3QWBA

Crystal structure of saccharomyces cerevisiae zeta-crystallin-like quinone oxidoreductase zta1 complexed with nadph
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
330
structure length
330
Chain Sequence
IPEQQKVILIDEIGGYDVIKYEDYPVPSISEEELLIKNKYTGVNYIESYFRKGIYPCEKPYVLGREASGTVVAKGKGVTNFEVGDQVAYISNSTFAQYSKISSQGPVMKLPKGTSDEELKLYAAGLLQVLTALSFTNEAYHVKKGDYVLLFAAAGGVGLILNQLLKMKGAHTIAVASTDEKLKIAKEYGAEYLINASKEDILRQVLKFTNGKGVDASFDSVGKDTFEISLAALKRKGVFVSFGNASGLIPPFSITRLSPKNITLVRPQLYGYIADPEEWKYYSDEFFGLVNSKKLNIKIYKTYPLRDYRTAAADIESRKTVGKLVLEIPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the cofactor-assisted substrate recognition of yeast quinone oxidoreductase Zta1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Probable quinone oxidoreductase
total genus 118
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qwbA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3qwbA01
4ZICA 3M2TA 1GTMA 3QHAA 4F46A 3HJAA 3TFQA 9LDBA 4N5NA 5I9LA 4J7XA 5TS3A 1T2AA 4NQZA 5L7WA 5F1PA 2Z1MA 1A5ZA 4RDIA 3L4SO 3JCZA 3Q6IA 5JPIA 1MUUA 1AE1A 1I32A 1LSUA 1MB4A 3RJ9A 4CR7A 3RIHA 1R0SA 1U4SA 3AUAA 5DDIP 4QT0A 2EJWA 2VHYA 2FR0A 1JDJA 1GV1A 3VPHA 1OOEA 4DBVO 3KYDB 1T2DA 1A72A 4RPKA 4YBZA 5A1TA 1LU9A 3TQHA 2P5UA 4HY3A 2IODA 5BT9A 3GAFA 3KRTA 3PWSA 1LDNA 4Y6SA 2YFQA 3ZHXA 3GG9A 1N8KA 2HUNA 4BQPA 3DQPA 3TOZA 4CUZA 5HS4A 3F5SA 1QYWA 3G17A 5EN4A 2H5LA 1HEUA 3SC6A 3S1LA 2W90A 4U7WA 1H2HA 4R4JA 3WWZA 3V1TC 3LU1A 5LCXA 4IZIA 4QTZA 2X0JA 4X54A 5T64A 1GZ6A 1PL8A 5H82A 3GG2A 4XDZA 1P44A 4BNUA 1H0KA 4J1NA 5AXBA 4R54A 5DOVA 3X2FA 3DMTA 4IQ8A 4RF2A 3TF5A 1N9GB 3O38A 4CMAA 4MO2A 2PNFA 2IRWA 5MGBA 4ALLA 2EJVA 3ETEA 4GSLA 1DC6A 2B37A 3AY6A 3BTSA 4XR4A 4CMEA 5JW6A 1I3LA 4DLAA 4LMRA 1ADFA 2OFPA 4RF4A 4PLVA 3KETA 2X0NA 1EVYA 3ZH2A 2B36A 3S2FA 3ASVA 4HWKA 3RKRA 4R5HA 2Q1WA 1MC5A 2EF1A 3TWOA 3F1KA 2I3AA 4GMGA 5TJ9A 3ONDA 3ETDA 1YS4A 1Z45A 1HF3A 3OICA 2O4CA 3E1KA 4WOJA 1E3LA 1ZEMA 4WNCA 4GX0A 4DPLA 4CM3A 5JYDA 2DPGA 3JQ6A 3GDGA 4EBFA 1YDWA 3IKVA 3EVTA 4FQ8A 3GUYA 3PVZA 2NVUB 2D8AA 5IXSA 1PWXA 1KIFA 4WLVA 5CDGA 5JCJD 3PJDA 3JYPA 2E48A 3OIFA 4NU5A 3WFJA 3ONFA 3ZHBA 1HRDA 5H83A 1PQPA 2QHXA 1EMDA 5GMOA 4K26A 3WDSA 1E1KA 4OL9A 3PWKA 3LQFA 2HMWA 1OBFO 3A14A 1FF9A 2IYOA 4XWYA 5T8KA 5AQ1A 1B14A 1B3BA 2H63A 5BSEA 1B8UA 5K9ZA 4ESOA 1J6UA 1KC3A 2EIHA 3WQQA 4H15A 3QRWA 3TL3A 5DCWA 3K31A 5DF1A 3O8QB 1AHIA 3R1IA 2EKLA 3H2SA 2C07A 3TNLA 4I8XA 1TVEA 1S6YA 3ADOA 4Q3AA 4E5NA 1G0OA 4GX5A 3K30A 3ENNA 4JJFA 4MVJI 3U3XA 2C7VA 1C0KA 3WIDA 2ZYGA 5G0WA 4ALKA 1RJWA 1LBEA 3DOCA 4D42A 1DIGA 3C24A 4QX6A 1DFGA 4TVOA 3RBXA 3GUCA 4J9UE 3VAZA 2CFCA 4BNTA 1L7EA 4YQYA 1N1EA 2G82A 2QYTA 5TGDA 5ICMA 1U7TA 4OKIA 3WGQA 1HDRA 1R15A 5A9RA 4EI2A 3ZHYA 1L7DA 4UREA 5JBIA 3KV3O 4XIJA 4WJZA 3INRA 2Z95A 3WICA 2EGGA 1A27A 1LSOA 3ROKA 3GNQA 1LLQA 4NG5A 3BMNB 4HP8A 1BXKA 4DUPA 1BW9A 1KVTA 3OMLA 5DT9A 4AG3A 1E7QA 3AW9A 3RUCA 2Y1CA 3FN4A 5IFLA 2B69A 5A9SB 2BGMA 3JQAA 3LVFO 3NDJA 1B3RA 4LISA 2ZIZA 3EZYA 2GASA 2ZYDA 2QRKA 2UUOA 3L77A 4D0SA 2W2KB 2G5CA 5KVCA 4TRJA 3WTCA 4CMEC 2NTVA 4KTTE 3GDOA 3LC1O 4PG8A 5GY7A 3QQPA 4KZPA 4OAQA 1WDKA 1QSGA 1HWYA 3H8VA 4BNKA 4DREA 1X13A 4EJMA 4U6QA 4R41A 2UAGA 1GD1O 3WGZA 4MP8A 4CMCA 3EVNA 5JO0A 2AQHA 3PRJA 2GCGA 4PRKA 4CM4B 3PLNA 3VZRA 1D8AA 1IHXA 1DSSG 3T7EA 2CZCA 1WNTA 1YQDA 3QWFA 2X5JO 4Z3KA 3F1LA 4IDAA 4DPKA 4WASA 4Q3EA 3WTBA 5I8WA 4GKBA 5CDYA 3CZMA 2D4AA 2PKQO 2BI8A 2Q4EA 1UAYA 3Q2IA 4FR5A 4HUJA 4WPGA 3GFGA 1YH3A 1E1MA 4BNMA 1C1DB 4IUYA 3RBZA 3ITDA 5A04A 3ZWMA 2OBNA 4P4NA 1QR6A 4BGUA 3UFXA 3S55A 1MFZA 2PZKA 4U8GA 3RUIA 3AJRA 2YDXA 1DJNA 1Q1NA 3W6UA 3DR3A 2HKIA 3GGGA 4F6LA 4G2NA 3I83A 1UR5A 1DIAA 2GSDA 2NU8A 2E6UX 3VH1A 1HE5A 1PS9A 3QWIA 2DTDA 4ZU3A 2Y66A 3DBLB 1FDVA 1XSEA 4FBGA 3GK3A 1FDTA 2NQTA 2O2SA 4NH4A 3GEGA 4B7XA 2AG5A 1NQTA 2HRZA 4ZJUA 4G65A 4E0BA 4P8RA 1EFKA 1A9ZA 3O03A 1YXMA 3DL2A 3PQDA 4EW6A 4FC6A 4M8SA 5ICSA 2J5RA 1GDHA 1N92A 3NAQA 2PV7A 2WD8A 2YFHA 2W8ZA 5F5NA 4ALIA 5L7TA 4NBWA 3IIEA 1PQWA 3JD3A 4I1IA 4U0KA 4Y98A 1B2LA 3GDFA 5AXDA 3S8MA 5HBRA 2GD1O 4RVFA 1RYEA 4RPGA 3DZGA 5EL0A 3DOJA 3FNHA 3HB4X 4I5FA 1QKIA 4H3VA 3NJ4A 3W8FA 1RM5A 1LDBA 3WFIA 1ISMA 2I76A 2BELA 3B6ZA 4XQGA 4YXFA 4E33A 1TXGA 1JAXA 1QLHA 2OP1A 2HAEA 4KP7A 4MOWA 4WK6A 4UUMA 1ZEJA 2Q99A 4IJUA 2BH9A 3U5TA 3PQFA 5G0SA 4Z9XA 4KWHA 3W6ZA 4R69A 3W8DA 2TMGA 1E3WA 3Q11A 3E18A 4BIIA 1YO6A 4YT2A 2J3HA 4TMFA 4FC7A 1SMKA 4LCEA 1LLCA 1X7HA 2F00A 2I9PA 3HDQA 3U4HA 4D7AA 5A03A 3Q9NA 2X5OA 1LJ8A 1ZNQO 4NBRA 2EKQA 5F1KA 4CV3A 1HDCA 4E31A 1LXCA 3VPXA 4YJDA 2VUTA 3NGXA 4P4LA 4DLLA 1V3TA 1WMBA 1WW8A 1KY5A 1U2GA 4FDAA 4FIZA 5DP1A 2EKPA 2JAPA 3FNGA 3OJEA 3AWDA 5DNAA 2GN8A 2P91A 4FFLA 4LGVA 2PY6A 5C7OO 3GFBA 1T2CA 4CR6A 1PJ3A 1NPDA 2HU2A 4YRAA 4R1UA 3S2EA 1GEEA 4OMUA 5L3ZA 2FMUA 3QVWA 4PLWA 1P1HA 4ALJA 5CAEA 2X9NA 3AU9A 1A7KA 4XYLA 4MJLA 1ZSYA 2EP7A 3I6QA 2OGUA 5DBIA 4KOAA 3AUSA 4LRSB 4CODB 2X1HA 2V6MA 3LYLA 1XELA 3ICCA 5EINA 2B35A 2IEBA 4IMRA 4ZQFA 5T57A 3QIVA 2GERA 2YZ7A 4D3FA 2Y0CA 4LRTB 1L1FA 1NYTA 4YAKA 1VPDA 4O0LA 5L53A 4J4HA 3KHUA 3OEWA 1NNUA 4BNHA 5G0UA 1Z82A 1Q7CA 1QLJA 4L76A 3RBVA 3VDRA 3AU8A 1QYDA 3K6JA 3HNPA 4LMPA 5IN4A 2EW2A 2O4UX 3PJGA 5EIOA 3V2HA 5COAA 4DGSA 4L4XA 1Q7BA 1WZEA 3AI3A 4UULA 3FF4A 5KVQA 2V6BA 2JJYA 2HMVA 1MLDA 1C0LA 2D3TA 2GO1A 3HDHA 1W0CA 1H2BA 2IE0A 4EJ0A 2QQ5A 4HNHA 4GWKA 3CXRA 5KKCA 1PJLA 3OA0A 2VQ3A 4PGFA 5CHEA 3MTGA 3WOHA 2I99A 4ND5A 1K2WA 3QV1A 1Y6JA 4BO0A 3ZWAA 1BVRA 2AEFA 3ZHZA 4JBGA 1BDBA 4BV9A 5JC8A 4Z3DA 5I8ZA 2YDYA 5JS6A 1EVJA 4N18A 5KVVA 4FOSA 4CMIA 1GADO 4L4RA 4R3WA 4BB6A 4D46A 4OXYA 5IZCC 2SCUA 3VDQA 5JY1A 5CP8A 4GWGA 2CDCA 1EUDA 5IN5A 1PSDA 1I36A 2Q1SA 2Y68A 3I1JA 4J3FA 1W8DA 2O7QA 3KO8A 4DMMA 3K92A 3VVBA 2RHCA 1DFHA 1KVUA 3WLEA 4ZQBA 3K2EA 3BMOA 4WEOA 2Z1NA 2X9GA 3EK2A 3DZIA 4AJ4A 1JTVA 1YB4A 2Y67A 2JFHA 4IS3A 3ZNOA 1QG6A 3ZN2A 1BRMA 1HLDA 4ZRMA 2C29D 5KVSA 2B0JA 4J6FA 2G1UA 5ER6A 1HT0A 3ZWCA 1U8FO 3OETA 4PG5A 1RPNA 5AYVA 1DAPA 4YYZA 2EXXA 3PHGA 2B4QA 1ZZEA 1HETA 1CQJA 3PFFA 4CM9D 3WGTA 1ZK0A 3ROPA 4PCVA 3JQ7B 3JQBC 2UYYA 1MG0A 1OMOA 5L40A 1UAGA 5A3VA 4WUVA 3E82A 1ZK1A 4BKOA 5KJ1A 4Y6PA 2QRLA 3DTYA 4WECA 3PI7A 1M76A 1EUCA 1OZAA 2VWQA 2OBYA 3BMQB 1K3TA 1PR3A 7ADHA 3GT0A 5L95A 4J4TA 4NPCA 3MJSA 3DHNA 4F3YA 3P5SA 3VPSA 1GEGA 3STHA 4B3HA 4L0QA 1VJ1A 1EFLA 1DC3A 4J7UA 2GYYA 4D41A 3I9LA 4PG7A 4ZQGA 5BR7A 3C1TA 2DVMA 4J4BA 4TRMA 4FGSA 3PPIA 2ZCVA 3OP4A 3RVDA 2AXQA 1A71A 3JQ7A 2WJPA 3L6DA 4KUEA 4BO4A 5AOVA 2ZB4A 5A9SA 4GSKA 1YL7A 2BFOA 4FD3A 1ZBQA 3DZFA 1NBOA 1NFFA 4YWJA 1O95A 2R00C 2HMUA 3WGGA 2PA3A 5K1SA 1IZ0A 4YT4A 3C7AA 1DC5A 3AFNA 3GVHA 3CKYA 4UVDA 4W9NC 1LA2A 1MC4A 1QYVA 5T5QA 3INGA 3TZQA 4XYMA 1PGOA 3B70A 4EGFA 3SVTA 1AGNA 3NDRA 3EAGA 3Q0EA 2VYND 4J2HA 1IY8A 4GVXA 3SJ7A 2RAFA 4AJIA 1FXSA 3PYMA 5FFFA 1LX6A 3ORFA 1UZNA 2JKVA 2EP5A 3IDSA 4YJFB 1E7MA 4HNGA 4MVJM 1XIVA 5A9TA 2A92A 2QRJA 4OOFA 4CR8A 2W4QA 1Q0HA 5JO9A 2WD7B 1P74A 1HTBA 1IB6A 2QW8A 3MWDB 2X6TA 1UXIA 1O0SA 2FN7A 2Y1FA 4BKQA 4FFMA 3L4BA 1R16A 4G81A 3SBOA 1VC2A 4MVJD 4XRRA 3CH6A 4JP3A 4XYEA 2OXIA 3PXXA 5TLSA 4BL5A 3IJRA 2JD0A 3DZKA 3VKVA 5G2OA 1SB8A 2NV6A 2QG4A 1H93A 3PDUA 2WE8A 4BKPA 4EEZA 2YY7A 3KYCA 5B37A 1R0KA 8ADHA 4MVJH 4TRRA 2VTDA 2OHXA 4EUHA 4R3NA 1NTOA 3DMTC 1U2DA 4GMFA 3M6IA 4DYVA 1NR1A 2YQ4A 1LDGA 3G0OA 4A2CA 4CM6A 2PWZA 4BQRA 3HFSA 1BG6A 1MX3A 2FWMX 3JQDA 4WCFC 5I7SA 4XD2A 1DIBA 3VH2A 4DPMA 1PJ4A 3VTZA 3F6YA 1E5QA 2FP4A 3JYNA 3HUDA 4UVGA 4E2YA 2P4HX 5JFOA 1ENZA 2VT3A 1E3SA 2FY8A 4D3SA 1VJ0A 3JTMA 4NFHA 4D43A 1R6DA 4M49A 4MVJP 4YAGA 1O94A 1U3VA 2EHDA 5BSGA 3H9QA 3ZV5A 3EUWA 2NTNA 4WLFA 2BKAA 3KZVA 1BHSA 4OJNA 4NK4A 3KEQA 3GN1A 4ID9A 3SX2A 4CM8A 1M6WA 1TLTA 4B8WA 3ITKA 1QRRA 4KTVE 1HE2A 1E3IA 3ST7A 1VL8A 2AHRA 2WEKA 5F5LA 4BGEA 1E0DA 2VWPA 1GL3A 1WXDA 3JYOA 2I67A 4WNIA 3AI1A 1SZJG 2NLOA 5JCJA 3FR7A 5U4QA 2JL1A 4JBIA 4RVHA 1TEHA 3MZ0A 2D0IA 1N1GA 4YTEA 4J2OA 4B7CA 1BSVA 1PQUA 4XQ9A 1NQOA 2AE1A 3NT5A 4IZHA 1SC6A 2JD1A 1YOVA 1ZK4A 4NFSA 3K2BA 3KTDA 4ZGWA 1Z75A 1R37A 4R1SA 2NM0A 3DB2A 5CFZA 3GZ4A 2BMAA 1NXQA 1JU9A 2BFAA 3C1OA 2E37A 1ZCJA 3MJEA 3V5NA 4CLOB 1VL6A 2VN8A 3CPSA 1UP4A 4CM7A 3BAZA 4UEJA 1WPQA 3A1NA 4W9NA 2AA3A 5TF4A 4FB5A 1G1AA 4B4OA 8LDHA 1LI4A 2VNSA 1KY4A 4QECA 1LC0A 4DXHA 2FRDA 4BV8A 2V7PA 2D5AA 1KYQA 2C20A 4H7PA 4J43A 5DCUA 4DC1A 2P5YA 4Q3CA 1I3MA 5JSFA 1M66A 1I10A 2Q4BA 4XQEA 1DFIA 5G0TA 4YQZA 3JQAD 2AQIA 4IJVA 2XXJA 2OOSA 4PVCA 4XYBA 1EDZA 1QMGA 2JHGA 1P1FA 4RLSA 4U6SA 4PLZA 4IGEA 5HA5A 4DA9A 5KIAA 4XRGA 2B4RO 1IHYA 2CVZA 1VL0A 3MEQA 4NMHA 4OH1A 4D3DA 1X0VA 3DBRB 3LF2A 4EJ6A 1F8GA 3KM0A 1GYPA 3UCEA 5KWEA 3CE6A 4AJPA 4IDCA 4E5KA 2PD3A 3PZBA 2GN4A 2NU7A 2NSDA 3H9EO 2OORA 2ZB7A 4R16A 1XCBA 5DBGA 4AJKA 4OSOA 4OQYA 1BXGA 1HE4A 5JDIA 3GVIA 5FYDA 3BMCB 3I5MA 4IDFA 4RDHA 1EQUA 5BSHA 4ZRNA 1F0YA 1ZIDA 1LSJA 1PWZA 2CF6A 4IXWA 3DOOA 1DRWA 1VKNA 4EZBA 2VUUA 1LEHA 2C2XA 4YAJA 3OIGA 1YJQA 1CJCA 2OMEA 3FSRA 4S1VA 3WX0A 1HL3A 1QV7A 4CM9A 1EZ4A 4PZEA 2W98A 4A0SA 2AMFA 3NKLA 5FWNA 1RWBA 1N2SA 2DC1A 2FPIA 3WJAA 5K6AC 4YR9A 4LK3A 1PJQA 2X58A 3M2PA 4DIOA 2JCVA 1TT5B 2RHRA 3UAGA 4CLRB 4BNGA 2PZJA 4GPD1 1HZZA 1ML3A 1X1TA 2WD7A 1Y81A 1E92A 4XB1A 1ADBA 4Q9NA 1I8TA 2J3IA 2C54A 3C3XA 1VI2A 2Y0DA 3RUEA 1XA0A 2Y1EA 3PDJA 1KETA 2HSDA 2EG9A 3JQ8A 3OFSA 1DC4A 3AUUA 4R01A 4CLXA 4CQLB 3U09A 1YBAA 3G1TA 3RC2A 4IDBA 2X23A 3QW2A 2OUIA 1KEVA 1LRLA 1WAMA 2Q1UA 4J1QA 4CM5A 1P0FA 1YGYA 3RC1A 4ZQHA 1Y8QB 4E13A 2BFMA 2V6GA 2VUSA 3L6EA 4U0JA 2UUPA 1HLPA 3BMOB 4J91A 4P4GA 4HBGA 2PGLA 5C7IO 2DBRA 4MPDA 2X0RA 3JQ9A 3JQCA 2C0CA 2FPPA 4HXYA 4DLBA 3I9MA 4MVJE 1GYRA 3EC7A 4QQRA 4A73A 5EQFA 3UOGA 4JQCA 1CYDA 3PGJA 4BNYA 3A4VA 1ZK3A 3QP9A 5CDUA 1Z73A 4AL4A 3DZJA 3I9KA 2ZQZA 3JQGB 4RPHA 3DAGA 3B20A 1O5IA 1EEHA 3I6IA 3OBBA 3U62A 3OM9A 1DLJA 3UCXA 4JP2A 1NPYA 4G5HA 3ZI0A 1SB9A 1ZXBA 2DKNA 2B83A 4CV0A 2Y05A 3CSDA 2GN6A 4ILKA 2HCTA 1DOHA 2NVWA 3PHJA 4B3JA 5THQA 5H81A 4CM8B 1U1IA 3B1FA 1C0IA 4ZVVA 4YT5A 4CLOA 5IDXA 3HFGA 3R3SA 1W4ZA 1C14A 2ZCUA 2GPTA 2ZATA 1CWUA 1U7HA 1NR7A 4B4VA 2X9VA 2AEJA 3BXXA 5EQDA 1VM6A 4GX1A 4W99A 1RYDA 4YJGB 4O5OA 3RUFA 4QXMA 3TZ6A 4BKUA 2ZJ1A 3A06A 4J9VA 1EQ2A 1R12A 3NT4A 1T4DA 4IXTA 3W8EA 2O23A 3TOXA 2C82A 1ADCA 4DC0A 2Q1TA 3WR5A 4B7UA 4LSMA 4D44A 2EGHA 4PLHA 1GQQA 3M1AA 4Q3BA 1YL5A 3VZSA 2ZB8A 2RH8A 2B5VA 4NBUA 4BGIA 5I7VA 4PZDA 1XQ6A 1R4NB 3VH4A 4W4TA 1H5QA 3N74A 2V65A 3W4JA 3HG7A 1KS9A 3PHHA 4L9RA 2C2YA 3ZWNA 1ZMOA 3FPCA 1R0LA 1Y8RA 2VYVA 5FI3A 1DRUA 1ZJYA 3WMWA 3NYWA 5EPOA 5DZSA 1H9BA 3GOHA 4YRDA 2G17A 1Y9EA 3FBGA 3FWZA 3LC7O 1BGVA 3WJ7A 1CRWG 4CPDA 2POQX 5IDQA 1E5LA 3WS7A 4WCFB 4PVDA 2QZZA 1OC4A 2DT5A 2VYVD 1IULA 4PLFA 2ZB3A 2CDBA 3H9GA 3WIEA 1NP3A 1U3WA 3DZHA 1N9GA 4K9DA 3HDYA 1CF2O 3WMXA 5C37A 2JFGA 4UVEA 3ZCXA 1KOLA 3JQ8B 4FFOA 3DO5A 1CIVA 3Q9UA 3OF2A 5B4TA 1GPDG 1MXHA 1Z74A 1WZIA 2UV8A 1GCOA 1K89A 1MFPA 3Q3CA 1W6UA 5J23A 3VPGA 2PFGA 1MXFA 1IYZA 2Y1GA 1H6AA 2UVDA 5IJZA 1C1XA 4IS2A 3WSWA 1Y5RA 4CLDA 1HYGA 4Q3NA 5F3RA 1XDWA 3EY4A 1T2EA 1B26A 3RUDA 1A4IA 3RFXA 3DBLA 3NUGA 2F1KA 3DXFA 3I4CA 2PH3A 3OA2A 3IOYA 4N54A 1PGJA 1DO8A 2AE2A 1ZK2A 3PIDA 4CUJA 1O8CA 4BO2A 2ZTLA 4QFDA 3UUWA 3WYBA 1SOVA 4JROA 3IAHA 3HQ4O 4JJGA 4DQVA 4EYEA 3L0DA 5CDSA 4M54A 2B4TO 3GLQA 5L4LA 3C7CB 4OXKA 4YVFA 4PG6A 3IL2A 1ZO8A 3QSGA 2EW8A 3TJRA 2NNLD 1XLTA 1QYCA 3DMYA 4RPJA 3RUAA 5THKA 1U4OA 3LT1A 5CPBA 3V1YA 1ISIA 1B8VA 3GRKA 1P1RA 3D4OA 2C5AA 4OHUA 2Y93A 5HS6A 1RM4A 4U5QA 4AICA 5EMHA 3UCFA 3O8QA 1TT7A 4IQGA 2PK3A 1KEWA 1GFSA 1WDLA 3RSHA 3GNTA 1CDOA 1NVMB 4QFCA 5BNTA 1D1TA 1M6HA 3WG9A 3EDMA 3V8BA 2H9IA 1VSUA 3CUKA 3KLMX 3RI3A 3U4DA 3ANMA 1XKQA 2DQ4A 3AFMA 3LC2O 1WP4A 3ZNPA 1XYGA 3H9JA 3Q2KA 4ITUA 1W73A 5IZ4A 3A9WA 4FJ1A 1N7GA 3WLFA 3EHEA 2CUKA 3DBVO 1R4NA 1HDZA 3H5AA 2VHWA 3QVSA 1B0AA 4XA8A 3CMMA 2R6JA 1PL6A 3T4EA 4TWRA 3DDNA 4RJTA 3VC7A 2DFVA 4TZTA 4CMKA 3H2ZA 1EDOA 3F46A 1LQUA 2ZTVA 3TSCA 4OOEA 5A06A 1H6DA 3PP8A 1NFQA 1PJSA 5CDTA 4E32A 2PR2A 3BMNA 1O89A 1MGOA 1DRVA 4BMVA 5A4DA 5B4VA 2HJRA 1K6IA 1FJHA 2NWQA 3QE3A 4XEHA 3COSA 2YJZA 4IDEA 3I52A 1DPGA 2J8ZA 3DHYA 4W82A 4MKXA 1U3TA 1LDYA 5JYEA 4EEXA 3EZLA 5L4NA 3T7CA 2BD0A 1UUFA 3ADPA 5FEUA 5JCXA 1UP7A 1E3JA 1I0ZA 4J7CA 3ZWYA 4F6CA 4BNLA 5A3JA 1A7AA 2VHVA 1SEVA 3HWRA 3I9OA 3PWZA 1R4MB 4RVDA 2AEMA 4DVJA 3RU7A 3C7DB 4H16A 4FW8A 1YONA 3ZV4A 4IBOA 2H1SA 2Q49A 4JN6B 5BQFA 2WMDA 3TN7A 4JNKA 3VPFA 2R2GA 5IZCA 5U9CA 4KQXA 1PJTA 1Y7TA 1C1XB 1VRWA 5TC4A 3QLJA 3QVTA 4PLPA 5IG2A 5ADHA 1NPTO 4JBHA 3OECA 4Y67A 2PTGA 3H3FA 4RCVA 4KUHA 5DULA 1IPFA 1E3WB 1P31A 1XEAA 1U28A 1SAYA 1I33A 1PJCA 3BTVA 2VCYA 5AVOA 1JWAB 3F4LA 1I2ZA 3MCVA 3D64A 4P38A 3FPLA 3BHMA 5B12A 5G4KB 4FFNA 2PH5A 1KC1A 4OYRA 3IKTA 5CEFA 1BXGB 2JD2A 1EK5A 2CVQA 2DPHA 2E4AA 3JQ9C 3JQFA 1P45A 3K9QO 4JX8A 4TKLA 2Y1DA 2IXAA 3DTTA 1QV6A 1NM5A 4RQTA 2E49A 1UXHA 5F1OA 4F45A 4DQUA 4YAEA 2FR1A 1H6BA 4K28A 4FFPA 3GQVA 3TDKA 4KDEA 4YA6A 1DHRA 3CIFA 4MIOA 2PGJA 3PYLA 2O7SA 4BOYA 1A4UA 4NIMA 2NQ8A 3WWYA 3VZQA 3PQEA 4YJHA 2DUUA 4RORA 3ZV6A 1UZLA 1D4FA 1P0CA 3F5QA 4R5MA 2D59A 3PFWO 1IUKA 2JCYA 2PKRA 2GZ2A 2BHLA 4XYGA 3SLGA 4DTIA 3P7MA 2BGKA 4OQZA 1JVSA 5EJ2A 1DB3A 4IPTA 5I7FA 4XGIA 1NHGA 2HJSA 2Q2VA 4Z9YA 3IP1A 1T24A 1OFGA 4NJOA 4JCOA 4XZ3A 4BKRA 1C0PA 4E5MA 5ER9A 4XKJA 4BMNA 1AHHA 3BZUA 5KTKA 1XWFA 1QP8A 3B1JA 4E2ZA 3NGLA 5TJHA 1PX0A 1UZMA 3K5PA 4IDGA 4TKMA 4BO8A 1X15A 5IF3A 4I5EA 1ID1A 4D45A 2HMSA 3GGPA 3D4PA 3ZWXA 1QYXA 3SJUA 3I23A 1PS0A 2G0TA 4S3MA 3JQBA 2XF8A 4HX5A 4L4SA 2BGLA 2A9FA 4NJMA 2NACA 1E7YA 3O26A 4M87A 2G76A 2P4QA 1P1KA 4RF3A 1F12A 4Y8VA 5TNXA 1ISHA 1J0XO 5MDHA 4ZQEA 5TT1A 1PZGA 3TFOA 1PZFA 2O3UA 4XQCA 4FJ2A 3KSZO 5TX7A 2QYSA 3U49A 4DWVA 3IUSA 3GGOA 2VNAA 1N7HA 4D79A 2FPGA 2Q3EA 4C7JA 2J6IA 3UW3A 5F21A 4MVJA 2X86A 1YQGA 5T8KC 2BRUA 3DWFA 1P33A 3NX4A 1I30A 2Y1OA 3ETGA 5A05A 4FGWA 1UP6A 2GR9A 2LDXA 5TQVA 4BVAA 2NADA 2P9CA 3LF1A 2PLAA 4IMPA 4R9RA 3ANNA 1NWHA 3L9XA 3I3OA 1Y8RB 4MVJG 1OI7A 2WYVA 2JCXA 3H3JA 4II3A 1PIWA 3HN7A 2DTEA 4Z6KA 1FMCA 2TMDA 3NTRA 4D0RA 3RFVA 4E5PA 4CMGA 2HRBA 5G4KA 4HKTA 4DMLA 4PFJA 4QUKA 1E3EA 4B3IA 4NBVA 3GAZA 3AM5A 4CMHA 1ULUA 3TRIA 2GF2A 3FTPA 3KXDA 2O3TA 3V2GA 2PKQP 2O48X 4IDDA 3PJFA 2CMDA 2CY0A 1JA9A 2LDBA 3CTMA 1I2BA 4NZ9A 1LUAA 3FTNA 3GPIA 3IUPA 3ROQA 1GUYA 2HLPA 3E5RA 4OSPA 1V3VA 4HADA 1GZ4A 4WCDA 3WBFA 1PGNA 1V35A 3IS3A 2J5QA 4IM7A 4IIUA 4O6VA 1ONPA 4FCCA 2VHXA 1LLDA 3BHIA 3HB5X 4JGBA 1PGPA 3ZWWA 4OM8A 4IINA 1IOLA 3R0IA 4E30A 4HV4A 4BGVA 3PHIA 1TA4A 1T2FA 4YCAA 5K6AA 3ZNQA 4RZHA 1U5CA 4HFRA 4UEOA 3RC9A 3PLRA 5JAZA 4FPXA 4I9HA 3I9JA 2XXBA 3UGKA 4EUEA 4J90A 1G6KA 3T4XA 2IYPA 3GRPA 4IY1A 4ND2A 4RVSA 3B1KA 4YACA 4R9SA 2R00A 2GZ1A 1YJ8A 2HMTA 2Y0EA 1UDBA 4JXKA 4PLCA 3W4IA 4XGKA 4PLGA 2Z5LA 5GZ1A 1I5RA 1R66A 2C7GA 3GZNA 2IZ0A 4M89A 1YB5A 2Q45A 5T67A 4IJKA 4A27A 1SO8A 1SNYA 3IP3A 3ENKA 4YPOA 1GCUA 1HYHA 2GUGA 2AW5A 2D1YA 2HK7A 2WM3A 1BMDA 2J3JA 4GLLA 4WKGA 3RROA 2FSSA 5JY6A 4GGOA 4BO9A 1RM3A 3E9MA 1P9LA 3QY9A 2CNBA 5CG1A 4RF5A 2W2KA 1WDMA 3EYWA 2YYYA 1NHWA 1Y1PA 5ILOA 2VRBA 3KSDO 3QWHA 1YE3A 3U9LA 1E77A 5JDCA 4A26A 4NI5A 3AOEC 1IZ9A 4QO8A 1YRLA 2YUTA 4I5DA 2QZ9A 3ZV3A 2BF7A 1M67A 4LVUA 4A03A 4NDNE 1BTOA 4GVLA 5TSDA 3C85A 1E6WA 4Z9FA 4A10A 1VKOA 3FI9A 4EDFA 3JD2A 3RD5A 4UUOA 2DLDA 3ZU2A 4R1NA 3G49A 1J5PA 1GAEO 3SEFA 3SLKA 1K6XA 1ZXLA 4ZN6A 5KOIA 3R3JA 4MKZA 1BXZA 1HDOA 1JN0A 3D3EA 3BA1A 5HM8A 1I24A 5KJCA 1E1LA 3H4VA 3L9WA 4MIYA 4CQMD 1OC2A 3FNEA 4ROSA 4GGPA 4GX2A 1P1IA 1DLIA 4FFRA 3ANLA 1EE2A 1SCUA 1DXYA 4CMIB 4PN3A 1JKFA 1ZJZA 4JLWA 4L74A 3PYXA 4R1TA 2YQ5A 3TL2A 3EGOA 2WYWA 3RAJA 2QIOA 4PIVA 2XPCA 3MJTA 4J0EA 2RBEA 3KBOA 4UEKA 5IDYA 4J49A 1SEPA 4DIFA 3ZWBA 1ZUD1 3MJ4A 4TRNA 1B8PA 1Z7BA 3JD4A 5EERA 1WLYA 2P9EA 3WGIA 3HE3A 4XJSA 4DIBA 3UXYA 2VRCD 4BO5A 4FOOA 3TZCA 3HHPA 3NEPX 1PZHA 4ND1A 4O63O 1PGQA 4KUGA 5DCYA 5I9MA 4TQGA 1CETA 2Q2QA 4OXNA 2EWMA 3DBRA 2UDPA 3UHAA 5IAAA 3L07A 5JXWA 4IQ0A 5L4SA 3JD1A 3KYDA 2HO5A 2I65A 4R68A 4A5OA 1D7OA 4IIVA 1HZJA 3UVEA 3GR6A 3V2UA 2VOJA 4NK5A 3E9NA 1HDYA 3V1UA 2CSUA 3GMDA 5JNLA 3QWAA 2X4GA 5FF9A 1U3UA 2VZ0A 1ZSNA 2RCYA 3GC6A 4GLOA 3RWBA 4BNIA 3I4FA 3E48A 3BTOA 4M55A 4BMSA 1EVIA 4CQMB 3GN2A 2OL4A 3AM3A 3JSAA 3UF0A 2D2IA 4W7IA 1T4BA 1VSVA 1AXEA 2WE7A 4UUNA 3FCOA 1NAIA 2P2SA 3WQSB 1XG5A 1RM0A 3LT4A 1NVTA 3WXBA 2I3GA 4XR9A 1MV8A 4DRYA 4ALNA 3S2IA 1F17A 2DBZA 4LW8A 3P2YA 5DP2A 1LRJA 3G1UA 3KOUA 4YJHB 3ZU3A 1I2CA 3M1LA 5HWSA 2CF5A 3QJ5A 2PGDA 3BMCA 4IGFA 3GVXA 5B1YA 1CQIA 3D4NA 3QVXA 4WLUA 3UN1A 2FSVA 1PR9A 4DQXA 1DDOA 7MDHA 3H65A 2O3JA 4ZD6A 1UDCA 3C1AA 3VTFA 3K96A 1HDXA 3L4BC 3K8ZA 1V0JA 1PU2A 1HSZA 1DBVO 4Q3DA 4E12A 4AJOA 3NDIA 3D3WA 3CMCO 1X1EA 4O59O 1KVQA 1JVBA 5I9NA 3WGYA 2FHSA 3WBBA 4AJLA 5TRTA 4B4UA 4RV9A 2DFDA 5DOZA 1MG5A 2YHUA 4J1TA 4AJNA 5AXCA 2GN9A 2W2LA 2A4KA 4J1SA 3NRCA 4BNNA 3D7LA 1DJQA 2FOIA 1LRKA 3LLSA 2XAAA 3LT0A 4CM1A 2OZPA 4XGNA 1P77A 3ZW9A 4DL9A 3FR8A 1X14A 2GDZA 3OQBA 4CQLA 2ZKLA 1VLLA 3BMQA 2CDAA 1KERA 3CEAA 4L73A 1AXGA 2GRAA 3GVPA 5IXYA 5DBFA 3GY0A 1Z7EA 3MTJA 4HFJA 2I66A 2FZWA 3FNFA 1O9BA 4NFYA 3GA0A 3BTUA 3IMFA 1BDMA 5TT0A 4BUCA 4BB5A 5L9AA 1EK6A 1O6ZA 1UJMA 3EMKA 4RQUA 3KSUA 1X7GA 3AOEA 3DC2A 4GL4A 2C5EA 2XOXA 3UH1A 2VZ9A 3OIDA 4HFMA 3RUHA 4YRBA 3BYZA 1HYEA 5FI5A 3GMSA 4A7PA 2HK8A 1DIRA 1QORA 4BO6A 3HDJA 5KNLA 2JFFA 5G4LA 3LSYA 4Z0HO 3F3SA 3MWEB 3O4RA 4CV1A 4XIYA 4IJWA 5L45A 2C59A 3ZWOA 1GUZA 3I9NA 3OJOA 3U0BA 2PZLA 1C1DA 3PJEA 3MOIA 4AJEA 1ZSVA 1P3DA 2DU8A 3OQ6A 3JQGA 4J16A 3D1LA 5ITWA 1CERA 2YV1A 4E6PA 4BNXA 5IDWA 4E2WA 4XX0A 3E6AA 2NUAA 4UUPA 3WB9A 1NASA 3AOGA 9LDTA 3ZNNA 4XCVA 4YB8A 3JQEA 1T1SA 1JKJA 3OEYA 5KJ6A 1H9AA 3H9UA 3ULKA 2PD4A 2V6FA 4BHTA 1Q7GA 3DAPA 3AK4A 2VWGA 4BNWA 4CL8A 2VOEA 3QA9A 4Z0PA 1UXJA 4LSWA 3RJ5A 3VH3A 3NTOA 3ZGYA 4JIGA 2IEDA 2O2YA 1HDGO 1GPJA 3WGHA 4GI2A 1KEUA 3GHYA 2NTJA 3LK7A 1J49A 1LLUA 1NQAO 2A94A 2BFPA 3VOSA 1HXHA 2IDZA 4WCFA 4YJGA 2X7HA 1XR3A 1YBMA 3AM4A 3KYBA 1GZ3A 1GY8A 4ND4A 4UAGA 2D5CA 5G0VA 2ZTMA 2DTXA 5JMWA 3K73O 1J4AA 1FDSA 2DBQA 1U8XX 2X8LA 3DFUA 2AQKA 4P22A 1EUZA 1GQYA 2HK9A 3LDHA 3WYEA 3HADA 4GAEA 1LDMA 4WLOA 3N58A 3DFZA 4NHEA 2NU6A 4TSKA 5ITVA 3KYCB 3JYQA 4Z0TA 5KCZA 1PJBA 4E2XA 5L7YA 5JAIA 3F47A 3VHRA 1Y8QA 4QO7A 3E9QA 4GKVA 2B5WA 3LT2A 4OKNA 5ILGA 3ZW8A 1IL0A 1Q0QA 1XU9A 3FBTA 1Z6ZA 4E5YA 5ENDA 3SC4A 1T25A 1JQBA 3GZNB 4PRLA 4MIEA 5B4UA 3VKUA 5ES3A 4MP6A 3E5MA 3E8XA 1JW9B 4LCJA 3OJLA 2DAPA 1SBYA 1ZH8A 3PIIA 1ISGA 3H5RA 1YQXA 1ENYA 3WNVA 3C8MA 1K6JA 3WNQA 1I3NA 3LLVA 3OJ0A 2WTBA 1XQ1A 2VWHA 3OQ1A 2A35A 1BWSA 4MDHA 4BNVA 1ARZA 1E6EA 1HE3A 1IE3A 1KBZA 2OO5A 4UVHA 3ZWVA 1K5HA 2PD6A 5LDGA 4ALMA 1YKFA 1NVGA 5LC1A 5HTOA 1ZMTA 4J0FA 4BO1A 3RASA 1KEPA 4JJIA 4NU6A 2JHFA 1YWGO 3BHJA 3ASUA 1PL7A 2VYNA 2ET6A 2I5PO 1S7CA 4PG4A 3X2EA 3ZU5A 4FN4A 5C5IA 1ISFA 1YVEI 2W2LD 2X0IA 4ND3A 4RVUA 4CLEA 3RFTA 3IQDB 3P2OA 5BNFA 4MINA 2O3QA 4LVCA 2I6TA 2O3SA 1ZW1A 4ONEA 3H5NA 4K1LA 1D1SA 1NWCA 5KJEA 1WMAA 3PZRA 1ZKMA 1YDEA 4CUKA 5A5EA 1DHTA 1M2WA 2J5KA 4OGWA 4WLNA 1EBFA 4DBZA 3GHHA 1SOWA 3MJVA 4LN1A 5JLAA 2IZZA 3AY3A 1DEHA 1WWKA 1F8FA 3HZZA 4YDRA 4II2A 4C7KA 3GPDG 4KMSA 4Y6RA 2GZ3A 4CMBA 1WVGA 5JE8A 2Y99A 4NBTA 1B15A 4KWIA 3JV7A 1GV0A 3RKUA 3ZU4A 3JQFC 4AFNA 5JDIC 4I5GA 1V6AA 4BS9A 3VZPA 1NAHA 1MP0A 3OJFA 1ADGA 1R4MA 1LNQA 3D3WB 4OIMA 4I08A 4N5MA 4PLTA 4W7HA 3W4KA 2GLXA 1B7GO 1XGKA 1E1NA 1LQTA 3DAFA 4JK3A 4RLHA 3RCBA 3PGXA 2AG8A 4YEDA 1SPXA 1UXGA 1PZEA 1LC3A 1P1JA 3DONA 3OH8A 1JLLA 3TZKA 5C7LO 1BW9B 3PTZA 4B8ZA 3CZRA 1G0NA 5A5FA 1JAYA 1F14A 3HSKA 3IJPA 4OO3A 4AJHA 1ONNA 2AQ8A 4O1MA 1UH5A 2WSBA 1ULSA 3ZWPA 2O3RA 3F9IA 4AJJA 3OSUA 4WE3A 1TI7A 1GQ2A 6ADHA 1ZFNA 4RPLA 3KLPX 1Q0LA 3H7AA 5K0ZA 2YW9A 5JC1A 2RIRA 3DEYX 1HKUA 2P9GA 5LDHA 1YBVA 1BVUA 1K0UA 3D5TA 1AN9A 2EERA 1AUPA 4L8VA 3O9ZA 4CL3A 4ZHSA 4TROA 2YHIA 3GEDA 1T1RA 1XHLA 1DAOA 1E7RA 1V9LA 2X22A 3JYLA 4I9NA 4TZKA 3WYCA 2GNAA 4RO0A 4CM4A 4L75A 1X7DA 1OAAA 1PEDA 3TPCA 2RH4A 2WWRA 3HN2A 5I7EA 1TT5A 4CLRA 5KKAA 1B16A 2VRCA 5EESA 1EVZA 1FDUA 2ZK7A 2HDHA 2IZ1A 3G79A 4YJFA 3WGOA 1QXSA 2OP0A 1TB4A 5AXAA 5JAMA 4URFA 4B4WA 3NT2A 4FSHA 1HSOA 1X0XA 2FZEA 5BSFA 4GH5A 3ABIA 4PZCA 1Q2XA 3DBHB 4HFNA 3U4CA 2BLLA 1LDEA 3FD8A 4GQAA 4QEDA 3GH3A 2GGSA 3EW7A 4WOKA 4N7RA 4E3ZA 1C3VA 5HRUA 3VVCA 1E6UA 2PZMA 3NJ8A 2HQ1A 4CQMA 4BNZA 4WEQA 1YB1A 2VHZA 1NX6A 3KEOA 2NVBA 3TZHA 1F06A 4INAA 5TIIA 4GBJA 5JAQA 3MOGA 3H6KA 4FS3A 4EITA 6LDHA 4BO3A 4WLEA 1V3UA 4TVBA 2WDZA 2Q50A 1LSSA 1ENPA 2IXBA 3G3EA 3DZBA 4QSMA 2P68A 1DIHA 3DHEA 3KUXA 2CD9A 3PHLA 2ZYAA 3QWBA 3GVCA 2EV9A 3RC7A 4R51A 3WSVA 1EE9A 3FRJA 3NTQA 4M86A 2NVUA 5COBA 5CEJA 2QX7A 3PK0A 1RKXA 1Y5MA 2O50A 5T6BA 3DBHA 3SXPA 1Y9AA 2VTEA 3D0OA 3KB6A 1GR0A 3UICA 1NQ5A 4YT8A 2BI7A 1PTJA 2NU9A 4Y9DA 5CG2A 3ZZNA 2VT2A 4C4OA 1A9YA 5A02A 4BNJA 2ZTUA 1UXKA 2EEZA 3P19A 4AJ1A 4N5LA 1PS8A 5KJFA 3ICPA 1JWBB 1H94A 2DBVO 1ISJA 2J3KA 3IC5A 3CINA 4CLHA 4NR0A 1GYQA 4XDYA 2X5KO 1GU7A 3QVOA 4UVIA 4E4YA 3BIOA 2H6EA 4NJMB 3RU9A 4B79A 4KQWA 1GUFA 1YOVB 5L51A 3WQRA 3UKOA 4RZIA 3ROMA 1KVRA 3D5QA 3GF4A 3MJCA 5GZ3A 1H6CA 3W1VA 1KVSA 2DM6A 2JAHA 4MP3A 1VJTA 4WGGA 3JD0A 3FWNA 2WYUA 4AVYA 4W6ZA 1FK8A 1U9JA 1VE9A 1YL6A 2YV3A 4DYDA 3PEFA 1JKIA 5JDCC 4CMJA 1I01A 3NV9A 2E82A 4FJ0A 3L6OO 4XJTA 2Q46A 1I3KA 1ORRA 1UDAA 4NNJA 4YAIA 4BNFA 1IPEA 1XU7A 3F4BA 1T26A 4K6CA 4RGBA 1ONOA 2YHIB 3AY7A 1U5AA 3AUTA 3KVOA 5ENVA 3ZDFA 1PJ2A 3GEMA 5GZ6A 1E7WA 4PLYA 1E7SA 2CVOA 4RL6A 2Q2WA 2YV2A 1CEQA 3N7UA 3ON5A 4MVJF 4E21A 4M1QA 4K6FA 3ONEA 4RVGA 3Q1LA 4ZA2A 1FDWA 3A28A 2FR8A 2ZJ0A 4MKRA 5COQA 5C3MA 4I9UA 5U1PA 3FHLA 2ILTA 3AI2A 3S2GA 1V8BA 3JQAB 1M75A 4EUFA 1D3AA 5CEEA 1MA0A 3INTA 2VZ8A 4BO7A 4CV2A 1LTHR 3U4IA 5BNIA 3E03A 4XB2A 5CPFA 4AJ2A 4KDFA 3RQSA 3R6DA 1EBUA 1N5DA 3LZ6A 2ZQYA 3OHSX 4Q39A 5JMPA 3GNSA 1ENOA 5DN9A 2DUWA 4CJXA 1ZVMA 1NFRA
chains in the Genus database with same CATH superfamily
4ZICA 1N5OX 1GTMA 2WIGA 4KN5A 3TFQA 2HDNB 4OTZA 3EPLA 4Q4HA 2PLNA 4ZV4A 1MJNA 1GM5A 1T2AA 1RMQA 4HQFA 4EBBA 2V7BA 2ZJ5A 3TXYA 4EHHA 2HRRA 1Z0ZA 4OJTA 3LKBA 3ACDA 1MC8A 3Q6IA 3I76A 3EXHC 3I73A 1MAAA 2E5FA 1JALA 3SQMA 2WQ7A 2IK8A 2V4UA 4MRSA 2D5IA 5SZKB 4CR7A 1H4SA 1T4MA 1EDDA 2VPWA 1CFJA 3I09A 3ISVA 5KNCD 3MS4A 1XTRA 4KO2S 5DDIP 5ABPA 2FR0A 1KK1A 2A33A 4OB7A 3TTTA 5JNVA 1N36B 1JDJA 1ORWA 3FOBA 4DBVO 4BCDA 3MCWA 3UGQA 3D4BA 4P98A 2DE0X 2Q1YA 1T2UA 3NRJA 1K6MA 3IUQA 2PMEA 4BYGA 4KIFA 2YY6A 4XWOA 4R1OA 3NUQA 1LU9A 3NWBA 4EHFA 1PTKA 3TQHA 5EE5B 4CTMA 1XT6A 1ESNA 1NRIA 1SCQA 1TZJA 2QI9F 2GBIA 4HY3A 4K9SA 3LBAA 4EGSA 3U17A 4OX9Y 4CKWB 4KI0A 3UC9A 4D56A 2XJ9A 5JQGB 1X74A 3UMCA 5DT2A 5FH9A 4I4TA 1BCRA 1BU5A 3SXUB 2I55A 3PUVA 3QVGA 1U2QA 3HL0A 1N8KA 2HUNA 3LWZA 2OESA 1YDHA 1CYEA 4CHTA 2FEOA 4LI0A 3KXKA 2HA6A 1Q12A 1IBRA 1RJDA 4KXMA 3EXIB 5B53A 4CKZA 4EF6A 2VNJA 2CJYA 4ZDKA 2VTVA 2BSXA 2W90A 4KRYA 3KDSE 2MSDB 1TKCA 5LCXA 2L2QA 3THXB 1J2RA 4GICA 4ZMSA 2VHTA 2X0JA 3QTLA 4Q37A 3J80A 3EVAA 1F0PA 1ZGHA 3FZEA 3GBSA 2XE7A 3GG2A 3M1YA 1P44A 5DBEX 5F2OA 2O8BA 2Q6TA 4L78A 4P3YA 4M2LA 8AT1A 5CNKA 1TUGA 3L7DA 4LBZA 4RWEA 1BKSB 2F2TA 3QFTA 4RF2A 2IYRA 3IDQA 3PQ2A 4U2GA 3SKXA 4CMAA 3TF5A 4OB6A 4LZPA 2OQIA 3LLCA 3T1OA 4ZI7A 1WMFA 4BMZA 1M2OA 1W94A 4ALLA 1SQ6A 1KJIA 3TECE 1N0IA 4FMCF 2BWJA 2WMNB 5JWOA 3O8BA 4UBMA 3ZHCA 1W4LA 1XN1A 1WVMA 4CMEA 1I3LA 4AG6A 4W5RA 4NARA 4LMRA 3T5CA 2CMFA 1L7NA 2DUNA 3KETA 3AP2A 3UMSA 4X41A 3ROFA 4DHWA 1XZDA 2ISSD 4KG7A 3R3UA 3PCXA 4HWKA 2IU0A 2AI3A 2FEAA 2E4UA 3GGSA 5D5HA 3HA3A 4CG1A 4FHZA 5A2GA 1LVHA 2LD4A 4HLUA 1YZQA 4OQLA 3CZAA 3TWOA 4XM2A 4CVNA 2Z3ZA 2I3AA 4H7DA 1E2IA 4AECA 2DKOA 3ONDA 4DUGA 3B1YA 3N7AA 4WCVA 4B09A 4UQPA 4LF5B 3A6DA 2VK4A 2QZ4A 1ZBDA 1ZEMA 1AGRA 5HJ7A 4AROA 1IFXA 4RH0A 2HNKA 4ZT4A 3U9SA 5CLJA 1TAHA 3R5SA 4UBNA 2DPGA 2C3UA 4ZT5A 3GDGA 3IKVA 2BZ0A 1BYUA 1EVQA 4G0NA 4RANA 5REQA 2NVUB 1L5MA 4EO9A 1JFFB 1PWXA 1S3FA 2UZ0A 3ZQJA 1TQDA 4PFQA 4YAOA 4WLVA 1ZH4A 2QKYA 4MUYA 2E48A 3OIFA 4QGFA 4A6PA 1BDIA 1SXJD 3DPUA 4QG3A 3ICEA 3BXEA 4PU0A 1FRZA 1HRDA 1XQXA 1C9KA 1MVNA 1PQPA 1ZIYA 2FXIA 1Y1TA 2B1GA 3F2IA 5GMOA 4XD7A 4KAFA 3ZDEA 2D0PB 5H1YA 2FYTA 2IYOA 1WKVA 1W0KA 4F2WA 1B3BA 2B8JA 2H63A 3M8KA 3NKFA 4WWHA 5KX5F 4E51A 2PUTA 2FQQA 4CRWB 2EIHA 3KK0A 1SIOA 3P5BA 5KB3A 4LAFA 1T0PA 3WQQA 4H15A 3HP4A 5AJUA 3V4RA 1TVKB 3OUUA 5DCWA 4QA9A 3DOFA 5K8UA 2NYAA 2WFLA 3NW9A 3T4PA 5AFSA 2GEDA 3GL9A 4OHOA 4DLKA 1MHPA 1TYAE 3HVJA 1O94D 2GEVA 2M6SA 3I5UA 3IDFA 2EKLA 1K75A 1SKBA 3MOSA 2IX9A 4TV9B 3ZI4A 4CQMB 2HSZA 3EIUA 2E4YA 3DP7A 3LCMA 3R44A 5ALWA 3ADOA 1A9QA 4Q3AA 3W79A 4E5NA 2P0YA 3T35A 6REQA 1GPKA 2XCQA 3QE2A 3ENNA 2ZFUA 3LUHA 3P4UA 5F9MA 1LBQA 1X8JA 5E4JA 2Y2VA 3WIDA 4QZVA 4BVJA 3JS5A 3F5DA 3E1GA 4K9LA 4OFXA 3OO0A 4D5GA 3PC8A 3GD7A 3RBXA 3CURA 3GUCA 1QGZA 1VHWA 2CFCA 2RHMA 2QPAA 1G8GA 1L7EA 4YQYA 1N1EA 3KJNA 2X9QA 5IARA 1JECA 2KI5A 1UCFA 5TGDA 1RNLA 1U7TA 2KHZA 1T0JB 2FDXA 5JTUA 5LQAA 3VHXA 3HCFA 3OTHA 4LVNA 4TUYA 4FQ5A 1VCMA 3OD1A 2ZAOA 2EFHB 4M7OA 1JZSA 1A7UA 4G5FA 3UMRA 2HF9A 4WJZA 4MQEB 1SCJA 1IXRC 2EGGA 2MOKA 2Z6VA 3GJYA 4BFVA 3ROKA 2QTWB 4U3JA 1ZN7A 1IN4A 4OUDB 4X60A 4LTNA 4RFVA 3URMA 5BV0A 1GTSA 3L0PA 3BRWD 3CLTC 3N76A 3P32A 1ZIXA 4BVFA 3OMLA 3NV7A 1X3LA 1MT0A 1M34E 2ZJFA 3HB7A 3HR4A 4X1KA 4DLYA 5IFLA 5CGQB 4LC1A 3QPWA 2H4FA 1U8UA 3HV0A 2HV9A 1AKQA 1UDWA 3DDWA 3NDJA 3KPJA 2ZIFA 2FP4B 3BJRA 2UUOA 3OLVA 3QEAZ 4G9GA 2GA9A 4KR6A 4TRJA 4UEQA 4C4PA 4DILA 4YDQA 1TMGE 2NTVA 2RIPA 3PNBA 4PG8A 4WBNF 3DYVA 4KZPA 3VTAA 1C3EA 1FYWA 3M4XA 4KMMA 2WI8A 1BO6A 1UMCB 1HWYA 1PK9A 3ABZA 3B85A 2BKVA 3RRFA 4BNKA 3NXSA 5FTKA 4DREA 3VNBA 5A62A 1HNNA 4RVOA 4WH0A 1L4LA 2VIIA 2AZTA 1S8FA 4PS0A 5EWMA 2A67A 3GJ0A 1W8IA 2UAGA 4C29A 3F73A 1JQ5A 4KXNA 3IP8A 1ZH2A 1V96A 2ATIA 2HFKA 3EVNA 4EGAA 5B12A 5JO0A 1J1ZA 1U94A 3NOVA 4P81A 3PRJA 4PRKA 3QQ5A 3FHCB 1A1SA 4CI9A 4LX0A 3ZCPA 4F21A 1D07A 2XKBA 1DSSG 3KQUA 2CZCA 1WNTA 3MRSA 5KSZA 3E5NA 1E1RD 4ZZ3A 1E1CB 1L8XA 3F6CA 1GTJ1 4IDAA 3DT6A 4Q3EA 5I8WA 1UL1X 1XEFA 4ZOLF 5LLTA 2PX8A 5M34A 5ADUS 2A58A 1AX9A 3E7FA 2VSYA 2FTKE 3DUFB 2BI8A 2XB4A 3FXAA 5IVIA 4AO8A 2QZSA 4B3MB 4HUJA 4TKVA 3ZHTA 3DE6X 4KZKA 4JYCA 2VA9A 2H2GA 3AFIA 1QANA 2A5DA 3ITDA 5A04A 2OFWA 1GJRA 1QR6A 3CWCA 1WDTA 5E1OA 1PL0A 3UOWA 3IEIA 1NE2A 1W4AA 4ILEA 2O06A 1U2ZA 1SKAA 2ZAMA 3QVGB 3TAHA 2RHBA 3AJRA 4G36A 3HL4A 4RE5A 2YDXA 3FTEA 3OG9A 4GMXA 1QHNA 4CF6A 2UXDB 1FNNA 1UKYA 5K3SA 3GGGA 4L9WA 4AM8A 4F6LA 3UYLA 1JDTA 1N5MA 3GLIA 1UR5A 2ZQ5A 4B85A 2GSDA 3AF0A 1AKNA 5ETJA 1NIPA 1GNSA 3IYLW 1FU7A 3MCZA 4Q21A 5BYAA 1ILEA 2C95A 1RTKA 3GK3A 1FDTA 1NF8A 1OBCA 1M0TA 1G7CA 2DULA 2O1EA 1TVMA 2O2SA 3FFTA 4B7XA 5CU7A 3L4KA 1TQ8A 5HF8A 4J3JA 4MUJA 1H3EA 4E0BA 1EJ0A 1EFKA 1OWMA 1A9ZA 1N7IA 1XJWA 2JJ1D 3DL2A 2XLBA 3DTVB 3IVRA 3O03A 1P3Y1 4QQNA 4ZANA 3ZXXA 1NL3A 3T3IA 5E7IA 1GDHA 2B8WA 2XQFA 5IJZA 2ZVJA 2IY8A 2LUOA 1OXSC 2LIPA 1QIKA 5JASA 3IIEA 2ENWA 5AXDA 4Y98A 3S8MA 2XBUA 3GDFA 2GD1O 3K94A 2XQVA 1RYEA 2RJ3A 7YASA 3GFTA 2HLDD 4PANA 2JGIA 4XVUA 5EL0A 2AOTB 4PR3A 1K88A 4I5FA 1N0VC 1QKIA 4FHFA 3W8FA 1GL6A 5CD1A 1QR2A 2YCLA 5JS2A 2BKUA 2C0PA 3B6ZA 3I5AA 4LE0A 3ZQ6A 2FE4A 3QYPA 1K5PA 2JGNA 3OX3A 4WOPA 1G38A 4MOWA 4KP7A 5KX5B 2X13A 3CWZA 1G4UR 1XJ0A 2FEXA 2VRNA 3QUQA 2Q99A 4ISCA 1VHQA 3PKJA 1H2AS 4U1RA 3PQFA 5ALFA 1PLKA 3HJGA 4R69A 3W8DA 1E3WA 3P0JA 1SN7A 3Q11A 3I28A 4FNOA 4A1OA 1USVA 1M2EA 3P97A 4FC7A 4X85A 4LCEA 3U4HA 2I9PA 1OW3B 3HDQA 3PXAA 4C1BA 6REQB 5A03A 4NE9A 1YQUA 3GFQA 2B82A 2YVAA 4O4HB 2I7XA 1J5EB 4ZCPA 2VUTA 2B2XA 4DLLA 1V3TA 1JPVA 1WW8A 1GAJA 1IBCA 4FIZA 5CGZA 1FIUA 2GCPA 4C3VA 5CVUA 3A4TA 1Z28A 5AI5A 3ONNA 1TM1E 3NR2A 2WV9A 5LD2B 1PJ3A 2GEUA 2V6IA 3PNQA 4L3OA 2ADFA 2FGJA 3R0VA 2I29A 1YBFA 1GEEA 4OMUA 4V2IA 3S2EA 4X24A 1JFRA 3U81A 1FMLA 3U1VA 4CT0A 5CAEA 2X9NA 2AG0A 2H5IA 1XAGA 1A7KA 2MIIA 4XYLA 1ZSYA 3CZQA 3I6QA 3TW8B 5DBIA 2GAJA 2OCYC 4D9GA 2E5LB 1Y1SA 4ZIRA 2X1HA 2V6MA 4Y0VA 1VRVA 1AVTA 3H2BA 2J32A 4IMRA 2I2DA 2XGGA 4QWWA 3PD0A 3CUVA 1QIHA 4P36A 4IIEA 4S12A 5FYQA 2J9FB 1L1FA 1P80A 1NMSA 5J2TB 1NYTA 3HRHA 4YAKA 2C5LA 1VPDA 2WSIA 2QU7A 1K08A 5L53A 3MWJA 4J4HA 3U4AA 1N0WA 1UQUA 1IXSB 3KHUA 1KTVA 1NNUA 2SKEA 3CNEA 3FWKA 3OEWA 5G0UA 5KS2A 5J2UF 4RMJA 2M6LA 1T8TA 2DQYA 2GPAA 3E7WA 2RGCA 4HB3A 4L76A 5EKXA 1YC2A 1NUSA 3AU8A 3GT7A 4TM7A 5IM4A 3EPJA 1KZ9A 3CH5A 5I7WA 5CD9A 1AN0A 3I39X 3ZPXA 5JQWA 1Z8NA 4L0DA 2VF2A 3K0AB 2PS3A 4KSYA 3TIXB 1IM8A 2P6NA 4C0AC 1Q7BA 1UBUS 1WZEA 2D3WA 2XDYA 3AI3A 3CG4A 4HWPA 1FUIA 4UULA 3S40A 4IYJA 4G0WA 3L1KA 5KVQA 3ZE6A 1M5RA 2V6BA 2JJYA 3S99A 3UUEA 1C0LA 1THGA 3EDRA 2Z43A 2WF9A 3PR3A 4EJ0A 4C6TB 2V7VA 1Q1AA 5JD5A 5F3WB 5KKCA 1PJLA 1XZ8A 3OA0A 10MHA 2GWHA 1KOGA 1BDJA 2O8FB 1YULA 2I99A 3EEQA 1M1XB 4JT8A 5AJVB 4HYQA 3JARB 2QQ0A 5BXYA 1Y6JA 3WKDA 1FLAA 1ABEA 2W6QA 2W6JA 3OTQA 4CEHA 4MQMA 2ZE7A 4E09A 2CYBA 1PVDA 2VF5X 4K87A 2DEUA 5JC8A 3VR3D 3EDOA 2CV0A 2YDYA 4N41A 1EVJA 3T3HA 2PGIA 1R8QA 1ZQ1A 4G0OA 1GADO 1CUJA 2WINI 3L2OB 4C7BA 1UK6A 1VJ5A 3BULA 1YACA 2O7VA 5K7SA 1O0CA 3W90A 5LZ7A 4QXAA 1E58A 2GXQA 2FSFA 1SUPA 1YQ9A 1EUDA 4LJYA 1FZTA 4HH4A 2X6RA 4EF4A 1XEXB 2Q1SA 1SUCA 1Y42X 1W8DA 2JI6A 2O7QA 4M8LA 3BFKA 2QAJA 4DMMA 4X7MA 1B2RA 2AXPA 1DFHA 3RVMA 1RLUA 1OJLA 4ZVTA 2B30A 3PR2B 3IODA 2XVMA 3R77A 4WNAB 1A2OA 3OPYA 5CVCA 2FW8A 1NG1A 4YBRA 5HM6A 4OQPA 4XLTA 1JTVA 3UB4A 1AS3A 5AQEA 5AVZA 4IS3A 3DZDA 1JSXA 3MPOA 1BRMA 1HLDA 2GT1A 3GH1A 5ALPA 2C29D 4ZRMA 3OY2A 4HNSA 5E2IA 1LWOA 2HBRA 4UZEA 3RTCA 2O2CA 5KSOA 3G0HA 1MB2A 2VZEA 3MGBA 4PG5A 4LRWA 4YYZA 3KP1A 1W5BA 3FETA 4JXXA 3KWMA 3WGTA 3K4QA 3ROPA 3JQ7B 3JQBC 1MG0A 1OMOA 2C42A 1AZTA 1UAGA 3QNMA 3CVUA 1AQ6A 1JDBC 2CBGA 2HA5A 3BCUA 4X90A 1N4AA 4UDXX 5KJ1A 3WYNA 2VDPB 1WTCA 1M76A 1TUIA 4HRAA 2WKPA 3L3BA 4ZP1A 3ZK7A 3ROTA 1M0WA 1RRGA 1CZRA 4KPEC 1MPXA 7ADHA 2CMHA 1W47A 3G8DA 1ZU4A 4NMXB 1ZD9A 5FBQB 3DHNA 1AGPA 1LV8A 1LPAB 4IIGA 3EXAA 3IURA 1JDSA 2R8XA 3KOWA 4F3YA 3NIDB 1FP4A 2WPDD 1GEGA 1YRQA 1Z5WA 3OCVA 3IFSA 1QTQA 1VJ1A 4B76A 1JI0A 3DVQX 1F5SA 3NAZA 2GYYA 4WT7A 4BP8A 2A9RA 2WWGA 4OEHA 3QITA 4MCIA 3HR7A 2OORC 5EZYA 4OVKA 3I9LA 4BATA 4D41A 3V97A 1C41A 4R9UC 3LSTA 4ON9A 3KOXA 3KU4A 3KVNA 5KYTA 3U4GA 5BR7A 3ZHQA 3N0RA 1CY8A 4TT3A 4TRMA 3W9UA 4FGSA 1U8CB 2BE7A 2IXFA 3VM6A 2ZCVA 4LFBB 4JVOA 2H7VA 5IKEA 4DZRA 4HI0E 3JQ7A 3A4YA 2WJPA 3L6DA 4H7EA 4I66A 1CJUC 1Y6FA 2EIXA 1CF4A 4HO1X 5LUBA 4IEEA 5MN5A 4XWAA 3JX9A 5EJ4A 1FQJA 1DQZA 4YJ3B 2BM1A 3MBIA 3OZUA 1IZZA 1NUHA 1O95A 1UBNA 2R00C 4YWJA 3HVKA 4BKMA 1HGXA 2PA3A 1C30B 4HJXA 3QLVA 4JJ6A 3ODGA 2EVWX 5FQNA 4YT4A 1DC5A 4W9NC 3GVHA 3CKYA 5T5QA 2HREA 1MC4A 1QYVA 1BFUA 3C5CA 4J07A 1T3HA 4XYMA 3W9YA 2JDIA 1OFTA 3CKMA 2J9YB 1AGNA 1NI3A 2PVPA 3DWEX 3GQBB 221PA 2WPNA 3PC4A 3Q0EA 4P31A 1IY8A 2HA0A 4GVXA 4TMKA 3W5IA 1AXRA 4E3WA 1OYYA 3SZRA 4EY5A 3NHUA 1QGED 1P2GA 1ZX1A 2EP5A 3BKWA 3HU3A 4YJFB 3ZBPA 3CBGA 1E7MA 3DAOA 1B23P 1U31A 3GIWA 1XIVA 5LR6A 2L19A 2PT5A 4KN9S 2OZLB 3BFJA 4HDAA 4D8UA 2WM2A 3IGFA 5CFNA 1OFIA 4IJQA 4C6RA 2B1RA 3OIYA 5JO9A 2WD7B 4OFWA 4EIWA 2QW8A 4HUQB 3MWDB 3PGKA 1CUZA 1UXIA 2FN7A 2MSKA 1WY7A 4F1JA 4BKQA 2J9RA 1AH2A 2J31A 4IMIB 2A0KA 3UATA 2I6UA 5AW2A 4X91A 4G81A 1VGVA 2PSDA 4GZMA 1EP2B 3A6ZA 4MVJD 4JP3A 3MINB 1NMXA 5EUQB 4C0BA 4EK9A 3VKVA 1T4GA 3D6MA 2BFBA 1RP7A 1OBOA 4LXYA 1GA1A 3M4YA 3W6PA 3SOPA 4BP1A 1J39A 3BWYA 3D6TB 4IIJF 4BKPA 3L4JA 3DKIA 3KYCA 5B37A 2JK1A 2VTDA 4MGHA 2J0SA 1NTOA 4GMFA 1U2DA 3DV2A 2HF7A 3WLIA 1MN6A 4O0MA 1SVOA 3HR8A 4G0ZA 2PWZA 1KFJB 3EVCA 1YFLA 5CVTA 4OMDA 2P4UA 3DKVA 3HFSA 3KIPA 1V4VA 2FWMX 2RGYA 3CGGA 3L0YA 4MS1B 4HAUA 3RK1A 3GEBA 3VH2A 1SCBA 1TM3E 1W4CA 3D7SA 1KAGA 5FKJA 1FJGB 1U0FA 1AUXA 1JV2B 2WSSA 3JYNA 3HUDA 5FOSA 1W34A 4J29A 2OSBA 3KSMA 4PTLA 5HR5A 5KNDD 1QYRA 5FTWA 1PNVA 3PD1A 4Y1RA 2G40A 4D3SA 3QK7A 3KBBA 1GR1A 1MOQA 3BD6A 1R6DA 1AC5A 2FUCA 4L6AA 1FSFA 4YAGA 1CKEA 1Z4OA 2EBUA 5AK5A 4QJIA 1ZNXA 5EUMA 1AV6A 2GJSA 3DKRA 4AKGA 1HI9A 2NTNA 3EUWA 2ACKA 4WLFA 2JJ8A 4F72A 1TGVA 1GFIA 2JF0A 1BHSA 1T9DA 4JYMA 4ENWA 4KVZA 5IJXA 2DZDA 4QPCA 4L3WA 5BXQC 4LC9A 3K0BA 3LY9A 1NW5A 5IBPA 3RLFA 4ZI7F 2PH7A 1FSPA 3P0IA 4Y1EA 3FPEA 1VE6A 5A6SB 4NOJA 4S1TA 4U7PB 2Z5GA 2W5UA 1OYWA 1QRRA 1IM5A 4FHCA 4QGBA 1PUXA 3ST7A 1VL8A 2XITA 1XZNA 2G72A 2E18A 1NXWA 2AHRA 5F5LA 3URKA 3UH0A 4EKDA 4BGEA 4EJFA 2H11A 2WZQA 4LXUA 3DT9A 4NPAA 2ODBA 5AOBA 1KMIY 2NLOA 4XX1A 2BFNA 5JCJA 1QC5B 4J0QA 2VBCA 4AZTA 1H8HA 2IYEA 2PMFA 1SU6A 2O2XA 3IBTA 3K70B 5AM5A 3GFSA 2AVDA 1XXLA 1NQOA 2H7YA 3K2QA 3AUXA 1XTJA 3NT5A 4GLFA 1TC2A 1ZP6A 4AQDA 3H1TA 3K2BA 1N8SA 4NFSA 2P6OA 3NIWA 4R1SA 1WHTB 1V6SA 3HJHA 1LZLA 1NXQA 3IQFA 1XYYA 1I4EB 5FWAA 4QBHA 2R8YA 1VLJA 1JU9A 4O4HA 1Z6PA 3JWGA 3P2KA 4IO0A 1ZCJA 3MJEA 3V5NA 4A8JA 3CPSA 2JLWA 4ZOBA 1JI3A 4FMPA 1FNMA 4IX9A 1MX1A 4MVYA 3LBHA 1PUJA 1RACA 5FUYA 3Q85A 5LIRA 4NENB 4H6VA 2ZI6A 2WR8A 1KY4A 2ZIVB 1LC0A 2C4MA 1PO7A 4UAJA 4Y18A 3TNDA 1CDDA 4BV8A 1T9HA 2O9JA 4DXHA 2C20A 4H7PA 4GOLD 5E6RA 4ZVKA 4ZYXA 1OU4A 2WRZA 2PE5A 1M66A 4LQCA 2Q4BA 3H1BA 4XQEA 1DFIA 4YQZA 2DH5A 4FOLA 3JQPA 5FBZA 2QAGB 2OOSA 2R3SA 1EDZA 2DHCA 1W9MA 3NWJA 4HLQB 2JHGA 4RLSA 4DLZA 2D2EA 3ZLBA 3ENZA 2B4RO 4GI3A 4PAOA 1Y7IA 1IHYA 3DNFA 2G77B 3F6EX 3GV0A 4ROTA 4J7AA 4F7WA 5JECA 2YFKA 3N6XA 4EJ6A 3LECA 1P3JA 2FJUA 3V00A 1SXPA 2IP1A 2RHHA 3DL7A 5AW5A 2FETA 2WPDA 1BS2A 3DMHA 3I34X 1E6CA 4IDCA 4E5KA 2P0AA 3U7QB 3OURA 3V1KA 1CS0B 1ZA2A 3H9EO 2OORA 1WR8A 2MMCA 3LHSA 4LBYA 4N39A 4WFQA 5AHXA 2GEKA 5DBGA 2VH1A 4AJKA 4IRUB 1SC1A 4GR9A 4IHJB 3SR4A 1GZVA 1JVNA 3GVIA 3T7DA 4YHBA 1P2SA 1C30A 1GHTA 2J46A 3S2UA 4FYXA 5IBQA 1UMCA 1WB6A 3EZ7A 3U5ZB 2HJGA 1PWZA 2JRCA 3TDMA 4IXWA 4RA6A 2CNDA 4WGFA 2VUUA 4DMFA 5KYXA 4RV5A 1MJ5A 3OIGA 4UD2A 1CJCA 2IZOA 1RKUA 2OMEA 3O90A 1CX9B 4KH0A 1J5XA 2RAPA 4WY8A 2Z4SA 1KF0A 4II7A 2BYTA 3L6UA 4PZEA 3H11A 3R5FA 2QTTA 1FC0A 5AKZA 3G6WA 1N2SA 2DC1A 1JHRA 4WQMA 1QHSA 2O0KA 3AVOA 3MQ2A 4LK3A 5AI4A 3DHVA 5I9SA 1XTBA 3CM0A 4LDQA 1TT5B 5AVJA 1QIGA 3ZY2A 4P5DA 4BNGA 3HNOA 4TYQA 3GRUA 4UDNA 3PEVA 2WD7A 5EHZA 5FPKA 1E92A 2VP4A 3MTBA 3HCEA 1PYDA 3F6BX 4H1WA 2QE6A 2ORIA 1YQQA 3T1YB 4KIGA 4L27A 1E1DA 3B7GA 1SXGA 1MX9A 5CB0A 3WLSA 3ZI7A 3OU7A 5BWCA 2RGBA 2HSDA 2ISQA 1K68A 1NLZA 3B6MA 3T7JA 1DC4A 4R01A 5K3BA 1ZRNA 4CQLB 3ZJTA 5E1MA 3U09A 1YBAA 3WVNA 4JI5B 3WIVA 1QGUB 1CEEA 2R1VB 2X23A 3AUFA 1LGYA 1B1AA 3QW2A 4IDBA 2OUIA 1KEVA 2H5EA 1ODCA 2WW8A 3L82B 3LA6A 4FXPA 2B1QA 4RVNA 1P0FA 2BISA 4PYQA 2XB2A 4ZQHA 1TUEA 1Y8QB 3NFRA 4E13A 4U0JA 2VUSA 5I9IA 1C4OA 2O7RA 2H0RA 4HC4A 1UBLS 4P4GA 4HBGA 4RMIA 1NN0A 4IVQA 2NUTA 2DBRA 2C61A 2A5GA 3JQCA 2G9VA 4KXVA 2MSEB 4YHHB 1P5RA 1XMPA 5B1IA 1L7XA 4MVJE 3OQVA 1G66A 1XNGA 3L8FA 3PDCA 4QU8A 2GDJA 1KWGA 5CFQA 5LP6C 3MBOA 3PHCA 2UZ1B 2RMKA 1U2RA 3QF4A 5GJVC 1QVZA 1KEEB 1XAHA 5CDUA 3RH0A 4O4JB 2W6IA 1Z2PX 2HU5A 3DOIA 3DZJA 3WMEA 4C4SA 1GUDA 3AQIA 4HPWA 1O5IA 1EEHA 3OBBA 4MYCA 2O5RA 3WC4A 3OM9A 2MSCB 1DLJA 2WABA 2ZRIA 3IT1A 3MLAA 1ZHHA 1K3UB 4X20A 4G5HA 2JHAA 3Q6MA 3TLMA 3ZI0A 4GSYA 1SB9A 4RD1A 3DNPA 5F9FA 1A8QA 4CV0A 1YBHA 1FMTA 4IZOA 5FJJA 3CSDA 4MXDA 2HCTA 3BM5A 2NVWA 3PHJA 4J8PA 3N53A 3OIUA 2LR0A 1CUBA 1X7ZA 4CM8B 1NBIA 3TXXA 4H1HA 3KB8A 1C0IA 2BI4A 1NU6A 2O1WA 3R3SA 1WCIB 1C2TA 2C58A 1QU3A 3VJKA 3U16A 4BQQA 2FFQA 1FFAA 5EPUA 3KQQA 5JAPA 2PA0A 4W5TA 2BMVA 4K9PA 5AW7A 1NR7A 1N77A 2X9VA 3BXXA 3Q0TA 5J58A 2F17A 3FMOB 5KDLA 2CHGA 1NXOA 1RFLA 4X95A 3NBXX 1CBUA 1KH1A 2BTOA 1RYDA 3I3SR 3VYRB 3BPSA 3F49S 4QXMA 2O8EB 2XCIA 1ZLYA 2FSIA 1SD5A 2ZJ1A 1QHYA 1EQ2A 3NT4A 3O2JA 2CYCA 2AMJA 2W83A 5JZOA 1R5NA 4M1EA 1SIBE 2XECA 2LE0A 3D81A 3IO5A 4RLQA 3RWMB 3TOXA 3TGPA 3DEJA 4NULA 2GCNA 1I13A 2KE5A 2DLCX 4V0KA 2IYQA 3WR5A 1X80B 1RVDA 3DXXA 2R6AA 2JA2A 2OLKA 4X71A 2RBKA 4D1YA 5IC6A 2ZT7A 4HDNA 2RH8A 2B5VA 4NBUA 4BGIA 1XQ6A 4RKQA 4EENA 2XD9A 5BOVA 2PEZA 3VH4A 2G63A 4UNSA 5FHQA 5AW8A 3RIEA 2DHRA 1H5QA 4UHFA 2IE8A 5IK2A 1G64A 3HG7A 3PHHA 5GPBA 4HEHA 2NZ8A 4HYEA 4FYKA 4MAMA 2I6SA 1Y8RA 2VYVA 5FI3A 4EWLA 3D3QA 3WMWA 4RC9A 1HBJA 4YRDA 1Z2NX 4LJ9A 3ILXA 2G17A 4GGMX 1Y9EA 4XJVA 4Q34A 4TL8A 2ATXA 3WV4A 4BQOA 2OCGA 3HXPA 1U98A 5LMUB 4XIGS 3D8NA 4IZ6A 3SYLA 5C35A 3KQVA 1E5LA 1TM7E 3EVGA 4WCFB 4QODA 1OC4A 2LP4Y 1N3IA 3A32A 4CCWA 4MH0R 4JP8A 1PNTA 1RWOA 3JY6A 4QHTA 4FFWA 3WK6A 3TIFA 1A4RA 2C5HA 2QDKA 5H83A 1LZKA 1U3WA 1N9GA 1XRJA 2ZT8A 1REQB 1Y3BE 3DQZA 3HDYA 3N5CA 1Z5VA 2JPDA 5C37A 3ZCXA 2G0NA 3LP5A 1KOLA 4FFOA 3QPBA 5LP6F 2QRZA 3ZY4A 4OK3A 4DR3B 4EKNB 3RS3A 4CCSA 1MXHA 3AB3A 1Z74A 3CV3A 4TWJA 3JTEA 1M34B 5J23A 1I9GA 3FW1A 1MXFA 1RSZA 2B6HA 1GGKA 2Y1GA 4XXHA 1G8YA 4LDZA 2M6KA 3LX4A 3SNHA 5FOWA 3UIEA 4EHBA 1H4QA 4HVAA 1F51E 2C2WA 2JJ1A 2V3VA 3LVQE 2GPBA 3IV7A 1EFUA 3RF6A 1PSWA 2ZT6A 1XDWA 3ELWA 3EY4A 3H04A 3Q87B 5F3RA 3RUDA 3VI4B 7REQB 2O5EA 4YROA 3CF0A 4BU0A 3FHTA 2HTFA 3CBQA 3RRZA 1XZPA 4HPXB 4PWZA 2LPMA 3OA2A 2J9GA 5CDFA 1DX4A 4S1PA 3FZYA 5A7HA 4AZWA 4KQ2A 5IH7A 3H97A 3I2KA 1ZK2A 2H16A 4CUJA 1O8CA 4DV0B 3W5UA 1KAQA 4KQJA 1N8NA 4KVAA 5AR1A 3DV0B 2IHJA 5EGSA 2OWEA 3FVQA 3KD3A 3IAHA 2V98A 2YX1A 3O1HB 4G0PA 4JJGA 1KZGB 1QS0B 4MRNA 3PD7A 3SICE 3IKMB 3BGWA 5EOVA 3GLQA 1G7RA 4YVFA 4TSFD 4XB6B 1XDUA 1EFRD 4IXNA 2QUKA 2BGRA 3DMYA 4Y0AA 5THKA 4FR0A 4HAWA 2ETVA 4R0VA 1SHZA 1ESZA 3OPMA 3DEHA 1B8VA 1HQKA 1T2VA 2AOWA 2DPYA 3GRKA 1SUIA 5EE3A 3QNUA 3GUVA 2YMQA 4EI7A 4Z99A 4IH9A 2W6ID 5EHQA 2Y93A 3VOTA 2GI4A 1RM4A 2Y3IA 1X2EA 4U5QA 4XGQA 4B87A 4BMOB 4DXDA 3ZGZA 1P81A 2OLEA 1YZUA 4L08A 3UCFA 1E3MA 1TT7A 2DCMA 4ZAFA 3KKPA 1KEWA 3DPSA 3K9LA 3EIOA 4ARIA 4KQFA 3SF8B 1CDOA 4C2TA 3R0ZA 4HVTA 1GZSA 1E1CA 4CHGA 4QUJA 1DAHA 1EWKA 2ZSJA 1Z56C 3V8BA 4Q9JA 4KRXA 4UMEA 3KLMX 5EQJB 2X2EA 4BP9A 2DQ4A 4OXXA 3H16A 2C96A 4L5CA 2QUJA 1WP4A 4DY6A 1CRLA 2JBAB 3OQHA 4TKUB 3ZNPA 1D09A 2QLLA 3IJEB 4JB2A 4N5IX 4O4IA 3CSUA 1J06A 2AYZA 4OQMA 4FJ1A 3GEIA 1DX9A 4HQ6A 1VE1A 1DJMA 1PCXA 2VHWA 4M0UA 1B0AA 4XA8A 1SVNA 5IJ9A 2QJRA 3T4EA 5JISA 3BE4A 4MUMA 2I3BA 4AC9A 4RJTA 3VC7A 3ZVLA 9MHTA 4OP2A 3MWYW 1LQUA 1G3QA 3IBFA 1GCGA 4YNBA 1RPJA 3K5IA 4BJHB 2R8EA 1JXAA 2NAPA 2EF0A 1H6DA 1NOJA 1ZG3A 3BXFA 1F9EA 4G1MB 4GPIB 4JQOA 5EZYB 3U1BA 5CDTA 1ZN9A 3FNRA 3NP7A 4L8FA 3HGMA 1O89A 4UARA 4M76B 3R24A 5FPPA 1LBSA 1UEJA 3HCDA 1C8KA 2WHPA 3KT3A 1AS0A 1LJLA 2F9MA 2Y76A 2YVLA 4HG2A 3PXBA 1F2TB 3BFXA 4MKXA 4PW0A 1RI4A 1IJEA 3BXGA 3FFBA 5JYEA 3HNRA 3EZLA 3HUTA 5AVUA 3KKEA 4C9BA 3WNDA 4D80A 2XUDA 3ANSA 5HCIA 3LCUA 4ACAA 3HFRA 1FDRA 2GNPA 1NQVA 3EGXB 3BREA 1N5LA 1E3JA 1I0ZA 1PK8A 3R8XA 2A84A 1KJJA 2FPGB 2RHTA 3UTDA 3KOZA 1JDUA 3OT1A 3TX6A 4DRXA 4QULA 4WZ6A 2VDRB 3BRQA 3NCTA 3DOEA 3PWZA 5DV9A 5EI5A 1R4MB 1B6TA 1XPJA 2AEMA 4RVDA 2YC4C 1XKLA 4P5EA 1ZM2A 4JR0A 5JAOA 3QX7A 3AKCA 1QTRA 2KBFA 1ECBA 2WYIA 1JIUA 4HZIA 3TN7A 3U40A 1DKRA 3UK2A 4RSRA 2IEYA 2O7NA 1JQLB 4JNKA 5IZCA 2Z4RA 1SHUX 4KQXA 1J33A 1UT5A 4G8DA 1IN6A 2GCOB 3HP1A 1C1XB 2NIPA 4ZCMA 2O6HA 2H1WA 2EJTA 5CFPA 2XADA 2YY5A 1V8ZA 2FX2A 4QIHA 4YXWD 5ADHA 4JBHA 4TL7A 2B4YA 1ZKDA 4ZYWA 3OECA 1BJKA 3GT4A 3O8NA 5T4FA 5IKPA 3OQMA 1ULHA 4Z7OB 1IPFA 1E3WB 1K7SN 2G04A 4UE3S 3BTVA 5C4GB 2QG6A 1Q20A 3AETB 3ROZA 2FV8A 1C9DB 1JWAB 3F4LA 4O4HF 1JBEA 4RLFA 1SHTX 3D64A 2FVXA 4NZPA 1YR9A 4LJKA 1W35A 1KC1A 4OYRA 5LBTA 1Y1QA 1O9GA 4XD7D 4OBXA 4U5XA 5CEFA 4TKLA 3K9QO 3EGXA 1OFVA 2IXAA 3NDBB 3AT1A 2J0VA 2FPWA 4EY4A 3X3HA 1D2NA 3MIZA 4KE9A 2PPVA 1GKYA 4BVHA 2Z6UA 3ZOKA 1P0PA 4RQTA 1V25A 3VR0A 4YMSA 4LE1A 1ZUNB 3LXUX 4JFAA 1AU9A 1H5UA 3G9TA 2FPSA 2GBLC 3IAXA 4KQEA 3DFIA 3Q7PA 2FR1A 3K4PA 1H6BA 1YZVA 4FFPA 4K28A 1DOZA 2B4KA 3GQVA 3OLZA 4KDEA 1NW7A 4L4UA 2WWIA 2FCRA 2JA1A 3A4IA 1V37A 1L7RA 1P8JA 1GZDA 1UPTA 2SECE 4KMRA 2AI2A 2C8VA 2NQ8A 2XEDA 1WXIA 3AGPA 2DUUA 4UPVA 4RORA 4DYHA 3EDQA 1UZLA 3BK7A 1XCLA 5ISMA 1VBNA 4JLUA 4NS4A 4RJIA 1FLDA 5BOSB 4R5MA 2D59A 3PFWO 1IUKA 1U5BB 2JCYA 4JNCA 5EZ6B 2BHLA 4XYGA 4R8KA 3LP6A 1QZZA 3P7MA 3QELB 4ZAXA 3FYHA 1BHJA 5TMEA 2XMCA 2PS9A 4I4TF 4LZNA 5I7FA 4O4JA 4RETA 2I7VA 3FPKA 3IP1A 4Z9YA 1QH0A 2YHAA 1OFGA 4QL3A 1N4DA 2ACVA 1DPFA 2JGDA 4E5MA 5ER9A 4BMNA 1AHHA 1RLJA 3QU2A 4I5DA 2FKNA 1QP8A 1XRRA 2QTVA 3B1JA 4D92A 3A70A 1G3MA 3T5PA 1FQOA 3N6RA 3PT5A 2VK8A 1NT4A 4PZZA 4R2KA 4RESA 1PX0A 4YUZA 1FRFS 3W7VA 1JIQA 3OZXA 3K9CA 4MV0A 1W1IA 4TKMA 2ID4A 3N86A 1ID1A 4R3UC 2R1ZA 3V48A 3WLTA 3OWOA 4HRXA 4MMYB 4BE7B 4X97A 4UNPA 1GRQA 2R66A 3LM8A 4Q3OA 1GPUA 3MRTA 4HGRA 2L42A 2QP3A 1MDFA 4O2AF 1K86A 4W8OA 1JZTA 5TMDA 4L4SA 1J07A 2NACA 1EFPB 3O26A 4M87A 2G76A 2P4QA 3B3AA 1P1KA 1XLWA 5DNCA 3E9DA 3RPEA 2AF3C 5C5CA 2OOKA 4FCVA 4Y2SA 5KREA 5TNXA 1WE2A 1U80A 2C5FA 1OJ7A 2H2IA 1JHDA 2Z1DA 1PZFA 3HWWA 5IJ0A 1SU7A 2O3UA 2XMBA 1U7ZA 3B38A 2I4NA 4NHOA 4XQCA 4ZO7A 4BJ5A 2FZ4A 2QYSA 2R6ZA 3M6WA 4DWVA 1GN8A 3KZNA 3NGMA 3GRCA 1IAQA 2X8JA 4Z7NB 1T3SA 4B3SB 1W9HA 2Q3EA 4RU1A 2J6IA 4YO8A 3LIIA 1BCSA 4MVJA 1E5DA 2X86A 3K35A 5B1YA 5T8KC 4DLXA 1TEXA 1MT3A 1M74A 3OQPA 3GCGA 3DWFA 2JLBA 4EJSB 2YIVX 5F64A 2VXOA 2Y1OA 1XKTA 3KNZA 4YAFA 2BFCB 4FGWA 3VZDA 1RJGA 1UP6A 1JGTA 2GR9A 2HJWA 1CG6A 1PW5A 1M7HA 2LDXA 2OCPA 5KNBA 5J1SB 1NSFA 4BVAA 5IC4A 4QVKA 4N1AA 2NADA 3LF1A 4K6HA 1XDSA 4R9RA 4IMPA 5DM0A 5TMBA 1VPVA 4MS4A 5DYWA 1C7JA 2LCQA 4C05A 3ZZ0A 2BKXA 4HGNA 1T43A 2ZBQA 2XVYA 1EB8A 3WK5A 4MR7A 1DMRA 2FG6C 3HN7A 3LG2A 5CT4A 5AD1A 1U0OC 4J94A 1TEVA