3QWDA

Crystal structure of clpp from staphylococcus aureus
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
192
structure length
187
Chain Sequence
LIPTVIETRAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Conformational Switch Underlies ClpP Protease Function.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 64
structure length 187
sequence length 192
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3qwdA00
4I4ZA 5C90A 3DJAA 2CE3A 1OD2A 4Z0MA 4K2NA 3GLMA 3GKBA 3QK8A 3T8AA 3HP0A 1J7XA 4WYOB 2C8TA 4ELXA 2A7KA 4I52A 4FJWD 3ZW9A 5DTWA 4WCZA 3ZW8A 5DU6A 3H0QA 2FBMA 1YG8A 4ELWA 3U9RB 5E0SA 2EJ5A 3TT6A 1K32A 3R9QA 4ZDDA 3M6NA 2PPYA 2Q34A 4KNPA 3H02A 3OT6A 3TVWA 3RSIA 3TVUA 3R6HA 3Q1TA 5C9GA 4JYLA 2PG8A 3JU1A 4FZWA 2Q2XA 3V5EA 3MOYA 3MFMA 4ZDBA 4FNDA 4KPKA 3BEZA 4JCSA 3TZ3A 1N6DA 3PE8A 2IEXA 5E0NX 3MYBA 3OC7A 2VX2A 4JSBA 2BZRA 3PGQA 4JCRA 2WTBA 1HNUA 3K8XA 5CTCA 5INIA 1Q51A 4U0HA 4JYJA 2CBYA 2X58A 5JBWA 1HZDA 4QIIA 3GMAA 3SWXA 3STAA 2F6IA 1EF9A 1PJHA 4EMMA 1FC9A 2ZL4A 3NJDA 3GF7A 1PIXA 3MT6A 3QKAA 2UZFA 2W3PA 3BPPA 2J5SA 4ZDCA 2ZQRA 1ON9A 4MI2A 3P5MA 4QFEA 2J5II 1UYSA 1W2XA 4ASIA 1DUBA 3RSTA 2J5IB 3OMEA 1WDLA 3M6MA 4KD6A 1JXZA 2VSUF 3IB9A 3PEAA 5KDRA 3HINA 3I47A 2Q35A 4RYFH 5IKLB 3PZKA 3Q7HA 4L6WA 3ZWAA 2X24A 2VSSE 4DI1A 1FCFA 3KTHA 4JWVA 3H81A 2VSSF 2VSSA 1SG4A 5KDRB 3R9TA 4K3WA 5FIFA 3QXZA 1TG6A 1FC7A 2GTRA 2VSUE 1Y7OA 1OD4A 3KTGA 1UYRA 2FZSA 1XX4A 3QXIA 2F6QA 3TRRA 1N6EA 2J5IA 3ST9A 2D3TA 3H0SA 3ZWCA 4JOTA 5DU4A 1RJNA 3IAVA 3HE2A 1K39A 3R0OA 4ZDEA 4RYFA 2ZQQA 4B3JA 4KWBA 5FUSA 3RRVA 3LKEA 4ZDFA 3DORA 3K50A 1Q52A 2J5GD 1TYFA 4U1AA 4ZU2A 3HLN1 4OMRA 4JVTA 3IBBA 3NJBA 3ISAA 1XNYA 4QIJA 5G1QA 4L8KA 1HNOA 3P2LA 4U18A 1EY3A 2NP9A 3TT7A 3R9SA 3N6RB 2VSUC 1XNVA 4I42A 1FC6A 1UYVA 2A81A 4B3HA 5DL1A 4JJTA 4GHNA 3U9SB 2ZL0A 2DUBA 3LAOA 4F47A 1WDMA 1XNWA 4U0GH 3T89A 5INFA 3FF6A 3TV5A 4LK5A 3KTJA 4EMPA 5DKPA 4NNQA 3U9TB 4IZBA 1MJ3A 4OG1A 5CTBA 3TDCA 3L3SA 3V5IA 4JFCA 4Q0GA 3KQFA 4Q1IA 4FZWC 1RJMA 5G1SA 1N6FA 1WZ8A 2HW5A 2DEOA 2J5GA 4G2RA 4HNKA 3T3WA 2ZL2A 4ELSA 5MGBA 1DCIA 2ZL3A 2A7SA 5E0SH 2F9IB 5DUCA 2PBPA 4NEKA 3ZWBA 4FN7A 3G64A 1EF8A 4HC8A 5INGA 1XO6A 2F9IA 3QREA 4JCQA 3T88A 4EMLA 1UIYA 4FNBA 5DZKH 5DTPA 4RCNA 4JCTA 3FDUA 4U19A 3BF0A 4MXIA 3QMJA 1VRGA 1X0UA 4OLQA 3KTIA 1WDKA 3P85A 5G1RA 1NZYB 4MOUA 3H0UA 4FN8A 3H0JA 3TLFA 1NZYA 4U0GA 4IZCA 1SZOA 4IZDA 2QQ3A 3QYRA 2VREA 4K29A 3VIVA 3T8BA 2VSUA 3SLLA 1YG6A 5DUFA 4B3IA 2F9YA 4WZ8B 4GM2A 4YLHA 1ON3A 3Q0JA 4FB8A 3GF3A 3Q0GA 5JBXA 5KJPA 2F9YB 3HRXA 3WG5A 5DU8A 3QWDA 2FW2A 3KTKA 1O8UA 5DZKA 1UYTA
chains in the Genus database with same CATH superfamily
4I4ZA 5C90A 3DJAA 2CE3A 1OD2A 4Z0MA 4K2NA 3GLMA 3GKBA 3QK8A 3T8AA 3HP0A 1J7XA 4WYOB 2C8TA 4ELXA 2A7KA 4I52A 4FJWD 3ZW9A 3BPTA 5DTWA 4WCZA 3ZW8A 5DU6A 3H0QA 2FBMA 1YG8A 4ELWA 3U9RB 5E0SA 2EJ5A 3TT6A 1K32A 3R9QA 4ZDDA 3M6NA 2PPYA 2Q34A 4KNPA 3H02A 3OT6A 3TVWA 3RSIA 3TVUA 3R6HA 3Q1TA 5C9GA 4JYLA 2PG8A 3JU1A 4FZWA 2Q2XA 3V5EA 3MOYA 3MFMA 4ZDBA 4FNDA 4KPKA 3BEZA 4JCSA 3TZ3A 1N6DA 3PE8A 2IEXA 5E0NX 3MYBA 3OC7A 2VX2A 4JSBA 2BZRA 3PGQA 4JCRA 2WTBA 1HNUA 3K8XA 5CTCA 5INIA 1Q51A 4U0HA 4JYJA 2CBYA 2X58A 5JBWA 1HZDA 4QIIA 3GMAA 3SWXA 3STAA 2F6IA 1EF9A 1PJHA 4EMMA 1FC9A 2ZL4A 3NJDA 3GF7A 1PIXA 4NARA 3MT6A 3QKAA 2UZFA 2W3PA 3BPPA 2J5SA 4ZDCA 2ZQRA 1ON9A 4MI2A 3P5MA 4QFEA 2J5II 1UYSA 1W2XA 4ASIA 1DUBA 3RSTA 2J5IB 3OMEA 1WDLA 3M6MA 4KD6A 1JXZA 2VSUF 3IB9A 3PEAA 5KDRA 3HINA 3I47A 2Q35A 4RYFH 5IKLB 3PZKA 3Q7HA 4L6WA 3ZWAA 2X24A 2VSSE 4DI1A 1FCFA 3KTHA 4JWVA 3H81A 2VSSF 2VSSA 1SG4A 5KDRB 3R9TA 4K3WA 5FIFA 3QXZA 1TG6A 1FC7A 2GTRA 2VSUE 5HUQA 1Y7OA 1OD4A 3KTGA 1UYRA 2FZSA 1XX4A 3QXIA 2F6QA 3TRRA 1N6EA 2J5IA 3ST9A 2D3TA 3H0SA 3ZWCA 4JOTA 5DU4A 1RJNA 3IAVA 3HE2A 1K39A 3R0OA 4ZDEA 4RYFA 2ZQQA 4B3JA 4J2UA 4KWBA 5FUSA 3RRVA 3LKEA 4ZDFA 3DORA 3K50A 1Q52A 2J5GD 1TYFA 4U1AA 4ZU2A 3HLN1 4OMRA 4JVTA 3IBBA 3NJBA 3ISAA 2YJGA 1XNYA 4QIJA 5G1QA 4L8KA 1HNOA 3P2LA 4U18A 1EY3A 2NP9A 3TT7A 3R9SA 3N6RB 2VSUC 1XNVA 4I42A 1FC6A 1UYVA 2A81A 4B3HA 5DL1A 4JJTA 4GHNA 3U9SB 2ZL0A 2DUBA 3LAOA 4F47A 1WDMA 1XNWA 4U0GH 3T89A 4HDTA 5INFA 3FF6A 3TV5A 4LK5A 3KTJA 4EMPA 5DKPA 4NNQA 3U9TB 4IZBA 1MJ3A 4OG1A 5CTBA 3TDCA 3L3SA 3V5IA 4JFCA 4Q0GA 3KQFA 4Q1IA 4FZWC 1RJMA 5G1SA 1N6FA 1WZ8A 2HW5A 2DEOA 2J5GA 4G2RA 4HNKA 3T3WA 2ZL2A 4ELSA 5MGBA 1DCIA 2ZL3A 2A7SA 5E0SH 2F9IB 5DUCA 2PBPA 4NEKA 3ZWBA 4FN7A 3G64A 1EF8A 4HC8A 5INGA 1XO6A 2F9IA 3QREA 4JCQA 3T88A 4EMLA 1UIYA 4FNBA 5DZKH 5DTPA 4RCNA 4JCTA 3FDUA 4U19A 3BF0A 4MXIA 3QMJA 1VRGA 1X0UA 4OLQA 3KTIA 1WDKA 3P85A 5G1RA 1NZYB 4MOUA 3H0UA 4FN8A 3H0JA 3TLFA 1NZYA 4U0GA 4IZCA 1SZOA 4IZDA 2QQ3A 3QYRA 2VREA 4K29A 3VIVA 3T8BA 2VSUA 3SLLA 1YG6A 5DUFA 4B3IA 2F9YA 4WZ8B 4GM2A 4YLHA 1ON3A 3Q0JA 4FB8A 3GF3A 3Q0GA 5JBXA 5KJPA 2F9YB 3HRXA 3WG5A 5DU8A 3QWDA 2FW2A 3KTKA 1O8UA 5DZKA 1UYTA
chains in the Genus database with same CATH topology
4I4ZA 5C90A 3DJAA 2CE3A 1OD2A 4Z0MA 4K2NA 3GLMA 3GKBA 3QK8A 3T8AA 3HP0A 1J7XA 4WYOB 2C8TA 4ELXA 2A7KA 4I52A 4FJWD 3ZW9A 3BPTA 5DTWA 4WCZA 3ZW8A 5DU6A 3H0QA 2FBMA 1YG8A 4ELWA 3U9RB 5E0SA 2EJ5A 3TT6A 1K32A 3R9QA 4ZDDA 3M6NA 2PPYA 2Q34A 4KNPA 3H02A 3OT6A 3TVWA 3RSIA 3TVUA 3R6HA 3Q1TA 5C9GA 4JYLA 2PG8A 3JU1A 4FZWA 2Q2XA 3V5EA 3MOYA 3MFMA 4ZDBA 4FNDA 4KPKA 3BEZA 4JCSA 3TZ3A 1N6DA 3PE8A 2IEXA 5E0NX 3MYBA 3OC7A 2VX2A 4JSBA 2BZRA 3PGQA 4JCRA 2WTBA 1HNUA 3K8XA 5CTCA 5INIA 1Q51A 4U0HA 4JYJA 2CBYA 2X58A 5JBWA 1HZDA 4QIIA 3GMAA 3SWXA 3STAA 2F6IA 1EF9A 1PJHA 4EMMA 1FC9A 2ZL4A 3NJDA 3GF7A 1PIXA 4NARA 3MT6A 3QKAA 2UZFA 2W3PA 3BPPA 2J5SA 4ZDCA 2ZQRA 1ON9A 4MI2A 3P5MA 4QFEA 2J5II 1UYSA 1W2XA 4ASIA 1DUBA 3RSTA 2J5IB 3OMEA 1WDLA 3M6MA 4KD6A 1JXZA 2VSUF 3IB9A 3PEAA 5KDRA 3HINA 3I47A 2Q35A 4RYFH 5IKLB 3PZKA 3Q7HA 4L6WA 3ZWAA 2X24A 2VSSE 4DI1A 1FCFA 3KTHA 4JWVA 3H81A 2VSSF 2VSSA 1SG4A 5KDRB 3R9TA 4K3WA 5FIFA 3QXZA 1TG6A 1FC7A 2GTRA 2VSUE 5HUQA 1Y7OA 1OD4A 3KTGA 1UYRA 2FZSA 1XX4A 3QXIA 2F6QA 3TRRA 1N6EA 2J5IA 3ST9A 2D3TA 3H0SA 3ZWCA 4JOTA 5DU4A 1RJNA 3IAVA 3HE2A 1K39A 3R0OA 4ZDEA 4RYFA 2ZQQA 4B3JA 4J2UA 4KWBA 5FUSA 3RRVA 3LKEA 4ZDFA 3DORA 3K50A 1Q52A 2J5GD 1TYFA 4U1AA 4ZU2A 3HLN1 4OMRA 4JVTA 3IBBA 3NJBA 3ISAA 2YJGA 1XNYA 4QIJA 5G1QA 4L8KA 1HNOA 3P2LA 4U18A 1EY3A 2NP9A 3TT7A 3R9SA 3N6RB 2VSUC 1XNVA 4I42A 1FC6A 1UYVA 2A81A 4B3HA 5DL1A 4JJTA 4GHNA 3U9SB 2ZL0A 2DUBA 3LAOA 4F47A 1WDMA 1XNWA 4U0GH 3T89A 4HDTA 5INFA 3FF6A 3TV5A 4LK5A 3KTJA 4EMPA 5DKPA 4NNQA 3U9TB 4IZBA 1MJ3A 4OG1A 5CTBA 3TDCA 3L3SA 3V5IA 4JFCA 4Q0GA 3KQFA 4Q1IA 4FZWC 1RJMA 5G1SA 1N6FA 1WZ8A 2HW5A 2DEOA 2J5GA 4G2RA 4HNKA 3T3WA 2ZL2A 4ELSA 5MGBA 1DCIA 2ZL3A 2A7SA 5E0SH 2F9IB 5DUCA 2PBPA 4NEKA 3ZWBA 4FN7A 3G64A 1EF8A 4HC8A 5INGA 1XO6A 2F9IA 3QREA 4JCQA 3T88A 4EMLA 1UIYA 4FNBA 5DZKH 5DTPA 4RCNA 4JCTA 3FDUA 4U19A 3BF0A 4MXIA 3QMJA 1VRGA 1X0UA 4OLQA 3KTIA 1WDKA 3P85A 5G1RA 1NZYB 4MOUA 3H0UA 4FN8A 3H0JA 3TLFA 1NZYA 4U0GA 4IZCA 1SZOA 4IZDA 2QQ3A 3QYRA 2VREA 4K29A 3VIVA 3T8BA 2VSUA 3SLLA 1YG6A 5DUFA 4B3IA 2F9YA 4WZ8B 4GM2A 4YLHA 1ON3A 3Q0JA 4FB8A 3GF3A 3Q0GA 5JBXA 5KJPA 2F9YB 3HRXA 3WG5A 5DU8A 3QWDA 2FW2A 3KTKA 1O8UA 5DZKA 1UYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I4Z A;  5C90 A;  3DJA A;  2CE3 A;  1OD2 A;  4Z0M A;  4K2N A;  3GLM A;  3GKB A;  3QK8 A;  3T8A A;  3HP0 A;  1J7X A;  4WYO B;  2C8T A;  4ELX A;  2A7K A;  4I52 A;  4FJW D;  3ZW9 A;  5DTW A;  4WCZ A;  3ZW8 A;  5DU6 A;  3H0Q A;  2FBM A;  1YG8 A;  4ELW A;  3U9R B;  5E0S A;  2EJ5 A;  3TT6 A;  1K32 A;  3R9Q A;  4ZDD A;  3M6N A;  2PPY A;  2Q34 A;  4KNP A;  3H02 A;  3OT6 A;  3TVW A;  3RSI A;  3TVU A;  3R6H A;  3Q1T A;  5C9G A;  4JYL A;  2PG8 A;  3JU1 A;  4FZW A;  2Q2X A;  3V5E A;  3MOY A;  3MFM A;  4ZDB A;  4FND A;  4KPK A;  3BEZ A;  4JCS A;  3TZ3 A;  1N6D A;  3PE8 A;  2IEX A;  5E0N X;  3MYB A;  3OC7 A;  2VX2 A;  4JSB A;  2BZR A;  3PGQ A;  4JCR A;  2WTB A;  1HNU A;  3K8X A;  5CTC A;  5INI A;  1Q51 A;  4U0H A;  4JYJ A;  2CBY A;  2X58 A;  5JBW A;  1HZD A;  4QII A;  3GMA A;  3SWX A;  3STA A;  2F6I A;  1EF9 A;  1PJH A;  4EMM A;  1FC9 A;  2ZL4 A;  3NJD A;  3GF7 A;  1PIX A;  3MT6 A;  3QKA A;  2UZF A;  2W3P A;  3BPP A;  2J5S A;  4ZDC A;  2ZQR A;  1ON9 A;  4MI2 A;  3P5M A;  4QFE A;  2J5I I;  1UYS A;  1W2X A;  4ASI A;  1DUB A;  3RST A;  2J5I B;  3OME A;  1WDL A;  3M6M A;  4KD6 A;  1JXZ A;  2VSU F;  3IB9 A;  3PEA A;  5KDR A;  3HIN A;  3I47 A;  2Q35 A;  4RYF H;  5IKL B;  3PZK A;  3Q7H A;  4L6W A;  3ZWA A;  2X24 A;  2VSS E;  4DI1 A;  1FCF A;  3KTH A;  4JWV A;  3H81 A;  2VSS F;  2VSS A;  1SG4 A;  5KDR B;  3R9T A;  4K3W A;  5FIF A;  3QXZ A;  1TG6 A;  1FC7 A;  2GTR A;  2VSU E;  1Y7O A;  1OD4 A;  3KTG A;  1UYR A;  2FZS A;  1XX4 A;  3QXI A;  2F6Q A;  3TRR A;  1N6E A;  2J5I A;  3ST9 A;  2D3T A;  3H0S A;  3ZWC A;  4JOT A;  5DU4 A;  1RJN A;  3IAV A;  3HE2 A;  1K39 A;  3R0O A;  4ZDE A;  4RYF A;  2ZQQ A;  4B3J A;  4KWB A;  5FUS A;  3RRV A;  3LKE A;  4ZDF A;  3DOR A;  3K50 A;  1Q52 A;  2J5G D;  1TYF A;  4U1A A;  4ZU2 A;  3HLN 1;  4OMR A;  4JVT A;  3IBB A;  3NJB A;  3ISA A;  1XNY A;  4QIJ A;  5G1Q A;  4L8K A;  1HNO A;  3P2L A;  4U18 A;  1EY3 A;  2NP9 A;  3TT7 A;  3R9S A;  3N6R B;  2VSU C;  1XNV A;  4I42 A;  1FC6 A;  1UYV A;  2A81 A;  4B3H A;  5DL1 A;  4JJT A;  4GHN A;  3U9S B;  2ZL0 A;  2DUB A;  3LAO A;  4F47 A;  1WDM A;  1XNW A;  4U0G H;  3T89 A;  5INF A;  3FF6 A;  3TV5 A;  4LK5 A;  3KTJ A;  4EMP A;  5DKP A;  4NNQ A;  3U9T B;  4IZB A;  1MJ3 A;  4OG1 A;  5CTB A;  3TDC A;  3L3S A;  3V5I A;  4JFC A;  4Q0G A;  3KQF A;  4Q1I A;  4FZW C;  1RJM A;  5G1S A;  1N6F A;  1WZ8 A;  2HW5 A;  2DEO A;  2J5G A;  4G2R A;  4HNK A;  3T3W A;  2ZL2 A;  4ELS A;  5MGB A;  1DCI A;  2ZL3 A;  2A7S A;  5E0S H;  2F9I B;  5DUC A;  2PBP A;  4NEK A;  3ZWB A;  4FN7 A;  3G64 A;  1EF8 A;  4HC8 A;  5ING A;  1XO6 A;  2F9I A;  3QRE A;  4JCQ A;  3T88 A;  4EML A;  1UIY A;  4FNB A;  5DZK H;  5DTP A;  4RCN A;  4JCT A;  3FDU A;  4U19 A;  3BF0 A;  4MXI A;  3QMJ A;  1VRG A;  1X0U A;  4OLQ A;  3KTI A;  1WDK A;  3P85 A;  5G1R A;  1NZY B;  4MOU A;  3H0U A;  4FN8 A;  3H0J A;  3TLF A;  1NZY A;  4U0G A;  4IZC A;  1SZO A;  4IZD A;  2QQ3 A;  3QYR A;  2VRE A;  4K29 A;  3VIV A;  3T8B A;  2VSU A;  3SLL A;  1YG6 A;  5DUF A;  4B3I A;  2F9Y A;  4WZ8 B;  4GM2 A;  4YLH A;  1ON3 A;  3Q0J A;  4FB8 A;  3GF3 A;  3Q0G A;  5JBX A;  5KJP A;  2F9Y B;  3HRX A;  3WG5 A;  5DU8 A;  3QWD A;  2FW2 A;  3KTK A;  1O8U A;  5DZK A;  1UYT A; 
#chains in the Genus database with same CATH topology
 4I4Z A;  5C90 A;  3DJA A;  2CE3 A;  1OD2 A;  4Z0M A;  4K2N A;  3GLM A;  3GKB A;  3QK8 A;  3T8A A;  3HP0 A;  1J7X A;  4WYO B;  2C8T A;  4ELX A;  2A7K A;  4I52 A;  4FJW D;  3ZW9 A;  3BPT A;  5DTW A;  4WCZ A;  3ZW8 A;  5DU6 A;  3H0Q A;  2FBM A;  1YG8 A;  4ELW A;  3U9R B;  5E0S A;  2EJ5 A;  3TT6 A;  1K32 A;  3R9Q A;  4ZDD A;  3M6N A;  2PPY A;  2Q34 A;  4KNP A;  3H02 A;  3OT6 A;  3TVW A;  3RSI A;  3TVU A;  3R6H A;  3Q1T A;  5C9G A;  4JYL A;  2PG8 A;  3JU1 A;  4FZW A;  2Q2X A;  3V5E A;  3MOY A;  3MFM A;  4ZDB A;  4FND A;  4KPK A;  3BEZ A;  4JCS A;  3TZ3 A;  1N6D A;  3PE8 A;  2IEX A;  5E0N X;  3MYB A;  3OC7 A;  2VX2 A;  4JSB A;  2BZR A;  3PGQ A;  4JCR A;  2WTB A;  1HNU A;  3K8X A;  5CTC A;  5INI A;  1Q51 A;  4U0H A;  4JYJ A;  2CBY A;  2X58 A;  5JBW A;  1HZD A;  4QII A;  3GMA A;  3SWX A;  3STA A;  2F6I A;  1EF9 A;  1PJH A;  4EMM A;  1FC9 A;  2ZL4 A;  3NJD A;  3GF7 A;  1PIX A;  4NAR A;  3MT6 A;  3QKA A;  2UZF A;  2W3P A;  3BPP A;  2J5S A;  4ZDC A;  2ZQR A;  1ON9 A;  4MI2 A;  3P5M A;  4QFE A;  2J5I I;  1UYS A;  1W2X A;  4ASI A;  1DUB A;  3RST A;  2J5I B;  3OME A;  1WDL A;  3M6M A;  4KD6 A;  1JXZ A;  2VSU F;  3IB9 A;  3PEA A;  5KDR A;  3HIN A;  3I47 A;  2Q35 A;  4RYF H;  5IKL B;  3PZK A;  3Q7H A;  4L6W A;  3ZWA A;  2X24 A;  2VSS E;  4DI1 A;  1FCF A;  3KTH A;  4JWV A;  3H81 A;  2VSS F;  2VSS A;  1SG4 A;  5KDR B;  3R9T A;  4K3W A;  5FIF A;  3QXZ A;  1TG6 A;  1FC7 A;  2GTR A;  2VSU E;  5HUQ A;  1Y7O A;  1OD4 A;  3KTG A;  1UYR A;  2FZS A;  1XX4 A;  3QXI A;  2F6Q A;  3TRR A;  1N6E A;  2J5I A;  3ST9 A;  2D3T A;  3H0S A;  3ZWC A;  4JOT A;  5DU4 A;  1RJN A;  3IAV A;  3HE2 A;  1K39 A;  3R0O A;  4ZDE A;  4RYF A;  2ZQQ A;  4B3J A;  4J2U A;  4KWB A;  5FUS A;  3RRV A;  3LKE A;  4ZDF A;  3DOR A;  3K50 A;  1Q52 A;  2J5G D;  1TYF A;  4U1A A;  4ZU2 A;  3HLN 1;  4OMR A;  4JVT A;  3IBB A;  3NJB A;  3ISA A;  2YJG A;  1XNY A;  4QIJ A;  5G1Q A;  4L8K A;  1HNO A;  3P2L A;  4U18 A;  1EY3 A;  2NP9 A;  3TT7 A;  3R9S A;  3N6R B;  2VSU C;  1XNV A;  4I42 A;  1FC6 A;  1UYV A;  2A81 A;  4B3H A;  5DL1 A;  4JJT A;  4GHN A;  3U9S B;  2ZL0 A;  2DUB A;  3LAO A;  4F47 A;  1WDM A;  1XNW A;  4U0G H;  3T89 A;  4HDT A;  5INF A;  3FF6 A;  3TV5 A;  4LK5 A;  3KTJ A;  4EMP A;  5DKP A;  4NNQ A;  3U9T B;  4IZB A;  1MJ3 A;  4OG1 A;  5CTB A;  3TDC A;  3L3S A;  3V5I A;  4JFC A;  4Q0G A;  3KQF A;  4Q1I A;  4FZW C;  1RJM A;  5G1S A;  1N6F A;  1WZ8 A;  2HW5 A;  2DEO A;  2J5G A;  4G2R A;  4HNK A;  3T3W A;  2ZL2 A;  4ELS A;  5MGB A;  1DCI A;  2ZL3 A;  2A7S A;  5E0S H;  2F9I B;  5DUC A;  2PBP A;  4NEK A;  3ZWB A;  4FN7 A;  3G64 A;  1EF8 A;  4HC8 A;  5ING A;  1XO6 A;  2F9I A;  3QRE A;  4JCQ A;  3T88 A;  4EML A;  1UIY A;  4FNB A;  5DZK H;  5DTP A;  4RCN A;  4JCT A;  3FDU A;  4U19 A;  3BF0 A;  4MXI A;  3QMJ A;  1VRG A;  1X0U A;  4OLQ A;  3KTI A;  1WDK A;  3P85 A;  5G1R A;  1NZY B;  4MOU A;  3H0U A;  4FN8 A;  3H0J A;  3TLF A;  1NZY A;  4U0G A;  4IZC A;  1SZO A;  4IZD A;  2QQ3 A;  3QYR A;  2VRE A;  4K29 A;  3VIV A;  3T8B A;  2VSU A;  3SLL A;  1YG6 A;  5DUF A;  4B3I A;  2F9Y A;  4WZ8 B;  4GM2 A;  4YLH A;  1ON3 A;  3Q0J A;  4FB8 A;  3GF3 A;  3Q0G A;  5JBX A;  5KJP A;  2F9Y B;  3HRX A;  3WG5 A;  5DU8 A;  3QWD A;  2FW2 A;  3KTK A;  1O8U A;  5DZK A;  1UYT A; 
#chains in the Genus database with same CATH homology
 4I4Z A;  5C90 A;  3DJA A;  2CE3 A;  1OD2 A;  4Z0M A;  4K2N A;  3GLM A;  3GKB A;  3QK8 A;  3T8A A;  3HP0 A;  1J7X A;  4WYO B;  2C8T A;  4ELX A;  2A7K A;  4I52 A;  4FJW D;  3ZW9 A;  3BPT A;  5DTW A;  4WCZ A;  3ZW8 A;  5DU6 A;  3H0Q A;  2FBM A;  1YG8 A;  4ELW A;  3U9R B;  5E0S A;  2EJ5 A;  3TT6 A;  1K32 A;  3R9Q A;  4ZDD A;  3M6N A;  2PPY A;  2Q34 A;  4KNP A;  3H02 A;  3OT6 A;  3TVW A;  3RSI A;  3TVU A;  3R6H A;  3Q1T A;  5C9G A;  4JYL A;  2PG8 A;  3JU1 A;  4FZW A;  2Q2X A;  3V5E A;  3MOY A;  3MFM A;  4ZDB A;  4FND A;  4KPK A;  3BEZ A;  4JCS A;  3TZ3 A;  1N6D A;  3PE8 A;  2IEX A;  5E0N X;  3MYB A;  3OC7 A;  2VX2 A;  4JSB A;  2BZR A;  3PGQ A;  4JCR A;  2WTB A;  1HNU A;  3K8X A;  5CTC A;  5INI A;  1Q51 A;  4U0H A;  4JYJ A;  2CBY A;  2X58 A;  5JBW A;  1HZD A;  4QII A;  3GMA A;  3SWX A;  3STA A;  2F6I A;  1EF9 A;  1PJH A;  4EMM A;  1FC9 A;  2ZL4 A;  3NJD A;  3GF7 A;  1PIX A;  4NAR A;  3MT6 A;  3QKA A;  2UZF A;  2W3P A;  3BPP A;  2J5S A;  4ZDC A;  2ZQR A;  1ON9 A;  4MI2 A;  3P5M A;  4QFE A;  2J5I I;  1UYS A;  1W2X A;  4ASI A;  1DUB A;  3RST A;  2J5I B;  3OME A;  1WDL A;  3M6M A;  4KD6 A;  1JXZ A;  2VSU F;  3IB9 A;  3PEA A;  5KDR A;  3HIN A;  3I47 A;  2Q35 A;  4RYF H;  5IKL B;  3PZK A;  3Q7H A;  4L6W A;  3ZWA A;  2X24 A;  2VSS E;  4DI1 A;  1FCF A;  3KTH A;  4JWV A;  3H81 A;  2VSS F;  2VSS A;  1SG4 A;  5KDR B;  3R9T A;  4K3W A;  5FIF A;  3QXZ A;  1TG6 A;  1FC7 A;  2GTR A;  2VSU E;  5HUQ A;  1Y7O A;  1OD4 A;  3KTG A;  1UYR A;  2FZS A;  1XX4 A;  3QXI A;  2F6Q A;  3TRR A;  1N6E A;  2J5I A;  3ST9 A;  2D3T A;  3H0S A;  3ZWC A;  4JOT A;  5DU4 A;  1RJN A;  3IAV A;  3HE2 A;  1K39 A;  3R0O A;  4ZDE A;  4RYF A;  2ZQQ A;  4B3J A;  4J2U A;  4KWB A;  5FUS A;  3RRV A;  3LKE A;  4ZDF A;  3DOR A;  3K50 A;  1Q52 A;  2J5G D;  1TYF A;  4U1A A;  4ZU2 A;  3HLN 1;  4OMR A;  4JVT A;  3IBB A;  3NJB A;  3ISA A;  2YJG A;  1XNY A;  4QIJ A;  5G1Q A;  4L8K A;  1HNO A;  3P2L A;  4U18 A;  1EY3 A;  2NP9 A;  3TT7 A;  3R9S A;  3N6R B;  2VSU C;  1XNV A;  4I42 A;  1FC6 A;  1UYV A;  2A81 A;  4B3H A;  5DL1 A;  4JJT A;  4GHN A;  3U9S B;  2ZL0 A;  2DUB A;  3LAO A;  4F47 A;  1WDM A;  1XNW A;  4U0G H;  3T89 A;  4HDT A;  5INF A;  3FF6 A;  3TV5 A;  4LK5 A;  3KTJ A;  4EMP A;  5DKP A;  4NNQ A;  3U9T B;  4IZB A;  1MJ3 A;  4OG1 A;  5CTB A;  3TDC A;  3L3S A;  3V5I A;  4JFC A;  4Q0G A;  3KQF A;  4Q1I A;  4FZW C;  1RJM A;  5G1S A;  1N6F A;  1WZ8 A;  2HW5 A;  2DEO A;  2J5G A;  4G2R A;  4HNK A;  3T3W A;  2ZL2 A;  4ELS A;  5MGB A;  1DCI A;  2ZL3 A;  2A7S A;  5E0S H;  2F9I B;  5DUC A;  2PBP A;  4NEK A;  3ZWB A;  4FN7 A;  3G64 A;  1EF8 A;  4HC8 A;  5ING A;  1XO6 A;  2F9I A;  3QRE A;  4JCQ A;  3T88 A;  4EML A;  1UIY A;  4FNB A;  5DZK H;  5DTP A;  4RCN A;  4JCT A;  3FDU A;  4U19 A;  3BF0 A;  4MXI A;  3QMJ A;  1VRG A;  1X0U A;  4OLQ A;  3KTI A;  1WDK A;  3P85 A;  5G1R A;  1NZY B;  4MOU A;  3H0U A;  4FN8 A;  3H0J A;  3TLF A;  1NZY A;  4U0G A;  4IZC A;  1SZO A;  4IZD A;  2QQ3 A;  3QYR A;  2VRE A;  4K29 A;  3VIV A;  3T8B A;  2VSU A;  3SLL A;  1YG6 A;  5DUF A;  4B3I A;  2F9Y A;  4WZ8 B;  4GM2 A;  4YLH A;  1ON3 A;  3Q0J A;  4FB8 A;  3GF3 A;  3Q0G A;  5JBX A;  5KJP A;  2F9Y B;  3HRX A;  3WG5 A;  5DU8 A;  3QWD A;  2FW2 A;  3KTK A;  1O8U A;  5DZK A;  1UYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...