QA 4FR5A 3AY6A 1GYPA 3BMCB 4BVAA 5K9ZA 3UVEA 1ONOA 5F5NA 1TLTA 2VYVA 3JQ6A 1B8PA 1DIAA 3NT4A 4BMSA 2GPTA 4DMMA 5L4SA 3RU7A 2EW8A 3GDGA 3OP4A 4J1SA 4RPLA 4N54A 1EK5A 5KJCA 1UXHA 4DREA 4L4RA 1O89A 2AE2A 4XZ3A 3GVCA 3DB2A 3DHNA 2AXQA 2PGLA 4CMBA 1DB3A 2X9NA 4IPTA 1ZJZA 4NNJA 2OP1A 4IGFA 2OXIA 2VQ3A 2HQ1A 3FNGA 4YBZA 5DCUA 3CE6A 4FFLA 7ADHA 3K5PA 4GI2A 4J16A 4NHEA 2GRAA 2IRWA 3CIFA 1LLQA 2BFMA 1NVTA 3B20A 3K6JA 3CPSA 4NBVA 1U28A 5G4LA 2GNAA 1MGOA 1UJMA 1XU7A 2V6FA 4IS2A 2EHDA 1DLJA 4E21A 4FDAA 3BMOA 4TVBA 3GN1A 4RORA 4BGEA 1J4AA 2DKNA 1AGNA 2EW2A 1W4ZA 2C54A 3PYLA 2D4AA 1HTBA 2C2YA 3LLSA 4LW8A 4EJMA 3RD5A 3U5TA 4DLLA 2IYOA 1JVBA 4A0SA 4RVSA 4WOKA 2VOJA 1BW9B 2E4AA 1OZAA 3JYOA 2D59A 4UVIA 5GMOA 4DGSA 1W8DA 2FN7A 5T6BA 3DOOA 5F5LA 1PGQA 1U4OA 4BNUA 3GPIA 1Q7CA 4FIZA 2GO1A 4CMHA 1SPXA 1MC4A 3GC6A 2EXXA 4PG5A 2AHRA 4IY1A 4XDYA 4KMSA 4BO7A 3E1KA 1BG6A 2FSVA 1VKOA 2C07A 1I33A 4C4OA 1F06A 3RKUA 4CR7A 3PJGA 3ZWNA 5TJHA 4N5NA 4BNLA 3C7DB 4YTEA 4R3NA 3WTCA 4WOJA 2XOXA 4JQCA 2PZKA 3MZ0A 1LU9A 4P4NA 3VPHA 4EGFA 1NWHA 4RZHA 3RUHA 3KSUA 2BRUA 2I66A 3W8DA 5KCZA 5COBA 1XWFA 1U7TA 3DO5A 1C0IA 3WGOA 1G1AA 5G0WA 4CM9D 4YR9A 3B1JA 1I2CA 2AG5A 5K0ZA 4M49A 4PG8A 5JDIA 3TNLA 3ETEA 3HQ4O 2DC1A 2X23A 2B36A 1ISIA 2J6IA 3GUCA 3HFSA 1PGOA 4EJ6A 2GGSA 3L6OO 3DZBA 2EERA 2I65A 2FWMX 3UH1A 1HDXA 4BNGA 5HRUA 1P45A 4BNNA 2QHXA 2O4UX 1O8CA 3OJOA 4TMFA 4M54A 4N5MA 4RVUA 4PG7A 1ZFNA 4E5KA 4FC6A 1K5HA 2ZB8A 3R1IA 1LA2A 3VVCA 3ZDFA 1OOEA 3ADPA 1M75A 2NADA 1D7OA 1ZH8A 5L53A 5COAA 1XQ1A 2C82A 3BMQA 1OBFO 1NFFA 3DQPA 1P74A 2TMDA 3NTOA 1I2ZA 5HBRA 1D4FA 2E48A 2AQ8A 3C7CB 1WXDA 3F1LA 3QVSA 3WLFA 4WLOA 2ZB7A 3Q2IA 2OUIA 5K6AA 4B8ZA 3Q11A 1ZUD1 3I52A 3WGHA 2I99A 3BXXA 4CQMD 1MXHA 3WWYA 4XIYA 3S2GA 3D3WB 4HBGA 1FDSA 1NVMB 2HU2A 5JCXA 4QTZA 4U6QA 3N7UA 3QQPA 3WMWA 1M66A 1GR0A 1DLIA 4BV8A 3AJRA 3JQ7A 2QW8A 4YWJA 4CM9A 3HG7A 4Z3KA 3EHEA 4LVUA 1E3EA 3I5MA 4IDDA 4K28A 1P77A 2CSUA 1MG0A 1DFHA 3VPXA 1X0VA 3SXPA 4N7RA 1XHLA 3TL3A 2VYND 3DBLB 1SC6A 3H9QA 3KO8A 2EKPA 1TT5B 3MWEB 3KB6A 3WG9A 5LCXA 1HZZA 1EVJA 4IJKA 4JBIA 4R5HA 3GOHA 2X86A 1P1RA 3ENNA 4GGPA 2GZ1A 3H8VA 3GNSA 3HDJA 3WFJA 2NWQA 2GCGA 2YUTA 4WK6A 1OI7A 3OH8A 4I9UA 4JK3A 5CFZA 4RZIA 5JAIA 1T2FA 1XIVA 2HDHA 1HDGO 1I32A 1XKQA 4EEXA 1A72A 2A4KA 3OIFA 4HFJA 4YEDA 1GZ4A 1U2DA 2EP7A 1GUYA 2DBQA 4YJFB 2H63A 2NU9A 3NDJA 5KOIA 5T8KA 1NHGA 4CQMA 4YAIA 4YB8A 3I9NA 1H2BA 3JYLA 3R3SA 1NR7A 1NTOA 2GASA 3U4CA 1V3VA 4RVHA 4R9SA 3RFTA 4RVGA 1KETA 3ICPA 3GPDG 3NTRA 3GN2A 1RYDA 1XGKA 4CLHA 3K9QO 4ITUA 5HS4A 5H81A 2QYTA 3DZFA 4PVDA 4DQXA 4XYLA 1DIRA 2PGDA 1ADFA 1IHYA 6LDHA 2DUUA 4R16A 5G0VA 4O0LA 3DHYA 1ZKMA 1P44A 3NKLA 5JFOA 5ILOA 2X22A 5CP8A 1P31A 5DT9A 3ZWMA 1P9LA 4IINA 1NVGA 2RH8A 3CH6A 1B0AA 4IDEA 2JJYA 4KUHA 1G6KA 4HFMA 1P3DA 1GQ2A 1CDOA 4BKUA 4NQZA 2EEZA 3V2UA 1PTJA 4IQGA 4MOWA 1PWXA 1X7HA 4M55A 4DYDA 3NT5A 1EUCA 3EZYA 3ZCXA 1O5IA 5KVQA 4CLOB 1LI4A 3NUGA 1DIHA 1GUFA 1ZCJA 3WICA 4QSMA 4CMAA 3NTQA 1ISGA 4RPJA 2G82A 4B79A 4TRMA 3PZRA 1PJ4A 1N8KA 3UFXA 4NFSA 4BMVA 3KLMX 4IMRA 4M1QA 4NJMB 4YT2A 3ZV3A 3HB5X 1GAEO 4GL4A 4R1UA 1NXQA 3F1KA 1HT0A 4W7HA 2O2SA 4DIOA 2AMFA 1EK6A 4ZQFA 4M87A 3GLQA 4YQZA 3ZU3A 1LDYA 1ZK1A 3FR7A 2C5AA 5IN5A 2NQTA 1FXSA 4E5YA 4WCDA 3T4EA 4BO3A 1L7DA 3GVIA 1LLCA 2Y93A 4NBWA 3WGIA 2C0CA 3GRKA 3MCVA 4W9NC 3WGGA 2CF6A 3DFUA 3RUAA 2B69A 1N1GA 3PHIA 1DC4A 1U9JA 4RF2A 5KWEA 2JFHA 4NBRA 3WQQA 5T73A 3G49A 4PG4A 1YBMA 4YA6A 3H9UA 3DAGA 1V3TA 1ZW1A 1A9ZA 3G1TA 3GGPA 3BYZA 3BZUA 4E0BA 2ZJ0A 3PLNA 4RF5A 4ZRMA 4W4TA 4U6SA 5M6DA 3BTUA 2X8LA 4MJLA 1Z7EA 4GSKA 4R41A 4CM3A 1JVSA 2JAPA 5EQDA 1ML3A 1PZGA 2P4QA 5BSHA 1J5PA 4NG5A 2Y1EA 3HB4X 4ZD6A 8ADHA 4D45A 1HKUA 4D46A 2D1YA 1H93A 2PA3A 4OGWA 3BA1A 3F47A 1OFGA 3FWZA 1DOHA 2O7SA 1R0LA 3OA0A 3JSAA 3PLRA 3KEQA 4K9DA 2IDZA 4DL9A 4YT8A 2CDBA 4HADA 3BAZA 5TX7A 1MP0A 1H94A 1TT5A 2O23A 5EN4A 3VH4A 4BL5A 4BKPA 3GAFA 1HXHA 2X0JA 3VDRA 1Y5MA 5JMWA 4ONEA 2YQ4A 3UW3A 1KVRA 3DZIA 4FN4A 1IY8A 1B3BA 4WCFB 4EDFA 1WDLA 5JYAA 1BXKA 7MDHA 3K2BA 1EVYA 3KBOA 1YQGA 3JCZA 3WR5A 2XF8A 2ZQYA 2NU6A 1KEVA 5CDSA 3D4OA 2P2SA 3SVTA 2YFHA 1M2WA 3PWSA 4ZRNA 4PCVA 4R69A 3PJFA 1DO8A 3FTNA 3WBFA 2Q3EA 1QSGA 3PK0A 4KOAA 1IPFA 1HDCA 4FJ1A 2RIRA 5AVOA 1VSUA 2GN9A 4WKGA 3PIDA 1T2DA 3LC1O 3MJTA 3DBRB 3F9IA 3WYCA 1LBEA 1UP4A 5IDYA 5H83A 5DCYA 3MJEA 3ZNNA 3P7MA 3GHYA 2CNBA 4J7XA 1CERA 4CLRA 1P1HA 3RSHA 3HUDA 2OGUA 1Q7BA 4NU5A 3GGGA 1DJNA 2ZTMA 3B6ZA 3OJEA 2X9GA 3ABIA 3O8QA 3Q6IA 4CUKA 4PN3A 1Q0HA 3WFIA 4CMKA 3SEFA 5TT0A 4CM7A 1H0KA 2W2LA 4J0EA 3RJ9A 3VKUA 5BQFA 5HWSA 2BI7A 4PLHA 4U5QA 2AEMA 4DUPA 3JQDA 4JP2A 5IAAA 3DR3A 3TOXA 2I6TA 3I9OA 2Q4EA 4MIEA 2IZZA 4ZJUA 4NFYA 2BLLA 4YRAA 3LT4A 3IKVA 1YB1A 1LLDA 2J3HA 2NV6A 3VVBA 2HRBA 4LVCA 3T7CA 2FZEA 4E3ZA 4WUVA 5ADHA 4ND1A 1VLLA 1VL8A 3P2OA 3Q2KA 5IDWA 4A5OA 3UGKA 5EERA 3TZHA 2ZJ1A 2GN8A 4B7UA 1RM3A 2EWMA 2O3JA 5KIAA 2HK8A 4IMPA 4G2NA 3I9JA 4CM4B 3KRTA 1VJ1A 3UUWA 4JBGA 2H6EA 4WNIA 3PXXA 3ZHBA 4Y6SA 1E7QA 3ETGA 2VTDA 2GYYA 5CEFA 5LDHA 4MVJF 1F8GA 1LSOA 3QVXA 3PHLA 4XB2A 4J1QA 9LDTA 4E2XA 1OC2A 4Q9NA 5KVSA 4K26A 1DRUA 4QX6A 1KEWA 4LMPA 5ER9A 4H7PA 1XYGA 3VAZA 1P0CA 2J3JA 1DFGA 3DZJA 3LT2A 3NRCA 4FC7A 4D0RA 4RJTA 4O1MA 1LTHR 1B7GO 5DZSA 4MO2A 3NDRA 3IS3A 2IZ1A 2DBRA 4DC1A 3VZSA 3WJ7A 4H3VA 3AFMA 1P1IA 2C7GA 3NAQA 4J9UE 4F6CA 2P9GA 3RC1A 1C14A 1JAXA 2VYVD 4AJIA 3MJSA 2EP5A 1SEPA 4PLCA 1AE1A 3JD4A 3U4DA 2O3QA 4F6LA 3HSKA 3QRWA 1T2CA 1I24A 4EZBA 4IXTA 1NBOA 2Y1GA 2Q1SA 1YL6A 3W4IA 1RM4A 4R3WA 5I9LA 3O9ZA 2O2YA 1E3SA 3KVOA 3VZPA 5ILGA 1HEUA 1W6UA 4Y67A 1QG6A 4YACA 1H5QA 1B8VA 1MFPA 4L75A 3VC7A 4CMEC 4OMUA 4A7PA 3OHSX 4HX5A 4UVEA 4ZQGA 4B4VA 3ZWOA 4EUEA 5ES3A 1MX3A 3Q3CA 1NPYA 4KQWA 5JAQA 2C7VA 2JD0A 4TKLA 3D3EA 5JDCA 1WZEA 2O48X 4BOYA 1KVQA 2JHFA 3D1LA 3LU1A 5LC1A 2I5PO 2ZK7A 4RVFA 2HRZA 5C7OO 3D64A 1U8FO 1EZ4A 2VZ8A 4NJOA 3QWIA 1LSSA 3ITDA 3EVNA 3ZHYA 5A4DA 1HDOA 2HJSA 1NM5A 2V7PA 3DAPA 2QYSA 1V9LA 3AM5A 2O3RA 3OICA 3ZZNA 3FRJA 1PWZA 3AWDA 4JNKA 5COQA 1LC0A 1E7SA 1CJCA 1NX6A 5CPBA 3Q9UA 5DP2A 3EZLA 1HL3A 1DBVO 3D5TA 2YYYA 4J4HA 3C1OA 4IJWA 1DRVA 3PHJA 1Y9AA 1N7HA 2X1HA 1XA0A 2JAHA 4M8SA 4YJHA 4MIYA 4CV0A 4E2YA 4Z6KA 4QO7A 4FS3A 1K6XA 1PU2A 4CLEA 4XRRA 1ENZA 1LX6A 4XWYA 3RBVA 4W7IA 3M2PA 4ZVVA 3GQVA 1ISMA 5KJ6A 5AXAA 4H16A 5TQVA 4PRLA 3SX2A 4J7CA 3IDSA 1QRRA 2EJWA 4ZU3A 3P5SA 4TZKA 3W4JA 3L4BC 4FBGA 4XQGA 5TRTA 2HLPA 1TT7A 2VRCA 3WBBA 4PFJA 5EMHA 1JTVA 2GLXA 1N7GA 2FOIA 4FJ0A 3H9JA 1PGNA 1E7RA 3O26A 2B4RO 4M86A 5CDUA 1ENYA 2AQKA 1VKNA 3RU9A 2Q2WA 5CHEA 2NLOA 4MVJM 3EUWA 2H9IA 2GERA 4AJHA 2EJVA 4PGFA 4BO9A 3HN2A 4FOOA 4UEKA 4ALNA 3F5SA 3NGLA 5CEJA 4WGGA 4CQLB 4CM8B 1DAPA 4PLPA 2O3TA 5I8ZA 3COSA 1NQTA 2LDBA 3NX4A 3WWZA 4IXWA 3W6UA 3CTMA 3WGTA 4BKOA 1ENOA 2ZB3A 4QQRA 4I9NA 3MTJA 3RUIA 5HTOA 1HE3A 4PLWA 2PTGA 5KVCA 4QXMA 5TS3A 1QYCA 4ZQEA 1ZO8A 4NFHA 1IZ0A 3EGOA 1QKIA 1JKJA 3BHIA 1T25A 3PFWO 2WD8A 4BB6A 4Q39A 1SCUA 3DOCA 5L7YA 1PJLA 1U3WA 3PGXA 3HFGA 5L40A 5ER6A 1GQYA 1YONA 4L0QA 4Q3AA 4M89A 5L9AA 3UXYA 1UXJA 1LRJA 1CF2O 1E7MA 3MEQA 4E4YA 4ALMA 4L74A 4D41A 3HNPA 2QZZA 4BO6A 1HLPA 3GUYA 1E6EA 2DLDA 1L7EA 2JFFA 4WJZA 4OM8A 4OIMA 4D3FA 2VRCD 4R4JA 3ZWCA 4MVJG 2PH3A 2DT5A 1WMAA 1N92A 2IEDA 2ZATA 1PJ3A 3QV1A 2P9EA 2VHWA 5F1KA 2CZCA 5LDGA 3QSGA 2IZ0A 3ZWPA 4J91A 3IJPA 4R68A 2VT3A 3O38A 2VWGA 4F45A 4TSKA 3MOIA 3GNQA 3I6QA 5G0TA 2WYWA 5I8WA 3C3XA 3Q9NA 3QJ5A 3RBXA 3E82A 1GZ3A 1T4DA 3FN4A 2YFQA 4PRKA 4NI5A 3QLJA 4QUKA 4RQUA 3OJ0A 4DIBA 2ZB4A 1R15A 3MOGA 4CV1A 2EKLA 2G5CA 2WMDA 4OAQA 3O8QB 4GLLA 3FSRA 1ZEJA 4FFMA 3OFSA 3GZ4A 1WAMA 2DM6A 3ASUA 4MIOA 1YJ8A 4RL6A 2PD4A 4XQCA 1DSSG 3RIHA 3CKYA 4MVJA 3ANNA 1E3WB 4A03A 3WJAA 2QG4A 3PWZA 2BGKA 2CVOA 1T1RA 1PQWA 4U0JA 3STHA 5G0UA 4IIVA 1HLDA 4NBTA 1VM6A 2J8ZA 4BS9A 5L51A 1PJ2A 5AQ1A 3W8EA 1QORA 3E9NA 4MDHA 4OXKA 4DC0A 4ROSA 1SO8A 2Q4BA 3UN1A 3W4KA 2HK9A 1D1TA 3WQRA 1BDMA 4FJ2A 1JKIA 1B15A 3H9GA 1EBUA 3ZI0A 4AFNA 4BO4A 3AUSA 4DPLA 2Q45A 2ZKLA 5B1YA 2PFGA 1QV7A 2NTJA 1PJSA 4AJPA 2Z5LA 1ADCA 1QP8A 1OC4A 1ONNA 4U7WA 4YDRA 4YRDA 3DDNA 3L0DA 4FFPA 4GX2A 1EE2A 1JWAB 2OBYA 4NPCA 1E1KA 1A9YA 2VUTA 4NDNE 1ENPA 1N2SA 5AOVA 4WECA 1EQUA 1F8FA 2X0RA 4YAEA 3ZWVA 4AJ1A 5B4TA 3L4SO 2XXBA 5JYEA 3TZQA 1A7AA 3JYPA 3ROKA 1X1TA 2OO5A 4RPKA 1WZIA 4NJMA 1X1EA 3AI1A 2DFVA 1EFLA 1SMKA 2W2KB 1UXGA 1AXEA 3MJ4A 5JYDA 2DBVO 1M67A 2GN6A 1TXGA 3QW2A 2J3IA 2FPGA 4BMNA 5JCJD 2A9FA 4MVJD 1V3UA 1SNYA 1YH3A 2OBNA 4JIGA 2CUKA 1DHRA 2AA3A 1J6UA 4CM4A 5EIOA 4O6VA 1XEAA 3KLPX 1I3MA 1EUZA 1NAIA 1GCUA 2W98A 4L4SA 1LUAA 3P19A 4UAGA 2IYPA 3JQAB 3JD2A 4P4GA 3WLEA 1O95A 5A9RA 3ROPA 4DVJA 1X15A 4HFRA 5IG2A 2DU8A 2PWZA 1YL7A 3ZWWA 3FF4A 4BGIA 4LRSB 1XDWA 2RHCA 3VPSA 4TWRA 4OO3A 4DIFA 5L4NA 3PP8A 1EDOA 1ZZEA 1TI7A 2E82A 4TZTA 3JQEA 3K73O 4CL3A 5A04A 2B4TO 3GNTA 3WXBA 4OYRA 4R9RA 1XCBA 4DQUA 1Z7BA 3IC5A 4Y6PA 3BTVA 1NNUA 2CD9A 3FCOA 3AUTA 4A27A 1EBFA 1XU9A 3TRIA 3S55A 1E1NA 1GDHA 3WOHA 5KNLA 3WNVA 3KHUA 3QA9A 4NIMA 4L73A 3U62A 1WNTA 1PIWA 1KC1A 3DTYA 4OOFA 3HDHA 1QR6A 1NQ5A 3IQDB 4NZ9A 3KXDA 4PLTA 5CDGA 4EJ0A 3V1UA 3RC9A 4GVLA 3G3EA 1U3UA 2A35A 2UUPA 2DPGA 3ICCA 2X5KO 4KDEA 3W1VA 3EAGA 3I9MA 2YJZA 3FPLA 3H5NA 1R0KA 1BSVA 5A1TA 1MC5A 3I4CA 4ZICA 5AYVA 2JCVA 1C1DB 1VJ0A 1I5RA 3C24A 3AW9A 1W73A 3TDKA 1UDBA 5DDIP 3VZRA 3GEMA 4DPMA 4GKBA 3ONEA 4CMJA 2Y1OA 1GCOA 1WP4A 4OXNA 4WLFA 3UICA 4CJXA 2WM3A 3DBVO 4OKNA 3VH3A 4XYBA 3RC2A 1GV1A 5JNLA 4D79A 4UEOA 3KYDB 5G2OA 4XA8A 1DXYA 3ADOA 1A7KA 4RCVA 1B16A 3V8BA 4BNIA 1I2BA 1BVUA 4MP6A 4G81A 4DTIA 1JW9B 3R3JA 4Y6RA 4YT4A 1PJCA 1LDNA 1LLUA 3JQGB 1F12A 1E7WA 5BR7A 2YHUA 1C0LA 2V65A 4RO0A 5CDTA 2V6BA 2AQHA 3IMFA 1P1KA 1DHTA 1WDMA 5CAEA 2FSSA 4JGBA 1QXSA 5DN9A 4CMCA 4IIUA 1ZSYA 4XR4A 4BO8A 3I3OA 3PYMA 3JQ7B 3JQFA 2Q2QA 3INRA 4BNZA 4IM7A 1CQIA 3E5RA 1KEPA 5L95A 3AY7A 1MUUA 1Q0QA 3V2HA 5IFLA 5KKAA 2Y68A 1HYEA 3L4BA 3MTGA 2R00A 4W6ZA 5IZ4A 4IDBA 4JBHA 5TC4A 5TNXA 3KSDO 1I30A 2I76A 3ITKA 1RM0A 5IF3A 5DCWA 5L7WA 4DBVO 4XRGA 1B14A 2F1KA 3AY3A 3Q1LA 1E0DA 5CG1A 2F00A 5EQFA 1TEHA 3GF4A 1LDGA 1F14A 4U0KA 1A27A 2J5KA 2WEKA 3PHGA 3IUSA 1L1FA 2DTDA 4XDZA 2YDYA 1ZSNA 3U3XA 3QHAA 4GQAA 2HMVA 5JBIA 3ZN2A 3ZU2A 3EK2A 2LDXA 1AHHA 3M1AA 4BQRA 3TFOA 4N5LA 1JLLA 2P91A 2G0TA 2J5RA 4PLZA 3AM4A 2Y99A 1PX0A 1A4UA 2I67A 3P2YA 3G17A 1BRMA 3N58A 4B3HA 5L4LA 2JL1A 1VE9A 3ZWAA 5B4UA 4BKQA 1N1EA 1Z6ZA 3QIVA 1YBAA 3RQSA 3GVPA 4QO8A 4DQVA 4IS3A 4Q3NA 2FR0A 2FRDA 3B70A 4J1TA 1O6ZA 1K2WA 1N5DA 2WYVA 4WCFC 3ONFA 4I1IA 1N9GA 3ENKA 1O9BA 2Q50A 2VNAA 3CEAA 1J0XO 5EPOA 2BI8A 4XB1A 5K6AC 2PZLA 5J23A 4BV9A 4QEDA 3JQ8B 4Z9YA 3UCEA 2JD2A 1YOVA 1YE3A 3IOYA 2OFPA 2SCUA 1E1MA 4IZIA 5FF9A 3WIDA 2VN8A 3DOJA 3GY0A 4FD3A 1CYDA 3RASA 4CODB 2YHIA 4XKJA 4CM5A 4PLVA 2CF5A 3DBHA 1KEUA 1BWSA 2YV3A 3EY4A 3GFBA 3OMLA 4BNXA 1SZJG 4OQYA 4RF4A 1Y5RA 4UUNA 1QYXA 1DC5A 1I3LA 2Z95A 2Q22A 4KWIA 1K0UA 1UXIA 2X6TA 3LVFO 4HFNA 1E3JA 4R01A 1GQQA 4R51A 3VH2A 4CQLA 4E5MA 4CUZA 4L8VA 2ZCUA 1S7CA 4LMRA 3IKTA 1Y9EA 1B3RA 2PK3A 5THKA 3OJLA 1UP7A 3RFXA 2VCYA 2V6MA 2Q46A 3PFFA 2OMEA 4CQMB 3S2EA 4LK3A 2CVQA 3NT2A 3JQAA 5KTKA 3AI2A 4XGIA 3FPCA 3LDHA 4UUMA 4YJDA 3WB9A 4DPKA 3OF2A 3PIIA 3U4IA 1UR5A 3BIOA 4ALKA 4R54A 3FNEA 4ZA2A 4EUHA 3ORFA 4RV9A 2IXBA 2NTVA 4H15A 5FFFA 5B37A 3IAHA 3T4XA 2WTBA 4YT5A 1U7HA 1R4MA 2GN4A 2UYYA 4D7AA 2XPCA 3PDJA 1IB6A 4W99A 2Z1MA 4HY3A 4J3FA 1YB5A 1HETA 4GWGA 3M2TA 1LDMA 4K1LA 2W8ZA 2HKIA 1FMCA 2JD1A 3GHHA 3ZNQA 4HV4A 3HDQA 1QYVA 1VC2A 1Z75A 2HCTA 3S1LA 3GVXA 3LC2O 3C1TA 1RM5A 4MVJI 2BHLA 5FI3A 2H5LA 2D2IA 1ZXLA 4PVCA 3AU8A 4AG3A 1R4MB 4R5MA 4W82A 1BW9A 5DBIA 4Z3DA 2PZMA 1I8TA 3KZVA 5MGBA 4OKIA 1JDJA 3FTPA 2DTXA 2VUSA 4RQTA 3S2FA 2HK7A 3GG2A 3LYLA 4UVDA 1JKFA 4ZHSA 4ID9A 3UCFA 1X0XA 2X58A 1G0OA
chains in the Genus database with same CATH superfamily
3IOBA 3RWBA 2WU1A 4OGFA 1CUFA 3VHLB 2RCYA 1CJTC 2X9VA 4A73A 3IQFA 4FNMA 4O2AA 4BHTA 1VPEA 1QWSA 4DDTA 1ARZA 1P7ZA 1NPTO 3IA7A 4QU9A 4PYKA 3JASA 4XM0A 3EDMA 4DRXB 4E70A 4NE7A 3PUVA 5L6MB 1S2LA 5AVKA 3QI2A 2PFSA 4C4PA 4Z53A 3WKAA 1J22A 2NZVG 3CEPB 1UC5B 1YGYA 3G1UA 2GK6A 3G89A 4ILKA 4O4IB 5EWJA 2OYCA 3RT7A 3UPDA 4D9NA 3D2LA 2XGOA 1J99A 2EX0A 2JFZA 2MR5A 2ZT5A 3ZZMA 2OKCA 3VR2A 3NALA 2VXOA 1OBCA 1WVMA 1L5WA 5G4KA 3W5IA 5C5IA 2XB9A 3O2JA 2A9PA 2QRVB 1NNLA 2GA9A 5LP6A 4AXXA 2VPWA 3TSZA 1M7HA 4QTTB 4W9NA 2I2FA 2H48A 1UIRA 1G20E 2I3BA 2FWIA 2PDAA 4ND6A 2R8ZA 2OWDA 4YMHA 1DJQA 4GP6A 2O57A 1P33A 1GTZA 4MQBA 1X77A 4MHSA 2WA2A 4HQRA 1HDZA 4QUJA 4ZT2A 5HK8A 1YXMA 1ID1A 2GEBA 1I01A 2ZT7A 2XTNA 4NR0A 1NWCA 1HOXA 3O1JC 3RRJA 3INYA 3VR5H 2Q29A 3WYBA 1I7BB 1Z2CA 2I7CA 1YOVB 3T7EA 2X0IA 3GT7A 4WOCA 3C4JA 2GF2A 1S4QA 3M1YA 1FYDA 2K7ZA 4BJ6A 2ZJ2A 4EECA 2IXEA 1FEZA 2R6AA 2IHNA 1VHWA 1MEJA 5FULA 1UKZA 2F3UA 1ZL0A 2IHBA 1FYWA 2V54A 2JGFA 3JATA 4OH1A 5JS2A 3KKQA 1YJQA 2OM2A 1T5TA 2A59A 2NACA 4GBED 1Z6AA 1JFLA 2WILA 4YV7A 1MO2A 1S2MA 3NEPX 4WERA 1G2IA 3W05A 1NMZA 1RXSA 4DDUA 1KVTA 2R6DA 3KHSA 4MGHA 2JCSA 3QLTA 5HE8A 2GAJA 3QOYA 2BKAA 3BMNB 1E1RD 2G04A 2BEJA 3W9UA 3JZDA 1FRVA 1DV2A 3AO0B 4INPA 1L7PA 1E9BA 5DULA 5C81A 1QYIA 5AICA 5BV0A 4RHCA 2G36A 4D0SA 2WZQA 1NXOA 4DEYA 4RY8A 2RC5A 2VS1A 2IUSA 3BG5A 3RV4A 2ZPAA 4C4YA 2VK1A 2V7EA 2HNBA 4OGGA 4W1RA 1U9ZA 2H52A 5AHWA 2VEOA 2NYRA 3FNHA 2BIFA 2H1RA 3ILYA 4F46A 3DKRA 3OBBA 4J0GA 2NZWA 2CY0A 4F85A 3I1YA 1UQUA 1RRKA 2E85A 2RSLA 2EOAA 3OLWA 5MDHA 2WAMA 3A06A 1ECFA 1T8RA 3ZQKA 5K0JA 5LZ2A 2BFCB 4O89A 2WHEA 5KNBH 4UUPA 1VQ1A 4OU4A 5DYGA 4NAHA 5A4MS 4BO0A 1KY5A 3HJBA 5KNDD 1XD9A 1WG8A 3GRPA 4MYSA 3EQ8A 5D8DA 4A92A 4YMTA 5HEKA 5CXUA 1RJDA 3ZX4A 3OQBA 2FZLA 3W5HA 4B76A 1S3FA 1KAHA 3D8SA 5AH0A 4W8HA 1FYVA 3C4QA 4UUBA 3UUFA 4XGNA 3IILA 1IZZA 1RP1A 1EQ2A 3RNLA 4DLPA 2VK2A 2ZDQA 1E2UA 3OIWA 3BWYA 4A4DA 8AT1A 5JWOA 1BTOA 2NSLA 1GKKA 1LS6A 3CF0A 1WW8A 4A36A 3UMGA 2CDCA 1PNTA 2XDAA 2CXUA 1GPJA 3MQ4A 1B74A 5FB3A 3E5HA 2V5VA 1ZBQA 2HIHA 3E1SA 2WWXA 4MP8A 3TZBA 4HVLA 1CDZA 1GGMA 4YJGA 1GZSA 1WLSA 1AOXA 1ZVKA 1XTBA 3TJMA 3U4AA 3WL6A 3JYHA 4Y2PA 4IDFA 1KP9A 3BH0A 3G0BA 2RH4A 221PA 3BF8A 4MQLA 2GTIA 3UH0A 1ADJA 1BMQA 7REQB 3MNFA 4E14A 4N5DA 5IC6A 1WCYA 2GETA 2HO5A 1D4OA 1MJ5A 1MIOA 1Z5GA 2IX9A 4GGOA 4QAQA 5TT1A 3QTBA 3F7TA 2VTEA 3BWDD 3DTNA 4K9RA 2VRBA 3LF1A 3T5AA 5E4JA 5ADVA 1Y8RA 2OQRA 3O4FA 1BXRB 1QV6A 4GYKA 3WMFA 1JDBB 2G9VA 2Q1XA 1JJAA 2AJCA 3R5HA 4JT9A 4LEIA 3W34A 4DRYA 3U16A 1NTRA 3IUPA 2NO6A 3AOGA 2REBA 2VJCA 3Q88A 1VSBA 3ASVA 3GEDA 1PJQA 4BTVA 2R60A 3CUUA 3H1GA 1QYDA 2P1ZA 4GX5A 4MUGA 4Z8XA 1BCRB 1M0SA 3I01A 4E2WA 3BTOA 3K6KA 3MWJA 3AB8A 3TSWA 4ZZ0A 5IVPA 1I9CA 4QPPA 4UOQA 1HSOA 2RH5A 3JD3A 4RLHA 2X7JA 1GXSA 2IYAA 1KOFA 1QMIA 1SCNE 4OA8A 3IB6A 4C0WA 5DK4A 4RV4A 4N47A 1X9IA 3LT1A 3ROQA 3TUXA 4B7AA 1XHFA 4P38A 4ZCTA 1QR2A 4JLNA 2GEFA 5C4IA 1UWCA 2QQGA 3BCUA 3D3WA 3PF8A 3Q5GA 5JS8A 1E9CA 3I4FA 3IV7A 3DMRA 4HF7A 4IZHA 5KQGA 1PZNA 3FCAA 2IHKA 4RK7A 4YFVA 2WTEA 2IUTA 1KOJA 4HB3A 4TV8A 3VZQA 1R37A 2CZQA 4F5DA 1T5DX 1QCCA 4LNAA 1W87A 1QQ7A 2B35A 5CVCA 1NBAA 5A0FA 1E2DA 2V9CA 4EJ2A 2QDKA 1CR1A 3I6MA 4KO1S 1F8YA 4MVXA 5CX1A 1I79B 5HKLA 1U2DC 2WIJA 1S2DA 2J0UB 5DGDA 2XIJA 4S2EA 3PXCX 2WSYB 3LUAA 3E9CA 3E18A 4MINA 1JIKA 3PC7A 4KKXB 3W77A 4LGVA 1TCVA 4D4JA 3NHFA 3CSDA 2H4ZA 4WLVA 1ONSA 2C7RA 3KJNA 1TU3A 2JFNA 4GUDA 3ZV7A 2QPTA 1U94A 2JC3A 1C9EA 3CX6A 3ZD6A 4YRBA 4LJRA 2ZJZA 4FB5A 1LQTA 2QE6A 5M29A 3JRXA 2O1WA 5JLAA 3OP1A 2WDZA 1J2EA 4Q01A 1JJ7A 4LNUA 2BFFA 1EFCA 1T9BA 1MBZA 5AK3A 1FDUA 1R0WA 3L2OB 3L8FA 4NYMR 4DW8A 4L4XA 3KYCA 4OXXA 4Q3BA 4C7OA 3LO8A 3PDUA 4DLAA 1QIEA 2VHCA 4HGPA 3SF8A 2DUWA 1CE8B 3PB3A 1SEVA 4INOA 1QE3A 4J2OA 4B74A 1L7VC 1BE6A 2YW2A 1XCJA 3DZ6B 4Y0AA 5FX2A 1XDDA 2EVWX 4BEBA 1JHQA 3FDFA 2BR3A 3B78A 2A94A 4MLPA 3D7KA 4PM4A 5HZHA 3ZJXA 3H6KA 4KZKA 5IX8A 1TRHA 3ESBA 2V7WA 4FMDF 4Y9TA 4AY5A 4EB3A 2PX2A 3RROA 3BXZA 3ONNA 4O5OA 1DEAA 1XWWA 4CF4A 5BSKA 4QYWA 1R0SA 1X9HA 1A5ZA 3RSOA 4OB6A 4KGDA 1P4RA 1Z07A 3V6LA 3IDZA 2JRLA 4F4UA 3ZEAA 3HKBB 4DQLA 3S8YA 2Z57A 2C57A 3FWHA 4NLLA 2C5EA 3TAUA 1BH2A 2EHJA 4XUDA 1T1SA 3WK7A 3RFFA 4C3OB 1T9GS 5C1OA 4NICA 4XYEA 1E8NA 5DXAA 3GFRA 3PEFA 4MWDA 3DOHA 1ZRSA 5FORA 3ZXIA 1TD1A 1XR3A 2OFOA 3LY7A 1WMFA 4FSHA 4GPAA 3JVDA 5F7XA 2WMYA 1S8NA 2F8TA 1CRPA 2FK7A 2JPDA 4RDXA 1TVKA 3OTHA 3H5OA 3PNOA 4ZWNA 2ZE5A 3F4BA 3CT6A 3GT3A 5LP6F 1W85A 2G1UA 3PHHA 2FY8A 4IXNA 1ORRA 1KI8A 1ZH2A 1BX0A 3MOSA 5IJZA 1XXHB 2NVBA 3KL2A 2JANA 4H31A 4I46A 4OGLA 4CIXA 2HBQA 4MV8A 1DWPA 5HF6A 3V1TC 4ZGWA 2YFKA 2O8EA 1TO6A 4DR3B 1XNHA 1I1OA 4O2BA 1MABA 3KOUA 2XE8A 2QUIA 4QVKA 2QN9A 2C04A 1L7RA 4A15A 2O2CA 2ZBRA 3E15A 2YW9A 3ZDYB 1P7YA 2FFQA 2H2AA 3F8WA 3MJVA 3G0IA 3TGWA 1GTJ1 2QMEA 4FW8A 2UZ1A 1E1CB 2RAPA 5AM5A 5JVDB 2C3OA 1HLFA 4TTIA 3A9UA 3D3EA 1CQIB 4U63A 4U00A 5FUXA 1RWOA 3UBTA 5LQAA 2M6RA 3UAZA 4FKBA 1DZIA 5BNTA 4KYTA 3LX4A 5DN6A 3KQVA 2IV7A 4C14A 5FT9A 3GRYA 3D1JA 5AI8A 3V9PA 4LI0A 3BHJA 3OF3A 4TVKA 3ZK7A 4BVGA 3VOAA 2VJNA 4EI2A 3SQWA 2CNLA 4AJ9A 3ZHCA 1K08A 1QGYA 4XSGA 4NZPA 5AJTA 1JL3A 1SBTA 4K86A 3UXEA 5JWRA 2A78A 4W5HA 1NLYA 3PJEA 1THMA 4QECA 1UC8A 4U3JA 4X71A 2FMKA 5D3QA 4YP1A 4O2BB 3V6MA 1C3LA 5ESRA 1RVV1 4XWOA 2QZ4A 2Q41A 5K3EA 3C8HA 1V5GA 4M7RA 2GVDC 5DMXA 2HJRA 2QL9A 2V7TA 1G6OA 1TUIA 2P6MA 3TS1A 1J07A 1ELOA 3LH5A 4Y98A 2G1AA 3WGJA 3SX4A 3B3AA 2RGGA 4ZI3A 3CNQS 5CXQA 4KYIB 3LGAA 1OAAA 1C2YA 1XLUA 2P68A 2ZDGA 4F4FA 1GPKA 4JYBA 4RL4A 2OXRA 4D9GA 4KO2S 1KY4A 2PKQP 4HWKA 2R5NA 3TQCA 1HYQA 2E1RA 1C3OB 1SBYA 2XGGA 1U0HC 1TKCA 2Q7XA 4FOLA 4J9VA 5E6RB 4JVMA 5DTRA 1NBHA 1UMBB 1D1SA 4K9MA 4IQ0A 2QQEA 5T64A 3WQHA 2DECA 3PS9A 4G1FA 2IU3A 2BM9A 2AN5A 2G9ZA 3IJEB 5BT9A 1UM9B 3ZYCA 3HVHA 5K8CA 4HNUA 1IULA 4Q4AB 3GLFA 3JTMA 6REQB 2VHYA 4GKAA 3QWBA 4HPJB 3ZOZA 4TMTA 1JQDA 1V5FA 2BMAA 2FR8A 2IYWA 5G0SA 3V5NA 3RAEC 1E5QA 3K05A 2EYUA 1PG5A 3WL3A 3WLIA 4HGOA 5E9WA 3IL2A 5FA5A 1LVUA 2ZRFA 4HXYA 4IV5A 4KPUB 2H16A 4QQFA 3K5WA 4P32A 4JCOA 1E18A 4XDHA 1TO2E 1GU7A 3Q87B 4FYMA 2HWXA 3K0FB 2BP7B 5IH7A 3RSLA 4X85A 4L2IB 4U4AA 5L3ZA 2PLAA 2WF8A 3TCNA 4B4WA 1NIJA 2VZEA 3CLTC 1RJGA 1CB7A 3HBJA 1UZAA 3H2SA 3OIYA 4IUBS 3OC6A 5ITWA 4P3PA 1CQXA 3NI2A 3NU1A 4G0PA 3MGBA 1CZOA 3P71T 4JLMA 4KMOA 4RX1A 4RXTA 4TMKA 4NHOA 2CNOA 2FETA 3T1OA 3VTKA 2HF9A 3GEGA 3KZXA 3NPAA 3RK1A 4BLWA 2AC7A 3G2IA 2A0WA 4M9ZA 1ZMXA 1V35A 4YCMA 2E49A 3EJWA 4MYHA 1G21E 2QW1A 1YVEI 4GYYA 4Q9IA 5KOHB 1U4SA 1CIVA 2AR9A 2P4HX 2ZFUA 4B4OA 1V9SA 4BX8A 2GAOA 1VHTA 2RGDA 3HHPA 3P2KA 3N74A 5BN4B 3ZS8A 1UFRA 1Y81A 4OYYA 5FJIA 3WGUA 3CRRA 3FNQA 1QLJA 1CETA 3FSGA 3KOMA 3H05A 2MSLA 3UCXA 1Q17A 1VLQA 1LW7A 4JXKA 3EIEA 4ZCLA 1QK4A 1GJRA 1K89A 1Q44A 2HHJA 4JN6B 1T1GA 5THQA 3REQB 4MHTA 2R6ZA 1ZN7A 1QS0A 3QLEA 5KTSA 3QE3A 4A8TA 5FPSA 2W00A 2E5WA 2VVTA 1T4CB 2EIXA 1PS0A 3AETB 1WPQA 4XQ9A 3GA0A 2QN1A 1E2JA 4YRLA 2CLOB 2ZBQA 3KTDA 4JBYA 4S1VA 4WXHA 4AZ0A 5KPJA 4YP7A 3ZE8A 2ZYHA 5UKDA 1IG3A 4WGFA 3OJFA 3HCDA 3HA5A 3BQNB 4QUBA 1TX4B 3ZKWA 5TQJA 4AJLA 1EK2A 4DAEA 4E2ZA 5JAMA 1HNXB 4ZC1A 2Q5JA 2DETA 1A8SA 3OLQA 4R8VA 3QWFA 5EZQA 1WU7A 2XUJA 3U09A 3RT1A 2QJWA 3WA7A 4E13A 1XWIA 1WB4A 1BX1A 1LC3A 5BSTA 4KPFC 2VC2B 3D43A 3JYNA 4QNRA 2GWRA 1BD4A 3CKKA 3NUZA 3EJ6A 3K8OE 2P5SA 4RA6B 1WZCA 3BGSA 1Y3HA 4OCZA 4F5WA 1F1JA 1Z63A 3E9DA 1D2RA 1T2UA 2YWBA 3IFSA 2GCNA 3L6DA 4QYIA 3TK1A 2WE7A 4LC9A 4DSAA 5KPDA 4ZQIA 3WLNA 1ZD8A 4Q9LA 2AFHA 1WQ1R 2XTMA 3PNYA 3SZRA 4GPIB 3L01A 4ESOA 4TROA 3M1LA 3WADA 1XNQB 2CB9A 3DW1X 1P2TA 3OHMA 3EQ7A 1G59A 2BFDA 1YL5A 4M46A 4O08A 1ISHA 4DADA 4LTNA 3PNSA 4WE3A 1F20A 3JV7A 2YNMD 3CONA 2BELA 4MWCA 4C1BA 1DRWA 5AJVB 2JCBA 4GF5A 3R3VA 5FBQB 3A9VA 1ZXXA 1ADGA 3BWCA 5IC5A 2YWGA 4NX2A 1ZGAA 1ISFA 4WJLA 3QMPA 1U02A 1EVKA 2VJBA 3DMDA 5FUYA 4D81A 3FSJX 4PR0A 4I1YA 2VWHA 1RBQA 4NBUA 5BNZA 4KW7A 4J49A 1VG0B 5HGJA 3FAZA 3QE4A 1OLUA 3HV0A 4KVZA 3OZVA 1T26A 2R6FA 2O7RA 3C97A 1ZK4A 2QTGA 5LZ8A 4DB2A 3CV3A 1M33A 1YFZA 3HR4A 5ALDA 2OFXA 4MS3B 2JIZD 3DV0A 1U1GA 4KSBA 3OX2A 1ODIA 3COPA 2ZZNA 1OTXA 2AN4A 3C8MA 2O1SA 4MVJE 1C0KA 2UUOA 3GJYA 1ULBA 1XTUA 3ICVA 4O02B 4TXJA 3RIYA 1M1YB 4FEAA 1W36B 4E6PA 4XSHA 1VFPA 2TS1A 4OOEA 1JB1A 1Z0KA 1F0KA 3IE0A 4PQFA 2PPVA 4F3NA 4J90A 3OO0A 1MQ9A 1NKSA 1C29B 4H9GA 4BUZA 1NVBA 5HRCA 2Z1DA 4IFBA 4HTFB 5C8YA 2IV3A 3LQRA 4BUCA 2R9VA 3CC8A 1NW3A 1L5RA 2V9PA 4JU8A 1ZMOA 3UJ6A 3QKUA 3KEMA 3C45A 5K3BA 4RIEA 3BIWA 3RABA 3R8FA 2ZJ3A 4GM4A 3FYHA 1SKAA 3QA3E 3U7EB 1RYFA 4TLEA 3ZKAA 2Z8YM 2JNWA 2D0OB 4D9JA 4FFBB 1XB2A 3KKMA 2P0EA 1CY2A 1RHMA 2OYSA 1PQUA 1OJ7A 1ORHA 4WUTA 2UVDA 4FOTA 2GEDA 3UUGA 3SJUA 1GAQA 2W6PA 3M3PA 1F5SA 5IXYA 4XARA 1VZ3A 1RQLA 1SHJA 2ST1A 4HAWA 3L6RA 3A10A 4RHFA 1BC5A 3NBKA 3EQ9A 2NW6A 5JISA 1P8AA 2ZT8A 1WVGA 3N2GA 4O4LF 3HSYA 2W6IA 4ZEWA 3CT4A 1E20A 5DBFA 2YFYA 5CA0A 3ZGXA 4Q5IA 1E8DA 4KIJA 1ILEA 2HMSA 4JC0A 5EUBA 1GTMA 4L5BA 3B60A 2R8BA 4GECA 1X8XA 4Z9XA 1YQQA 1H5UA 1QV9A 4P54A 1QCZA 4OH7A 3L1HA 4XQEA 2Z3WA 1SCBA 1B1AA 1RYZA 4G5HA 1OV6A 2EWVA 2C3PA 1VBMA 3OE5A 4J7UA 2ZJBA 1SC1A 5IUKC 1OQAA 4AZTA 2ORVA 3RRFA 4FDTA 1Z7YA 2D5BA 3X1DA 3KQSA 4CFZA 1OGIA 3A36A 1P2SA 2M9MA 4MDFA 3PGJA 1OTYA 3H1AA 5EL0A 5JPIA 4BZPA 1PTJC 3HP4A 5TPWB 4XWGA 5KKCA 1WQ3A 2BM0A 2ZWVA 5HPYB 1JJIA 1FB5A 3HCEA 3I30X 4QHSA 4Q34A 1VI6A 3VKHA 4PQGA 2Q6VA 2NO9A 2VZ9A 4Q18A 2UVQA 4RFVA 5I7SA 2QTVB 4IO0A 1SVUA 1BJTA 1WDKA 3BN3A 4PNEA 1MKYA 4GOND 5IVHA 3EPAB 2X5JO 2D0IA 3N75A 1TVKB 1DQRA 4EENA 1GQOA 2HF7A 4M7PA 4LXYA 4RK5A 4PZLA 4LF6B 2B83A 4EG6A 4BVKA 5T4BA 2JGLA 4INAA 3PRKE 4YAFA 4F6RA 3EPPA 5DNCA 2QGFA 3A6EA 2F3RA 4U7FA 4DANA 5JNWA 3A9SA 1CY8A 3DMNA 3PKZA 5MF6A 2EV9A 4RD3A 2IBTA 4DNPA 4M22A 1QRUA 2IE0A 4C6SA 2LV8A 1XVLA 3H65A 2FH5B 5EE0A 5B58C 2NTNA 3BXHA 3RK4A 2GD6A 3E7WA 3WGVA 1HQDA 1DPFA 1JAZA 4KFSA 1U7DA 3V7WA 3FRIA 3MT9A 5ETJA 2GK7A 2ZR0A 1OYOA 5B1SA 9GPBA 1TA4A 1BYUA 1LDEA 3LPDA 4CMGA 4ZHQF 4EA7A 4DR6B 4UTRA 3MVEA 2JVJA 3RIGA 3FLEA 3IB3A 3L7KA 4WKOA 1JZSA 4JI3B 2R86A 4FQ8A 1AXRA 3DV2A 2NP7A 1GXSB 5GV7A 3EOZA 2JA1A 3G9QA 1CUJA 1UWKA 5F2OA 1GWNA 3QVOA 4CDNA 3AFIA 3MW8A 1CE8A 5B4VA 2FQQA 2XYRA 2QSYA 1H1LB 1UM8A 2OV1A 3H2IA 3KR2A 3PD7A 1E94E 2V0CA 4J0IA 4MPDA 4CLQA 4PINA 2W6CX 5JI3E 4I4TA 4C7OB 2ODQA 2FMUA 1E61A 4U5XA 1LPMA 4X1KB 5EJGA 3AKEA 3G79A 4LHZA 4JA0A 3TQHA 3IRUA 3LZDA 3EH1A 4NS4A 5C37A 3GOQA 3THYB 5GM2A 8ATCA 5JJIA 2E37A 3A58B 4N6GA 1IBKB 2D2XA 1TKRA 2HC9A 3CNLA 2KE5A 3D2AA 3FBGA 2EGHA 2GQ0A 2FX3A 4MV5A 4L78A 3FUVA 3GGOA 4M1EA 3ZV6A 4ZCRA 1SD2A 3VPFA 3HJAA 2ZIFA 4Q1AA 3V8VA 3PHCA 2PT9A 2C2OA 3VC3A 3O5AA 3ECAA 4WFJA 1PJTA 3OLXA 4OI2A 1GPLA 3UJ7A 3UJ8A 4E11A 3ANSA 5D3MA 4V2UA 4XYMA 1V4BA 1SZPA 3TNYA 3O03A 4AK9A 5AW8A 1GNQA 5CG2A 3E6AA 1YO6A 1NF3A 2FJ0A 5CBPA 3GCZA 5JE8A 3EXAA 2FG7C 4KCGA 3VTFA 5HRAA 3RFUA 3PPVA 5BYJA 1C50A 1JZQA 4J0JA 3E9YA 5JXWA 4ZHQB 2EARA 1JQEA 4B3GA 1OT5A 3PE3A 1N0HA 3LWNA 1WY5A 1TAHA 3FWPA 4JHXA 3GH3A 4TX1A 5EG5A 3AL2A 3UFBA 4WL0A 2FQWA 2E3JA 4R2MA 4DSUA 2EKQA 1DGQA 1ZW6A 3OIDA 4BGVA 1RHJA 3PTAA 3L9WA 2GT1A 4LOIA 4EIWA 5A2GA 1TVMA 1EGQA 3ACCA 4R8MA 4OXIA 5TGTA 4M8KA 2GILA 3T7AA 2RAVA 5ITVA 4QDUA 5IABA 2OG2A 2MTBA 3EXIA 1RYEA 3WJ1A 4EGAA 3FTFA 3T1VA 4EDHA 4XX0A 2F43A 5GPBA 1VGRA 3I73A 4RY9A 2J46A 3C3DA 1YWGO 3D8UA 4TQGA 3LF2A 4DCPA 3TI7A 2WWHA 1N2HA 3ZHVA 2BHTA 2R6JA 3BQ9A 3JQCA 3GLVA 1JFFA 4WY8A 1JILA 1ZZGA 2QUHA 5FYQA 4DKXA 3MJCA 4LOJA 4MW0A 1MV8A 3DJYA 3S8MA 3H2ZA 3HB7A 4JYAB 1KFEB 4PXAA 1SBIA 1XRSB 1ZP6A 1L6RA 2NV0A 4RZXA 3B2NA 2LW7A 1MGPA 3LHFA 2BGNA 3I2KA 2IUYA 1J2RA 5F3RA 2XIQA 3VNQA 4HHEA 2ON6A 1TMOA 4O4HB 1SQGA 5DSTA 1G3IA 2VAPA 1E6KA 2Y1XA 3A4TA 1II9A 1YQTA 1ZM9A 4AZWA 5DGIA 3KJIA 5HS6A 5JJBA 5ALOA 1M6VB 3RC7A 1YK0A 2A1IA 4FFOA 4I5EA 4X20A 3TMAA 4J8PA 1DCKA 5LD2C 3IP1A 1CUEA 4G65A 1ISJA 1C4XA 2GTPA 3C70A 3HXMA 2OO5C 1ZK2A 2AG0A 5HCNA 2D5CA 4IHJA 4DBZA 3ER8A 1X92A 4X6YA 2NU8A 3R0IA 3GFGA 2I54A 1UK6A 3ORYA 5DWDA 3K1JA 1KMQA 1K88A 2AUTA 1GY8A 2DQ4A 2GRUA 2XNDA 1MAAA 3C87A 4JSYA 5CFLA 5IWAB 2Z9CA 2DLNA 1GUZA 1C7ZA 2XR1A 1D4AA 3E05A 5JSKA 1AUVA 1KBZA 2NQ8A 1NNI1 4YMLA 1NT4A 1JQAA 2BD0A 1USUA 1EI9A 1QIDA 1BS9A 3AJAA 4O8ZA 1DT3A 3U7QB 5CEEA 1K75A 4LRXA 3K6RA 4LE2A 3TB4A 5CDYA 2MYUA 3MGKA 4UVGA 3TLJA 2YV1A 4QFCA 5EA2A 1JH9A 5EZ6B 1UBJS 2R48A 4H1VA 1D0VA 4ALJA 3DBHB 1U63A 2DKOA 4F56A 2NO0A 3KE8A 1BGWA 4CLRB 2D8AA 1KZHA 2PD6A 2X1VA 3IVAA 1KSFX 1NZJA 2P69A 5FFMA 2JLZA 2VLIA 1DKMA 1Q1QA 5K4GA 1W36C 2NVUA 1BQ4A 1K8XB 1W4BA 4V0QA 2Y05A 2J0EA 4JLOA 5C5EA 4JI0B 4HB4A 4WY2A 3KHTA 5JY6A 1Z34A 2I8LA 2IS4A 3CN9A 2GARA 5DNDA 3HM9A 5BSRA 4LPKA 1JSXA 4IHJB 4YI5A 5I9LA 1NATA 3WJ2A 3VOSA 3SYLA 1F6BA 1NQWA 1TM3E 5JSFA 2HWWA 2H4HA 1JNXX 1ULHA 4X94A 4YJHB 1JA9A 4EY5A 3CVVA 3H8SA 5LZ7A 2R1ZA 1IVYA 2TRSB 3M0EA 3O7WA 1N9GB 1C0PA 1FP4B 3IIKA 2VP4A 3H2HA 3WYDA 5BWBA 3TVDA 3N86A 2GOYA 2HO4A 1FLNA 2AZMA 2FRXA 2PWAA 3OEYA 4TTSA 2PMFA 4PIVA 5D87A 4Q3OA 2RHOA 1U0OC 3PYXA 1SQSA 4XVQA 3W90A 2BUBA 4AUMA 2HOQA 4DCMA 1U2GC 1XZQA 2CGEA 3B82A 1HLGA 1PHPA 1GRQA 1W96A 4DLVA 1MB4A 3LE8A 2GXQA 2ZZKA 1G3RA 4DZTA 5K9ZA 4WCFA 2R7LA 4FR5A 4CG0A 3V4ZA 1OB2A 3EBOA 3TRHA 5FBRB 1GG2A 4HNQA 3EVGA 1FP7A 1ZD5A 2G8LA 3NT4A 1ODCA 4AY3A 4BMSA 2GK3A 2I7DA 4REQA 1O77A 4RS3A 3DZCA 2PGIA 5AK6A 4YLYA 1Z0IA 3GCDA 2EW8A 3CH5A 1LF5A 1QRTA 1DAHA 2WICA 4WIAA 3OP4A 4J1SA 4WAUA 2LVBA 3BE6A 3H5WA 4HTAA 3LPCA 1H69A 4P80A 4YO7A 5IANA 2O1EA 1M2OA 3OWXA 3BVPA 3NAMA 3PTLA 4L4RA 4F9GA 5FWYB 3DHNA 3DUFB 3WQBA 2PGLA 3KB8A 1BAPA 4MIKA 2ZXUA 1XQWA 2OP1A 4IGFA 4QEZA 1QPGA 2VQ3A 4YBZA 3EGVA 3EGDB 5CTJA 3IQWA 1ECGA 1ECBA 3G8CA 4KQGA 2IRWA 4XFDA 1KQGA 2BFMA 5G4LA 2BV3A 3BX1A 4IS2A 2XDYA 2VJLA 3UWOA 4TLMB 4E21A 4O4LB 1M73E 4PZ9A 1RQNA 4MCJA 3CIOA 2CXQA 2G8NA 2PGXA 3LXMA 4O33A 2IY7A 1AGNA 1SRRA 2NU9B 1W4ZA 2ZWPA 2FWPA 2FR8C 2BTOA 1QKJA 4PWYA 1ZD9A 3LLSA 4TS3A 2B8NA 3U7RA 3ZCPA 1OU0A 4BMOB 5BR4A 1JXAA 1UZUA 4OHYA 1I7MB 2ID9A 4DSTA 2J4DA 3U5TA 2W58A 2IYSA 1RD4A 3IP9A 2OZLB 1K5DA 1S2IA 2VP9A 2VOJA 4RVSA 1ULAA 5P8WA 3JYOA 4DGSA 4F60A 1L7AA 2O0MA 3NLLA 2Y0BA 3KL4A 4DN6A 1V11B 1EHYA 3IH5A 1E2EA 2FN7A 3FOBA 4G5FA 5T6BA 3T9EA 3TOVA 3C3BA 2AMJA 1KA9H 3DOOA 2HNKA 1JRLA 4KAFA 5KO2A 2GFQA 3QEBZ 4Y2GA 5F9HA 1VE5A 1GRCA 3HCOA 4S05A 1AB6A 1Q7CA 4OMFG 1X7YA 3ACDA 3R5TA 4FIZA 2GO1A 3EQ2A 4KLCA 1VG1A 4NCNA 5DXFA 2OAGA 3GC6A 2EXXA 4R8KA 3M6FA 4CYMA 1NDQA 2AHRA 3L7LA 4IY1A 4KMSA 1BVYF 3E1KA 1BG6A 2FSVA 1Z06A 1VKOA 1KQPA 2C07A 4C4OA 1F06A 2P9YA 4CR7A 1MN6A 3ZWNA 1LD3A 4F93B 4UEQA 3RTCA 4FHFA 1G20A 5B6IA 2XQJA 3KWMA 4R1OA 4WOJA 3RIEA 3OAAD 4HT3B 4QFBA 4R7GA 6Q21A 5D01A 3TTYA 3CLRC 3LFTA 4B6SA 5KWJA 4MR7B 4NS1A 1LU9A 2AVNA 3WFZA 3VPHA 4YR7A 1QHYA 1NWHA 3LLMA 1XK6A 3HKCA 1TCUA 3RUHA 5L3QB 2QBYB 2W93A 5FBHA 2CNWD 1GFIA 1K7EB 4A8JA 3W8DA 2FUG6 3MUNA 5COBA 3RU2A 2IKSA 4PYNA 3UAXA 2IHUA 4ESHA 3M4NA 4CM9D 1EWTA 4O2LA 2EW1A 3B1JA 3HU2A 1O0CA 1D0IA 1M6YA 1XFDA 2GZRA 1QTIA 5EIAA 3CVOA 3TNLA 3ETEA 5CGZA 1ISIA 3BXPA 3GUCA 3LQKA 4IKEA 1WXHA 3P9SA 2WJIA 5F77A 4KX3A 4MA0A 4EJ6A 1K27A 4OU5A 3MT0A 5A6SA 2EERA 2I65A 5TF0A 3BHNA 1EJ2A 4A8PA 5HSGA 2CCJA 1CFZA 3HA7A 2IDKA 1AGXA 2O4UX 2QLNA 3NS7A 4WXYB 1XZNA 4X95A 3WMEA 2FP3A 1L3IA 2WKQA 1XVIA 2WUVA 4N5MA 3GUHA 3O95A 4QTXA 3ZTTA 4FC6A 1K5HA 2ZB8A 4AYTA 1OLOA 3VYUB 2Y27A 4CTMA 1AO3A 3GLGE 3ZDFA 2HSEA 1M75A 3B6KA 4F2GA 4L85A 2LD4A 4ZEVA 1XRQA 1ZH8A 1Q50A 2ZP1A 1KZ9A 3R5XA 2DERA 3KPYA 4QREA 1NJ5A 1XQ1A 1NM5C 2C82A 3BMQA 3DNPA 1OBFO 1QH1B 2BC9A 3DQPA 4TMVA 2TMDA 4KRXA 3NTOA 3I42A 2QMYA 5HTOA 5DLDA 1J7KA 1YZHA 2O0HA 3BH7A 3F1LA 4M2LA 1LZKA 4JP8A 5IBQA 2OUIA 5K8LA 3FVWA 2V7QA 3MTEA 1DC8A 1OPRA 4US0R 4ZOQI 2FEKA 4AUKA 3I52A 1N6NA 1W34A 2VJDA 3RS0A 1MXHA 3WWYA 1DRJA 1SJ9A 3ESZA 5JXHA 1D09A 4LV6A 1FDSA 2P0AA 4BX3A 2GH1A 2IP1A 4FR0A 4M1KA 5JSZA 2C4NA 4PPQA 3WMWA 4JL5A 2YVKA 4COKA 4NENA 4QL3A 4YWJA 4ZVOA 2HIGA 3D3QA 1KZ4A 5G3ZA 3SJAA 2JG3A 4MUMA 4P84A 4AZ3A 1I3CA 3W5BA 2NSHA 2O06A 4P4SA 1MG0A 4RGYA 3VPXA 3ZXYA 3WLMA 1HE8B 2VRNA 3SXPA 4Q1FA 5C52B 1J1UA 3E1GA 5LB2A 1XHLA 4IWXA 4EO9A 2WWWA 4OD0A 3ROZA 5GP1A 3HBMA 3KO8A 2O8FB 1JH8A 1YUBA 4I36A 3UW1A 3KB6A 1KU0A 1KJWA 4KPGA 1N5RA 1T0PA 1JT2A 3I3SR 4ZI2A 1W6RA 3K9FC 3JU3A 1EVJA 3OCXA 1V95A 3KELA 4YUWA 4POAA 1QH8B 4LMBA 4R5HA 1DX6A 1HFKA 2D54A 5G1NA 5MN5A 3ENNA 1SCQA 1JWLA 4X3PA 5K2MA 3WFJA 5HDQA 3PX3A 2I03A 1ZS9A 4WK6A 4I9UA 4D96A 3A05A 2IXDA 4Y18A 4GG1A 5CFZA 2Q5CA 1HDIA 3H42B 4A6PA 4B17A 4QLOA 1SXJA 4RK1A 3Q5DA 2OCDA 1HDGO 1JBKA 3B12A 3FFWA 2FUEA 2BSQA 1Z5OA 3NYRA 3KDSE 3QYAA 4C3ZA 3L8MA 1YR8A 2J4FA 5JSZB 4YEDA 3EZFA 1GZ4A 2XCOA 4YMUA 3SEAA 1NRIA 4G0QA 4TTPA 4YJFB 1E1QA 1LK5A 2BLNA 1PR4A 3NDJA 4B82A 1XMQB 5T8KA 4CQMA 3KTFA 4YAIA 1H8EA 3JYLA 3VU9A 3WHLA 2JHPA 4AF7A 1NR7A 1NTOA 4K6KA 4K8RB 1A7JA 2B5OA 3E7XA 1XZBA 4RVHA 2OGSA 3E3AA 3IP8A 1YZYA 3WGMA 1IN6A 2HRDA 3RJZA 4RVGA 4Q6BA 4NOJA 3HXQA 4DBLC 4GOKA 5CFQA 4ZVKA 1Q0RA 3B8HA 3GN2A 1DKRA 2AN9A 1E2BA 1C3XA 1QAQA 2D00A 4CLHA 5IAEA 2HWKA 3HXKA 1H2WA 1OIXA 3NM6B 3TTSA 4F8EA 1DWOA 1CEXA 3P4XA 2H00A 1D0SA 3EX7C 1S3IA 4WBNA 1DP4A 3HYTA 3G0CA 1GKLA 2IYLD 3D9QX 3OESA 3QFTA 1P1BA 4MTCA 3KP1A 1SXPA 1ADFA 4TYNA 4KH0A 6LDHA 2DUUA 4R16A 2EFDB 1CUXA 1P18A 3P9NA 3PQ8A 2QM7A 5ILOA 5JFOA 1ETUA 1RAGA 2AXNA 2J6HA 3GEPA 4N03A 1M9NA 1P31A 2XYQA 2Y3IA 3QEMB 2F8LA 4HQKA 4V0NA 3SJBA 3FTEA 1XNGA 1B0AA 3F6PA 2JJYA 2O0KA 2QU7A 2VKTA 4RESA 4HFMA 1P3DA 1Q7RA 4JI8B 1URPA 2LNDA 1YK1A 2BEKA 3KJXA 1HG0A 1JGTA 2FMTA 4MOWA 3V1MA 4DLZA 3LWZA 3AM1A 4AYWA 1X7HA 2QRUA 1H2EA 4DYDA 3NT5A 2ECOA 4U2BA 4INJA 2OYRA 1WPXA 2YWEA 3FRHA 1M6NA 3INNA 3VSCA 3ELWA 1LI4A 1XN4A 5C5CA 2MDTA 3E4CA 3QELA 1AUOA 1FNBA 3ZDQA 3HY4A 1I9GA 3WY9A 4QGFA 4HQFA 4MQ6A 4QSMA 1Z6TA 1AQYA 1IRIA 1FCJA 1GNSA 1NUSA 2DUMA 3P1JA 4RPJA 3PZRA 1UPUA 4NMXB 5TDHA 3MYYA 4HXEB 4QGGA 1KQOA 1MHPA 4M1QA 3WC4A 1MJGM 1V37A 4FZVA 3ZV3A 2IT1A 2XGJA 3CF6R 1SUWA 2A86A 2JIDA 2W71A 3QY0A 4DG5A 1Q7EA 4W7HA 1HT0A 4BJ3A 2O2SA 4DMFA 1L5ZA 2PX0A 4G8JA 4ZREA 2AW3A 3NNSA 4M99A 3H8JA 5I51A 4YQZA 4CF7A 3LTEA 1LDYA 3HC7A 3I64A 2YJ5A 3DG9A 3R3UA 3MWYW 4X00A 5IN5A 5HJEA 1SK9A 3F6SA 4NAVA 1FXSA 5TPZD 3R7SA 2KM1A 2GCOA 4BMXA 3D4BA 4TT8A 5IMSA 2JJ1D 5M3BA 4NBWA 3A1EA 4RMJA 2C0CA 4W9NC 3UJHA 5BN4A 2HZBA 4ATNA 3DFUA 4L0MA 2OHHA 3W2IA 2B69A 2O8VA 1ZU5A 2VPQA 3PHIA 1U9IA 1RZ3A 4WA8A 4WKPA 1DC4A 1UAAA 1Q6ZA 3FZNA 4U6NA 5IUJC 3G68A 4RF2A 5KWEA 1XVTA 2XUZA 3WLPA 1T5LA 1QF9A 1TZCA 2P79A 1JU3A 1RTTA 3EE6A 3PPYA 1NNSA 3DAGA 4AP5A 4QQ8A 4IOKA 1ZW1A 4LQLA 2ZKIA 3R41A 1YMVA 3H2YA 1L1EA 4A6EA 2QD3A 3Q6NA 1ZD4A 4BP3A 1K1EA 3P0EA 1N75A 2ORED 4PZPA 4I55A 1DXHA 4W4TA 1RI3A 3BTUA 5TY0A 4LX8A 2QI9C 4MJLA 2H65A 2QE7D 2WB4A 4R41A 3L49A 5DNVA 2JAPA 2XB8A 5EQDA 1ML3A 4EGJA 1G42A 4G23A 1VJCA 1XZFA 8ABPA 3N8NA 5AVUA 2ZRAA 1GRRA 3DLIA 5K1ZA 3IJ5A 1KDVA 3SYTA 4EELA 1J90A 4YMVA 3SQMA 1PV1A 3GUUA 3LUHA 2D1YA 3TFWA 4UNNA 1P17A 3EY9A 4M8IA 1T43A 3NBMA 4QVIA 4WSOA 3PNQA 2Y1WA 5JOQA 1CY6A 1OFGA 1DOHA 3L8EA 1FRZA 1LX7A 2PHZA 2O6HA 3PLRA 4LCBA 1E9DA 3EEOA 4K9DA 1K06A 4YT8A 3WLAA 5LYJB 5TX7A 2AX4A 4BL5A 2I91A 2O23A 3GAFA 4DV0B 2G6BA 2QV7A 2V6JA 1YFJA 1PR5A 2E6KA 1U9IC 3FOCA 3G5MA 4Z99A 5IKOA 4B3DA 1NMEA 4FDVA 3UW3A 2FEAA 3HN6A 1C4OA 4FN4A 3QXCA 4OJTA 4WCFB 4D9HA 4EW2A 4GZLA 5TMPA 1J00A 1BXKA 2WFLA 1RI4A