3QWDA

Crystal structure of clpp from staphylococcus aureus
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
192
structure length
187
Chain Sequence
LIPTVIETRAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title A Conformational Switch Underlies ClpP Protease Function.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
molecule tags Hydrolase
total genus 64
structure length 187
sequence length 192
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3qwdA00
1HZDA 2J5II 4U1AA 3T89A 4ELSA 1EY3A 2Q35A 3GF3A 3TT7A 4U0HA 4ZDEA 4FN8A 4HC8A 3NJDA 2DEOA 3U9SB 4RCNA 4FB8A 4I42A 2WTBA 1J7XA 1N6FA 5DTWA 3PEAA 1XNYA 3ZWAA 3SWXA 2A7KA 4Q0GA 3GLMA 3OMEA 3QKAA 5G1QA 3K8XA 1PJHA 2VSUF 1YG8A 4FJWD 3T3WA 3ZWCA 2FZSA 4ASIA 1HNUA 4RYFA 3TVUA 1EF8A 4FN7A 3R6HA 1SZOA 5DZKH 1OD2A 2F9YB 1OD4A 1JXZA 3MOYA 4OG1A 2PPYA 3V5IA 3GKBA 1WDLA 4JYJA 2X24A 3BEZA 4JVTA 1NZYB 5DUCA 4OLQA 3Q0JA 3GF7A 4GHNA 3KTHA 1XNWA 3HLN1 4LK5A 4IZCA 4IZDA 3RSTA 4NEKA 2Q2XA 2F9IB 2J5IB 3DORA 4GM2A 4U19A 1UYSA 3QMJA 5KJPA 3H0QA 4MI2A 4K3WA 3WG5A 1XX4A 5DTPA 4QIJA 1Q51A 3L3SA 4JCTA 5DL1A 5CTBA 1FC7A 3M6NA 5G1RA 2F9IA 2A7SA 1FCFA 2UZFA 1TG6A 3K50A 1RJNA 3LAOA 4G2RA 1UYRA 4K2NA 3ZW8A 1DUBA 3ZWBA 5KDRB 3TVWA 2CE3A 3P5MA 3TLFA 5JBWA 2X58A 4ZDFA 3R9QA 1WZ8A 1DCIA 2ZL4A 1YG6A 5DZKA 2J5GD 1WDKA 3VIVA 5G1SA 4DI1A 5IKLB 4U0GH 4I4ZA 4WCZA 2W3PA 3KTKA 2F6IA 5KDRA 3Q1TA 5E0SH 2BZRA 4ELWA 4L6WA 5FIFA 3Q7HA 1ON9A 3R9SA 4F47A 2PBPA 4B3JA 3PE8A 5INGA 2HW5A 5C9GA 3IB9A 2VSUC 4KD6A 4JFCA 4IZBA 3T8AA 3P85A 3PGQA 3STAA 1N6DA 4JWVA 1EF9A 3ISAA 4ZU2A 1FC6A 3H81A 1X0UA 3LKEA 3KTJA 2ZL2A 3MYBA 5INIA 3Q0GA 3T8BA 1Q52A 3IBBA 2VSSF 3H0UA 3H0JA 3FDUA 5DU6A 4JJTA 3HRXA 1XO6A 5MGBA 4WYOB 4Z0MA 4HNKA 4JCSA 1RJMA 2D3TA 5JBXA 2VREA 1N6EA 3TZ3A 2Q34A 1Y7OA 2PG8A 4JCQA 2VSSE 4QFEA 3H02A 3IAVA 3G64A 4FZWC 2VSSA 3TT6A 1K32A 3U9RB 4L8KA 3MT6A 1SG4A 1K39A 3QREA 3H0SA 4EMLA 3HE2A 3DJAA 4U0GA 4JSBA 4MXIA 3OT6A 1UYVA 4I52A 4K29A 3M6MA 3RSIA 2EJ5A 2J5SA 3KQFA 4KWBA 1FC9A 3QYRA 3TV5A 3JU1A 4OMRA 2F6QA 3T88A 2CBYA 4B3IA 5C90A 5DUFA 3QXZA 2ZL0A 2NP9A 3KTIA 4ZDCA 5DU8A 2ZQRA 3NJBA 1UIYA 3MFMA 4NNQA 3FF6A 4MOUA 2A81A 3U9TB 1MJ3A 4QIIA 1W2XA 3OC7A 3QWDA 2IEXA 5DKPA 4JYLA 2ZQQA 4JCRA 3BPPA 2DUBA 4ZDDA 2GTRA 1UYTA 3R0OA 1PIXA 2VSUE 2FBMA 3N6RB 2VSUA 4Q1IA 4FNBA 1HNOA 1TYFA 1WDMA 2C8TA 3ZW9A 3P2LA 4KNPA 4RYFH 4EMMA 3QK8A 2F9YA 3R9TA 5E0NX 3RRVA 4YLHA 1XNVA 4JOTA 2ZL3A 4EMPA 5FUSA 5CTCA 1O8UA 3I47A 4B3HA 2QQ3A 2VX2A 1NZYA 3BF0A 3HP0A 4ZDBA 4WZ8B 2J5GA 3TRRA 3SLLA 4ELXA 3PZKA 3GMAA 1VRGA 4FNDA 4KPKA 3HINA 4U18A 3QXIA 5E0SA 3TDCA 3KTGA 2FW2A 3V5EA 3ST9A 2J5IA 4FZWA 5DU4A 5INFA 1ON3A
chains in the Genus database with same CATH superfamily
1HZDA 2J5II 4U1AA 3T89A 4ELSA 1EY3A 2Q35A 3GF3A 3TT7A 4U0HA 4ZDEA 4FN8A 4HC8A 3NJDA 2DEOA 3U9SB 4RCNA 4FB8A 4I42A 2WTBA 1J7XA 1N6FA 5DTWA 3PEAA 1XNYA 3ZWAA 3SWXA 2A7KA 4Q0GA 3GLMA 3OMEA 3QKAA 5G1QA 3K8XA 1PJHA 2VSUF 1YG8A 4FJWD 3T3WA 3ZWCA 2FZSA 4ASIA 1HNUA 4RYFA 3TVUA 1EF8A 4FN7A 3R6HA 1SZOA 5DZKH 1OD2A 2F9YB 4J2UA 1OD4A 1JXZA 3MOYA 4OG1A 2PPYA 3V5IA 3GKBA 1WDLA 4JYJA 2X24A 3BEZA 4JVTA 1NZYB 5DUCA 4OLQA 3Q0JA 3GF7A 4GHNA 3KTHA 1XNWA 3HLN1 2YJGA 4LK5A 4NARA 4IZCA 4IZDA 3RSTA 4NEKA 2Q2XA 2F9IB 2J5IB 3DORA 4GM2A 4U19A 1UYSA 3QMJA 5KJPA 3H0QA 4MI2A 4K3WA 3WG5A 1XX4A 5DTPA 4QIJA 1Q51A 3L3SA 4JCTA 5DL1A 5CTBA 1FC7A 3M6NA 5G1RA 2F9IA 2A7SA 1FCFA 2UZFA 1TG6A 3K50A 1RJNA 3LAOA 4G2RA 1UYRA 4K2NA 3ZW8A 1DUBA 3ZWBA 5KDRB 3TVWA 2CE3A 3P5MA 3TLFA 5JBWA 2X58A 4ZDFA 3R9QA 1WZ8A 1DCIA 2ZL4A 1YG6A 5DZKA 2J5GD 1WDKA 3VIVA 5G1SA 4DI1A 5IKLB 4U0GH 4I4ZA 4WCZA 2W3PA 3KTKA 2F6IA 5KDRA 3Q1TA 5E0SH 2BZRA 4ELWA 4L6WA 5FIFA 3Q7HA 1ON9A 3R9SA 4F47A 2PBPA 4B3JA 3PE8A 5INGA 2HW5A 5C9GA 3IB9A 2VSUC 4KD6A 4JFCA 4IZBA 3T8AA 3P85A 3PGQA 3STAA 1N6DA 4JWVA 1EF9A 3ISAA 4ZU2A 1FC6A 3H81A 1X0UA 3LKEA 3KTJA 2ZL2A 3MYBA 5INIA 3Q0GA 3T8BA 1Q52A 3IBBA 2VSSF 3H0UA 3H0JA 3FDUA 5DU6A 4JJTA 3HRXA 1XO6A 5MGBA 4WYOB 4Z0MA 4HNKA 4JCSA 1RJMA 2D3TA 5JBXA 2VREA 1N6EA 3TZ3A 2Q34A 1Y7OA 2PG8A 4JCQA 2VSSE 4QFEA 3H02A 3IAVA 3G64A 3BPTA 4FZWC 2VSSA 3TT6A 1K32A 3U9RB 4L8KA 3MT6A 1SG4A 1K39A 3QREA 3H0SA 4EMLA 3HE2A 3DJAA 4U0GA 4JSBA 4MXIA 3OT6A 1UYVA 4I52A 4K29A 3M6MA 3RSIA 2EJ5A 2J5SA 3KQFA 4KWBA 1FC9A 3QYRA 3TV5A 3JU1A 4OMRA 2F6QA 3T88A 2CBYA 4B3IA 5C90A 5DUFA 3QXZA 2ZL0A 2NP9A 3KTIA 4ZDCA 5DU8A 2ZQRA 3NJBA 1UIYA 3MFMA 4NNQA 3FF6A 4MOUA 2A81A 3U9TB 1MJ3A 4QIIA 1W2XA 3OC7A 3QWDA 2IEXA 5DKPA 4JYLA 4HDTA 2ZQQA 4JCRA 3BPPA 2DUBA 4ZDDA 2GTRA 1UYTA 3R0OA 1PIXA 2VSUE 2FBMA 3N6RB 2VSUA 4Q1IA 4FNBA 1HNOA 1TYFA 1WDMA 2C8TA 3ZW9A 3P2LA 4KNPA 4RYFH 4EMMA 3QK8A 2F9YA 3R9TA 5E0NX 3RRVA 4YLHA 1XNVA 4JOTA 2ZL3A 4EMPA 5FUSA 5CTCA 1O8UA 3I47A 4B3HA 2QQ3A 2VX2A 1NZYA 3BF0A 3HP0A 4ZDBA 4WZ8B 2J5GA 3TRRA 3SLLA 4ELXA 3PZKA 3GMAA 1VRGA 4FNDA 4KPKA 3HINA 5HUQA 4U18A 3QXIA 5E0SA 3TDCA 3KTGA 2FW2A 3V5EA 3ST9A 2J5IA 4FZWA 5DU4A 5INFA 1ON3A
chains in the Genus database with same CATH topology
1HZDA 2J5II 4U1AA 3T89A 4ELSA 1EY3A 2Q35A 3GF3A 3TT7A 4U0HA 4ZDEA 4FN8A 4HC8A 3NJDA 2DEOA 3U9SB 4RCNA 4FB8A 4I42A 2WTBA 1J7XA 1N6FA 5DTWA 3PEAA 1XNYA 3ZWAA 3SWXA 2A7KA 4Q0GA 3GLMA 3OMEA 3QKAA 5G1QA 3K8XA 1PJHA 2VSUF 1YG8A 4FJWD 3T3WA 3ZWCA 2FZSA 4ASIA 1HNUA 4RYFA 3TVUA 1EF8A 4FN7A 3R6HA 1SZOA 5DZKH 1OD2A 2F9YB 4J2UA 1OD4A 1JXZA 3MOYA 4OG1A 2PPYA 3V5IA 3GKBA 1WDLA 4JYJA 2X24A 3BEZA 4JVTA 1NZYB 5DUCA 4OLQA 3Q0JA 3GF7A 4GHNA 3KTHA 1XNWA 3HLN1 2YJGA 4LK5A 4NARA 4IZCA 4IZDA 3RSTA 4NEKA 2Q2XA 2F9IB 2J5IB 3DORA 4GM2A 4U19A 1UYSA 3QMJA 5KJPA 3H0QA 4MI2A 4K3WA 3WG5A 1XX4A 5DTPA 4QIJA 1Q51A 3L3SA 4JCTA 5DL1A 5CTBA 1FC7A 3M6NA 5G1RA 2F9IA 2A7SA 1FCFA 2UZFA 1TG6A 3K50A 1RJNA 3LAOA 4G2RA 1UYRA 4K2NA 3ZW8A 1DUBA 3ZWBA 5KDRB 3TVWA 2CE3A 3P5MA 3TLFA 5JBWA 2X58A 4ZDFA 3R9QA 1WZ8A 1DCIA 2ZL4A 1YG6A 5DZKA 2J5GD 1WDKA 3VIVA 5G1SA 4DI1A 5IKLB 4U0GH 4I4ZA 4WCZA 2W3PA 3KTKA 2F6IA 5KDRA 3Q1TA 5E0SH 2BZRA 4ELWA 4L6WA 5FIFA 3Q7HA 1ON9A 3R9SA 4F47A 2PBPA 4B3JA 3PE8A 5INGA 2HW5A 5C9GA 3IB9A 2VSUC 4KD6A 4JFCA 4IZBA 3T8AA 3P85A 3PGQA 3STAA 1N6DA 4JWVA 1EF9A 3ISAA 4ZU2A 1FC6A 3H81A 1X0UA 3LKEA 3KTJA 2ZL2A 3MYBA 5INIA 3Q0GA 3T8BA 1Q52A 3IBBA 2VSSF 3H0UA 3H0JA 3FDUA 5DU6A 4JJTA 3HRXA 1XO6A 5MGBA 4WYOB 4Z0MA 4HNKA 4JCSA 1RJMA 2D3TA 5JBXA 2VREA 1N6EA 3TZ3A 2Q34A 1Y7OA 2PG8A 4JCQA 2VSSE 4QFEA 3H02A 3IAVA 3G64A 3BPTA 4FZWC 2VSSA 3TT6A 1K32A 3U9RB 4L8KA 3MT6A 1SG4A 1K39A 3QREA 3H0SA 4EMLA 3HE2A 3DJAA 4U0GA 4JSBA 4MXIA 3OT6A 1UYVA 4I52A 4K29A 3M6MA 3RSIA 2EJ5A 2J5SA 3KQFA 4KWBA 1FC9A 3QYRA 3TV5A 3JU1A 4OMRA 2F6QA 3T88A 2CBYA 4B3IA 5C90A 5DUFA 3QXZA 2ZL0A 2NP9A 3KTIA 4ZDCA 5DU8A 2ZQRA 3NJBA 1UIYA 3MFMA 4NNQA 3FF6A 4MOUA 2A81A 3U9TB 1MJ3A 4QIIA 1W2XA 3OC7A 3QWDA 2IEXA 5DKPA 4JYLA 4HDTA 2ZQQA 4JCRA 3BPPA 2DUBA 4ZDDA 2GTRA 1UYTA 3R0OA 1PIXA 2VSUE 2FBMA 3N6RB 2VSUA 4Q1IA 4FNBA 1HNOA 1TYFA 1WDMA 2C8TA 3ZW9A 3P2LA 4KNPA 4RYFH 4EMMA 3QK8A 2F9YA 3R9TA 5E0NX 3RRVA 4YLHA 1XNVA 4JOTA 2ZL3A 4EMPA 5FUSA 5CTCA 1O8UA 3I47A 4B3HA 2QQ3A 2VX2A 1NZYA 3BF0A 3HP0A 4ZDBA 4WZ8B 2J5GA 3TRRA 3SLLA 4ELXA 3PZKA 3GMAA 1VRGA 4FNDA 4KPKA 3HINA 5HUQA 4U18A 3QXIA 5E0SA 3TDCA 3KTGA 2FW2A 3V5EA 3ST9A 2J5IA 4FZWA 5DU4A 5INFA 1ON3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZD A;  2J5I I;  4U1A A;  3T89 A;  4ELS A;  1EY3 A;  2Q35 A;  3GF3 A;  3TT7 A;  4U0H A;  4ZDE A;  4FN8 A;  4HC8 A;  3NJD A;  2DEO A;  3U9S B;  4RCN A;  4FB8 A;  4I42 A;  2WTB A;  1J7X A;  1N6F A;  5DTW A;  3PEA A;  1XNY A;  3ZWA A;  3SWX A;  2A7K A;  4Q0G A;  3GLM A;  3OME A;  3QKA A;  5G1Q A;  3K8X A;  1PJH A;  2VSU F;  1YG8 A;  4FJW D;  3T3W A;  3ZWC A;  2FZS A;  4ASI A;  1HNU A;  4RYF A;  3TVU A;  1EF8 A;  4FN7 A;  3R6H A;  1SZO A;  5DZK H;  1OD2 A;  2F9Y B;  1OD4 A;  1JXZ A;  3MOY A;  4OG1 A;  2PPY A;  3V5I A;  3GKB A;  1WDL A;  4JYJ A;  2X24 A;  3BEZ A;  4JVT A;  1NZY B;  5DUC A;  4OLQ A;  3Q0J A;  3GF7 A;  4GHN A;  3KTH A;  1XNW A;  3HLN 1;  4LK5 A;  4IZC A;  4IZD A;  3RST A;  4NEK A;  2Q2X A;  2F9I B;  2J5I B;  3DOR A;  4GM2 A;  4U19 A;  1UYS A;  3QMJ A;  5KJP A;  3H0Q A;  4MI2 A;  4K3W A;  3WG5 A;  1XX4 A;  5DTP A;  4QIJ A;  1Q51 A;  3L3S A;  4JCT A;  5DL1 A;  5CTB A;  1FC7 A;  3M6N A;  5G1R A;  2F9I A;  2A7S A;  1FCF A;  2UZF A;  1TG6 A;  3K50 A;  1RJN A;  3LAO A;  4G2R A;  1UYR A;  4K2N A;  3ZW8 A;  1DUB A;  3ZWB A;  5KDR B;  3TVW A;  2CE3 A;  3P5M A;  3TLF A;  5JBW A;  2X58 A;  4ZDF A;  3R9Q A;  1WZ8 A;  1DCI A;  2ZL4 A;  1YG6 A;  5DZK A;  2J5G D;  1WDK A;  3VIV A;  5G1S A;  4DI1 A;  5IKL B;  4U0G H;  4I4Z A;  4WCZ A;  2W3P A;  3KTK A;  2F6I A;  5KDR A;  3Q1T A;  5E0S H;  2BZR A;  4ELW A;  4L6W A;  5FIF A;  3Q7H A;  1ON9 A;  3R9S A;  4F47 A;  2PBP A;  4B3J A;  3PE8 A;  5ING A;  2HW5 A;  5C9G A;  3IB9 A;  2VSU C;  4KD6 A;  4JFC A;  4IZB A;  3T8A A;  3P85 A;  3PGQ A;  3STA A;  1N6D A;  4JWV A;  1EF9 A;  3ISA A;  4ZU2 A;  1FC6 A;  3H81 A;  1X0U A;  3LKE A;  3KTJ A;  2ZL2 A;  3MYB A;  5INI A;  3Q0G A;  3T8B A;  1Q52 A;  3IBB A;  2VSS F;  3H0U A;  3H0J A;  3FDU A;  5DU6 A;  4JJT A;  3HRX A;  1XO6 A;  5MGB A;  4WYO B;  4Z0M A;  4HNK A;  4JCS A;  1RJM A;  2D3T A;  5JBX A;  2VRE A;  1N6E A;  3TZ3 A;  2Q34 A;  1Y7O A;  2PG8 A;  4JCQ A;  2VSS E;  4QFE A;  3H02 A;  3IAV A;  3G64 A;  4FZW C;  2VSS A;  3TT6 A;  1K32 A;  3U9R B;  4L8K A;  3MT6 A;  1SG4 A;  1K39 A;  3QRE A;  3H0S A;  4EML A;  3HE2 A;  3DJA A;  4U0G A;  4JSB A;  4MXI A;  3OT6 A;  1UYV A;  4I52 A;  4K29 A;  3M6M A;  3RSI A;  2EJ5 A;  2J5S A;  3KQF A;  4KWB A;  1FC9 A;  3QYR A;  3TV5 A;  3JU1 A;  4OMR A;  2F6Q A;  3T88 A;  2CBY A;  4B3I A;  5C90 A;  5DUF A;  3QXZ A;  2ZL0 A;  2NP9 A;  3KTI A;  4ZDC A;  5DU8 A;  2ZQR A;  3NJB A;  1UIY A;  3MFM A;  4NNQ A;  3FF6 A;  4MOU A;  2A81 A;  3U9T B;  1MJ3 A;  4QII A;  1W2X A;  3OC7 A;  3QWD A;  2IEX A;  5DKP A;  4JYL A;  2ZQQ A;  4JCR A;  3BPP A;  2DUB A;  4ZDD A;  2GTR A;  1UYT A;  3R0O A;  1PIX A;  2VSU E;  2FBM A;  3N6R B;  2VSU A;  4Q1I A;  4FNB A;  1HNO A;  1TYF A;  1WDM A;  2C8T A;  3ZW9 A;  3P2L A;  4KNP A;  4RYF H;  4EMM A;  3QK8 A;  2F9Y A;  3R9T A;  5E0N X;  3RRV A;  4YLH A;  1XNV A;  4JOT A;  2ZL3 A;  4EMP A;  5FUS A;  5CTC A;  1O8U A;  3I47 A;  4B3H A;  2QQ3 A;  2VX2 A;  1NZY A;  3BF0 A;  3HP0 A;  4ZDB A;  4WZ8 B;  2J5G A;  3TRR A;  3SLL A;  4ELX A;  3PZK A;  3GMA A;  1VRG A;  4FND A;  4KPK A;  3HIN A;  4U18 A;  3QXI A;  5E0S A;  3TDC A;  3KTG A;  2FW2 A;  3V5E A;  3ST9 A;  2J5I A;  4FZW A;  5DU4 A;  5INF A;  1ON3 A; 
#chains in the Genus database with same CATH topology
 1HZD A;  2J5I I;  4U1A A;  3T89 A;  4ELS A;  1EY3 A;  2Q35 A;  3GF3 A;  3TT7 A;  4U0H A;  4ZDE A;  4FN8 A;  4HC8 A;  3NJD A;  2DEO A;  3U9S B;  4RCN A;  4FB8 A;  4I42 A;  2WTB A;  1J7X A;  1N6F A;  5DTW A;  3PEA A;  1XNY A;  3ZWA A;  3SWX A;  2A7K A;  4Q0G A;  3GLM A;  3OME A;  3QKA A;  5G1Q A;  3K8X A;  1PJH A;  2VSU F;  1YG8 A;  4FJW D;  3T3W A;  3ZWC A;  2FZS A;  4ASI A;  1HNU A;  4RYF A;  3TVU A;  1EF8 A;  4FN7 A;  3R6H A;  1SZO A;  5DZK H;  1OD2 A;  2F9Y B;  4J2U A;  1OD4 A;  1JXZ A;  3MOY A;  4OG1 A;  2PPY A;  3V5I A;  3GKB A;  1WDL A;  4JYJ A;  2X24 A;  3BEZ A;  4JVT A;  1NZY B;  5DUC A;  4OLQ A;  3Q0J A;  3GF7 A;  4GHN A;  3KTH A;  1XNW A;  3HLN 1;  2YJG A;  4LK5 A;  4NAR A;  4IZC A;  4IZD A;  3RST A;  4NEK A;  2Q2X A;  2F9I B;  2J5I B;  3DOR A;  4GM2 A;  4U19 A;  1UYS A;  3QMJ A;  5KJP A;  3H0Q A;  4MI2 A;  4K3W A;  3WG5 A;  1XX4 A;  5DTP A;  4QIJ A;  1Q51 A;  3L3S A;  4JCT A;  5DL1 A;  5CTB A;  1FC7 A;  3M6N A;  5G1R A;  2F9I A;  2A7S A;  1FCF A;  2UZF A;  1TG6 A;  3K50 A;  1RJN A;  3LAO A;  4G2R A;  1UYR A;  4K2N A;  3ZW8 A;  1DUB A;  3ZWB A;  5KDR B;  3TVW A;  2CE3 A;  3P5M A;  3TLF A;  5JBW A;  2X58 A;  4ZDF A;  3R9Q A;  1WZ8 A;  1DCI A;  2ZL4 A;  1YG6 A;  5DZK A;  2J5G D;  1WDK A;  3VIV A;  5G1S A;  4DI1 A;  5IKL B;  4U0G H;  4I4Z A;  4WCZ A;  2W3P A;  3KTK A;  2F6I A;  5KDR A;  3Q1T A;  5E0S H;  2BZR A;  4ELW A;  4L6W A;  5FIF A;  3Q7H A;  1ON9 A;  3R9S A;  4F47 A;  2PBP A;  4B3J A;  3PE8 A;  5ING A;  2HW5 A;  5C9G A;  3IB9 A;  2VSU C;  4KD6 A;  4JFC A;  4IZB A;  3T8A A;  3P85 A;  3PGQ A;  3STA A;  1N6D A;  4JWV A;  1EF9 A;  3ISA A;  4ZU2 A;  1FC6 A;  3H81 A;  1X0U A;  3LKE A;  3KTJ A;  2ZL2 A;  3MYB A;  5INI A;  3Q0G A;  3T8B A;  1Q52 A;  3IBB A;  2VSS F;  3H0U A;  3H0J A;  3FDU A;  5DU6 A;  4JJT A;  3HRX A;  1XO6 A;  5MGB A;  4WYO B;  4Z0M A;  4HNK A;  4JCS A;  1RJM A;  2D3T A;  5JBX A;  2VRE A;  1N6E A;  3TZ3 A;  2Q34 A;  1Y7O A;  2PG8 A;  4JCQ A;  2VSS E;  4QFE A;  3H02 A;  3IAV A;  3G64 A;  3BPT A;  4FZW C;  2VSS A;  3TT6 A;  1K32 A;  3U9R B;  4L8K A;  3MT6 A;  1SG4 A;  1K39 A;  3QRE A;  3H0S A;  4EML A;  3HE2 A;  3DJA A;  4U0G A;  4JSB A;  4MXI A;  3OT6 A;  1UYV A;  4I52 A;  4K29 A;  3M6M A;  3RSI A;  2EJ5 A;  2J5S A;  3KQF A;  4KWB A;  1FC9 A;  3QYR A;  3TV5 A;  3JU1 A;  4OMR A;  2F6Q A;  3T88 A;  2CBY A;  4B3I A;  5C90 A;  5DUF A;  3QXZ A;  2ZL0 A;  2NP9 A;  3KTI A;  4ZDC A;  5DU8 A;  2ZQR A;  3NJB A;  1UIY A;  3MFM A;  4NNQ A;  3FF6 A;  4MOU A;  2A81 A;  3U9T B;  1MJ3 A;  4QII A;  1W2X A;  3OC7 A;  3QWD A;  2IEX A;  5DKP A;  4JYL A;  4HDT A;  2ZQQ A;  4JCR A;  3BPP A;  2DUB A;  4ZDD A;  2GTR A;  1UYT A;  3R0O A;  1PIX A;  2VSU E;  2FBM A;  3N6R B;  2VSU A;  4Q1I A;  4FNB A;  1HNO A;  1TYF A;  1WDM A;  2C8T A;  3ZW9 A;  3P2L A;  4KNP A;  4RYF H;  4EMM A;  3QK8 A;  2F9Y A;  3R9T A;  5E0N X;  3RRV A;  4YLH A;  1XNV A;  4JOT A;  2ZL3 A;  4EMP A;  5FUS A;  5CTC A;  1O8U A;  3I47 A;  4B3H A;  2QQ3 A;  2VX2 A;  1NZY A;  3BF0 A;  3HP0 A;  4ZDB A;  4WZ8 B;  2J5G A;  3TRR A;  3SLL A;  4ELX A;  3PZK A;  3GMA A;  1VRG A;  4FND A;  4KPK A;  3HIN A;  5HUQ A;  4U18 A;  3QXI A;  5E0S A;  3TDC A;  3KTG A;  2FW2 A;  3V5E A;  3ST9 A;  2J5I A;  4FZW A;  5DU4 A;  5INF A;  1ON3 A; 
#chains in the Genus database with same CATH homology
 1HZD A;  2J5I I;  4U1A A;  3T89 A;  4ELS A;  1EY3 A;  2Q35 A;  3GF3 A;  3TT7 A;  4U0H A;  4ZDE A;  4FN8 A;  4HC8 A;  3NJD A;  2DEO A;  3U9S B;  4RCN A;  4FB8 A;  4I42 A;  2WTB A;  1J7X A;  1N6F A;  5DTW A;  3PEA A;  1XNY A;  3ZWA A;  3SWX A;  2A7K A;  4Q0G A;  3GLM A;  3OME A;  3QKA A;  5G1Q A;  3K8X A;  1PJH A;  2VSU F;  1YG8 A;  4FJW D;  3T3W A;  3ZWC A;  2FZS A;  4ASI A;  1HNU A;  4RYF A;  3TVU A;  1EF8 A;  4FN7 A;  3R6H A;  1SZO A;  5DZK H;  1OD2 A;  2F9Y B;  4J2U A;  1OD4 A;  1JXZ A;  3MOY A;  4OG1 A;  2PPY A;  3V5I A;  3GKB A;  1WDL A;  4JYJ A;  2X24 A;  3BEZ A;  4JVT A;  1NZY B;  5DUC A;  4OLQ A;  3Q0J A;  3GF7 A;  4GHN A;  3KTH A;  1XNW A;  3HLN 1;  2YJG A;  4LK5 A;  4NAR A;  4IZC A;  4IZD A;  3RST A;  4NEK A;  2Q2X A;  2F9I B;  2J5I B;  3DOR A;  4GM2 A;  4U19 A;  1UYS A;  3QMJ A;  5KJP A;  3H0Q A;  4MI2 A;  4K3W A;  3WG5 A;  1XX4 A;  5DTP A;  4QIJ A;  1Q51 A;  3L3S A;  4JCT A;  5DL1 A;  5CTB A;  1FC7 A;  3M6N A;  5G1R A;  2F9I A;  2A7S A;  1FCF A;  2UZF A;  1TG6 A;  3K50 A;  1RJN A;  3LAO A;  4G2R A;  1UYR A;  4K2N A;  3ZW8 A;  1DUB A;  3ZWB A;  5KDR B;  3TVW A;  2CE3 A;  3P5M A;  3TLF A;  5JBW A;  2X58 A;  4ZDF A;  3R9Q A;  1WZ8 A;  1DCI A;  2ZL4 A;  1YG6 A;  5DZK A;  2J5G D;  1WDK A;  3VIV A;  5G1S A;  4DI1 A;  5IKL B;  4U0G H;  4I4Z A;  4WCZ A;  2W3P A;  3KTK A;  2F6I A;  5KDR A;  3Q1T A;  5E0S H;  2BZR A;  4ELW A;  4L6W A;  5FIF A;  3Q7H A;  1ON9 A;  3R9S A;  4F47 A;  2PBP A;  4B3J A;  3PE8 A;  5ING A;  2HW5 A;  5C9G A;  3IB9 A;  2VSU C;  4KD6 A;  4JFC A;  4IZB A;  3T8A A;  3P85 A;  3PGQ A;  3STA A;  1N6D A;  4JWV A;  1EF9 A;  3ISA A;  4ZU2 A;  1FC6 A;  3H81 A;  1X0U A;  3LKE A;  3KTJ A;  2ZL2 A;  3MYB A;  5INI A;  3Q0G A;  3T8B A;  1Q52 A;  3IBB A;  2VSS F;  3H0U A;  3H0J A;  3FDU A;  5DU6 A;  4JJT A;  3HRX A;  1XO6 A;  5MGB A;  4WYO B;  4Z0M A;  4HNK A;  4JCS A;  1RJM A;  2D3T A;  5JBX A;  2VRE A;  1N6E A;  3TZ3 A;  2Q34 A;  1Y7O A;  2PG8 A;  4JCQ A;  2VSS E;  4QFE A;  3H02 A;  3IAV A;  3G64 A;  3BPT A;  4FZW C;  2VSS A;  3TT6 A;  1K32 A;  3U9R B;  4L8K A;  3MT6 A;  1SG4 A;  1K39 A;  3QRE A;  3H0S A;  4EML A;  3HE2 A;  3DJA A;  4U0G A;  4JSB A;  4MXI A;  3OT6 A;  1UYV A;  4I52 A;  4K29 A;  3M6M A;  3RSI A;  2EJ5 A;  2J5S A;  3KQF A;  4KWB A;  1FC9 A;  3QYR A;  3TV5 A;  3JU1 A;  4OMR A;  2F6Q A;  3T88 A;  2CBY A;  4B3I A;  5C90 A;  5DUF A;  3QXZ A;  2ZL0 A;  2NP9 A;  3KTI A;  4ZDC A;  5DU8 A;  2ZQR A;  3NJB A;  1UIY A;  3MFM A;  4NNQ A;  3FF6 A;  4MOU A;  2A81 A;  3U9T B;  1MJ3 A;  4QII A;  1W2X A;  3OC7 A;  3QWD A;  2IEX A;  5DKP A;  4JYL A;  4HDT A;  2ZQQ A;  4JCR A;  3BPP A;  2DUB A;  4ZDD A;  2GTR A;  1UYT A;  3R0O A;  1PIX A;  2VSU E;  2FBM A;  3N6R B;  2VSU A;  4Q1I A;  4FNB A;  1HNO A;  1TYF A;  1WDM A;  2C8T A;  3ZW9 A;  3P2L A;  4KNP A;  4RYF H;  4EMM A;  3QK8 A;  2F9Y A;  3R9T A;  5E0N X;  3RRV A;  4YLH A;  1XNV A;  4JOT A;  2ZL3 A;  4EMP A;  5FUS A;  5CTC A;  1O8U A;  3I47 A;  4B3H A;  2QQ3 A;  2VX2 A;  1NZY A;  3BF0 A;  3HP0 A;  4ZDB A;  4WZ8 B;  2J5G A;  3TRR A;  3SLL A;  4ELX A;  3PZK A;  3GMA A;  1VRG A;  4FND A;  4KPK A;  3HIN A;  5HUQ A;  4U18 A;  3QXI A;  5E0S A;  3TDC A;  3KTG A;  2FW2 A;  3V5E A;  3ST9 A;  2J5I A;  4FZW A;  5DU4 A;  5INF A;  1ON3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...