3QWDA

Crystal structure of clpp from staphylococcus aureus
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
192
structure length
187
Chain Sequence
LIPTVIETRAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Conformational Switch Underlies ClpP Protease Function.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 64
structure length 187
sequence length 192
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3qwdA00
3PGQA 3VIVA 3KTJA 2F9IB 4B3JA 2Q2XA 2A81A 4KNPA 1YG8A 5KJPA 1FC6A 3MYBA 5JBXA 3MOYA 4HNKA 3QYRA 2HW5A 2A7SA 1Q51A 4ZDFA 4NNQA 2PG8A 5FIFA 2J5GA 4MI2A 2FW2A 4U18A 3H0QA 3GMAA 1XX4A 5INFA 4RYFA 3Q0JA 1N6EA 2UZFA 2W3PA 5CTBA 5DZKA 2EJ5A 4I52A 3LAOA 3TLFA 4RYFH 3H0SA 4ZDCA 3IBBA 1UIYA 4JCSA 1XNYA 3QREA 1PIXA 1RJNA 4I42A 2BZRA 5CTCA 3QKAA 4ZU2A 4EMPA 2ZL3A 4FZWA 4WCZA 4NEKA 3T89A 3KTGA 1MJ3A 4QFEA 2FBMA 3KTKA 4Z0MA 1FCFA 3TDCA 1WZ8A 3KTHA 4U19A 1N6DA 4ZDBA 4GHNA 5DKPA 4Q1IA 2ZL0A 2PPYA 3ZW9A 3PE8A 1XO6A 3GLMA 4WZ8B 4JSBA 2D3TA 3T8BA 1ON3A 1OD4A 2VX2A 3R6HA 3FF6A 4OG1A 3SLLA 1ON9A 1NZYB 2ZQQA 3H81A 3RSIA 1DUBA 2VSSA 3ISAA 5DU4A 2CE3A 5C90A 4JWVA 4KWBA 4JJTA 4YLHA 2VREA 1TG6A 2J5IA 2IEXA 3QXZA 3ZWBA 3IB9A 5KDRB 3HINA 4IZBA 3MT6A 4FNDA 3ZW8A 3IAVA 5INGA 2A7KA 3OMEA 1W2XA 5FUSA 3ZWAA 1OD2A 1X0UA 3TT6A 1TYFA 2X58A 3FDUA 4GM2A 3QXIA 1RJMA 2F9IA 4K3WA 1XNWA 1EF8A 4JYJA 4MXIA 2C8TA 3I47A 4QIIA 3NJBA 4OLQA 1UYTA 2X24A 3V5IA 3KQFA 3TVWA 3U9RB 3H0UA 4K2NA 5DZKH 4FB8A 3U9SB 3MFMA 1J7XA 4FN7A 4JCRA 4OMRA 1HNOA 2PBPA 1JXZA 3TT7A 3Q7HA 4Q0GA 2J5GD 4HC8A 3N6RB 3QWDA 5C9GA 2F6IA 3TV5A 1N6FA 3U9TB 4L6WA 2GTRA 4JOTA 2CBYA 4IZDA 3KTIA 4U1AA 3HRXA 5DTWA 4B3IA 4FJWD 3G64A 4JCTA 4U0HA 5E0SA 4F47A 2NP9A 3ZWCA 3HLN1 5DTPA 2DEOA 3P85A 5KDRA 4U0GA 3R9QA 4K29A 2J5IB 4KD6A 3TZ3A 5DUCA 5E0SH 3HE2A 2VSUE 3PEAA 1WDLA 3OT6A 1HZDA 4JVTA 5E0NX 1HNUA 4JYLA 1EY3A 2QQ3A 3QK8A 3JU1A 1NZYA 4LK5A 4ELXA 2VSSF 1SZOA 4ELWA 2VSUF 3T8AA 2J5II 3BPPA 3M6NA 2Q34A 5MGBA 3M6MA 2ZL4A 5DUFA 3GF3A 3BEZA 1UYRA 3L3SA 5DU8A 3GF7A 1YG6A 3DORA 4FN8A 3R9SA 1WDMA 3BF0A 2F6QA 2VSUA 1PJHA 1UYVA 2F9YA 4JFCA 3RRVA 1K39A 3T88A 3HP0A 2ZL2A 3P5MA 4MOUA 4FZWC 4EMLA 4EMMA 4FNBA 4DI1A 3PZKA 5G1SA 4IZCA 3QMJA 2VSSE 3K8XA 2J5SA 1FC9A 4ZDEA 3DJAA 1SG4A 1Q52A 2ZQRA 1XNVA 4WYOB 3SWXA 5JBWA 3OC7A 1DCIA 3GKBA 1Y7OA 1K32A 3T3WA 4QIJA 4ASIA 3TRRA 4I4ZA 3TVUA 3ST9A 3H0JA 3K50A 3STAA 4JCQA 5DU6A 2Q35A 3Q0GA 1O8UA 1WDKA 3R0OA 5G1QA 3V5EA 1EF9A 3RSTA 4KPKA 4ZDDA 3Q1TA 4U0GH 4ELSA 2F9YB 3R9TA 5DL1A 3LKEA 2FZSA 4RCNA 5G1RA 4B3HA 5INIA 1FC7A 1UYSA 2WTBA 1VRGA 3P2LA 3NJDA 3H02A 4L8KA 2VSUC 5IKLB 2DUBA 3WG5A 4G2RA
chains in the Genus database with same CATH superfamily
3PGQA 3VIVA 3KTJA 2F9IB 4B3JA 2Q2XA 2A81A 4KNPA 1YG8A 5KJPA 1FC6A 3MYBA 5JBXA 3MOYA 4HNKA 3QYRA 2HW5A 2A7SA 1Q51A 4ZDFA 4NNQA 2PG8A 5FIFA 2J5GA 4MI2A 2FW2A 4U18A 3H0QA 3GMAA 1XX4A 5INFA 4RYFA 3Q0JA 1N6EA 2UZFA 2W3PA 5CTBA 5DZKA 2EJ5A 4I52A 3LAOA 3TLFA 4RYFH 3H0SA 4ZDCA 3IBBA 1UIYA 4JCSA 1XNYA 3QREA 1PIXA 1RJNA 4I42A 2BZRA 5CTCA 3QKAA 4ZU2A 4EMPA 2ZL3A 4FZWA 4WCZA 4NEKA 3T89A 3KTGA 1MJ3A 4QFEA 2FBMA 3KTKA 2YJGA 4Z0MA 1FCFA 3TDCA 1WZ8A 3KTHA 4U19A 1N6DA 4ZDBA 4GHNA 5DKPA 4Q1IA 2ZL0A 2PPYA 3ZW9A 3PE8A 1XO6A 3GLMA 4WZ8B 4JSBA 2D3TA 3T8BA 1ON3A 1OD4A 2VX2A 3R6HA 3FF6A 4OG1A 3SLLA 1ON9A 1NZYB 2ZQQA 3H81A 3RSIA 1DUBA 2VSSA 3ISAA 4NARA 5DU4A 2CE3A 5C90A 4JWVA 4KWBA 4JJTA 4YLHA 2VREA 1TG6A 2J5IA 2IEXA 3QXZA 3ZWBA 3IB9A 5KDRB 3HINA 4IZBA 3MT6A 4FNDA 3ZW8A 3IAVA 5INGA 2A7KA 3OMEA 1W2XA 5FUSA 3ZWAA 1OD2A 1X0UA 3TT6A 1TYFA 2X58A 3FDUA 4GM2A 3QXIA 1RJMA 2F9IA 4K3WA 1XNWA 1EF8A 4JYJA 4MXIA 2C8TA 3I47A 4QIIA 3NJBA 4OLQA 1UYTA 2X24A 3V5IA 3KQFA 3TVWA 3U9RB 3H0UA 4K2NA 5DZKH 4FB8A 3U9SB 3MFMA 1J7XA 4FN7A 4JCRA 4OMRA 1HNOA 2PBPA 4HDTA 1JXZA 3TT7A 3Q7HA 4Q0GA 2J5GD 4HC8A 3N6RB 3QWDA 5C9GA 2F6IA 3TV5A 1N6FA 3U9TB 4L6WA 2GTRA 4JOTA 2CBYA 4IZDA 3KTIA 4U1AA 3HRXA 5DTWA 4B3IA 4FJWD 3G64A 4JCTA 4U0HA 5E0SA 4F47A 2NP9A 3ZWCA 3HLN1 5DTPA 2DEOA 3P85A 5KDRA 4U0GA 3R9QA 4K29A 2J5IB 4KD6A 3TZ3A 5DUCA 5E0SH 3HE2A 2VSUE 3PEAA 1WDLA 3OT6A 1HZDA 4JVTA 5E0NX 1HNUA 4JYLA 1EY3A 2QQ3A 3QK8A 3JU1A 1NZYA 4LK5A 4ELXA 2VSSF 1SZOA 4ELWA 2VSUF 3T8AA 2J5II 3BPPA 3M6NA 2Q34A 5MGBA 3M6MA 2ZL4A 5DUFA 3GF3A 3BEZA 1UYRA 3L3SA 5DU8A 3GF7A 1YG6A 3DORA 4FN8A 3R9SA 1WDMA 3BF0A 2F6QA 2VSUA 1PJHA 1UYVA 2F9YA 4JFCA 3RRVA 1K39A 3T88A 3HP0A 2ZL2A 4J2UA 3P5MA 4MOUA 4FZWC 4EMLA 4EMMA 4FNBA 4DI1A 3PZKA 5G1SA 4IZCA 3QMJA 2VSSE 3K8XA 2J5SA 1FC9A 4ZDEA 3DJAA 1SG4A 1Q52A 2ZQRA 1XNVA 4WYOB 3SWXA 5JBWA 3OC7A 1DCIA 3GKBA 1Y7OA 1K32A 3T3WA 4QIJA 4ASIA 3TRRA 4I4ZA 3TVUA 3ST9A 3H0JA 3K50A 3STAA 4JCQA 5DU6A 2Q35A 3Q0GA 1O8UA 1WDKA 3R0OA 5G1QA 3V5EA 1EF9A 3RSTA 3BPTA 4KPKA 4ZDDA 3Q1TA 5HUQA 4U0GH 4ELSA 2F9YB 3R9TA 5DL1A 3LKEA 2FZSA 4RCNA 5G1RA 4B3HA 5INIA 1FC7A 1UYSA 2WTBA 1VRGA 3P2LA 3NJDA 3H02A 4L8KA 2VSUC 5IKLB 2DUBA 3WG5A 4G2RA
chains in the Genus database with same CATH topology
3PGQA 3VIVA 3KTJA 2F9IB 4B3JA 2Q2XA 2A81A 4KNPA 1YG8A 5KJPA 1FC6A 3MYBA 5JBXA 3MOYA 4HNKA 3QYRA 2HW5A 2A7SA 1Q51A 4ZDFA 4NNQA 2PG8A 5FIFA 2J5GA 4MI2A 2FW2A 4U18A 3H0QA 3GMAA 1XX4A 5INFA 4RYFA 3Q0JA 1N6EA 2UZFA 2W3PA 5CTBA 5DZKA 2EJ5A 4I52A 3LAOA 3TLFA 4RYFH 3H0SA 4ZDCA 3IBBA 1UIYA 4JCSA 1XNYA 3QREA 1PIXA 1RJNA 4I42A 2BZRA 5CTCA 3QKAA 4ZU2A 4EMPA 2ZL3A 4FZWA 4WCZA 4NEKA 3T89A 3KTGA 1MJ3A 4QFEA 2FBMA 3KTKA 2YJGA 4Z0MA 1FCFA 3TDCA 1WZ8A 3KTHA 4U19A 1N6DA 4ZDBA 4GHNA 5DKPA 4Q1IA 2ZL0A 2PPYA 3ZW9A 3PE8A 1XO6A 3GLMA 4WZ8B 4JSBA 2D3TA 3T8BA 1ON3A 1OD4A 2VX2A 3R6HA 3FF6A 4OG1A 3SLLA 1ON9A 1NZYB 2ZQQA 3H81A 3RSIA 1DUBA 2VSSA 3ISAA 4NARA 5DU4A 2CE3A 5C90A 4JWVA 4KWBA 4JJTA 4YLHA 2VREA 1TG6A 2J5IA 2IEXA 3QXZA 3ZWBA 3IB9A 5KDRB 3HINA 4IZBA 3MT6A 4FNDA 3ZW8A 3IAVA 5INGA 2A7KA 3OMEA 1W2XA 5FUSA 3ZWAA 1OD2A 1X0UA 3TT6A 1TYFA 2X58A 3FDUA 4GM2A 3QXIA 1RJMA 2F9IA 4K3WA 1XNWA 1EF8A 4JYJA 4MXIA 2C8TA 3I47A 4QIIA 3NJBA 4OLQA 1UYTA 2X24A 3V5IA 3KQFA 3TVWA 3U9RB 3H0UA 4K2NA 5DZKH 4FB8A 3U9SB 3MFMA 1J7XA 4FN7A 4JCRA 4OMRA 1HNOA 2PBPA 4HDTA 1JXZA 3TT7A 3Q7HA 4Q0GA 2J5GD 4HC8A 3N6RB 3QWDA 5C9GA 2F6IA 3TV5A 1N6FA 3U9TB 4L6WA 2GTRA 4JOTA 2CBYA 4IZDA 3KTIA 4U1AA 3HRXA 5DTWA 4B3IA 4FJWD 3G64A 4JCTA 4U0HA 5E0SA 4F47A 2NP9A 3ZWCA 3HLN1 5DTPA 2DEOA 3P85A 5KDRA 4U0GA 3R9QA 4K29A 2J5IB 4KD6A 3TZ3A 5DUCA 5E0SH 3HE2A 2VSUE 3PEAA 1WDLA 3OT6A 1HZDA 4JVTA 5E0NX 1HNUA 4JYLA 1EY3A 2QQ3A 3QK8A 3JU1A 1NZYA 4LK5A 4ELXA 2VSSF 1SZOA 4ELWA 2VSUF 3T8AA 2J5II 3BPPA 3M6NA 2Q34A 5MGBA 3M6MA 2ZL4A 5DUFA 3GF3A 3BEZA 1UYRA 3L3SA 5DU8A 3GF7A 1YG6A 3DORA 4FN8A 3R9SA 1WDMA 3BF0A 2F6QA 2VSUA 1PJHA 1UYVA 2F9YA 4JFCA 3RRVA 1K39A 3T88A 3HP0A 2ZL2A 4J2UA 3P5MA 4MOUA 4FZWC 4EMLA 4EMMA 4FNBA 4DI1A 3PZKA 5G1SA 4IZCA 3QMJA 2VSSE 3K8XA 2J5SA 1FC9A 4ZDEA 3DJAA 1SG4A 1Q52A 2ZQRA 1XNVA 4WYOB 3SWXA 5JBWA 3OC7A 1DCIA 3GKBA 1Y7OA 1K32A 3T3WA 4QIJA 4ASIA 3TRRA 4I4ZA 3TVUA 3ST9A 3H0JA 3K50A 3STAA 4JCQA 5DU6A 2Q35A 3Q0GA 1O8UA 1WDKA 3R0OA 5G1QA 3V5EA 1EF9A 3RSTA 3BPTA 4KPKA 4ZDDA 3Q1TA 5HUQA 4U0GH 4ELSA 2F9YB 3R9TA 5DL1A 3LKEA 2FZSA 4RCNA 5G1RA 4B3HA 5INIA 1FC7A 1UYSA 2WTBA 1VRGA 3P2LA 3NJDA 3H02A 4L8KA 2VSUC 5IKLB 2DUBA 3WG5A 4G2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGQ A;  3VIV A;  3KTJ A;  2F9I B;  4B3J A;  2Q2X A;  2A81 A;  4KNP A;  1YG8 A;  5KJP A;  1FC6 A;  3MYB A;  5JBX A;  3MOY A;  4HNK A;  3QYR A;  2HW5 A;  2A7S A;  1Q51 A;  4ZDF A;  4NNQ A;  2PG8 A;  5FIF A;  2J5G A;  4MI2 A;  2FW2 A;  4U18 A;  3H0Q A;  3GMA A;  1XX4 A;  5INF A;  4RYF A;  3Q0J A;  1N6E A;  2UZF A;  2W3P A;  5CTB A;  5DZK A;  2EJ5 A;  4I52 A;  3LAO A;  3TLF A;  4RYF H;  3H0S A;  4ZDC A;  3IBB A;  1UIY A;  4JCS A;  1XNY A;  3QRE A;  1PIX A;  1RJN A;  4I42 A;  2BZR A;  5CTC A;  3QKA A;  4ZU2 A;  4EMP A;  2ZL3 A;  4FZW A;  4WCZ A;  4NEK A;  3T89 A;  3KTG A;  1MJ3 A;  4QFE A;  2FBM A;  3KTK A;  4Z0M A;  1FCF A;  3TDC A;  1WZ8 A;  3KTH A;  4U19 A;  1N6D A;  4ZDB A;  4GHN A;  5DKP A;  4Q1I A;  2ZL0 A;  2PPY A;  3ZW9 A;  3PE8 A;  1XO6 A;  3GLM A;  4WZ8 B;  4JSB A;  2D3T A;  3T8B A;  1ON3 A;  1OD4 A;  2VX2 A;  3R6H A;  3FF6 A;  4OG1 A;  3SLL A;  1ON9 A;  1NZY B;  2ZQQ A;  3H81 A;  3RSI A;  1DUB A;  2VSS A;  3ISA A;  5DU4 A;  2CE3 A;  5C90 A;  4JWV A;  4KWB A;  4JJT A;  4YLH A;  2VRE A;  1TG6 A;  2J5I A;  2IEX A;  3QXZ A;  3ZWB A;  3IB9 A;  5KDR B;  3HIN A;  4IZB A;  3MT6 A;  4FND A;  3ZW8 A;  3IAV A;  5ING A;  2A7K A;  3OME A;  1W2X A;  5FUS A;  3ZWA A;  1OD2 A;  1X0U A;  3TT6 A;  1TYF A;  2X58 A;  3FDU A;  4GM2 A;  3QXI A;  1RJM A;  2F9I A;  4K3W A;  1XNW A;  1EF8 A;  4JYJ A;  4MXI A;  2C8T A;  3I47 A;  4QII A;  3NJB A;  4OLQ A;  1UYT A;  2X24 A;  3V5I A;  3KQF A;  3TVW A;  3U9R B;  3H0U A;  4K2N A;  5DZK H;  4FB8 A;  3U9S B;  3MFM A;  1J7X A;  4FN7 A;  4JCR A;  4OMR A;  1HNO A;  2PBP A;  1JXZ A;  3TT7 A;  3Q7H A;  4Q0G A;  2J5G D;  4HC8 A;  3N6R B;  3QWD A;  5C9G A;  2F6I A;  3TV5 A;  1N6F A;  3U9T B;  4L6W A;  2GTR A;  4JOT A;  2CBY A;  4IZD A;  3KTI A;  4U1A A;  3HRX A;  5DTW A;  4B3I A;  4FJW D;  3G64 A;  4JCT A;  4U0H A;  5E0S A;  4F47 A;  2NP9 A;  3ZWC A;  3HLN 1;  5DTP A;  2DEO A;  3P85 A;  5KDR A;  4U0G A;  3R9Q A;  4K29 A;  2J5I B;  4KD6 A;  3TZ3 A;  5DUC A;  5E0S H;  3HE2 A;  2VSU E;  3PEA A;  1WDL A;  3OT6 A;  1HZD A;  4JVT A;  5E0N X;  1HNU A;  4JYL A;  1EY3 A;  2QQ3 A;  3QK8 A;  3JU1 A;  1NZY A;  4LK5 A;  4ELX A;  2VSS F;  1SZO A;  4ELW A;  2VSU F;  3T8A A;  2J5I I;  3BPP A;  3M6N A;  2Q34 A;  5MGB A;  3M6M A;  2ZL4 A;  5DUF A;  3GF3 A;  3BEZ A;  1UYR A;  3L3S A;  5DU8 A;  3GF7 A;  1YG6 A;  3DOR A;  4FN8 A;  3R9S A;  1WDM A;  3BF0 A;  2F6Q A;  2VSU A;  1PJH A;  1UYV A;  2F9Y A;  4JFC A;  3RRV A;  1K39 A;  3T88 A;  3HP0 A;  2ZL2 A;  3P5M A;  4MOU A;  4FZW C;  4EML A;  4EMM A;  4FNB A;  4DI1 A;  3PZK A;  5G1S A;  4IZC A;  3QMJ A;  2VSS E;  3K8X A;  2J5S A;  1FC9 A;  4ZDE A;  3DJA A;  1SG4 A;  1Q52 A;  2ZQR A;  1XNV A;  4WYO B;  3SWX A;  5JBW A;  3OC7 A;  1DCI A;  3GKB A;  1Y7O A;  1K32 A;  3T3W A;  4QIJ A;  4ASI A;  3TRR A;  4I4Z A;  3TVU A;  3ST9 A;  3H0J A;  3K50 A;  3STA A;  4JCQ A;  5DU6 A;  2Q35 A;  3Q0G A;  1O8U A;  1WDK A;  3R0O A;  5G1Q A;  3V5E A;  1EF9 A;  3RST A;  4KPK A;  4ZDD A;  3Q1T A;  4U0G H;  4ELS A;  2F9Y B;  3R9T A;  5DL1 A;  3LKE A;  2FZS A;  4RCN A;  5G1R A;  4B3H A;  5INI A;  1FC7 A;  1UYS A;  2WTB A;  1VRG A;  3P2L A;  3NJD A;  3H02 A;  4L8K A;  2VSU C;  5IKL B;  2DUB A;  3WG5 A;  4G2R A; 
#chains in the Genus database with same CATH topology
 3PGQ A;  3VIV A;  3KTJ A;  2F9I B;  4B3J A;  2Q2X A;  2A81 A;  4KNP A;  1YG8 A;  5KJP A;  1FC6 A;  3MYB A;  5JBX A;  3MOY A;  4HNK A;  3QYR A;  2HW5 A;  2A7S A;  1Q51 A;  4ZDF A;  4NNQ A;  2PG8 A;  5FIF A;  2J5G A;  4MI2 A;  2FW2 A;  4U18 A;  3H0Q A;  3GMA A;  1XX4 A;  5INF A;  4RYF A;  3Q0J A;  1N6E A;  2UZF A;  2W3P A;  5CTB A;  5DZK A;  2EJ5 A;  4I52 A;  3LAO A;  3TLF A;  4RYF H;  3H0S A;  4ZDC A;  3IBB A;  1UIY A;  4JCS A;  1XNY A;  3QRE A;  1PIX A;  1RJN A;  4I42 A;  2BZR A;  5CTC A;  3QKA A;  4ZU2 A;  4EMP A;  2ZL3 A;  4FZW A;  4WCZ A;  4NEK A;  3T89 A;  3KTG A;  1MJ3 A;  4QFE A;  2FBM A;  3KTK A;  2YJG A;  4Z0M A;  1FCF A;  3TDC A;  1WZ8 A;  3KTH A;  4U19 A;  1N6D A;  4ZDB A;  4GHN A;  5DKP A;  4Q1I A;  2ZL0 A;  2PPY A;  3ZW9 A;  3PE8 A;  1XO6 A;  3GLM A;  4WZ8 B;  4JSB A;  2D3T A;  3T8B A;  1ON3 A;  1OD4 A;  2VX2 A;  3R6H A;  3FF6 A;  4OG1 A;  3SLL A;  1ON9 A;  1NZY B;  2ZQQ A;  3H81 A;  3RSI A;  1DUB A;  2VSS A;  3ISA A;  4NAR A;  5DU4 A;  2CE3 A;  5C90 A;  4JWV A;  4KWB A;  4JJT A;  4YLH A;  2VRE A;  1TG6 A;  2J5I A;  2IEX A;  3QXZ A;  3ZWB A;  3IB9 A;  5KDR B;  3HIN A;  4IZB A;  3MT6 A;  4FND A;  3ZW8 A;  3IAV A;  5ING A;  2A7K A;  3OME A;  1W2X A;  5FUS A;  3ZWA A;  1OD2 A;  1X0U A;  3TT6 A;  1TYF A;  2X58 A;  3FDU A;  4GM2 A;  3QXI A;  1RJM A;  2F9I A;  4K3W A;  1XNW A;  1EF8 A;  4JYJ A;  4MXI A;  2C8T A;  3I47 A;  4QII A;  3NJB A;  4OLQ A;  1UYT A;  2X24 A;  3V5I A;  3KQF A;  3TVW A;  3U9R B;  3H0U A;  4K2N A;  5DZK H;  4FB8 A;  3U9S B;  3MFM A;  1J7X A;  4FN7 A;  4JCR A;  4OMR A;  1HNO A;  2PBP A;  4HDT A;  1JXZ A;  3TT7 A;  3Q7H A;  4Q0G A;  2J5G D;  4HC8 A;  3N6R B;  3QWD A;  5C9G A;  2F6I A;  3TV5 A;  1N6F A;  3U9T B;  4L6W A;  2GTR A;  4JOT A;  2CBY A;  4IZD A;  3KTI A;  4U1A A;  3HRX A;  5DTW A;  4B3I A;  4FJW D;  3G64 A;  4JCT A;  4U0H A;  5E0S A;  4F47 A;  2NP9 A;  3ZWC A;  3HLN 1;  5DTP A;  2DEO A;  3P85 A;  5KDR A;  4U0G A;  3R9Q A;  4K29 A;  2J5I B;  4KD6 A;  3TZ3 A;  5DUC A;  5E0S H;  3HE2 A;  2VSU E;  3PEA A;  1WDL A;  3OT6 A;  1HZD A;  4JVT A;  5E0N X;  1HNU A;  4JYL A;  1EY3 A;  2QQ3 A;  3QK8 A;  3JU1 A;  1NZY A;  4LK5 A;  4ELX A;  2VSS F;  1SZO A;  4ELW A;  2VSU F;  3T8A A;  2J5I I;  3BPP A;  3M6N A;  2Q34 A;  5MGB A;  3M6M A;  2ZL4 A;  5DUF A;  3GF3 A;  3BEZ A;  1UYR A;  3L3S A;  5DU8 A;  3GF7 A;  1YG6 A;  3DOR A;  4FN8 A;  3R9S A;  1WDM A;  3BF0 A;  2F6Q A;  2VSU A;  1PJH A;  1UYV A;  2F9Y A;  4JFC A;  3RRV A;  1K39 A;  3T88 A;  3HP0 A;  2ZL2 A;  4J2U A;  3P5M A;  4MOU A;  4FZW C;  4EML A;  4EMM A;  4FNB A;  4DI1 A;  3PZK A;  5G1S A;  4IZC A;  3QMJ A;  2VSS E;  3K8X A;  2J5S A;  1FC9 A;  4ZDE A;  3DJA A;  1SG4 A;  1Q52 A;  2ZQR A;  1XNV A;  4WYO B;  3SWX A;  5JBW A;  3OC7 A;  1DCI A;  3GKB A;  1Y7O A;  1K32 A;  3T3W A;  4QIJ A;  4ASI A;  3TRR A;  4I4Z A;  3TVU A;  3ST9 A;  3H0J A;  3K50 A;  3STA A;  4JCQ A;  5DU6 A;  2Q35 A;  3Q0G A;  1O8U A;  1WDK A;  3R0O A;  5G1Q A;  3V5E A;  1EF9 A;  3RST A;  3BPT A;  4KPK A;  4ZDD A;  3Q1T A;  5HUQ A;  4U0G H;  4ELS A;  2F9Y B;  3R9T A;  5DL1 A;  3LKE A;  2FZS A;  4RCN A;  5G1R A;  4B3H A;  5INI A;  1FC7 A;  1UYS A;  2WTB A;  1VRG A;  3P2L A;  3NJD A;  3H02 A;  4L8K A;  2VSU C;  5IKL B;  2DUB A;  3WG5 A;  4G2R A; 
#chains in the Genus database with same CATH homology
 3PGQ A;  3VIV A;  3KTJ A;  2F9I B;  4B3J A;  2Q2X A;  2A81 A;  4KNP A;  1YG8 A;  5KJP A;  1FC6 A;  3MYB A;  5JBX A;  3MOY A;  4HNK A;  3QYR A;  2HW5 A;  2A7S A;  1Q51 A;  4ZDF A;  4NNQ A;  2PG8 A;  5FIF A;  2J5G A;  4MI2 A;  2FW2 A;  4U18 A;  3H0Q A;  3GMA A;  1XX4 A;  5INF A;  4RYF A;  3Q0J A;  1N6E A;  2UZF A;  2W3P A;  5CTB A;  5DZK A;  2EJ5 A;  4I52 A;  3LAO A;  3TLF A;  4RYF H;  3H0S A;  4ZDC A;  3IBB A;  1UIY A;  4JCS A;  1XNY A;  3QRE A;  1PIX A;  1RJN A;  4I42 A;  2BZR A;  5CTC A;  3QKA A;  4ZU2 A;  4EMP A;  2ZL3 A;  4FZW A;  4WCZ A;  4NEK A;  3T89 A;  3KTG A;  1MJ3 A;  4QFE A;  2FBM A;  3KTK A;  2YJG A;  4Z0M A;  1FCF A;  3TDC A;  1WZ8 A;  3KTH A;  4U19 A;  1N6D A;  4ZDB A;  4GHN A;  5DKP A;  4Q1I A;  2ZL0 A;  2PPY A;  3ZW9 A;  3PE8 A;  1XO6 A;  3GLM A;  4WZ8 B;  4JSB A;  2D3T A;  3T8B A;  1ON3 A;  1OD4 A;  2VX2 A;  3R6H A;  3FF6 A;  4OG1 A;  3SLL A;  1ON9 A;  1NZY B;  2ZQQ A;  3H81 A;  3RSI A;  1DUB A;  2VSS A;  3ISA A;  4NAR A;  5DU4 A;  2CE3 A;  5C90 A;  4JWV A;  4KWB A;  4JJT A;  4YLH A;  2VRE A;  1TG6 A;  2J5I A;  2IEX A;  3QXZ A;  3ZWB A;  3IB9 A;  5KDR B;  3HIN A;  4IZB A;  3MT6 A;  4FND A;  3ZW8 A;  3IAV A;  5ING A;  2A7K A;  3OME A;  1W2X A;  5FUS A;  3ZWA A;  1OD2 A;  1X0U A;  3TT6 A;  1TYF A;  2X58 A;  3FDU A;  4GM2 A;  3QXI A;  1RJM A;  2F9I A;  4K3W A;  1XNW A;  1EF8 A;  4JYJ A;  4MXI A;  2C8T A;  3I47 A;  4QII A;  3NJB A;  4OLQ A;  1UYT A;  2X24 A;  3V5I A;  3KQF A;  3TVW A;  3U9R B;  3H0U A;  4K2N A;  5DZK H;  4FB8 A;  3U9S B;  3MFM A;  1J7X A;  4FN7 A;  4JCR A;  4OMR A;  1HNO A;  2PBP A;  4HDT A;  1JXZ A;  3TT7 A;  3Q7H A;  4Q0G A;  2J5G D;  4HC8 A;  3N6R B;  3QWD A;  5C9G A;  2F6I A;  3TV5 A;  1N6F A;  3U9T B;  4L6W A;  2GTR A;  4JOT A;  2CBY A;  4IZD A;  3KTI A;  4U1A A;  3HRX A;  5DTW A;  4B3I A;  4FJW D;  3G64 A;  4JCT A;  4U0H A;  5E0S A;  4F47 A;  2NP9 A;  3ZWC A;  3HLN 1;  5DTP A;  2DEO A;  3P85 A;  5KDR A;  4U0G A;  3R9Q A;  4K29 A;  2J5I B;  4KD6 A;  3TZ3 A;  5DUC A;  5E0S H;  3HE2 A;  2VSU E;  3PEA A;  1WDL A;  3OT6 A;  1HZD A;  4JVT A;  5E0N X;  1HNU A;  4JYL A;  1EY3 A;  2QQ3 A;  3QK8 A;  3JU1 A;  1NZY A;  4LK5 A;  4ELX A;  2VSS F;  1SZO A;  4ELW A;  2VSU F;  3T8A A;  2J5I I;  3BPP A;  3M6N A;  2Q34 A;  5MGB A;  3M6M A;  2ZL4 A;  5DUF A;  3GF3 A;  3BEZ A;  1UYR A;  3L3S A;  5DU8 A;  3GF7 A;  1YG6 A;  3DOR A;  4FN8 A;  3R9S A;  1WDM A;  3BF0 A;  2F6Q A;  2VSU A;  1PJH A;  1UYV A;  2F9Y A;  4JFC A;  3RRV A;  1K39 A;  3T88 A;  3HP0 A;  2ZL2 A;  4J2U A;  3P5M A;  4MOU A;  4FZW C;  4EML A;  4EMM A;  4FNB A;  4DI1 A;  3PZK A;  5G1S A;  4IZC A;  3QMJ A;  2VSS E;  3K8X A;  2J5S A;  1FC9 A;  4ZDE A;  3DJA A;  1SG4 A;  1Q52 A;  2ZQR A;  1XNV A;  4WYO B;  3SWX A;  5JBW A;  3OC7 A;  1DCI A;  3GKB A;  1Y7O A;  1K32 A;  3T3W A;  4QIJ A;  4ASI A;  3TRR A;  4I4Z A;  3TVU A;  3ST9 A;  3H0J A;  3K50 A;  3STA A;  4JCQ A;  5DU6 A;  2Q35 A;  3Q0G A;  1O8U A;  1WDK A;  3R0O A;  5G1Q A;  3V5E A;  1EF9 A;  3RST A;  3BPT A;  4KPK A;  4ZDD A;  3Q1T A;  5HUQ A;  4U0G H;  4ELS A;  2F9Y B;  3R9T A;  5DL1 A;  3LKE A;  2FZS A;  4RCN A;  5G1R A;  4B3H A;  5INI A;  1FC7 A;  1UYS A;  2WTB A;  1VRG A;  3P2L A;  3NJD A;  3H02 A;  4L8K A;  2VSU C;  5IKL B;  2DUB A;  3WG5 A;  4G2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...