3QWFA

Crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
261
structure length
261
Chain Sequence
TYIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies on a Fungal 17Beta-Hydroxysteroid Dehydrogenase
pubmed doi rcsb
source organism Cochliobolus lunatus
molecule tags Oxidoreductase
molecule keywords 17beta-hydroxysteroid dehydrogenase
total genus 104
structure length 261
sequence length 261
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qwfA00
4NJMA 2J3IA 3U49A 4U8GA 4EEXA 1A9YA 3LQFA 1R37A 4YT5A 1E7QA 1I2ZA 1HE2A 3FD8A 2C7GA 1GL3A 3L6DA 4I08A 2YW9A 1VJ0A 5A3VA 1U28A 5FEUA 5CDUA 1XWFA 3QVTA 1QV6A 4ID9A 4LGVA 1B8PA 2H63A 3M1AA 1C1XB 3VKUA 2AQHA 1XQ6A 4LMRA 3ZU2A 2PD4A 3KYCB 4XX0A 3R1IA 1IE3A 4BNYA 3WS7A 1B8UA 4BNTA 4OGWA 4MKXA 2IEBA 4XB2A 3R0IA 1YKFA 3ETEA 1XQ1A 2X6TA 1ZVMA 1LJ8A 1K6JA 3I23A 3TL2A 1ZK0A 4Z0PA 4CMBA 3F6YA 1HWYA 1E1KA 3DTYA 2QRLA 4IS2A 2BLLA 4PZDA 2O48X 3MOIA 1WDMA 2BF7A 3TZ6A 1C0KA 3QE3A 1QLHA 4OOEA 3LLVA 1YB1A 1WZIA 2EGGA 2OORA 4LMPA 5A05A 1GZ3A 1EVZA 4CV0A 1W4ZA 3LC7O 1QV7A 4JROA 3ICCA 3ZNNA 3W6UA 4Q9NA 3TSCA 1ARZA 3PRJA 5TGDA 3Q9UA 1A7AA 1KEUA 3LT1A 4AJJA 1TXGA 5FFFA 2RAFA 5ILGA 5T8KA 3PYLA 1DC6A 2AMFA 4O63O 4Z0HO 4WNIA 2GN6A 4GSKA 4HV4A 4ND1A 2Y0EA 4N5MA 4YPOA 1GU7A 3BYZA 1C0LA 1GD1O 3ZWNA 1I3LA 4BNUA 3RU7A 3INGA 1UR5A 1ID1A 1WAMA 3JYOA 3JTMA 4LCEA 2DLDA 3HFGA 3NEPX 3U4IA 3IMFA 2W98A 2DKNA 5G4LA 4D3SA 1R12A 1ZK2A 3QVWA 2NQ8A 4H3VA 2DUUA 5JCJA 5F21A 4ALLA 4BVAA 3VPXA 2PY6A 1I3NA 4FGWA 4BMVA 4WOJA 3DAFA 3TNLA 4DL9A 4EUEA 3IAHA 2WD8A 3DMTC 3GEMA 5CDYA 2Q4EA 4CLOA 3TFOA 2VYVD 2WYWA 2CF6A 1PJQA 1GPJA 3B1KA 2NUAA 5IZCA 4L76A 5JSFA 1ZCJA 1HDRA 5K9ZA 3CZRA 2UAGA 1JLLA 3I9NA 4R9SA 3I9KA 4C7KA 2W2KB 2VHWA 4PLGA 4IJUA 1OC2A 1LUAA 2VCYA 1Y8QA 4L0QA 1ADFA 2E6UX 3MWDB 3QWHA 4U6QA 4XEHA 5TS3A 3HFSA 1WDLA 4YAGA 5EESA 1R0KA 5KJ6A 4Z9XA 1KVTA 2B37A 4IIVA 3WOHA 4RVFA 4CMEC 5MGBA 4ZU3A 2FR8A 1EMDA 2GSDA 2HU2A 2CUKA 3PWSA 5JAIA 2ZIZA 3QLJA 3DOCA 2X5KO 3HG7A 5I7EA 5I7SA 1F06A 4BB6A 4J9UE 5CEJA 1VL8A 3ZV3A 3BMCB 4R3NA 3HZZA 3WBBA 4G65A 3P2OA 4W4TA 3RBZA 3M6IA 3EDMA 4NFYA 4DQVA 1HLPA 4E31A 3VH1A 3K96A 4Z0TA 4BNLA 2YYYA 4I5FA 3ITKA 1ZMTA 2XAAA 3WG9A 1YWGO 4RCVA 1P1KA 3E1KA 4E5MA 4IXTA 5BSEA 4YJHB 3FBGA 4Y6SA 4J2HA 5I9NA 4BO9A 3F5QA 1DIAA 3PJDA 3NGLA 4MVJD 4U6SA 1LQUA 5U4QA 4FFNA 3PIIA 1E3SA 4JNKA 4DC0A 3BTUA 4GX1A 1PGQA 3N74A 4J6FA 4BGEA 2OL4A 4IDFA 3VZRA 5G0SA 2I5PO 2GERA 5TSDA 1Q0QA 1B7GO 5KJFA 2C5AA 3I6QA 4FB5A 4XA8A 1T1RA 1T2AA 2EEZA 4I9HA 3ZV5A 5JYEA 3VH2A 2VTEA 3GHYA 4NR0A 1RM0A 4ITUA 1TT5A 2VYND 3JQ9A 3QVOA 5ITWA 3HSKA 4D3DA 1E3WA 4WECA 3GPIA 4J4HA 2EJWA 1DLJA 5I7FA 3MJ4A 4J90A 4BL5A 1E3JA 1CQJA 1GFSA 4NBTA 4MVJM 1UZLA 3F1KA 3PEFA 3EY4A 2AE2A 2JCYA 1TA4A 5FF9A 2V65A 4CMHA 3WR5A 4E21A 2ZTLA 1KY4A 1U3WA 2GLXA 4AFNA 1Y7TA 2NLOA 3LZ6A 4Q3EA 2X0JA 4UUPA 1RM5A 1M66A 2QHXA 4XQGA 4BKUA 1LSJA 1ZSVA 1J6UA 1ZZEA 3NUGA 4YA6A 2ZK7A 1ONOA 4QQRA 5DT9A 2PD6A 1M67A 4MVJP 3VTZA 3ZHYA 2ZTVA 4JXKA 4DIFA 4W99A 2B4QA 2FOIA 2VHYA 3DWFA 3PK0A 2EP7A 4XDZA 3FCOA 3KEOA 1HXHA 1VE9A 1E7YA 3PZBA 3W6ZA 4CM1A 3OH8A 1IHYA 2PKRA 3HDYA 5L4SA 3K6JA 1GADO 4UUMA 3JD3A 1JW9B 2EKQA 2TMDA 2G5CA 3ZNPA 3MJTA 3GEGA 3H65A 4B8WA 3WTBA 4CMKA 3MJSA 4D45A 2H6EA 5KCZA 2BHLA 5JFOA 4RPKA 5EINA 4A03A 2Q1TA 4AJPA 4ND3A 4KDFA 2YV3A 5EQDA 2O4UX 2TMGA 2B0JA 4OL9A 1FDTA 3KBOA 1LC0A 2IYOA 2BKAA 4LISA 3OEWA 3A4VA 4KUGA 2G82A 1T4BA 4FFOA 4OXYA 1U7TA 1PR3A 3IP3A 1LBEA 3K31A 5T64A 1GV0A 5IFLA 1N7GA 4J3FA 1J4AA 3D5TA 4CV3A 5BNTA 3LC1O 4IQ0A 1L7DA 2HK8A 4WEQA 2W2LD 3NDJA 3G79A 1QYCA 1VI2A 2PD3A 5I8WA 1KERA 1NP3A 5JDIC 4U5QA 3MEQA 1ZNQO 2IODA 4GMFA 3BTVA 2D3TA 3FNEA 4BV8A 2YHUA 1U3UA 4JIGA 3O9ZA 4N5LA 1YDWA 1UXKA 3DAPA 1MC5A 2J5QA 3EC7A 1B8VA 3JYLA 3BXXA 4YT8A 1QXSA 4WEOA 4MOWA 1NR7A 2VWHA 1E77A 1ORRA 4D46A 1J5PA 4AG3A 4ALMA 4BO4A 3GG9A 3OETA 4W9NA 3I1JA 4ZHSA 2CDCA 1LSOA 1D3AA 4D0RA 4E5KA 1U1IA 3HHPA 2GRAA 3NTQA 3FR7A 2WEKA 3AOGA 2GASA 1V3VA 1WMAA 3BMQA 3ZNOA 1P1HA 2PR2A 3OF2A 1I8TA 3SLGA 1ZFNA 4DBZA 2NU9A 4B4WA 3KB6A 4OMUA 3PI7A 3OA0A 4Q3BA 4PG4A 1ZO8A 2WYVA 1PS8A 4CM6A 3PXXA 2X8LA 4DIBA 3OJOA 3GG2A 2G76A 4B3IA 3M2TA 2JD1A 4W82A 2W2KA 3GC6A 4LCJA 4TRMA 5KKAA 1LC3A 3ZH2A 3S2EA 4XJTA 4C4OA 3QVXA 2X23A 3DZIA 3D0OA 4QTZA 1YB4A 4FOOA 1AUPA 1QG6A 1ZW1A 3F46A 5CEFA 1ISHA 3WJAA 1ZH8A 1N1EA 4CL8A 4CL3A 4ZQBA 4GGOA 2D2IA 2RCYA 4IY1A 4KP7A 4UEKA 4R69A 1ISJA 4LK3A 1YVEI 5A9SA 2FZWA 4IJVA 1WWKA 3I9MA 3JQCA 3Q6IA 4NI5A 3COSA 3NTOA 5BQFA 1GPDG 4J7CA 3NTRA 3WWZA 4CLRB 2ZQYA 4IJWA 5B37A 1YBAA 3HNPA 2YDXA 2PGLA 2YQ5A 5AOVA 1SPXA 2O23A 1BG6A 1C1DB 4B4OA 4TROA 3ZWCA 3FF4A 4YDRA 3FNGA 1ONPA 4UVEA 4PLFA 4XIJA 3DBRA 2GNAA 2PLAA 1X0XA 3BTSA 4AL4A 4XR9A 3AJRA 4BKRA 3KSUA 2R2GA 3S2GA 3JQ7A 1ZK4A 3DZHA 3LT4A 5B4TA 3R3SA 4KDEA 4PGFA 4HY3A 3WJ7A 4J1QA 5JPIA 1O95A 3JD2A 3NKLA 3TWOA 4YRDA 3RJ5A 5K0ZA 2ET6A 1DEHA 4NBUA 4P8RA 1GUFA 1X0VA 3PGJA 4QX6A 2Q1SA 3RC9A 2HMWA 4FOSA 5G0TA 1SCUA 4DIOA 2F1KA 3WGQA 1GEEA 1VL0A 1C3VA 1NFFA 4Q3CA 4ND2A 4NBWA 3INTA 1YJ8A 2X86A 4FGSA 5LDGA 2A94A 1AXEA 1IPEA 4DTIA 5IZ4A 3OMLA 5JCJD 3JQFC 5BNFA 2PGDA 3H5NA 4HFJA 1U4OA 3WGHA 4J91A 3JQBC 3H2SA 2OO5A 4P38A 4IXWA 1R15A 2PZJA 1I32A 5AYVA 1SOVA 1HE3A 3OHSX 3UAGA 5K6AA 5F5LA 4NK5A 1KOLA 3NT4A 5IJZA 1Z45A 3HJAA 3GNSA 5C37A 3IL2A 4EDFA 2EJVA 2GGSA 3HB5X 4RQTA 1HE5A 4Y67A 1NTOA 4AJKA 4ND5A 2A4KA 1P0FA 3GQVA 3GZNB 4MKRA 1JKFA 4IMPA 3RKRA 4WGGA 3GFBA 5B4UA 4GKVA 4WJZA 3D1LA 3L4BC 2X22A 3E9MA 1PR9A 3NV9A 3WGGA 4AJHA 1U3VA 5TJHA 3OSUA 7MDHA 4TVBA 5L9AA 1ZMOA 3EK2A 3N58A 1SB8A 4DWVA 3WFJA 4MVJI 4CM7A 1QMGA 4FFMA 2PZKA 2C82A 1PJSA 1EUZA 1Y81A 5JY1A 1UH5A 3RC1A 1VL6A 4II3A 2ZQZA 3WGYA 4CLDA 3CMCO 3UCFA 2BFMA 2PH3A 4AJ4A 1T25A 4MO2A 2R00A 1R6DA 2AXQA 2VOJA 3B70A 4HFMA 4IGEA 2IZ0A 4IZIA 1HYEA 4LW8A 3L9XA 5C7OO 5HWSA 4CQLB 2HO5A 1GEGA 4KTVE 1WLYA 1T1SA 2VUSA 3C8MA 3ZWXA 4MKZA 2C2YA 3BHMA 1PJCA 1R4MA 1LDMA 3GVIA 5I9LA 3RIHA 5KWEA 4INAA 4L4SA 3GDOA 4GLOA 3C7DB 4GX2A 4HNHA 1LRJA 5HS4A 4JLWA 3NGXA 5JCXA 3RKUA 3OJEA 3TOXA 1U5CA 1H6AA 4KWIA 3GR6A 3T4EA 3FN4A 1LLCA 2HSDA 3VZQA 1LDBA 5FI5A 4JBIA 1HL3A 2OHXA 1NASA 1E7MA 1NNUA 5DCUA 1Y5RA 2YZ7A 3DZGA 1J0XO 4AJOA 4FW8A 2QYSA 1JU9A 1WXDA 2XOXA 2Z1NA 1W6UA 1H6CA 3DZJA 4TVOA 4MINA 4E30A 2PGJA 3WGZA 2CF5A 3GGOA 4CLHA 3ITDA 5JW6A 1JN0A 2BI8A 3WIEA 4NFHA 4J1TA 1JDJA 3KXDA 1TB4A 4CR6A 3V1TC 3G0OA 1IB6A 3TL3A 3BMNA 1NM5A 4NBRA 1DHRA 1Q7CA 4QO8A 3AK4A 3C1TA 1C14A 4CMJA 2GO1A 2DTEA 1Q2XA 2OBYA 4S1VA 3DMTA 3R6DA 1LDYA 1P31A 1EUCA 3UVEA 1SZJG 3IUSA 3KOUA 2WWRA 3DOJA 4N18A 1MGOA 4YCAA 1M6HA 4JN6B 3ANNA 4R4JA 4BO2A 3AM4A 2XXBA 1E1LA 4J1NA 4U0KA 1PGOA 1BWSA 4KMSA 3JQ9C 4A10A 1X7HA 4NPCA 1XCBA 2C5EA 2O3SA 1DLIA 3H6KA 4Y6RA 1QYXA 1TT7A 3CTMA 2NTJA 2JJYA 4NJMB 2QG4A 1U8XX 3VH3A 4DVJA 3UHAA 2CFCA 3VAZA 1SEPA 3IJPA 2B83A 2DPHA 1N1GA 4IS3A 5A03A 1YH3A 4EBFA 3GOHA 4PVCA 2JHFA 2JFHA 3P7MA 5U9CA 5DBFA 1ML3A 2AEFA 4BKOA 4PFJA 4DA9A 4ONEA 1DAPA 4RF5A 3WYEA 3ST7A 1LDGA 2FR1A 3WTCA 3X2FA 4KQXA 3TZHA 5DULA 1ENPA 2ZJ1A 1VJTA 1ONNA 1ZJZA 1H0KA 3KUXA 1HE4A 1I5RA 3MJCA 3WIDA 1UZMA 4MJLA 2AA3A 2FWMX 2DAPA 1Q0LA 2Q45A 3E9QA 1IYZA 3SLKA 4YAKA 1O94A 5JDIA 1E1MA 1HSZA 3KV3O 2EWMA 4M8SA 1DRUA 1T24A 1TEHA 3GMSA 4J0EA 2UYYA 4WCFC 2UVDA 2W4QA 3C7AA 1VSUA 4BNHA 5KVCA 5EN4A 3WFIA 1E5QA 3EMKA 4WASA 1F17A 1Z74A 1BW9B 1E6EA 2PH5A 5G4KA 3ZWOA 4DYVA 3TFQA 1V9LA 2A9FA 3ADOA 1NQ5A 3GAFA 3E8XA 3ONDA 4UVDA 1IL0A 1U2DA 4K26A 4QXMA 4CLXA 4EEZA 1UXIA 4TSKA 1A4UA 5KVQA 1V0JA 3GN2A 4BMNA 4DUPA 1ZEJA 1DDOA 2Z5LA 1DIHA 4FD3A 3L07A 4ZICA 1A7KA 2Q50A 1GYPA 1Z6ZA 3GUCA 4M86A 1PIWA 4UAGA 2C7VA 3RVDA 3E18A 5JNLA 1E7SA 2VOEA 1U7HA 4IDGA 1T2DA 1HF3A 1XELA 3ROQA 5IF3A 3DOOA 3P2YA 3DXFA 3JYPA 3TRIA 3TF5A 1VJ1A 2O4CA 1HTBA 1DIRA 2Q2QA 4WPGA 3KTDA 5T8KC 4BOYA 3FI9A 1P77A 4DC1A 4DPLA 2J8ZA 4I8XA 4KTTE 2C20A 4AJIA 2VWGA 1V3TA 4WCDA 4MDHA 1TLTA 3MWEB 4XB1A 2WD7B 1I2CA 4NH4A 4BO6A 2YUTA 2I99A 2WDZA 4YR9A 3SBOA 4CJXA 1P44A 2HRBA 3D4PA 4DQUA 3BMOA 3IC5A 3AFMA 1ENYA 3O26A 3RBVA 3GAZA 2OGUA 2NACA 3PYMA 2QQ5A 2DT5A 1LI4A 3V8BA 1XLTA 1NVTA 2BMAA 5TX7A 2B35A 4XYBA 3OEYA 3L4BA 4II2A 2DM6A 4R68A 2J5RA 3O03A 1SBYA 3UH1A 1I2BA 1IZ9A 2BH9A 4R51A 1BXGA 3PVZA 5LC1A 1LTHR 1HT0A 2Y1DA 4CM4B 2X9NA 4CQMA 3GT0A 4DMMA 4M55A 2FRDA 1I30A 3V2HA 3DAGA 1B16A 3ZNQA 4E5YA 1O89A 1Y5MA 3GGGA 1TI7A 1DIGA 1HRDA 1YOVA 4IGFA 3KETA 2NVUB 4FDAA 2D59A 3D3EA 1BVUA 3W1VA 4BGUA 2CDAA 2VWPA 3RASA 4IDEA 1E7WA 1RM3A 3I9OA 2I3GA 2O7SA 4BNIA 1X15A 2X58A 3HDQA 5ITVA 2IZZA 1I3KA 2Q4BA 5DP1A 1SEVA 5L7WA 4UVHA 4XRRA 1P3DA 4FCCA 3PHGA 4DLAA 2VHXA 1UUFA 4ZRMA 2DTDA 1Q1NA 4R16A 4AJNA 2Y0DA 1RPNA 2Q46A 4IJKA 3JQEA 1L1FA 3WX0A 3ZWMA 4Z9FA 3JQ7B 4E5PA 1MV8A 4GWGA 3WGTA 9LDBA 3AI2A 2B4TO 2ZB4A 3KSDO 3JV7A 4K28A 4N54A 4WLNA 1XU9A 4XIYA 1AGNA 4CMEA 1PQPA 1PX0A 3L6EA 3VTFA 3Q1LA 3VPGA 1I0ZA 5TQVA 5L95A 4ZD6A 2P9EA 3IKTA 3Q9NA 2O3TA 2HMVA 2GF2A 1P45A 4J43A 5ICMA 3AUSA 4R1NA 1K5HA 4JGBA 4FPXA 3JQGA 4YJDA 2NV6A 4WLFA 1LSUA 1PJBA 1DBVO 1IHXA 4DXHA 4XWYA 2IRWA 4YAIA 4P22A 3AU9A 2HK7A 5L7YA 4CMIA 3PQFA 3WGOA 3LSYA 5JC1A 2J5KA 3AM3A 3H2ZA 3RUHA 3ZDFA 2QX7A 2E48A 1IOLA 3CXRA 3GLQA 3W4KA 4GBJA 4NU5A 3PHLA 1KETA 4OH1A 3GVXA 1ULUA 1XU7A 3KRTA 1PWXA 4B7UA 1R0LA 4A73A 1EQ2A 2V6FA 2DTXA 2VZ8A 4D3FA 4BNZA 4JX8A 1Y8QB 3CIFA 4GQAA 3CEAA 4GX5A 5JC8A 5JDCC 1O6ZA 1A4IA 3GA0A 1K6XA 2EF1A 4ZN6A 4OKNA 5A3JA 2NSDA 2Y1EA 3FTNA 4RL6A 3HUDA 4D79A 4MVJF 3RUIA 3RUAA 5H83A 4WOKA 1R4NA 2C54A 4NNJA 2JFFA 1XG5A 1H2BA 3OQ1A 5FI3A 1MP0A 3D4NA 3IJRA 3FPCA 3GNQA 1EDZA 3RBXA 1LSSA 5JXWA 3AW9A 2PFGA 2E49A 4CLOB 2GZ1A 4Z3DA 1OMOA 1PSDA 2FPPA 4UREA 4XYMA 4R9RA 4F6LA 1QP8A 4R54A 4CPDA 5KIAA 5C7IO 1UXHA 2VN8A 5G0WA 1E1NA 1X1EA 4OJNA 4BIIA 2JFGA 2WSBA 4RVSA 1RYEA 2DC1A 4S3MA 2Y0CA 4RVGA 2POQX 2FY8A 4PLWA 3KLPX 5L51A 1ZIDA 4W7IA 4ALNA 1JVSA 5J23A 4YTEA 4PLZA 4E3ZA 4R5HA 1H6DA 1Y9AA 1AN9A 3ZWPA 3KSZO 4ALJA 4M1QA 3C3XA 3PJGA 4WUVA 3KVOA 2B36A 4J1SA 1XA0A 1QKIA 1WP4A 4EJ0A 2HKIA 2J3JA 1ZJYA 3B20A 4A7PA 1P1IA 1L7EA 3ZV4A 2R6JA 3DHEA 4CQMB 1YQGA 1CIVA 4IDCA 1QLJA 4TWRA 1DJNA 1VPDA 1AXGA 2BGMA 1JKIA 1VSVA 1YOVB 4CMCA 3TPCA 2VZ0A 5COAA 1V8BA 3VKVA 3BTOA 2P9GA 2IYPA 3PPIA 5EQFA 3PTZA 5BT9A 4BNFA 4BO0A 4B8ZA 1I01A 5GZ1A 5B12A 1NR1A 4PLHA 1T2EA 5TNXA 3ZU3A 4RF4A 3IQDB 4IINA 1P9LA 3V1YA 3H9GA 4UUNA 3UGKA 4R1SA 4J7UA 2D5AA 2B4RO 4G5HA 4OQZA 3KHUA 1NPYA 1R0SA 1HDGO 1D8AA 4NJOA 3WICA 1FF9A 4H15A 3M2PA 4A0SA 4XRGA 8LDHA 2CMDA 3DBHB 1ULSA 4HKTA 1QSGA 5THKA 5L3ZA 3I9JA 4R5MA 3T7EA 1PGNA 4B3HA 1NBOA 4W6ZA 3PDUA 1H2HA 2Y1FA 3G1TA 4CM3A 1E6WA 2LDBA 3GRKA 3LC2O 3QWAA 2Y93A 2Z1MA 1N9GA 1G6KA 1P1FA 3JQAB 2QRJA 5JAQA 4PZCA 5AXDA 3ASVA 1O5IA 1BSVA 2X1HA 1F8GA 3NYWA 3DDNA 5CG1A 2HCTA 4RORA 1LU9A 3LYLA 4URFA 2X5OA 2VRCD 2PV7A 3W4JA 1LQTA 2ZYGA 2GZ3A 1VLLA 5T5QA 3TQHA 4NBVA 2O3JA 3WNVA 1MG0A 5DBIA 3EGOA 2JCVA 3GMDA 1SNYA 3GY0A 2PKQO 1KYQA 3WLEA 1PGPA 1ADGA 1J49A 5ER9A 5COQA 1BXGB 1YRLA 4PRKA 4YWJA 4DPKA 1G0NA 3P19A 5JLAA 4RLSA 4ZQEA 1K89A 5LCXA 1NQAO 4HADA 3FWNA 1GY8A 3H9JA 5DF1A 3U4HA 4F3YA 3F9IA 4CMGA 4PLPA 2OP0A 3TZCA 2GZ2A 1MC4A 4AVYA 1FXSA 4E0BA 1I24A 3F47A 1MB4A 3A28A 3D3WA 4KUEA 4GVLA 4RO0A 4F46A 5JDCA 1ENZA 1XR3A 3TZQA 2VWQA 1X7GA 1BVRA 2D4AA 4PG7A 1TT5B 1Y1PA 1XEAA 3HDHA 2Y05A 1T2CA 1CWUA 3VPFA 1XHLA 5K6AC 1PJ4A 4GGPA 3CSDA 1EK6A 4E32A 2JL1A 3ON5A 4O5OA 1DJQA 3PLRA 3GVCA 1A5ZA 2CVOA 1DHTA 1SC6A 4PRLA 4RPGA 4XKJA 1OFGA 1E7RA 4ALIA 5A4DA 1HDZA 3L4SO 1H93A 1WVGA 2VT2A 2I66A 5A9TA 3FRJA 3GGPA 1UXJA 4DREA 5A5EA 1R4NB 1XGKA 4JJGA 3ZWYA 6ADHA 4EGFA 4C7JA 3EZYA 4DQXA 4PN3A 1ISGA 5L40A 5T6BA 1EDOA 3U3XA 2P91A 2VRBA 4RV9A 5TJ9A 3WYCA 3VHRA 2GN4A 1PZGA 1YE3A 4RPHA 4CR8A 5THQA 4WLUA 3S55A 1EVJA 1O9BA 2ZTMA 3HADA 3HDJA 3W8EA 5L7TA 5KKCA 4HXYA 3O4RA 1X14A 2RIRA 3RCBA 5ILOA 1UAGA 3ROPA 1DAOA 1E5LA 5H82A 3K92A 3I52A 3PIDA 4PLVA 4YAEA 4WKGA 3L0DA 4XDYA 3DFUA 3KYDA 1D4FA 1WZEA 3C24A 1YGYA 1HEUA 1FDSA 2O2SA 2VRCA 3ENKA 2EIHA 1ISIA 2H5LA 2CVQA 3U62A 2BRUA 2Y1CA 1Q0HA 3E6AA 1KIFA 3PJFA 4GL4A 4XYEA 1ZXLA 4K6CA 3ULKA 5JO9A 4BNVA 2AG5A 3K30A 4IDBA 5CPBA 3H7AA 3DQPA 1KEWA 4B3JA 3ROKA 5ADHA 1NFQA 2ZYAA 4WE3A 4GKBA 3RFXA 2C2XA 3GVHA 3EZLA 4WCFA 1DPGA 1YDEA 1ZEMA 5TIIA 2CY0A 1A71A 3SJUA 1JAYA 1I3MA 1IULA 2GPTA 3CZMA 4D43A 3TOZA 3PZRA 4ILKA 1PJLA 5A06A 3FNFA 3VDQA 5F3RA 1UDCA 3RSHA 3AY6A 4M54A 1YS4A 2Y1GA 2NTVA 3H4VA 4RVUA 3JQ6A 1UP4A 4TRJA 3FSRA 2FN7A 2DU8A 3JYNA 4FJ1A 3LF2A 3H3FA 1LRLA 4BGIA 2YFQA 2QIOA 5A9SB 4M49A 3OJLA 5KOIA 3HN2A 4JJFA 3ENNA 4J9VA 1EVYA 1LEHA 3PHHA 4WK6A 2CDBA 4LSMA 4IQ8A 1QYVA 3WQRA 3LT0A 4K1LA 4BMSA 4XGNA 2NNLD 1YQXA 3U9LA 4YRAA 4ROSA 9LDTA 3H3JA 1HLDA 3VPSA 1BTOA 1C1DA 2FPIA 3IKVA 1NQOA 3JCZA 3A1NA 4FFLA 4R1TA 2ZB8A 3ZWVA 1B2LA 4HBGA 3RC7A 1SMKA 3DFZA 4BKPA 3EVNA 2YHIB 1E0DA 2C07A 1GCOA 4BO1A 3RFTA 1RKXA 1N9GB 1IUKA 3NT5A 3D64A 3LF1A 4OM8A 2HMUA 3K2EA 2Z95A 4PZEA 1EE2A 4XQEA 2HK9A 2G17A 5IG2A 4I1IA 4YQYA 3OP4A 4CMAA 1UJMA 4KWHA 1PL6A 2PNFA 2EKPA 3QWFA 4YEDA 3ORFA 5G2OA 5I7VA 4YRBA 2AG8A 4UEOA 2Y68A 5TRTA 1EUDA 3G17A 1ZBQA 1NPTO 4RDIA 5BR7A 4FJ0A 1SOWA 5JAMA 2EKLA 4O6VA 4AJLA 1E6UA 3INRA 4CMIB 5TF4A 3C1OA 1SB9A 4WNCA 2RBEA 2ZCUA 3QWBA 4AICA 1GUYA 4FJ2A 3DZFA 3HQ4O 3VH4A 4JP2A 1KEVA 3VVCA 4YVFA 1JKJA 3DBHA 5EJ2A 4OYRA 1I10A 2CNBA 3OA2A 4YQZA 4L73A 3R3JA 1KVQA 3AM5A 3JQAA 5IDWA 4OIMA 1NHWA 4I5DA 2QYTA 1MA0A 1NWCA 2O50A 5EMHA 4BHTA 4TMFA 4F45A 5CAEA 2IE0A 4D0SA 5AQ1A 4JCOA 1F8FA 3O8QB 1U4SA 3A9WA 1H6BA 1N2SA 5DCYA 1ZSYA 3DBRB 3DC2A 1CEQA 1VM6A 2O3RA 4N7RA 5IN5A 4FR5A 5T67A 3QQPA 2J3HA 2YV1A 3FR8A 3OICA 3AWDA 5CEEA 1DRVA 2EW2A 3DHYA 2X0RA 3KYCA 4PIVA 2G1UA 3UFXA 1B3BA 3KM0A 3DMYA 3E03A 4JP3A 3OIGA 2VQ3A 2Y99A 1BMDA 1TVEA 4HNGA 3E9NA 5HS6A 3KZVA 5GY7A 4RQUA 4CQLA 2OFPA 1H94A 3NAQA 4CUJA 3V5NA 1LDNA 4O1MA 1A9ZA 1YL6A 2PZMA 4EJ6A 4DRYA 1KC1A 1N7HA 3LT2A 2ZKLA 3PQEA 3WB9A 3GUYA 4M89A 1EFKA 3Q3CA 1DO8A 1EQUA 2WE7A 5KNLA 1D1SA 4MP3A 3WDSA 3PLNA 2RHRA 4ND4A 3ZW8A 3NJ4A 3PGXA 4L4RA 4PG6A 3T7CA 4XQ9A 1ZK3A 1JA9A 3FTPA 4WLVA 3HWRA 5F1KA 4JQCA 5DOVA 2Q2VA 1B26A 4XGIA 4CM8A 1XIVA 4D41A 2C59A 1Y6JA 2E37A 4UULA 4ZJUA 4XGKA 1NQTA 4FFRA 1RM4A 4KZPA 3PYXA 3VDRA 1YL5A 1OC4A 4BNNA 3RUFA 4B7CA 1SAYA 1GQQA 1CERA 4YJFA 3H9QA 3BMCA 3D7LA 1NAIA 4MVJE 2FMUA 3WYBA 4CQMD 3IS3A 1LNQA 1ZUD1 2IDZA 1O8CA 4GVXA 1K2WA 3IUPA 3GVPA 3PP8A 4WCFB 1VRWA 3PWZA 2P9CA 2H1SA 2W2LA 1DXYA 4UEJA 3WSVA 1K0UA 5T57A 4ZQHA 3HB4X 3LLSA 1PEDA 4XYLA 2FP4A 4EYEA 2O3QA 3GN1A 3PDJA 1BXKA 4OO3A 2XPCA 4DBVO 4CV2A 1ZK1A 5A04A 3H5RA 3RROA 3MTGA 2YJZA 1PL7A 5JYDA 4CR7A 3ASUA 3L6OO 1OBFO 5EPOA 4BGVA 2LDXA 1M75A 4H7PA 3WWYA 1BXZA 3NRCA 2GR9A 3SJ7A 1MUUA 2AW5A 2WD7A 2JAHA 1UZNA 2NWQA 1HDXA 3ANLA 2UUPA 2GN9A 5TC4A 2PK3A 3F3SA 1EK5A 3LDHA 3UN1A 3GPDG 2NU8A 4B79A 1UAYA 2V6MA 3WNQA 5BSFA 2Q99A 3JSAA 1GQ2A 2P2SA 1U5AA 2YV2A 4P4LA 5G0VA 2JHGA 5TT0A 3LVFO 1NVMB 1U8FO 2VHZA 3UKOA 4CV1A 7ADHA 1F14A 2BFPA 3RWBA 3W8FA 1GAEO 3M1LA 4IM7A 4BV9A 2B69A 1D7OA 1WW8A 2AHRA 3OFSA 2P4HX 4L8VA 2I76A 3SEFA 4GPD1 2BFAA 1LRKA 4B4UA 2FSSA 4F6CA 3AFNA 2I67A 5DDIP 3TN7A 3MCVA 4J16A 4EW6A 3DBVO 3GDFA 3F4BA 4IUYA 4YB8A 4FS3A 4HWKA 4HFNA 3PHJA 2UDPA 4NFSA 1H9AA 3AY7A 4XR4A 5DCWA 2X9GA 4NMHA 4BNJA 3IOYA 1DFIA 1DSSG 3K73O 1HDYA 1LXCA 2CSUA 4NU6A 4X54A 1OI7A 1R66A 4RZIA 5IZCC 4CUKA 4BO3A 3B1JA 1PJ2A 4YYZA 3S2FA 4Z3KA 1T4DA 4L74A 3ZW9A 3JQ8A 1BW9A 1Z7EA 1GV1A 4IPTA 3UICA 3ADPA 4RF3A 2WM3A 1EEHA 1GCUA 2YFHA 3UW3A 4JBGA 1I33A 1V6AA 2VZ9A 2Q1UA 5AXAA 2ZATA 3WSWA 4ZQFA 1X7DA 3EYWA 1U9JA 4L9RA 1KC3A 2OMEA 4MIYA 4BKQA 1QORA 2NQTA 3RAJA 4PLYA 3S1LA 4OSPA 5DBGA 3Q0EA 3EVTA 5JY6A 3V2GA 4BQRA 2OOSA 4PLTA 5I8ZA 2B5VA 2I9PA 3BHJA 4J7XA 5CP8A 1KVUA 4TZKA 1GDHA 3QP9A 4RGBA 4J0FA 5H81A 2GUGA 2RH8A 4N5NA 1LX6A 3DL2A 2IEDA 3BIOA 4AJEA 3NJ8A 3PWKA 4FC6A 4LVCA 4IDAA 4OSOA 4MVJA 4G81A 2B5WA 1WDKA 1YL7A 4CODB 5DN9A 1PWZA 1QRRA 4XJSA 4YAJA 4TQGA 4JBHA 3CINA 3RFVA 4H16A 3ETGA 4ZRNA 3WMWA 4AJ2A 2EHDA 3RJ9A 2BFOA 5IDQA 4YJGB 2O2YA 4O0LA 1H9BA 1GZ4A 1N92A 3QV1A 2RHCA 3ZWBA 2ZYDA 1PJTA 3BHIA 4HP8A 5CFZA 2PA3A 2J3KA 5ENDA 1JTVA 3IP1A 2IXBA 2NTNA 4IBOA 4GWKA 3ZWWA 4A26A 1ISMA 5CPFA 3ZHZA 2FPGA 4GX0A 4E2WA 1LDEA 1T26A 1B15A 1HYHA 2FR0A 4LRSB 4NK4A 3AOEC 4PLCA 2AE1A 3NT2A 4BNXA 5G0UA 3BAZA 2DBVO 3I9LA 3ICPA 5FWNA 3QHAA 1CYDA 3IDSA 3ETDA 2RH4A 3SC4A 1MG5A 2P5YA 2F00A 5I9MA 3F4LA 3ZV6A 1DC5A 1B14A 4OOFA 1KS9A 2JD0A 4ZA2A 3X2EA 4J4BA 3ZI0A 4Q3NA 1Z7BA 1V3UA 4YXFA 3OIFA 4G2NA 3OJ0A 2OXIA 1UDBA 2D0IA 3W4IA 2G0TA 2VUUA 5ER6A 5AVOA 1IPFA 1PZHA 1NVGA 2HRZA 3AUTA 5BSGA 3GF4A 1PU2A 2GN8A 3U4CA 2OBNA 1DOHA 3W8DA 3A06A 1E92A 1W8DA 4EJMA 2NVBA 1XDWA 3ZU5A 5BNIA 2VYVA 4MPDA 5JMWA 3AI3A 1OAAA 3E5RA 1E3EA 4LRTB 3VOSA 4E2ZA 1YXMA 4YJHA 4EI2A 1FDUA 1PJ3A 5TLSA 4TRNA 3WQQA 1BGVA 1U3TA 5JS6A 3U0BA 2AQKA 2D5CA 2X4GA 4P4NA 1HYGA 1U2GA 4NDNE 4R1UA 1EZ4A 1P74A 1BHSA 4R01A 3ONEA 1LLDA 1YBMA 5KJ1A 3T4XA 4CUZA 1IY8A 3I5MA 1GQYA 2P4QA 4A27A 1GR0A 1M76A 3U09A 4CM4A 1HKUA 2X7HA 4TKMA 2I65A 1A72A 4NG5A 2Q3EA 2X0IA 3BZUA 3WQSB 3C1AA 3TJRA 1A27A 4YJFB 1X1TA 4WLOA 3FWZA 4BS9A 4RJTA 2X9VA 4TZTA 1AHHA 5JAZA 4I5EA 1VKNA 1P0CA 1NPDA 3QA9A 3ZU4A 5A9RA 1CQIA 1T2FA 2EXXA 3L77A 4MVJG 4J49A 4EITA 4I9NA 2WTBA 4DYDA 1ADBA 2AQ8A 4NHEA 4XCVA 4E6PA 3I3OA 2BD0A 2O3UA 2YDYA 1HDCA 2NU7A 1EBFA 1Z82A 3BMQB 4E13A 1B0AA 4EUFA 5AXCA 1PS0A 3A14A 2ZCVA 3F1LA 2GYYA 4U0JA 1BDBA 6LDHA 1PZEA 2P5UA 2GD1O 3V2UA 1UP6A 2D1YA 4DLLA 3UXYA 3JD1A 3PJEA 4XZ3A 3UCEA 4YT2A 4QUKA 3HE3A 5HM8A 4HUJA 5KJCA 1HETA 5COBA 4YBZA 4AJ1A 3ZHBA 4QEDA 2AEMA 3FBTA 4Q3AA 4FSHA 1C0IA 1DFHA 1KVRA 3QY9A 3I6IA 4M87A 3G49A 2H9IA 2CZCA 3I4CA 3OBBA 1UXGA 2HUNA 5CG2A 3S2IA 3K8ZA 5CDGA 4IDDA 3ZZNA 2OZPA 1FK8A 4L4XA 3UCXA 2HJRA 1NWHA 4DPMA 4E12A 2BI7A 2ZJ0A 1RJWA 3E5MA 5ES3A 1WNTA 4KUHA 4YJGA 3VZPA 5HTOA 1I36A 4OQYA 4QO7A 1Q7BA 1WMBA 2UV8A 4HFRA 2HAEA 3ZN2A 2EV9A 3GDGA 1BRMA 1LLQA 3JQFA 4XYGA 1MXFA 3EHEA 4E33A 2D8AA 3AUUA 3DBLB 5JBIA 3OIDA 3JQGB 2OP1A 3GZNA 1B3RA 2V7PA 4RF2A 2FSVA 2V6GA 3DZBA 4CLRA 3PFWO 3RQSA 2VNSA 1ZKMA 4BNMA 4MIOA 1JAXA 1K3TA 3RUDA 4OHUA 3I4FA 3WBFA 1OOEA 3B6ZA 5L4NA 4BO5A 4BNKA 1XKQA 1VC2A 3QRWA 4Q3DA 5LDHA 2GDZA 1H5QA 4GAEA 3QWIA 4CM8B 3DZKA 3KEQA 1RWBA 3UOGA 1QR6A 5ICSA 4BQPA 4BNWA 1Z75A 4ZQGA 2WYUA 4I9UA 1MLDA 4B4VA 2XXJA 3UF0A 1HSOA 1NAHA 2Y1OA 5L45A 2BELA 5DNAA 4QFCA 4Z6KA 1N5DA 1P1JA 5GZ3A 5EIOA 4Z9YA 2BGKA 3RD5A 2Y66A 2EP5A 1E3IA 3ONFA 5B1YA 2JAPA 5CDSA 3STHA 4R3WA 3ZWAA 1CJCA 3GNTA 1YO6A 5KVSA 2HLPA 2XF8A 3VPHA 1R4MB 5IXSA 2VT3A 5U1PA 3SC6A 1DFGA 3Q2KA 1FDVA 2R00C 2NVWA 3EW7A 4RLHA 4E4YA 3C7CB 3JD4A 4D44A 5KTKA 4GMGA 1JVBA 3JQBA 2JKVA 4PCVA 1QYDA 3CUKA 5B4VA 1DC3A 4E2YA 4Y9DA 3GRPA 4L75A 1BDMA 4BO8A 2O7QA 3CPSA 3FHLA 2EG9A 3FPLA 4QT0A 5KJEA 3PFFA 2I3AA 1EVIA 1KY5A 3EUWA 2EW8A 3GH3A 3K2BA 4GLLA 4DLBA 2DVMA 5FYDA 1GTMA 1W73A 1S7CA 4RVHA 3OECA 3K9QO 2QRKA 2WMDA 2GCGA 1SO8A 1DB3A 4UUOA 1F0YA 4B7XA 2HMTA 2YY7A 2FZEA 2P68A 3VC7A 3H5AA 2W8ZA 1PZFA 2NM0A 1DRWA 5L4LA 3BMNB 1JWBB 3OM9A 4QSMA 3ANMA 3WLFA 4D7AA 2ILTA 3JQAD 1KVSA 3P5SA 2HQ1A 2YQ4A 1HZJA 3NDRA 2HDHA 4MIEA 5HA5A 5C3MA 2WJPA 1OZAA 3JD0A 4LN1A 5F1PA 2DBRA 2UUOA 4NZ9A 4GH5A 1MFPA 4RDHA 2J6IA 2DPGA 3ZHXA 2IXAA 1AHIA 3F5SA 3TZKA 3NX4A 1ENOA 4ZVVA 2Y67A 2DBQA 3AI1A 3D3WB 5ENVA 1PS9A 3DR3A 3RU9A 3AOEA 3TDKA 1Y8RB 4J2OA 2Q49A 4R41A 2ZTUA 3D4OA 4E2XA 1M2WA 4PG5A 1MXHA 2NU6A 3S8MA 1RYDA 3BA1A 3JQ8B 1AE1A 2W90A 1FJHA 2DBZA 4KQWA 4WLEA 3VVBA 4FBGA 1NYTA 2EERA 1KEPA 3DO5A 3H9EO 3CH6A 3WXBA 1CETA 1EFLA 2ZB7A 1ISFA 1ZXBA 1UDAA 4FC7A 4IIUA 4Y8VA 1XSEA 5CDTA 3LU1A 3OJFA 1P1RA 1FDWA 3IIEA 4YACA 5MDHA 3V1UA 1WPQA 4OKIA 1LA2A 5EERA 4FFPA 4CM9D 4P4GA 1F12A 2VHVA 4JK3A 4CM9A 3DHNA 1NX6A 4D42A 3AUAA 2EGHA 4A5OA 5JO0A 2DUWA 1EBUA 3DEYX 1YBVA 3K5PA 4PG8A 2VTDA 4GI2A 3DBLA 5GZ6A 3ZCXA 1O0SA 3CE6A 3OQBA 2JD2A 3OQ6A 1PGJA 1E3WB 1KBZA 4UVIA 4CLEA 1ZSNA 1VKOA 3EAGA 3KYDB 3VZSA 3D5QA 1C1XA 4KOAA 4MP8A 1MX3A 4BNGA 5G4KB 2E4AA 1GYRA 1GYQA 1PTJA 1QYWA 4K9DA 3DTTA 5A5FA 5C5IA 5IN4A 5A1TA 2DQ4A 3GK3A 3ABIA 3QW2A 4W7HA 3H8VA 2Q2WA 5IDXA 1EE9A 4NIMA 2QZ9A 5DP2A 2I6TA 1CRWG 3WMXA 4LSWA 1K6IA 3LK7A 3E48A 1IZ0A 4E5NA 2DFVA 4EZBA 3MOGA 4PVDA 1NFRA 4K6FA 1S6YA 3H9UA 4OXNA 3DB2A 4QECA 1ADCA 3GEDA 2E82A 1YB5A 5KVVA 4Y98A 4OAQA 3Q2IA 2QZZA 3RUEA 3O8QA 3QSGA 3U4DA 5JE8A 3SXPA 5BSHA 5IXYA 1CDOA 4QFDA 1Q7GA 4OXKA 3G1UA 3AY3A 4RVDA 3ROMA 4Y6PA 3KO8A 3QIVA 4IQGA 4YT4A 2VYNA 2FHSA 5C7LO 1YJQA 2HJSA 4DGSA 1YONA 2ZB3A 2DFDA 1M6WA 5GMOA 1JWAB 4UVGA 1R16A 1W0CA 4XQCA 4XD2A 5JMPA 2QW8A 3PHIA 2PKQP 2C0CA 1E3LA 2VUTA 3CKYA 4GSLA 2PTGA 1Z73A 1MFZA 4BO7A 3JQDA 3MJVA 2A35A 1C0PA 1YQDA 2CVZA 3C85A 1CF2O 2CD9A 4HX5A 5AXBA 4Q39A 2HMSA 4FQ8A 1Y9EA 2PWZA 5EL0A 3SVTA 2WE8A 1PQUA 4U7WA 3MJEA 4NQZA 2AEJA 3I83A 3GFGA 3MTJA 3FNHA 5IDYA 1PQWA 5F1OA 4TRRA 5HBRA 2JCXA 4BB5A 3O38A 2YHIA 8ADHA 1DIBA 5HRUA 3QVSA 2OUIA 5IAAA 5TT1A 3WGIA 4J4TA 2X0NA 4A2CA 5F5NA 4JJIA 3KLMX 1HZZA 4IMRA 2A92A 2AQIA 1DC4A 3BMOB 4RPLA 4IZHA 5DOZA 2BGLA 3DONA 3KYBA 4BUCA 2Q1WA 3HN7A 2NVUA 1FMCA 4RPJA 2NADA 1HDOA 4CM5A 1NXQA 4ALKA 4LVUA 2IZ1A 3SX2A 1G1AA 2V6BA 3MZ0A 3NDIA 4O59O 1GUZA 3JYQA 3N7UA 4MP6A 5DZSA 4ZGWA 1N8KA 1V35A 3GZ4A 1LLUA 4MVJH 4TKLA 3RUCA 3PQDA 3B1FA 3Q11A 4I5GA 4RZHA 3UUWA 4DMLA 3RI3A 1GZ6A 1P33A 1NHGA 2C29D 4FIZA 3L9WA 3RC2A 1XYGA 3AU8A 5CHEA 1PL8A 3GHHA 4EUHA 4FN4A 3E82A 3G3EA 3U5TA 1D1TA 1Y8RA 2X5JO 1JQBA 1UP7A 3QJ5A 1G0OA 4ESOA 3CMMA 5L53A 1X13A 2PZLA 4W9NC 2VNAA 3ZGYA 5A02A 2SCUA
chains in the Genus database with same CATH superfamily
3VC3A 5CH3A 1MO2A 2PMKA 1Y6RA 4NJMA 5AK3A 2AF4C 4ARZA 3ZTWA 4U8GA 4ZK2A 2QI9F 1A9YA 1HFKA 2RARA 2GPAA 3WL7A 1XMPA 4YT5A 3D0KA 4P7KA 1E7QA 1ZR2A 1HE2A 1TAHA 2C7GA 1QOPB 3A9CA 3C14C 5A7GA 1ZOPA 2NX2A 5AK6A 1MH9A 4DF3A 1OF1A 2ASEA 3LA6A 1S8AA 5DVZA 4RBNA 1UBKS 5FEUA 5CDUA 1D6SA 1XWFA 3E2MA 2B1IA 2K6GA 5AICA 2JFXA 2PBZA 2O2GA 3MWFA 4UC0A 1VMAA 3VKUA 5D3KA 2V7QA 3A05A 1XQ6A 1FVOA 3KYCB 2I1WA 4PXSA 1IE3A 1JPJA 3IVRA 5AK4A 1B8UA 2OZVA 3TX6A 4BFZA 4RDXA 4OGWA 4YMLA 5EZQA 1KZ4A 2IEBA 2BEVB 3CBGA 3R5KA 2C97A 5AVZA 2B78A 4JFAA 5AVQA 1OI4A 1W19A 1L4YA 3V8MA 2X6TA 2Z30A 1T1JA 3ZGZA 1NUAA 2GKGA 4PAOA 1AURA 1ZK0A 4Z0PA 4Z4IA 5JNWA 1TJYA 4IS2A 2OB2A 2YWDA 3L40A 4FQ7A 2O48X 3MOIA 1KTIA 3C3MA 1Y4AE 1C0KA 1YZVA 1QLHA 1V4NA 3QE3A 4P36A 5AJXA 5FPTA 1NC1A 2EGGA 2H0QA 4LMPA 4NL4H 2O2EA 3PRYA 5A05A 3QVJA 4BVEA 3LC7O 4D02A 1U8EA 1MQ9A 4RYDA 3W6UA 4Q9NA 1H65A 3NIGB 2PX8A 3K94A 2B8TA 3QFRA 3NNSA 1DWQA 3MGAA 1KEUA 2JARA 3CVOA 1J5XA 1K6EA 3GLFE 1TXGA 3WY9A 3C8ZA 4DLVA 1UZUA 1RBZA 4G9BA 1AGPA 1YUBA 5TE9A 3KR9A 5ILGA 3G0IA 1VPLA 1DC6A 2IYVA 2PN1A 4HK4A 4TZ6A 1IONA 1K5GA 1YULA 4N5MA 4YPOA 5LYJA 4P53A 4GFDA 3BYZA 4R2JA 3BFKA 5C3UA 4AO8A 1VFNA 4BBJA 1OFTA 1ESMA 4YO8A 3FUCA 2XUPA 5AI9A 1K7XB 2O9JA 1UR5A 1WKCA 2XNCA 3VVLA 1ID1A 1WAMA 3QFFA 5L4SA 1Q0UA 3PC8A 4CEHB 4A0HA 3NEPX 2ZYTX 3P2KA 1T3LA 5G4LA 1T5BA 1RZUA 1R12A 1TYDE 1UKEA 3FZQA 3UG6A 2OAP1 3GT7A 5KS2A 3PHCA 5F21A 1HTTA 4FS8A 5B7NA 5BY2A 3LY8A 5CT4A 4KWCA 1DWOA 2PH7A 3TNLA 2X2EA 2GN2A 1UIMA 3UW1A 4Q37A 1VGRA 4ME6A 3G85A 2OV4A 5HSGA 5IJ0A 1L0BA 2C4TA 3K5HA 5CDYA 4MCHA 3HL0A 3II6X 2VYVD 2WYWA 1GPJA 3B1KA 2NUAA 3TR0A 4ZT7A 5FOXA 5FIUA 1ZGJA 2P3LA 1P6UA 1RE0A 2DCMA 4JVNA 4PXAA 4DLPA 4IGIA 3LUAA 1OXBB 3ESXA 2P9JA 3CU5A 4O4HA 5FUMA 3IX7A 2W2KB 2PQ0A 4D9MA 1XZAA 3UHFA 3JQRA 3P71T 4IJUA 1OC2A 1OFHA 1M6VA 1VE7A 1Q0TA 2EGUA 5TS3A 3UC5A 2AKYA 2R7NA 4YJ3F 1TU4A 2SKDA 1R0KA 5EESA 4ZZ0A 1T9AA 1KVTA 2Q5JA 3LCJA 2II6A 5INTA 2AFIB 4G0UA 1SY7A 1P39A 1K5PA 3WOHA 2XYPA 4FM9A 3F6PA 1WKVA 2VYCA 2WFAA 4ND8B 4DSNA 5SY6A 2PRYA 1Y1SA 3RYHA 2R6HA 4HHEA 4JB3A 3VKHA 4W5OA 3PWSA 1RWNA 4LNUA 4Q82A 5CCDA 4TUYB 2PHZA 4S05A 4O02B 2ZIZA 1AIPA 3QLJA 4KXFB 4V24A 4GDFA 4KHZA 5A1JA 3G0BA 4V3CA 4LX8A 5I7EA 1ZUHA 3AXSA 4RMHA 1M6NA 2LTAA 3QYPA 1Y5IA 3OCZA 1G2OA 1VL8A 3ZV3A 4URVR 1VB3A 1PZXA 4G65A 3BGIA 4HDNA 1U2EA 4F2HA 5BRJA 1PLJA 3ASZA 5J5VA 4BC1A 2G72A 2G63A 5DTIA 4DQVA 4ZYUA 2BTQA 1WUHS 2MSWA 3M7IA 1NZJA 2VDKB 2QV0A 3K96A 4Q1BA 3DVRX 2YYYA 4I5FA 5IH3A 3TO5A 3OZAA 4BAZA 2BEWB 2WTEA 1YIDA 1Z8DA 1JB9A 3ZBTA 3G0HA 3A1WA 3OF3A 5K8LA 2X1MA 1P1KA 5FCDA 3GT3A 1CFZA 1X7XB 4JB2A 3WWDA 1UJ5A 4IXTA 4EI9A 5JQWA 4EAQA 3BUSA 1Z15A 4WBNA 3FBGA 3EZ7A 4J2HA 4IOJA 4Y6SA 2YXBA 1CQXA 1F9EA 5G53C 2FDCA 2G9VA 3U7FB 3NIDB 4QOEA 3AGQA 1LQUA 4D5EA 1QGUA 2R1TA 1NMXA 1JSRA 1JZSA 1IPHA 2O1XA 3PD7A 4YCJA 3D81A 2BDEA 3HXLA 1XZGA 4GX1A 5GWXA 1M9NA 1O1YA 3VJLA 2FX2A 2JH8A 1L5ZA 1O96B 3N74A 3TQRA 4A8HA 4BGEA 4NG4A 1GPYA 3AUXA 4IVPA 3B1XA 2ENWA 2FFAA 1Q0QA 4PYQA 1B7GO 1QF7A 3L7NA 4FB5A 2PAFA 2YZKA 1T1RA 1T2AA 3ROEA 4BO4A 4CKXA 4G9GA 5TARA 3K35A 3ZV5A 1OIWA 3FTCA 3VH2A 1H8EA 4JR0A 1CRQA 1H66A 1RM0A 2OZKA 2XF2A 2VH5R 3IB3A 4ITUA 4MVWA 3UJDA 5ITWA 2QM0A 2CL5A 1RR6A 1TNDA 3LO5A 3GPLA 5I4BA 3GPIA 3V1LA 2VZLA 3DV0B 1FS5A 3KAJA 2IV2X 1A3CA 1LNZA 2CCGA 4J90A 5EPEA 1GFSA 1V5WA 1YVUA 1AZSC 2YOGA 2ZPAA 1UZLA 3PEFA 5EJMA 5IAGA 3WLHA 2AE2A 1QO9A 2FCRA 1RLOA 4CMHA 4JCCA 2DZDA 2AUMA 4G86A 5GV7A 5CBPB 4B32A 1N36B 2O0MA 4V0MA 4AZTA 1T8YA 1Y7TA 2NLOA 3ES9A 3LZ6A 4O4HF 4ZARA 4PEVA 3ZDRA 4KMRA 2WHPB 1BQ4A 1THTA 1GA6A 1AKWA 4WBSA 4BLQA 2X0JA 4C6TA 1RM5A 3T34A 3V4FA 2XQJA 4L4UA 4HLDA 2GX6A 3OCCA 1WDWB 3WK7A 1C4OA 3IRVA 5IAEA 4AUNA 2QLNA 1J6UA 3RB8A 3HB7A 2A30A 3BDIA 1L4MA 1NU8A 4YA6A 4KI0A 4QQRA 3W79A 2J31A 2NYUA 1QZ3A 2PD6A 4HGQA 5JNSA 4MVJP 3UY4A 5L8VA 1TFUA 1E58A 1G20A 1ZIYA 4JXKA 1NSFA 5F35A 2A78A 5JSKA 5HE8A 1UMBA 1JVNA 4H3KB 3AUFA 2EP7A 1N8SA 3RS0A 3KEOA 4MA4A 3LBYA 1UC4B 3C3DA 2UZIR 1X1DA 3GLVA 1VE9A 3PZBA 3SM9A 5BNWA 5JFTA 4X65B 5BYJA 2W43A 3QFSA 2WV9A 1ZIPA 1WXQA 4CM1A 4AD8A 2OYRA 1IHYA 3DBIA 2XEXA 4BQQA 5IWCA 1JW9B 4PZ9A 1SQ5A 3BH0A 2AK3A 4G0OA 4MUIA 1JJFA 5G1OA 3N0VA 3GEGA 4I3HA 1QH8B 4N7JA 3WTBA 1VBKA 4OP2A 1Z2DA 3ORQA 3IXQA 3O8DA 1RYBA 4KFSA 3RTCA 3CVJA 2FEAA 2FPSA 2W71A 3ILHA 4JJAA 4JLJA 1FFSA 3ELUA 1Z0AA 4A03A 1AA9A 3RVOA 3SK0A 4PHGA 1OKKA 4MKHA 4ND3A 4KDFA 5EQDA 1BJTA 3TLXA 3GJYA 5DFAA 3J7TA 3RTGA 1LC0A 4UM7A 4KYVA 1KNQA 2IYOA 1WZNA 3OEWA 1GKUB 3VR4A 5B7PA 2XIJA 5H7XA 1UPUA 2G82A 2NZYA 3NIFB 4ZVPA 2HREA 3DEIA 3LTNC 1UC5B 4YXWA 1MEEA 1MIOA 1TM3E 1BCSA 4L7QA 5E6RA 2BUBA 2GBGA 1PG0A 4UARA 3ZDQA 3PUWA 1P6XA 3D1VA 4KR9A 5IFLA 1Y42X 3D5TA 1XCLA 3T0GA 4IQ0A 4WEQA 2W2LD 4L95C 3NDJA 5A0TA 4GLFA 1VI2A 2PD3A 5I8WA 1GG2A 2JK1A 2QRPA 2DFLA 4UQOA 1QHNA 3BE8A 4GMFA 3B2NA 3IP7A 3FNEA 4BV8A 1KORA 1C0EA 1SZPA 4JIGA 3ID6C 1PTKA 1PT8A 1YDWA 2QENA 2Y0PA 2ZIGA 1MC5A 1IG0A 3DAPA 2ZSAA 4IIJB 3ZW7A 1B8VA 3CRRA 4YS6A 5E9WA 4ZYVA 3FNBA 2O5EA 1QXSA 5ALXA 3C3CA 3TNJA 3VMMA 4B40A 3RHTA 3U4QB 2VWHA 2FZKA 4TSFD 2FN9A 4RKWA 4WUTA 5EWLA 4AS2A 2IYNA 4F2DA 1U2RA 3M4XA 4CCYB 3VR1A 3KK0A 5EUQB 1F2VA 4ESVA 4EKEA 1QVRA 4O1IA 1JHMA 3ETLA 2VPQA 1VKZA 3GG9A 3IT0A 3I1JA 3LQ2A 3G89A 1NI4B 4LC0A 4JSRA 5HKLA 1SOUA 1CY6A 2J30A 1ZUWA 2PT7A 1QG2A 3KJXA 3NTQA 1SUPA 1V3VA 1XLTC 3GQBB 1VLMA 2HEGA 3LHSA 3LYAA 3EXG2 1P1HA 3HH8A 3T3OA 2ARKA 1ST2A 5KVAA 2XMCA 4DBZA 1JHYA 2BR3A 3KS9A 5TB5A 3TJZA 4BBPA 4OMUA 2FSVC 3TSOA 5JCZA 4KR7A 2B4YA 1WR8A 2J9FB 1ANKA 1HY3A 1OYYA 3JWJA 4HTFA 1L9XA 4NH0A 3PXXA 4GR4A 2D00A 4B84A 4JB8A 4FYMA 4GYYA 2UYGA 4FMDF 1ZVJA 4BKMA 4OREX 4X44A 5ELMA 3X2SA 4EL0A 1MKYA 4ED9A 1G8PA 1GNPA 1ECJA 2JNWA 3GJRA 3H97A 4I1UA 4DUGD 4ZC1A 1GVHA 2ZVDA 3QUSA 3ZH2A 2NSYA 3DDHA 4IO0A 1JYSA 2D4HA 2QQEA 3S2EA 5KHOC 4C4OA 3PC3A 1DEXA 2IXEA 3BVPA 3KKOA 3M5PA 4H7EA 4C76A 1NXOA 4DHEA 4MYUA 4QLBA 2GXAA 3BGWA 3ESCA 1TF5A 3RVPA 5CT9A 2H16A 4AURA 2J6CA 3LXRA 3A9VA 3BH6A 5DYGA 5K51A 4GYJA 3S70A 1XFAA 1E9SA 1TTPB 1ISHA 3NAMA 4BN0A 1HTWA 2REQB 3M83A 2P41A 4AZ0A 3PTLA 2GZSA 1RI1A 2QW0X 3NHAA 4RK0A 4RJKA 3UNXA 2DBYA 4GGOA 3NU1A 1GNTA 3L4KA 2D2IA 1MRNA 3C74A 4UEKA 5DLQC 1N5OX 4R69A 4LK3A 3WZLA 1X39A 3DE5X 4LNAA 1S9DA 1BN7A 4GMHA 5E4YA 5M04A 3Q8MA 2BFNA 2XZLA 4HDNB 3EULA 3FUXA 5A4IS 3I9MA 3CBQA 3JQCA 3JVIA 3LBNA 1P29A 3Q6IA 4RACA 3ZK7A 4KBGA 4GP9A 3WWZA 1ODSA 1UOPA 2FMKA 3TH5A 4TXJA 1ZM3A 3O2QB 4JEHA 3GT4A 3P20A 1JLRA 1R6XA 2IKSA 2YQ5A 5HJ5A 3EJ6A 2GQ0A 1FQKA 3EF3A 3Q12A 3V8RA 1AOXA 3I64A 1W581 4DLWA 3EEOA 1LK0A 2XMRA 1XZBA 3GI1A 3LY7A 4UVEA 4G4JA 1MX5A 1ZH2A 1U9ZA 2QMQA 3AJRA 3EGEA 1JX6A 1FRVA 5B4TA 1ZK4A 5DE3A 4X1IB 5CNJA 1BU5A 3UMJA 4PGFA 4HY3A 3HA7A 4DEVA 5I6DA 4J1QA 3L4EA 4C7BA 5JPIA 1Z5VA 4OA8A 4A0RA 2NSHA 4K86A 2PPLA 3AV3A 3TWOA 1Z8FA 3BORA 2AOUB 2WIBA 5JR3A 4V38A 3WDLA 2H7YA 1UWKA 5FUWA 4KXMA 4I2NA 1L5KA 1X1QA 2OESA 2DQZA 5G0TA 4D9EA 1SCUA 2Q8PA 1MVNA 4DDUA 1VHLA 4HC4A 2QGFA 2X86A 1LW7A 2A88A 3DEFA 5LDGA 2A94A 2ZUTA 4DUYB 4M7OA 3K9FC 1S01A 1IPEA 1NG9A 3P5BA 1XEFA 5JCJD 3FYTA 2OPBA 3F8TA 4JOQA 3TXXA 1NJ8A 1Z29A 4HFJA 4J91A 4FNMA 3OHPA 4G37A 2L19A 5LP6B 3KVYA 4IXWA 1PL0A 2PZJA 4L0DA 1U8TA 3OWHA 3OY2A 5M7EA 1HE3A 2PBRA 4ZV9A 5K6AA 1KOLA 4FR2A 3NT4A 1AGRA 1SIOA 5ALPA 1TQ8A 1ZI6A 2H7XA 3HJAA 5AFSA 1I7DA 1D9XA 2QORA 3S99A 2J9YB 1G64A 4AJKA 3GQVA 3A7DA 3FGNA 3KZMA 1ZVKA 1JKFA 2DOKA 2HTEA 2ZSHA 3DM9B 1G4AE 3O9MA 4B9EA 4EA8A 1FFYA 5KBYA 1P3JA 1RYFA 4QUJA 3EZ6A 3D1LA 4R2XA 4CGYA 1LK7A 3KPJA 1KK1A 3FETA 1JHRA 4Q4LA 3NVAA 5J2UB 2X22A 3L1UA 1CF4A 1XMJA 4AJHA 1Y1KE 3M6UA 5B5SA 1A8IA 4TVBA 1H2EA 4HAVA 1U28C 5L9AA 3U4QA 1T8RA 3GW8A 4P2GA 1RPTA 2F8TA 4WXHA 4NEQA 3WFJA 2Q41A 2Q0HA 4TKVB 3P9KA 2C82A 2E9SA 4DLNA 2CXQA 1FP2A 2APJA 3TZBA 4OM7A 4II3A 2WICA 2CYBA 2EFEB 2J4CA 4HEA6 2BFMA 1CNEA 3UCFA 1C1YA 1T25A 2VUHB 2NU9B 2AI2A 4MO2A 2AXQA 3B70A 4C06A 4QQ8A 4O4JB 3UOWA 4P84A 1FUKA 1PNOA 3OQJA 1CW2B 1U9IC 4OGLA 4QU5A 1NVEA 5MF6A 1LV8A 1Y1LA 5FKJA 1T1SA 2VUSA 3BT7A 3KWMA 1BH6A 4EB6A 5FV4A 2CB9A 4AKTA 4W5NA 1J90A 1N6OA 2PG3A 3BB3A 1PHPA 3H2YA 3RIHA 3IT2A 4FWTA 1OH5A 3GDOA 2AXPA 1C9DB 1VHWA 2R4TA 3T7JA 3EXIA 4YRTA 3B3QA 1FNSA 4LXUA 1EWQA 5G1PA 1SURA 5FLEX 5TEWA 1KEEA 2ZLBA 4KWIA 5BYBA 1EP9A 5FADA 3HU2A 4EKGA 4ZYZA 1QGUB 1NN0A 4IW3B 5FI5A 1L3CA 1HL3A 3OUUA 4DV1B 2RHMA 3OM1A 4A36A 4GM4A 4XX1A 5DCUA 1BEZA 3JU3A 4RNDB 1J0XO 1G38A 4FHDA 2YTZA 4FW8A 2NMVA 2PFKA 1YKSA 5ECGC 1GPKA 3IAAA 2JGRA 2XOXA 4YRFA 2VF2A 2C5GA 3GJTA 4MQ4A 2CLHB 3L0OA 2JHPA 1JA1A 2WA1A 1M2OB 4EY6A 1JEJA 1KO7A 2CF5A 3SQXA 1F8YA 4N0EA 1Y4DE 2VA9A 1HOTA 3MRSA 3N2EA 1FTWA 1SQ6A 1C30B 2FFJA 3KXDA 3ZXXA 4CR6A 4BE7B 3EIHA 1CPYA 1G4HA 4NOMA 3G0OA 3Q7QA 2JKZA 2VP4A 4FZVA 4IMIB 4D26A 1NUSA 5ELLA 1NI4A 3TRFA 4EENA 2OECA 1J00A 5ALYA 4XJSA 2ZJBA 3WWCA 3AK4A 4QVGA 3C1TA 4UDNA 3C3KA 2DTEA 5JIBA 4IAOA 1FYWA 1T4CA 1RD4A 1M33A 2OCKA 5D84A 1ZJWA 3LKDA 3A0RB 5DLDA 5REQA 3CF6R 1KEKA 3EOZA 4TWZA 1OXXK 1P31A 4Q21A 2Q5FA 2QU8A 3IUSA 3KOUA 4HNTA 3KV1A 1LBIA 1MGOA 4XD7A 5HQ3B 3NHSA 3OM0A 1NW6A 3KKKA 3OQVA 1UEXC 1V6SA 2GILA 3AM4A 3D5EA 2XXBA 5E8RA 4HL6A 3HCAA 4QPNA 1UJBA 4KMSA 3K0CA 1QQ7A 3C70A 4KZKA 1RLIA 2QN6A 1ICEA 2IHKA 4ZRDA 2O3SA 4XVHA 3AMVA 3MLAA 3PQ6A 1DLIA 4Y6RA 1A2BA 3KUUA 2JJYA 4DVJA 2QG4A 1U8XX 3CUVA 4FZJA 1SQFA 3L79A 3PT9A 2O06A 2ORVA 3R5SA 4MAAA 3VAZA 1H5NA 1Z68A 2JRCA 1SEPA 3P9PA 4CG3A 4YY3B 1SG0A 2NZ8A 5A03A 3CLSD 4FCTA 4P0PB 4I4IA 3FSGA 3GOHA 2JRLA 4PVCA 2GCNA 2HB6A 3KQSA 3P8ZA 3I73A 2X0EA 1H42A 3WADA 4TMXA 5U9CA 1RVDA 3ZE8A 4XGRA 1SUWA 1U0OC 2HU8A 1M1UA 1DAPA 1EM6A 5AHKA 1Z5WA 4QDOA 4RLQA 4EO9A 1PLKA 4D8VA 2EARA 3X2FA 1IY1A 5B30A 2GARA 1W1UA 1VP3A 3TZHA 2WMOB 2ZJ1A 2V7VA 2ZYVX 2JC3A 2QQGA 2MTBA 2DSNA 3AJEA 2CT8A 1F9AA 4FX5A 4MI1A 1UZMA 1RCTE 1LWNA 2WIFA 5HR5A 1ZM4A 1RFGE 1C7ZA 3AESB 2NXCA 3VHXB 1E1MA 1J0CA 1HSZA 2XUQA 2EWMA 4D4GA 4HRYA 2V4ZA 1DRUA 5DGHA 5MN4A 3GMSA 4J0EA 1VE1A 2UYYA 3AFOA 3EE6A 4MS3A 5AKGA 4YUAA 3BH7A 1ZD5A 1EFRD 1GLVA 3LCMA 4MA5A 4PY2A 5I9TA 1VSUA 4HLQB 1PJZA 5KVCA 4RM3A 5EN4A 2X14A 1SUBA 5I47A 4WASA 1VSBA 1BW9B 1Z74A 3F9CA 3O3NB 2PH5A 3PEUA 1JALA 1QHEA 3X1WA 1ZD2P 3BD7A 1L3BA 4AG6A 1EJBA 4LJ5A 4DYVA 4U7DA 3FB1A 3QUAA 1V9LA 3E05A 1NQ5A 4JITA 2OB1A 3RAEC 4A10A 1VPEA 4K26A 1U2DA 3ESDA 4D9BA 2A57A 4TSKA 3IDQA 5EE9A 1E9EA 1SHJA 4BJ6A 1BWQA 2CLCX 3G9ZA 3NOXA 3DEZA 1DDOA 3GFVA 2Z6AA 1P60A 3AX6A 3L07A 4DADA 1NF9A 4UAGA 1UKBA 2C7VA 5CNMA 3K1TA 5KTNA 3HP7A 4DZZA 1BS1A 4K9QA 4ASUD 3CN7A 4HVAA 1X94A 4H08A 4BLUA 4OFZA 3VQTA 4I1RA 5FI1B 4YCMA 2XE8A 1U3CA 1XELA 3HWX1 1BVYF 4C4TA 5BMVA 2KMLA 3DXFA 3B5EA 4NENB 4RMGA 1ZISA 4Q9HA 5AOCA 1KRXA 1VJ1A 2O4CA 2AH5A 3R5JA 1CUIA 4DDHA 4S1TA 4OLJA 1WW2A 1EX9A 1C8BA 4F5WA 3X0DA 1W4BA 1T8UA 2OLJA 1NXPA 3GO4A 1RHUA 2J8ZA 5JI3E 2WWXA 2Q7XA 3OWXA 3IILA 3VNBA 1P2SA 2AFHA 3DOEA 1R6AA 2AZ4A 4AQYB 4XB1A 2XZTA 1KFJB 4GBMA 4NH4A 4DLSA 1FQOA 1WU8A 2I99A 4LE0A 1PNTA 2WDZA 4X20A 5KYXB 1V7QA 4CJXA 2A5GA 3RYFB 1MH1A 1ULAA 2C4NA 2PO7A 1N0WA 1NBMD 1V7ZA 4LXYA 3SZGA 1C5KA 3DZDA 4DQUA 1CE8B 3BMOA 4Z99A 3O26A 1ENYA 5TV2A 1BS2A 1Q0ZA 2YMQA 4M1SA 2OGUA 3EEFA 5JJLA 1BKYA 1KMCA 1PR1A 1LI4A 2DT5A 2ZTHA 1J7JA 5F7JA 4D0NA 5TX7A 4F3NA 5JFGA 3HVHA 2CHVA 1DG9A 3L4BA 2AJ8A 3W34A 1CQIB 2IBSA 1GTG1 4GRDA 4MR9A 4P3PA 3AHCA 5LQJA 3W5AA 1CHNA 5IJXA 1RWOA 1OT5A 2NSJA 1BOOA 2JFUA 3HVUA 2IS4A 4RVOA 5IKOA 2WIAA 1I2BA 4QRIA 1Q1AA 3H6HA 2CXSA 4JC5A 3HXQA 2JCSA 1UBLS 4OV6B 3ICWA 5ECWA 4N48A 4LNUB 3OKAA 1HT0A 1T4CB 2LUOA 1P17A 1IEQA 2X9NA 2G88A 2Y1DA 3O47A 4AM8A 1I30A 3BSWA 1LPAB 1B16A 3DAGA 3GA5A 3V2HA 3RYCA 1MV5A 2PZ8A 1RI4A 2BY4A 2HLHA 4LY6A 2GT1A 3IBFA 1R0ZA 1W5BA 3IHWA 5GJCA 4QQFA 1FMLA 2JGNA 5EHZA 1ISPA 4RLFA 2PV0A 1UC9A 3QPAA 2GZRA 4M98A 5GM2A 2W4IA 3O4VA 4FHZA 3OM8A 1S2IA 4NE2A 3RASA 2PX4A 1RWQA 2Z6UA 1C7IA 1N3YA 2W83A 4EG0A 3AL0C 3IQGX 1V8ZA 3H13A 2J1LA 3L0YA 1X15A 2VAPA 3EISA 3P2JA 4MS1B 1YCHA 2IZZA 1I3KA 2BZGA 3AJDA 5IYZF 1DO0A 3QTLA 4XRRA 3MVEA 4ZYXA 2VHXA 3JAKB 2PMFA 4ZDJA 2GJKA 1Q1NA 2H1VA 2PUEA 1P19A 1CUXA 3PKZA 4W1SA 2G3YA 2X8WA 1IVNA 4MJ7A 3JQEA 1EFHA 1FYFA 3I1FA 3P9CA 4JJ7A 1KRWA 1MV8A 2D2VA 4A4DA 3EZ9A 3AI2A 4YV2A 1AKVA 3KSDO 3JV7A 5HUHA 2DJ5A 5EA2A 5K8VA 1Q0SA 4H18A 2Z6QA 1AGNA 3R5XA 4BX0A 3P2EA 1IG3A 3I8SA 1P61B 1OX4A 1OA0A 1V3QE 2AMYA 3VPGA 3VTFA 5KTYA 4BEVA 5L95A 3UB3A 4ZD6A 2P9EA 3WRXC 3Q9NA 5LQMA 2FCAA 2O3TA 4LBZA 3HJUA 3SS9X 2JBAB 4J43A 3WHKA 5ICMA 4UU1A 2I4LA 2VJNA 3P0EA 2HPVA 4LV6A 4NZPA 5C7YA 1PYOA 2RJ3A 2FZLA 3LX5A 4DCJA 4P1ZA 3JQGA 3VOBA 1ID8A 2NV6A 2XVMA 1LSUA 1W7AA 4XJVA 3BE6A 4TMYA 4DJ5X 3VO9A 4DXHA 2R8XA 3A3KA 5DHAA 4ZCSA 2RDMA 4CWAA 5D3MB 1P4SA 3NANA 4KQCA 4UBNA 4OUDA 3WGOA 4E3WA 5K0GA 3VYUB 3ZHOA 3DV9A 2O1EA 1JG4A 1F3LA 2BPOA 1ODIA 2JF0A 2O2ZA 4HYEA 2HA3A 1KFCB 4Z4GA 4C5AA 4NMLA 4TLMB 1N2HA 2L18A 1ZH0A 4PM4A 3SYNA 2BKXA 3PHLA 3T61A 2I34A 1ODCA 1QGOA 1XU7A 1DCTA 2AOTA 4B7UA 1UFKA 4MEAA 2EOAA 5G40A 4N3CA 4A73A 1VKRA 3H2HA 2GBIA 4MCJA 4ZVQA 1XJWA 4TZ0A 3TVYA 4ER5A 4JX8A 3CB4A 3H8SA 2GPYA 2IYWA 2O7VA 1QRTA 5GPBA 2VK2A 4UTVA 1B74A 1MC8A 2D1QA 2AWNA 3GGSA 3TZLA 1YASA 3WMRA 1Q0RA 2EF1A 1E1QD 1ZUNB 4LXGA 4OKNA 2NSDA 4RZSA 2VDWB 2IZ6A 2PVCA 2OA0A 3RABA 4GR5A 4N6NA 5T4EA 3PF8A 3J7AC 2ZG6A 4ABTA 3NHPA 3TOCA 3ZDZB 3IBSA 1VIMA 5ALZA 1PT7A 4KE8A 4QPCA 4JLSA 5EAIA 3UMYA 3GNQA 1EDZA 2ZIVB 5CYPA 4QNNA 4QOIA 1LSSA 1MOZA 4EPRA 4EX6A 5JU6A 3TRHA 1I3CA 3SHOA 1OV6A 3BL6A 3KOXA 3SMQA 2CLOB 4JJ6A 1OLUA 5E38A 3RREA 3FRHA 2FPPA 4DZTA 5LD2C 2O20A 1NUUA 1WHSB 5FLKA 4R9RA 4CPDA 3AFGA 4JI6B 4L8LA 5K45A 2A5DA 4NAVA 5KIAA 1IOVA 3P9IA 1MA3A 2VN8A 5G0WA 2I33A 3G8DA 4BIIA 1KY3A 2C95A 4H6VA 4IFBA 1XQVA 3QU2A 4EA9A 1BCRB 1J0BA 2POQX 4PLWA 3SYKA 1ZIDA 2EFGA 4PLZA 5IAJA 1FDRA 4EFDA 1YUMA 1A4RA 3PR2B 2H1HA 1AN9A 4EBBA 3QELB 2B36A 3LQ1A 2Q6IA 1XA0A 4RPCA 2L82A 4CF6A 3L43A 2OCGA 4FD2A 3EGXA 2BZ0A 3E7DA 5F77A 5J47A 1TCVA 2BDTA 1GITA 2BGTA 2YXPX 4E4TA 5B1EA 521PA 1GFZA 3ESBA 4I6GA 2EFJA 1W1WA 1SA0A 4LVNA 1J07A 5E7QA 1IUNA 1TW3A 4MWDA 3V8EA 4OHCA 2QL9A 1QLJA 1X7YB 1PO7A 1YU6A 3TSAA 4D3YA 2XMBA 1NUTA 13PKA 1VSVA 2RBKA 2X8BA 2VZ0A 3JRXA 1XI2A 2HHLA 5EZ5A 1E62A 1B23P 1FFXB 2A5LA 3GCGA 4L16A 5BT9A 4BO0A 1XMOB 1SR8A 4B8ZA 1YVPA 3L2OB 2WVHA 3D2CA 4ZT5A 3ZU3A 3H9CA 1E1RA 4RF4A 3IQDB 3K5IA 4IINA 2J59A 4ACAA 2GA8A 2WT8A 3NTLA 4RD1A 1LF5A 4NICA 4URWR 4ZALA 4OHYA 1JIVA 3KHUA 1NPYA 1R0SA 3LWBA 1QP0A 1D8AA 3B36A 3W06A 4F04A 4QXPA 2B21A 3N7TA 3OPXA 4H7KA 4NJOA 3T5PA 1OH8A 3E3LA 3G9TA 2ZXFA 3M2PA 8LDHA 1E32A 2QLTA 4Y2VA 2CMDA 1ULSA 1DCFA 1QSGA 5L3ZA 1MGPA 2A7XA 4G5RA 1RWWA 5E1DA 4O4LA 4DSOA 2I6SA 1Y1TA 2HL6A 4WXRA 5HFJA 4BJ3A 1BJRE 3LC2O 2GFQA 1N9GA 2Z1MA 1G6KA 1P1FA 3QU5A 4TOIA 3SAJA 3W7AA 4CI9A 4REQA 4ZVLA 5HZMA 3EUAA 3SYRA 1O96A 1QTIA 1NJSA 3REQA 5MFZA 1A1SA 3NYIA 1WM1A 4YLGA 3C2QA 1BSVA 2X1HA 5A4MS 3NYWA 4BWGA 5KYUB 4O08A 1BX1A 1DXOA 2QAIA 2AVNA 3E7PA 4U9HS 5FTMA 4D0GA 5K0JA 1HV8A 5EYPA 3LYLA 2VF8A 3L7AA 3O3MB 1U0FA 4QVKA 5E2AA 2DPYA 4KQFA 3SJBA 4NBVA 1AH2A 3W8NA 5E2IA 5J63A 1FJXA 4LAFA 1XTRA 3GY0A 4Q7LA 4WTOA 4N6GA 4CN8A 5JH7B 1T2UA 1KYQA 3R6TA 1ADGA 4IHJF 5ER9A 3HJCA 4QUAA 2AJTA 4K5QA 2IYAA 2AL7A 2P2CA 4P4SA 2FWJA 1G0NA 4J0GA 2PGNA 3KVRA 1P1CA 2HA2A 1CUFA 3CX7A 3SR0A 4AN1A 2H7VA 3LL4A 1FBTA 4HAWA 4Y2QA 2QR2A 3FZNA 3G82C 3N86A 4WV3A 3U4HA 4F3YA 4GZ6A 1P2VA 1H9CA 2IQIA 2OP0A 3TZCA 2CVHA 3V4OA 1Z18A 3STYA 2TSYB 5HFNA 1BEUB 2QVZX 1V47A 1BIFA 1MB4A 2JBAA 2LXNA 1LV7A 3D3WA 2FWBA 3NEAA 3OJCA 4FUTA 4RO0A 3U26A 1GHTA 2OHFA 3OZXA 3NFYA 3CE9A 1U11A 1BVRA 1UM9A 3TIGA 1N5JA 5ICCA 1TT5B 4UHCA 2X2FA 2BR5A 2GN0A 3PX7A 2DHCA 1PG5A 1T2CA 1XHLA 2H4JA 1DCKA 1D0VA 2CLLB 2HQBA 1SVSA 3HYLA 3EGCA 3PR1A 3WRVA 4F91B 5TVKA 3T3NA 1PQYA 4M6WA 2IHUA 4E32A 1SKUA 3DUFA 2Q5LA 2PX6A 4JHLA 4TQAA 1GA1A 4RPGA 1RYNA 4PRLA 3FKJA 4XKJA 2JIPA 4MUNA 4RZUA 3SHTA 2F8SA 2AXNA 1NMQA 2MT9A 1QWSA 4II7A 5A6VA 2PUVA 1EX7A 2HWWA 4V0NA 3GGPA 1TK3A 4V0KA 4P83A 1XGKA 3E22B 1V2GA 1KJQA 4FYKA 2CXRA 4TL7A 5FOVA 1ZHFA 4PN3A 3GCXA 5T6BA 1KAHA 2IGBA 4WXEA 3UT0A 1F48A 1Q84A 2NZXA 2G5PA 4U2CA 3AY0A 2VJDA 3NYRA 2YYSA 3CXUA 4RV9A 5TJ9A 2QTVA 2XQFA 1FFGA 3KQUA 3I2GA 4GPAA 2JZOA 2GN4A 2EBHX 5DYYA 4G07A 4B17A 4PBRA 2O5RA 1YE3A 2C5BA 2YXLA 3KZOA 1IM8A 5FA5A 3ZK9A 3J80A 1EVJA 1O9BA 5AI0A 1KJNA 4QBTA 3AERB 4JJZA 4DDKA 1IEWA 2OZLA 4HXYA 1UBFA 1G42A 4D9FA 3RCBA 1R8QA 4RKYA 4BX8A 4GRIA 3U1VA 1E5TA 1TUIA 3RPEA 3BIJA 4KGXA 4BNDA 5BRAA 3I52A 4BEWA 4JBXA 3IE2A 2ZM6B 3L0DA 1PDOA 4RKQA 3DFUA 4KKXB 1D4FA 3GQBA 4TYMA 1YGYA 3GBSA 3IUYA 1FDSA 2I7VA 4TWJA 3LNTA 4BGDA 2AG0A 2EIHA 3JATA 1ISIA 4Q48A 1N5KA 2CVQA 1Q1ZA 2XZDA 3LM8A 1B76A 2W70A 2BUAA 4KFUA 1PEYA 1Y3AA 4OX9Y 1K68A 1I7LA 2VLBA 4JKIA 4DSZA 5BV7A 4NARA 4CKBA 3DCYA 2AUNA 5AJUA 3AI7A 4I4TA 1EFAA 2YUIA 4BNVA 2AG5A 5GONA 4B4KA 4OQLA 4IVNA 5CPBA 2RK3A 1MF7A 1AUVA 3QKSB 5KMGB 1KEWA 3NLLA 2NYAA 5ADHA 1NFQA 4X1YA 2ZYAA 4KIJA 1VG9B 1O94C 3GU3A 1VL2A 3NH9A 4WE3A 4IO1A 2XXAB 2QRMA 3N5KA 3RFXA 2IS1A 2C2XA 4OVKA 2PUHA 3DE2X 3V4RA 4IVRA 5CA0F 4DG5A 4QJ5A 2WU1A 4R2HA 1ZEMA 1EB8A 2VP9A 3KR1A 1RJGA 1I3MA 1IULA 2I91A 2XH8A 2E1PA 1T8TA 1EWTA 3C5CA 4D43A 2ZUEA 4R8MA 3QNMA 5A06A 1UDCA 5HQJA 2PM8A 4C43A 1AZTA 2ID8A 4RVUA 3JQ6A 2I8AA 1L7NA 3IALA 3HFJA 1IU9A 3MXOA 3T0IA 1LRLA 2ORED 4XCQA 3BQNB 2YFQA 1M1NA 1JDSA 2WF7A 4BQFA 2QIOA 2C8LA 3EQ7A 3HN2A 4IX1A 4Q1VA 2RJNA 2G9NA 2HH9A 4N1AA 5GINE 2I1VB 1KDZA 3LS2A 3EFEA 4I50A 1BMFD 4ER7A 1BFDA 1G21B 4WK6A 4A8PA 1YS2X 4LSMA 3GMIA 3KSAC 3WJ1A 2HSGA 1SVIA 1G3QA 2P9TA 2VXCA 5TEVA 4YRAA 4ROSA 9LDTA 1FPMA 4YRJA 1WW3A 5C51B 3L01A 4RX1A 2V0NA 1FUIA 4Q7QA 1KP2A 2FPIA 3IKVA 2HWKA 4FEAA 4QARA 4WNAB 3R7BA 1WZCA 2BKLA 4A15A 4NULA 3HP1A 4KQ6A 1XZQA 1ZWLA 1NSYA 2G25A 2P1ZA 5ALIA 1DAMA 1D5CA 1T5LA 3DFFA 5DK4A 5AR1A 3ZWVA 4ZOAA 1Z56C 5KYYA 1IBMB 2ZWMA 3FUUA 5K8TA 1NVBA 4ZJYA 5JTTA 1GCOA 2XLBA 5GP1A 3ICVA 1NT4A 1WUKS 1Z88A 3A10A 3RUPA 3YASA 4OM8A 1X19A 2RGNA 1OWPA 2C5SA 3DXXA 3K2EA 4XQEA 4DRXA 2HK9A 4EHNA 4H3SA 2ADFA 1T15A 4TQ9A 5CB8A 2M6RA 3BSFA 1YFKA 4YQYA 3C6BA 4LRYA 1N2EA 4YECA 4G4GA 2F48A 3ESAA 5J43A 1UJMA 4KWHA 4COKA 3IFSA 5KNBH 1P4RA 1Q1BA 4BP3A 3ZGVA 2GYWA 4YRBA 1MX1A 2Y68A 5TRTA 1AT1A 1DOZA 2H54A 5I7VA 4KREA 2WOOA 4NYJR 2XUIA 4S35A 1RQRA 1NPTO 2QTTA 4JEIA 3O1LA 1MHPA 2BFBB 3ZEAA 1SOWA 1WJGA 2Q3BA 3OMWA 4K6MA 4NDAA 3V97A 5JAMA 1MW9X 2QTMA 4NV3A 1IBLB 4MARA 1E6UA 3AB8A 2IFTA 5BVHA 5JAUA 5EE3A 2LP4Y 2PDAA 4YV1A 1E1QA 4WNCA 3ZG6A 2M1XA 2RBEA 2ZCUA 1KZGB 2QVBA 3IMGA 3QOXA 1KU0A 5DXFA 2P27A 3VTAA 3VH4A 3DZFA 3HQ4O 5CGZA 4DJJA 4HUTA 5HZHA 1PK9A 1KJ8A 3RSOA 5B57C 3O8CA 2AOVA 4RJ2A 2CHGA 1M34E 4LECA 4AXBA 5JD6A 3ADCA 2PT9A 3QVUA 4KAJA 2MSLA 1SCBA 1XAGA 2Z4TA 2A9QA 2RGXA 1FXWF 1NQVA 2PX3A 2XA2A 3WLJA 1NJ2A 1HDEA 1TQDA 4OIMA 3ZS9A 3IEUA 4Y9UA 3NG1A 3RF6A 3UPUA 3AEUA 2QYTA 4G4SO 1NWCA 4I9FA 4BHTA 3HEAA 2P0YA 3NNDA 4BMXA 2HHAA 2PYZA 4MWZA 2OHJA 5DMHA 2FUCA 5C80A 5ALHA 2NAPA 3HNRA 2IPLA 1E9AA 1H6BA 1N2SA 2ZBQA 4KFTA 1QF6A 4F8JA 2MINB 1YHYA 3DBRB 3V1KA 3I2YX 3DC2A 5AKZA 1VM6A 4N7RA 4J6EA 5IN5A 1JHPA 4FR5A 1ZG3A 1IN6A 2V7TA 3FR8A 3N8GA 1T9CA 5C8YB 2QUKA 4KU4A 3T99A 3VR3A 1DRVA 2VTVA 1JQ3A 4D57A 4MQBA 4XM2A 3DHYA 4RV4A 2G1UA 3UFXA 1B3BA 1XK7A 2NZJA 4JOSA 4JP3A 4PPGA 3OIGA 3UJAA 4GR9A 3STUA 1BMDA 1TVEA 5EVCA 3M4JA 3C8DA 4RNCA 3KZVA 4C2AA 5JH7F 4RQUA 2OFPA 3BEDA 3LZDA 4B6RA 4TT3D 1TC1A 1JEYB 3G1WA 2QRHA 2X3YA 4MV1A 3PQEA