3QWFA

Crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
261
structure length
261
Chain Sequence
TYIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17beta-hydroxysteroid dehydrogenase
publication title Structural Studies on a Fungal 17Beta-Hydroxysteroid Dehydrogenase
pubmed doi rcsb
source organism Cochliobolus lunatus
molecule tags Oxidoreductase
total genus 104
structure length 261
sequence length 261
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qwfA00
1NHWA 2TMDA 1X7HA 3JYQA 4WUVA 4ZVVA 1LDGA 5A02A 3BHJA 4QT0A 4AJOA 2D59A 3JQAA 3ZHXA 4JN6B 2QZZA 5JNLA 2Q99A 4CM7A 3PHLA 4BUCA 4DWVA 1I0ZA 3CXRA 1QV7A 3AU8A 2JKVA 1KYQA 3ZWNA 4N5LA 1N9GB 4ROSA 1GUYA 4ALKA 3BIOA 4D3DA 3QY9A 2E4AA 3DQPA 2BELA 2C07A 1HDXA 2NNLD 2YHIA 1ZK4A 4XRRA 5L53A 2RBEA 3RBXA 3IJPA 3Q2KA 5FI5A 1LNQA 3RUAA 4JP2A 4XD2A 3O8QA 2E49A 4PG4A 5K0ZA 4NBWA 3C7DB 3WGHA 2VHWA 4G5HA 1H5QA 2X6TA 3AI3A 1DC4A 3EW7A 4BNLA 5DZSA 4DGSA 3Q9NA 3ZV6A 1VL0A 5FF9A 3M1LA 1Y9EA 3QWIA 1KERA 2J3JA 3D4PA 3L9XA 5A9SB 1YB5A 3DONA 4M89A 5CDSA 4C7JA 1O94A 1WAMA 1TI7A 4E2YA 3PHIA 3AFMA 4LMRA 1CF2O 3HADA 3S8MA 2VYND 1DIRA 2GLXA 3PGXA 4NMHA 1AE1A 1YRLA 2HJSA 3VKVA 1R4NB 4NNJA 4YT4A 5K9ZA 1XDWA 4BQRA 4DTIA 1RM0A 2J3IA 4PLVA 1U3UA 4D7AA 1YL5A 1KIFA 5L4SA 1Y5MA 1DIGA 4IJWA 3RFTA 3MWEB 3QRWA 4WLUA 1QLJA 2YV3A 1SBYA 1PGNA 3NAQA 3KYDB 3VC7A 5I8WA 5ER9A 3FNGA 4MVJG 1SPXA 3VPFA 2GERA 2IE0A 3LT2A 1DB3A 2RHCA 1V3UA 4BMVA 2ZB8A 3KB6A 3OA2A 4Y9DA 3ZHZA 4OSOA 2PD6A 3U4IA 4WLNA 3W4KA 1FF9A 5A06A 4I1IA 4D0RA 1B8UA 3ICPA 1U2DA 2V6FA 4R51A 5AYVA 1DFIA 3MEQA 4Y8VA 1DO8A 4R1NA 4NJMA 1P1JA 4P4NA 4I9NA 5F5LA 1GTMA 5BNTA 4AFNA 2JCYA 2WDZA 3HWRA 5G0SA 3E8XA 4LRTB 3WQQA 3D3WB 3ULKA 3OFSA 3PGJA 2Q4EA 1H6AA 3DBHB 1D1TA 1ULUA 2RHRA 2IODA 3MTJA 3PWSA 2UYYA 3FBGA 2FSVA 4LCEA 4RDHA 2OXIA 4YDRA 4B3JA 4IGEA 1SO8A 4KUEA 1Y81A 3TZCA 3C85A 2NSDA 5JO9A 4PLPA 1EBUA 2Y1FA 3WOHA 4M49A 4FOSA 2P4HX 4PGFA 1I2BA 3JQ7A 3GHYA 1NFRA 4WCFC 3ZN2A 5B1YA 5KVVA 3EVNA 5L4LA 4R54A 2EKQA 4FGSA 1MG5A 3F1KA 1HYHA 4CM5A 3DXFA 2Q1UA 4GI2A 1HDOA 3TOXA 3ROPA 3EGOA 3BAZA 4IZHA 1J4AA 3MCVA 1XQ6A 2YZ7A 4A5OA 1XSEA 4D41A 1QKIA 1LRJA 1YOVA 4R1TA 3ETGA 4CMGA 4MVJM 2F1KA 4R01A 4TKMA 4YCAA 3VOSA 1WNTA 4W4TA 2OORA 2PV7A 1QMGA 1Y8QA 3COSA 3WX0A 1M76A 1PGOA 4WEOA 1IE3A 1RM4A 1WDKA 3HG7A 3WNVA 1VKOA 1VSVA 3SX2A 4E5PA 2PD3A 3PIDA 5T64A 4S3MA 2GNAA 1XU9A 5I9MA 1E7WA 4W99A 3K2EA 1NVGA 3GNSA 2GN8A 4Z0TA 3AUAA 1NYTA 3HN2A 3NTOA 2W98A 5CDTA 3KV3O 3DOJA 4F6CA 3WGGA 3GT0A 2Y99A 2XAAA 1GCUA 3ANNA 4MVJA 2JHGA 1HDRA 1IPFA 1JKIA 1H6DA 2POQX 4KWHA 4ND2A 5JSFA 2O2YA 4CMJA 3A9WA 3BHMA 1QYDA 3GUYA 1MLDA 1K3TA 1J0XO 2YHUA 1C0IA 4U8GA 1GDHA 5TLSA 1CWUA 1CERA 1ENOA 2GCGA 2X0IA 2BGMA 2HK8A 1NQ5A 2ZB4A 1V35A 1K6IA 4J16A 1UXJA 2ZQYA 4B3HA 2W8ZA 4XR4A 1HZZA 3K6JA 3UF0A 5JC8A 2GN4A 4RVUA 3AJRA 3B70A 4MIEA 1QORA 1XG5A 1SC6A 1I3KA 1U3WA 3M6IA 4BKUA 5I7EA 3EC7A 3GZNB 4YXFA 4FN4A 1HT0A 3PJGA 2P91A 5JY6A 3AFNA 3QIVA 2X5OA 3ZNOA 2G1UA 3I4CA 2FPPA 2Q49A 1NQTA 4XQGA 3I9JA 4HFRA 3QHAA 5GMOA 3WGOA 3OEWA 3ZV5A 5L4NA 3RFVA 3NT4A 4RPHA 3WLFA 1T4DA 1KEPA 4ZA2A 1OC2A 1QYCA 2JFGA 1CJCA 1H0KA 4IUYA 3WBBA 1IUKA 4FOOA 3P5SA 4XB1A 5EN4A 4N5NA 4ALJA 1YL6A 3ZWMA 1IL0A 1DRWA 1ZCJA 2VWHA 3OIFA 3R1IA 1NQOA 1UXIA 2HQ1A 3I6IA 1LX6A 2EJWA 3STHA 2F00A 2Q2QA 3L6DA 2BI8A 3VZSA 3OJLA 3EAGA 4PVCA 5ILGA 3PJEA 4YRDA 4CMHA 2I9PA 3GEGA 1J49A 2YFHA 5JMWA 2QQ5A 2IYPA 3FSRA 4IDCA 4ONEA 4P4LA 5I8ZA 4PG8A 4FPXA 1F12A 1LC3A 3O8QB 1DSSG 1DOHA 4CMEC 4NK4A 3K31A 3TZ6A 1DLIA 4GAEA 2D3TA 3PYXA 3C7AA 3H3JA 1NFFA 1U4SA 4WECA 4Q3CA 4TKLA 3E48A 1E3EA 1TVEA 2PZLA 2E82A 4B8ZA 1KEWA 1YVEI 2Y1CA 3BMQA 4FC6A 4CJXA 3C1AA 4WE3A 2WTBA 2ZKLA 1HLDA 3JSAA 4J4HA 3U3XA 2DPGA 4P4GA 2C54A 1GUZA 5T57A 3RU9A 5EESA 2Q4BA 1UZNA 1E6WA 1H93A 1HDCA 1V3VA 5G4KA 7MDHA 3SLGA 1E1LA 4OQYA 3V2GA 3WBFA 2C2XA 4ZN6A 4M1QA 4JGBA 4RPGA 4D46A 2PKQP 4R3WA 1BXZA 2HDHA 3T4EA 3R6DA 4NU6A 1B15A 3L4BA 1N7GA 3GFGA 4C4OA 4OOFA 2ZIZA 3P19A 3DR3A 5KKAA 1P77A 3I9LA 4XCVA 5ITWA 2A92A 4LCJA 2PKQO 4YEDA 3ON5A 3LU1A 1F0YA 2C59A 3GEMA 2VCYA 5KNLA 5L7TA 3I3OA 4UVEA 3DMYA 3QLJA 1SOVA 4EZBA 2HSDA 4ZQHA 3ASVA 2ZCVA 2DBZA 2DTEA 2X0NA 4QUKA 4DUPA 4HV4A 1TA4A 2QIOA 1UAYA 5DT9A 1NXQA 4CLEA 1LSUA 1GYRA 1TB4A 5L7WA 1NPTO 1XYGA 3PDJA 2HMTA 1E1NA 1QG6A 4BO7A 1D8AA 1PS0A 2O50A 3VH3A 1U1IA 1I2CA 1DAPA 3PYLA 4XRGA 3EK2A 3RKRA 3TJRA 4RF2A 1N1EA 2J5KA 3GUCA 4WLOA 2X58A 1LDNA 2HMVA 1HWYA 1ORRA 1VSUA 4OJNA 2R6JA 3BMNB 4B3IA 5DCWA 1ZW1A 5FI3A 2FN7A 5GY7A 4J1QA 3TOZA 4Z9XA 5L9AA 1P1RA 4NU5A 3GGGA 3G79A 2I5PO 2OL4A 5AVOA 2AMFA 2CF5A 1KC1A 1LRLA 2A94A 3AI2A 1G6KA 1QYXA 2WWRA 5DNAA 1Q1NA 4KQWA 5JLAA 1KC3A 1ONOA 2WSBA 3UH1A 4WEQA 3VZRA 3DEYX 1BDBA 1L1FA 1MC5A 2AQHA 5KCZA 1N9GA 5CG1A 5T8KC 4LGVA 3U62A 1WDLA 4L9RA 4MO2A 3AY3A 1B7GO 1HYEA 4L8VA 3TL2A 4GMFA 1T2FA 3FHLA 2YYYA 3TL3A 4DPMA 3ZWWA 1Y8QB 3PHGA 1GY8A 3H9GA 3PP8A 4AJ1A 4BMSA 5KJ1A 3FWZA 3I83A 1T26A 1R6DA 3BMCB 1Q0QA 2NU9A 2BMAA 4YJGA 1I8TA 3A06A 3JQEA 3CPSA 3V1TC 1D4FA 4CLOA 2CD9A 4AG3A 5BSFA 3GOHA 3DFZA 1O95A 2NWQA 1H9AA 3M2PA 2VRCA 1WWKA 4R3NA 2RIRA 3ADPA 3JD1A 1H6BA 4UEKA 2PZMA 2Z5LA 4UAGA 1YGYA 4ND3A 4E13A 1A9ZA 3RUEA 1OOEA 2YV2A 3DWFA 3E1KA 5IZCC 5ILOA 1R4NA 1DC6A 2D5AA 5FYDA 4NK5A 4CODB 4BB6A 5EMHA 5DCUA 3WR5A 1T1SA 4RDIA 4GMGA 1M6WA 3UN1A 3WIDA 4FFNA 4EBFA 4CLRB 5A5EA 3DO5A 1UP4A 1C3VA 1LU9A 3QSGA 4J4TA 5IJZA 3ANMA 5FEUA 1NR7A 3L6EA 5EL0A 4D3FA 5L51A 2NVUB 5A9RA 2NTVA 3JQFC 3KBOA 4GX1A 1W4ZA 2DFVA 1PEDA 1E77A 3GG2A 1S7CA 1LJ8A 2W2LD 1YQDA 5EQFA 5TC4A 4RLHA 3VDRA 1WZIA 5BQFA 2WM3A 3BYZA 4IJKA 4O6VA 1RJWA 5DOZA 3CTMA 1B16A 3Q9UA 3LF1A 2P9GA 2BKAA 1LQUA 5CHEA 5DN9A 5KOIA 3RC2A 1V6AA 3S2EA 4PCVA 3WFJA 3E9MA 5IN5A 2DBRA 3GQVA 3D3WA 1T1RA 4FFRA 4XJSA 4BO2A 1NX6A 1CDOA 3IC5A 3DBHA 4KP7A 5JS6A 2EJVA 1X0XA 2Y66A 4CM6A 2QZ9A 1EQUA 3LC7O 2VWGA 4BNKA 1A71A 1NASA 1OMOA 3AM5A 3KTDA 3DZJA 1EBFA 3OJ0A 4DQVA 3W4IA 1E3LA 3JYPA 4Q39A 3PI7A 1GPJA 4MVJF 1P33A 4XB2A 4I08A 3H8VA 4ZGWA 3LT0A 8LDHA 2B36A 1GAEO 5CEFA 4FR5A 1FDVA 3D4OA 3OICA 3I9KA 1LRKA 4JXKA 5G0UA 1WW8A 4B7XA 3EZYA 3AWDA 4P8RA 4GGPA 4UUPA 4J1NA 1G0NA 3NKLA 3Q0EA 4A27A 1J5PA 3PLRA 2VYNA 1P44A 5LDHA 1L7DA 3W6ZA 4CM9A 1LDBA 5L45A 4K9DA 3OECA 5I7VA 1YJQA 3DZFA 3QJ5A 4YJHB 2NM0A 1DPGA 1LLQA 3GN2A 1EFKA 4FD3A 2NUAA 4RVDA 4Z3KA 2ZYDA 4JJGA 2CVQA 3E9QA 4DC0A 2AG8A 4N54A 2D0IA 4ALNA 5J23A 2OBYA 2GYYA 3RUFA 3DHEA 4HY3A 1HLPA 1NFQA 4IDFA 2RH4A 1YONA 2UAGA 1ZK1A 4CQLB 3NT5A 4XQ9A 4EITA 1E3JA 1UAGA 1AHHA 3BMQB 4H7PA 4KTVE 3OETA 1F06A 2EEZA 4OM8A 3GN1A 2V6GA 3RJ9A 2DFDA 4XGNA 3QW2A 1GZ4A 3FN4A 3T7EA 4XEHA 5G4KB 4RVGA 3TZQA 1T2CA 3GMDA 4TMFA 3ADOA 3WB9A 4BO6A 2R00A 1CIVA 4YAEA 1O6ZA 1RKXA 1H2HA 2C7GA 2ZB7A 1WLYA 4I8XA 4A73A 1E3IA 3NGLA 3D0OA 3ST7A 1LEHA 3HE3A 2EW2A 1ADGA 1LXCA 1QXSA 3RBVA 2C7VA 1O5IA 4RPLA 2BFMA 5L3ZA 1B8VA 3AUTA 2I6TA 4ND4A 4KDFA 4Y67A 4KUHA 4CR6A 3DZIA 1NHGA 1DJNA 3GDOA 4AJJA 5A1TA 2BGLA 1PZEA 1KEUA 2XXBA 2PWZA 4BVAA 3KETA 1TEHA 1OC4A 4X54A 3K30A 1A4IA 1MP0A 2CMDA 1MFZA 3JQ9A 3RBZA 1GEGA 2C5AA 4S1VA 3A1NA 1BVRA 3GC6A 2D4AA 3DBLA 1ZBQA 4A7PA 4AICA 4NBTA 2W2KA 1GYPA 1HE3A 3NYWA 2FRDA 5IN4A 3DMTA 3KEOA 4BQPA 3H2SA 4YYZA 3QA9A 2OP1A 3RUIA 3V5NA 1U3TA 3R0IA 5T5QA 3D5QA 4TQGA 1CQIA 1Y9AA 3PQFA 3I6QA 4GSLA 4QSMA 5F5NA 1XHLA 2AQIA 2O4UX 5T6BA 5F1KA 4AJEA 4GSKA 3B1JA 5I7SA 1IHXA 1R12A 4E33A 1XIVA 5BSGA 4P22A 3B1KA 2NV6A 2XPCA 4QTZA 3WYEA 4CQMA 2FSSA 4HFMA 4MINA 5B4UA 4IINA 3HUDA 1R15A 1PJCA 4W82A 5C7IO 1PR3A 3LK7A 1VM6A 2OO5A 3DZBA 3HHPA 1P3DA 4XQEA 1HRDA 1PU2A 1U5CA 4A26A 1LDYA 6ADHA 5KVCA 2Y68A 4L4RA 2G0TA 4EW6A 1WXDA 3C24A 3JQGB 4R9SA 3W8DA 4EJ0A 5DBFA 4OO3A 1DRVA 4MKZA 3KEQA 5TGDA 1WZEA 4DMLA 1JN0A 2HRZA 4XWYA 4YJGB 3HJAA 1SNYA 2B83A 3C7CB 4UUMA 4CLOB 2Z1MA 3TN7A 2VHXA 4L73A 2WE8A 2P9CA 3I9NA 3GAZA 5TJ9A 2V7PA 4ID9A 3D3EA 1YDWA 2PZJA 3RUCA 2AE1A 4CR8A 3ZU3A 3OQ6A 5IDQA 1WP4A 3I52A 2YY7A 3ZWPA 4XYLA 1Y5RA 1ZMTA 1FDSA 4CM9D 1Z7EA 2BD0A 2G17A 4Z3DA 4ND5A 2O7QA 4BKRA 4J0FA 2VTDA 5TSDA 3D4NA 1HYGA 4NPCA 3PEFA 1LA2A 4M54A 1SOWA 4ALLA 1C1DB 4CV1A 4WASA 3IAHA 5AXDA 3IKVA 5U4QA 4DYDA 2RCYA 5HM8A 1JW9B 3WIEA 1IULA 2AEFA 4JK3A 4RLSA 1NBOA 4E21A 1E7MA 5A3JA 1EDOA 4IZIA 4INAA 2PGDA 3F3SA 4CL3A 2VHYA 4XIYA 1U2GA 1E1KA 5EERA 1XCBA 3GEDA 1I3MA 1JVSA 2DC1A 2QYSA 4TWRA 4E5YA 4B4UA 1BXKA 3SJ7A 3ORFA 3KYBA 4BGUA 1BW9A 4YJFA 1ISIA 1O9BA 4E6PA 4IM7A 2AG5A 4D44A 1VL6A 5B4VA 3F6YA 4KMSA 3GZ4A 5KKCA 2DTDA 2JCVA 2OMEA 3BTVA 4TSKA 3RVDA 1E5LA 1ZVMA 4W6ZA 1HSOA 4L0QA 3OF2A 1E6UA 1ENYA 3HZZA 3CE6A 4U0KA 2Q46A 4PG5A 4CPDA 2VWPA 5JFOA 1PJ4A 4IBOA 2HK7A 2VT3A 4FJ2A 4WPGA 1Q0LA 1ISGA 1ZK0A 1LLCA 3RASA 2AW5A 1E6EA 2O3UA 4K26A 3AY7A 3BMNA 1F8FA 4JP3A 4DPLA 3H5NA 4OAQA 3TFOA 1R0SA 5HA5A 3GNTA 3IMFA 4I5GA 3Q2IA 4WLEA 3RFXA 4LRSB 3PJDA 2X7HA 3ZWVA 2V65A 2UV8A 3WSVA 4Z9YA 3D64A 3U4DA 3AM3A 3I23A 1GUFA 4CMBA 1UZMA 3NDJA 4HADA 4WLFA 4TVOA 3ZNQA 3ZU4A 5A4DA 1QYWA 2OBNA 1PZHA 3RAJA 1YKFA 2Y0CA 4RPKA 2P2SA 2X86A 1U28A 5DDIP 1GCOA 2X5JO 1NTOA 4BKOA 2O4CA 3D7LA 2WJPA 5H83A 1EVJA 3BMCA 3E5RA 3JQCA 3WJAA 4KDEA 2YDYA 4BO9A 1TT7A 3M1AA 4BO0A 4YAIA 3QVTA 2CSUA 3ZWBA 4DVJA 2WEKA 2YDXA 3GHHA 2AXQA 5DULA 2VNAA 3E6AA 4HNHA 2D1YA 4CQMD 3N58A 1EVYA 3OH8A 4DPKA 4OH1A 5BNIA 1LBEA 4Z9FA 3RD5A 1JQBA 3VPHA 4QFDA 2QRKA 2IRWA 2JAPA 1DIBA 3AOGA 3AOEC 5GZ6A 5BNFA 3L4BC 2C29D 3F47A 2DM6A 3S2FA 3GRKA 5C7LO 2X9GA 5ITVA 3C8MA 2VOEA 2FZEA 3D1LA 3KRTA 1K89A 3VTZA 4E5NA 4CLRA 1DXYA 1BWSA 3LZ6A 3O4RA 1LLUA 3WQRA 3IDSA 3NDRA 4A03A 4OXYA 2NVUA 5TT1A 4FIZA 1ZKMA 2AHRA 3W8EA 4Q3BA 2ZTUA 1W0CA 3WGTA 2GN9A 3K96A 3MJSA 3C1OA 4O5OA 5EINA 4BV9A 2IZZA 4YQYA 4CMIB 3DBLB 3OMLA 4BMNA 5I9LA 2W2KB 3H9JA 2J3KA 3PZBA 3WMWA 4II3A 1Q7GA 4HNGA 2AEMA 4BGIA 4Y6RA 4WOJA 5C3MA 1ENZA 3Q11A 1C1XA 1ZJZA 1CQJA 2DBVO 4FFPA 4GVLA 3GAFA 2P5UA 1GFSA 1T2EA 1XELA 3UXYA 1MG0A 5IG2A 1GL3A 1P74A 4LVCA 2VZ0A 3OP4A 5IDXA 4BGEA 1RM3A 3VTFA 4DREA 4OXKA 2WYVA 4CQMB 4PLGA 2P4QA 4K1LA 4EYEA 1IZ0A 5IZ4A 3PRJA 4IXWA 4MJLA 1Q2XA 4RPJA 3PYMA 3PQEA 4IQ0A 4PLCA 2OUIA 1E5QA 5TQVA 2GO1A 5JYDA 5AXBA 3EVTA 2ET6A 3PFFA 4NBRA 2ZQZA 3JV7A 2CDCA 4M8SA 4ZJUA 2I99A 3IUSA 3IP3A 4U6QA 2HMUA 3PPIA 4ZRMA 1H2BA 3FD8A 3NUGA 4J1SA 1GADO 4YJHA 3TF5A 2CDAA 4I9UA 3WYCA 3UCXA 3K9QO 4A10A 1PJTA 1UXHA 4XDZA 4LSMA 4CV2A 1XR3A 1KVRA 5TT0A 4EUHA 4DBVO 4N18A 2VHZA 4CLHA 1T24A 1NR1A 3GK3A 4CQLA 1ENPA 1PS9A 1I2ZA 1ZXBA 4H15A 4PZDA 5A03A 1NM5A 2W2LA 2C82A 1KY4A 4BNJA 3QWFA 3IQDB 4DL9A 3OSUA 4BL5A 2C0CA 1WMAA 4CM1A 1Z74A 1HE4A 1HZJA 3Q1LA 3IJRA 5ICSA 1E92A 3F1LA 4PLWA 4PZEA 1H9BA 5F1PA 3GNQA 1ZK2A 4UULA 3RKUA 3U4CA 3ZW8A 5LC1A 1Y7TA 1PS8A 3WNQA 3AOEA 2HKIA 3QVSA 1X7DA 4FCCA 4GGOA 4BNFA 1V8BA 1F14A 4FS3A 1KOLA 2WD8A 5TIIA 2Q1WA 1BMDA 4FQ8A 5JAIA 4W9NA 1P0FA 1XEAA 1BHSA 4BO8A 1RPNA 5HBRA 5CDYA 1E7RA 1RWBA 3ANLA 5KIAA 1F17A 1GPDG 4GX5A 4ALMA 1BW9B 3FF4A 3QQPA 4YJFB 4L76A 3CEAA 4MVJE 3RUDA 1AUPA 1LLDA 3ZHBA 2HUNA 3AI1A 4AJPA 1NWHA 3EYWA 1SB9A 2FR1A 4CLXA 1P1HA 4DQXA 2PFGA 2BFAA 3H5RA 3JYNA 3FRJA 4W7IA 2ZJ0A 2O3RA 3G49A 4Q3AA 3WS7A 2VUTA 2UVDA 3F46A 1PIWA 4NG5A 3BTUA 3INTA 3BXXA 4OYRA 2NVBA 3PXXA 3WGZA 5L40A 1XLTA 1AHIA 4NHEA 4U6SA 4J2HA 1KS9A 2EP5A 3B6ZA 4MP8A 2Y93A 1HL3A 4GH5A 4IDDA 3WWZA 1LSJA 1SEVA 3IOYA 5L7YA 1HXHA 1CRWG 1ISMA 3MOGA 3CUKA 4L75A 5KVSA 2JL1A 3NEPX 2IZ0A 3F5SA 3EUWA 2J6IA 4AJHA 4WKGA 4B4WA 3CMMA 1DIHA 2Y05A 4HX5A 1EUZA 5F21A 3GVPA 2EKPA 4M55A 4IS3A 4OHUA 2DBQA 4QQRA 3KLPX 4BO4A 3OA0A 1BSVA 4II2A 2EG9A 1UXKA 2B4TO 3GY0A 5EPOA 3NTQA 2JHFA 3H5AA 3JQGA 4GX0A 4R1UA 1PQWA 1V0JA 2FPGA 2NADA 3GVCA 3H65A 4J6FA 4D43A 4FSHA 5GZ1A 3RROA 3ZWCA 4CMCA 3OIDA 3ENKA 1M6HA 1B0AA 4E12A 5JXWA 1PL8A 5JAMA 3HB4X 5COAA 1PJQA 1I5RA 3I4FA 3ZW9A 1B3BA 1QP8A 3BHIA 3H7AA 4R9RA 5TNXA 1FK8A 1W8DA 2BI7A 2X4GA 1IYZA 1Q7BA 1OFGA 2E6UX 2Q2VA 4JLWA 5H81A 3QWAA 7ADHA 4CUJA 1Z73A 2R00C 3SC6A 1I3NA 4U5QA 1Z75A 1X7GA 3GMSA 5DP1A 3SLKA 1HDYA 3TZHA 4YRAA 4HXYA 3LLVA 1S6YA 3LC2O 4H16A 4DIOA 3IKTA 3WG9A 2BGKA 1XGKA 2EERA 4WNCA 1PWXA 2X9NA 3PHJA 1WMBA 1UUFA 4PIVA 3FI9A 5IAAA 2CZCA 3RUHA 4I5FA 5HS4A 1YO6A 4NFSA 1KVUA 1AXEA 3INGA 5TF4A 4RL6A 1C1DA 1JKFA 3SBOA 2DVMA 1JWAB 1ZEMA 3JQ9C 1EUCA 4HKTA 1X1TA 4NBUA 3U49A 5CEEA 3E18A 4R4JA 4XZ3A 3HDHA 4JCOA 3IL2A 1GR0A 3DMTC 3NT2A 1P9LA 1VLLA 4BNUA 2H5LA 2O7SA 4GX2A 3WLEA 5JDIA 1TT5B 3AU9A 1B3RA 4G65A 4F46A 3GVIA 4PG7A 3VKUA 1C1XB 1ADBA 3FBTA 4D79A 1IB6A 5KTKA 1Y8RB 1FXSA 1N5DA 1YL7A 4CL8A 4CMKA 4CV0A 4RVHA 3WYBA 4E30A 2OOSA 5IXSA 2I3AA 2FWMX 1PGQA 2DQ4A 4Q9NA 5CPBA 1X13A 5TS3A 2IDZA 3L9WA 4JBHA 5T67A 4YTEA 1XA0A 2CVZA 1UP7A 5AXCA 3ENNA 4BNYA 3KXDA 2EGHA 2TMGA 4LISA 4RORA 4D45A 1LSOA 1NAHA 3NX4A 2D5CA 3F5QA 4PLTA 3WMXA 1PQPA 3I9OA 2O48X 3OEYA 4KTTE 3ZWAA 3FTNA 4IXTA 3X2EA 4K6FA 5IF3A 1ZJYA 3H4VA 4BV8A 1LTHR 2OGUA 4WLVA 4EJMA 6LDHA 2VZ8A 2EF1A 4AJNA 1EE9A 1EVZA 4B4VA 2ZCUA 3LT4A 2VT2A 3RCBA 3RC1A 2QRLA 3DBVO 5I7FA 1JA9A 4EUFA 1G0OA 3KSUA 4R68A 1JAXA 4HP8A 3DZGA 3ONFA 1I24A 4E2WA 3H3FA 2Z1NA 1J6UA 2AEJA 4YA6A 3VPGA 2EW8A 5MGBA 1JWBB 4XYGA 2GRAA 3DTYA 4J7UA 4PLZA 2HMWA 3UCEA 2FY8A 4IGFA 4MKRA 2GZ3A 2I65A 3RJ5A 2ZK7A 1EK6A 2JD2A 3TNLA 1D7OA 3GPIA 1OI7A 1K2WA 1P1IA 2VNSA 4E2ZA 3WXBA 4GLOA 1ID1A 1QV6A 5JDCA 4RVFA 2BHLA 3ZI0A 3B20A 3DAPA 3HB5X 1ZO8A 4IY1A 4NZ9A 4AVYA 3PQDA 5C7OO 3OQBA 2YW9A 4BHTA 3ICCA 2Y1OA 1I01A 4JIGA 3W1VA 3LSYA 3OJFA 2FOIA 4DA9A 1XKQA 5IDWA 2O3QA 4IDAA 3WGIA 1N8KA 4YAKA 3TQHA 1HF3A 1WPQA 5JMPA 1HETA 4XR9A 1UH5A 3TPCA 1K6JA 1PQUA 3JQ6A 3K92A 4YVFA 2C2YA 4GKBA 4URFA 5DBIA 3HQ4O 4B7CA 3E9NA 5CFZA 3JD3A 2DU8A 2EV9A 2ILTA 4E32A 2PGJA 1GZ3A 3WTBA 1QLHA 3GFBA 3QE3A 4KQXA 2DTXA 2J8ZA 1P1KA 5G0VA 3ZV3A 2X23A 3IIEA 2VYVD 1BVUA 5F3RA 1EUDA 4CMIA 1FJHA 2WYWA 1Y1PA 1ZSNA 4UVDA 4CM4A 4ALIA 3BZUA 3ETEA 3JYLA 2ZJ1A 4NI5A 4XKJA 3QWBA 1TLTA 4BNNA 1UDBA 3DHYA 4MPDA 5U9CA 4RCVA 4UVIA 3WDSA 3UW3A 3RU7A 4DLAA 1PSDA 2WD7B 5JY1A 1NAIA 4PFJA 1ISFA 2HO5A 1U5AA 1DIAA 1P31A 1K0UA 2X0JA 2UDPA 2B4RO 2DUWA 3TZKA 4YT8A 2GUGA 4L4SA 4BKPA 1KVSA 5A3VA 1ZUD1 2NQTA 4N7RA 4BIIA 2X8LA 1I3LA 2V6MA 1HDGO 4JBGA 2GPTA 3HN7A 1DDOA 3MWDB 4P38A 3SC4A 3PDUA 2G82A 5FFFA 2DLDA 1EDZA 3OQ1A 1RYDA 5C37A 3DL2A 4XYMA 1VJTA 2PKRA 3PIIA 1BGVA 4YJDA 1A7KA 2QYTA 2HK9A 2WYUA 4M87A 5JCJD 1C0LA 1SMKA 3ZZNA 3ZU2A 4ZD6A 4NFYA 4TROA 1O0SA 5DOVA 1BXGA 1PJ3A 1EMDA 3ZWOA 3KOUA 4IDEA 4XQCA 4A0SA 4OL9A 4DLLA 2BLLA 5KJFA 2O2SA 3PK0A 4RF3A 5A05A 5TRTA 1QSGA 3G3EA 2ZTMA 1ZZEA 2VTEA 4O59O 3T7CA 4EGFA 2I3GA 3KSZO 3VDQA 3HSKA 4FJ0A 2I67A 3RC7A 2D8AA 3RI3A 3O26A 3HDQA 4B79A 2B69A 4UREA 4Z0PA 3U0BA 5HTOA 4QO8A 3UKOA 2DPHA 2C5EA 5CDGA 4GKVA 1GV0A 2O3TA 3K2BA 2VZ9A 4ZRNA 3JTMA 1LI4A 1JDJA 5IFLA 1JU9A 2YFQA 3DTTA 9LDTA 3F4LA 3DZHA 1JTVA 3UAGA 3QVOA 1EE2A 2AE2A 1HSZA 3K8ZA 2QG4A 5B37A 3VH1A 3JCZA 3LYLA 3WQSB 3LDHA 1ZFNA 4HWKA 3MJTA 3I9MA 3QVWA 1W73A 1M67A 3FPLA 4ND1A 1H94A 4RGBA 5AQ1A 1IHYA 2HJRA 1NVTA 4FFOA 1PJ2A 3JQBA 5BSEA 4HFJA 1XQ1A 2Q1SA 3TDKA 1N1GA 1JKJA 1B2LA 3OJOA 2PZKA 4BNMA 1U9JA 4RQUA 5H82A 1UP6A 4U0JA 2CF6A 1ONNA 3KUXA 4YWJA 2B0JA 5EQDA 4CM3A 4RF5A 2G5CA 1MXHA 3WFIA 4FW8A 4OKNA 3G1UA 1X1EA 1T2DA 2ZYAA 3K5PA 1JLLA 1Z6ZA 1ISJA 3FTPA 1UR5A 3ONEA 4GL4A 2Y1EA 4MVJH 2PH5A 4E2XA 2EKLA 3CINA 4JROA 2EIHA 4FFMA 3PHHA 4LN1A 2B37A 1ZNQO 3ZU5A 1SCUA 2PY6A 1GZ6A 3A14A 4CV3A 4QECA 3GLQA 4CMAA 1E7SA 5K6AA 1NVMB 4OMUA 3WGYA 1ZEJA 4JBIA 1I30A 1IPEA 1T25A 3GPDG 1R37A 4Y6PA 4IDGA 1FDWA 1A7AA 3CSDA 3H2ZA 1MX3A 3Q3CA 1W6UA 3VH4A 2PGLA 4H3VA 4NR0A 3GR6A 4QFCA 1JVBA 4YQZA 2GN6A 2SCUA 3INRA 4RO0A 4TZKA 3ZCXA 3WICA 4ILKA 1L7EA 3LLSA 1F8GA 1PZGA 1ZH8A 4BNZA 1U3VA 3ZWXA 4C7KA 3P2YA 4PZCA 1GQQA 4XX0A 1MFPA 1AN9A 3HFGA 1R4MA 1I32A 4J90A 4JQCA 5AOVA 4QXMA 3G17A 4R41A 5CG2A 4YRBA 4AL4A 2EWMA 3G1TA 4RF4A 3ROQA 1BRMA 4GBJA 3UUWA 2CY0A 1UXGA 5HWSA 3ITKA 4NQZA 4DRYA 1RYEA 1MUUA 2DT5A 2Q1TA 4DC1A 2IEDA 3BTOA 1NP3A 2YV1A 5G0TA 3GF4A 4YB8A 4PLYA 4J7XA 4O1MA 3EZLA 2IXAA 5DF1A 2P68A 3QWHA 5BSHA 1N7HA 4WOKA 1C14A 5I9NA 4GWKA 1IY8A 1HE5A 3O03A 1LQTA 4HBGA 3RIHA 4O0LA 1NWCA 4MOWA 1K5HA 3NJ4A 3LQFA 4EI2A 1NPYA 2JD1A 3GDGA 1T4BA 3PLNA 1ZMOA 1PGPA 5U1PA 4BB5A 2Y0DA 4BNWA 4FB5A 4B8WA 2JAHA 2Q3EA 3U9LA 3JQ8A 4YAJA 3ZNNA 1VJ0A 2YQ5A 2IXBA 1CETA 4UVGA 3X2FA 2FR0A 4Y6SA 2YUTA 1LDEA 3CZMA 4JJIA 3N74A 1GEEA 4W9NC 1B26A 5JAQA 4DLBA 4FC7A 3R3JA 2Y0EA 3PFWO 1G1AA 4HFNA 3JQAD 3UFXA 4OQZA 1KEVA 3RQSA 4YPOA 1HDZA 1NPDA 3DAFA 3DZKA 1A5ZA 4J0EA 3MJEA 3GRPA 2R2GA 3AY6A 4RZHA 4CUZA 1Q0HA 2NACA 1YS4A 4F45A 4J49A 4AJLA 4CR7A 4EUEA 1TXGA 4Q3NA 1D1SA 4MDHA 2O3JA 2ZTLA 4LK3A 4FDAA 5LCXA 4CM4B 4AJKA 1TT5A 3SVTA 1DJQA 2GGSA 3U09A 1V9LA 2Z95A 4Q3DA 1O89A 3SEFA 2JFHA 3RSHA 3DFUA 4BNGA 1Y8RA 4CUKA 4XA8A 3KM0A 5ICMA 2GSDA 5G0WA 1SB8A 4NDNE 1BG6A 5LDGA 3LF2A 2CUKA 3F9IA 1YB4A 3OBBA 1ML3A 3E03A 4RV9A 4MVJI 4E4YA 1KVTA 3F4BA 1FMCA 1WDMA 2VUSA 1RM5A 2NLOA 1HKUA 1QR6A 5G4LA 3VZQA 4J1TA 3MJ4A 1P45A 1B8PA 1K6XA 2A35A 3H6KA 4YBZA 5CAEA 1PX0A 2XXJA 1ZSVA 4CM8A 1R66A 1UZLA 3V1YA 2GF2A 4GPD1 2WE7A 3UOGA 3VH2A 4DBZA 2VUUA 4LW8A 3QP9A 2A9FA 4B7UA 3UHAA 3L0DA 1OAAA 1ZSYA 1H6CA 2Y1GA 4IMPA 1BXGB 3BMOB 1I33A 1YE3A 4OXNA 4W7HA 5JAZA 2AA3A 3ROMA 3WJ7A 3JQDA 3CIFA 3V2UA 2LDBA 4XIJA 5MDHA 1PWZA 3L77A 2OP0A 3CKYA 3JQAB 5IDYA 4GLLA 1SAYA 4IQ8A 4BNIA 4I9HA 4OOEA 1GQ2A 5JC1A 3U4HA 3SXPA 2EGGA 2O23A 4TRJA 4WCFA 3MTGA 3A28A 1PL7A 2H9IA 3S2IA 3PTZA 3DBRA 2PK3A 1P0CA 1MV8A 4XJTA 3CZRA 1PR9A 3NTRA 5THKA 4RVSA 1E7QA 3EMKA 1A4UA 3H9EO 1O8CA 2YHIB 3DDNA 3JD2A 3HFSA 1EEHA 1NQAO 4JNKA 2XF8A 4WK6A 1PZFA 3KO8A 1YXMA 3OIGA 3W4JA 2V6BA 2P9EA 3FR8A 3GGOA 5EIOA 1Z7BA 3KYCA 2CDBA 3VHRA 1YB1A 4E5KA 4FFLA 1E1MA 4KWIA 4LMPA 1MC4A 1Y6JA 1M66A 1WVGA 3C1TA 3VPSA 1KY5A 1KBZA 5ENDA 3N7UA 3DAGA 3HNPA 1ISHA 4J9UE 2JJYA 4LVUA 4QX6A 1C0KA 3QV1A 1YBVA 2PR2A 1MB4A 3ITDA 2PA3A 2OHXA 3BTSA 2FHSA 2IEBA 3OJEA 4J43A 1HEUA 1XWFA 4BKQA 5CDUA 5G2OA 4XYBA 2Y67A 1BDMA 2HU2A 3VZPA 4EDFA 4WJZA 3ROKA 5JDIC 4YACA 5B4TA 2J5RA 1YBMA 2FP4A 3ASUA 3LC1O 2C20A 4TRRA 5JPIA 4M86A 5A9TA 1I36A 3KHUA 3GDFA 4NFHA 3TWOA 4MP3A 4XGIA 5KVQA 3EY4A 3V1UA 3ZH2A 4MKXA 3C3XA 1DC3A 4YR9A 3ABIA 4R5HA 5TX7A 2OZPA 3PVZA 1VKNA 4WNIA 3OHSX 4IDBA 2WD7A 3DB2A 2CNBA 2FZWA 2JD0A 4MIYA 4OKIA 1GQYA 2IYOA 2PTGA 3L07A 4IIVA 5JE8A 2G76A 2BFPA 1PJSA 4MVJP 8ADHA 5C5IA 3AM4A 3UCFA 3D5TA 3FNEA 2JCXA 1KETA 3ONDA 4NJMB 3ETDA 1E3WA 5BR7A 4IQGA 1HTBA 4G2NA 1KVQA 3PWKA 3DHNA 2H63A 2NTNA 3UICA 3B1FA 2X5KO 2QX7A 3PJFA 2PH3A 1FDUA 4EJ6A 1A72A 3P7MA 4MVJD 5HRUA 2GDZA 1U7HA 9LDBA 3GGPA 2Q45A 1R4MB 2VOJA 1X15A 1DEHA 4ZQFA 5HS6A 1MGOA 4ZQBA 4PN3A 1EVIA 5DCYA 1DLJA 3FNFA 1LC0A 2HRBA 5B12A 1N2SA 3FPCA 1UDCA 3MJVA 1GV1A 4IS2A 4ITUA 4ZQEA 4DMMA 2YJZA 2X1HA 1ULSA 1GYQA 4GQAA 4E0BA 1X0VA 4MIOA 3JQ7B 1MXFA 3IUPA 3JYOA 4TRNA 4WGGA 3AUUA 1GU7A 4BS9A 2E37A 2BRUA 2VN8A 3ZGYA 4A2CA 5THQA 4AJIA 4Z0HO 1ARZA 4ZQGA 2IZ1A 5KJ6A 4IJUA 4AJ4A 2Y1DA 1DRUA 4HUJA 4UUNA 5JDCC 2CVOA 3HDYA 3MJCA 3O9ZA 4DQUA 4QO7A 5COBA 1YOVB 3VPXA 1R0LA 2E48A 4NJOA 3UVEA 3WWYA 2VYVA 3MZ0A 3W6UA 1I10A 1EK5A 3TRIA 3ZWYA 5JW6A 1VL8A 3LT1A 1CEQA 1ZIDA 1SEPA 4UUOA 4XYEA 3JQ8B 1DC5A 1HE2A 3TFQA 3W8FA 3KLMX 3ZV4A 4E31A 4E5MA 4YAGA 5EJ2A 5A04A 4QEDA 3K73O 4PG6A 3TSCA 3L4SO 4AJ2A 1YBAA 3HDJA 5ADHA 4CMEA 3NGXA 4ZICA 4EEXA 2B35A 1B14A 4N5MA 3VVBA 5A9SA 2FR8A 4WCDA 4ESOA 1XU7A 2P5YA 2PLAA 2WMDA 3H9QA 1Z82A 2HLPA 4IPTA 3FCOA 2FPIA 4E3ZA 2ZYGA 2EHDA 4TRMA 1OZAA 4BO5A 1YJ8A 4K6CA 1UDAA 1DHTA 4DIFA 1ONPA 2A4KA 4Y98A 4PRLA 4GVXA 2VWQA 2GR9A 4NH4A 2HCTA 4K28A 2HAEA 1PJBA 4KOAA 3I5MA 1EZ4A 3KYDA 1OBFO 1T2AA 2H1SA 5JCJA 1X14A 4BO1A 3JD0A 2BH9A 3JD4A 4KUGA 4BOYA 4I5DA 2QRJA 3QVXA 1AGNA 4U7WA 3AUSA 4RQTA 4J9VA 2EP7A 4D42A 3PWZA 3NJ8A 4J2OA 2PD4A 5A5FA 4IMRA 3KZVA 4J91A 1ZXLA 5KJEA 3S2GA 4D0SA 1CYDA 4BO3A 4O63O 3ZNPA 1E0DA 2DUUA 3T4XA 1PGJA 1AXGA 4GWGA 2QW8A 3EDMA 4PLHA 5F1OA 1LSSA 2X0RA 4Q3EA 4CM8B 1R0KA 4J3FA 1UJMA 4CLDA 3NDIA 5IXYA 5TJHA 4BNVA 4D3SA 4FGWA 2B4QA 3P2OA 2I76A 5JYEA 1DBVO 2CFCA 4R5MA 1VC2A 2D2IA 2RH8A 1ADFA 5FWNA 4XDYA 5KJCA 2VHVA 3IS3A 4OSPA 2W4QA 1D3AA 5CP8A 1FDTA 1M75A 2AQ8A 3ZDFA 1QYVA 1MA0A 4IIUA 4DYVA 4RJTA 3L6OO 5ENVA 1ZK3A 3WTCA 1DFGA 4ZU3A 2H6EA 3VVCA 3MOIA 5GZ3A 3PZRA 2NQ8A 3S55A 4DXHA 1YQGA 2HMSA 1Z45A 4G81A 2DAPA 4PRKA 1JAYA 1ADCA 4WCFB 2GZ2A 2YQ4A 4KZPA 4OGWA 4R69A 4B4OA 1U7TA 3DBRB 4UEJA 3AK4A 4MP6A 3DOCA 1Q7CA 1M2WA 2BF7A 1DHRA 2JFFA 2VQ3A 2ZTVA 4TVBA 2BFOA 3FR7A 1V3TA 1NNUA 3O38A 3LVFO 4XGKA 3S1LA 3IP1A 3GVHA 2AQKA 4TZTA 4YT5A 3RC9A 1PJLA 3DOOA 2UUOA 5T8KA 2XOXA 1LDMA 3KVOA 3KYCB 4L74A 1PL6A 2EXXA 2OFPA 2UUPA 2GASA 2X9VA 4NBVA 4BNHA 3JQBC 2NU8A 4R1SA 1LUAA 5JCXA 3OM9A 2J3HA 4PVDA 1E7YA 1A27A 3KSDO 1U8XX 2W90A 5COQA 2NVWA 4UEOA 1E3SA 3E5MA 2J5QA 3V2HA 1SZJG 2Q50A 5JBIA 3GH3A 1VRWA 2QHXA 2X22A 2FMUA 4JJFA 3A4VA 3WSWA 4RZIA 5ER6A 3SJUA 1IOLA 4UVHA 3CMCO 1PTJA 3G0OA 2PNFA 3GG9A 1BTOA 4F3YA 1C0PA 2Q2WA 3BA1A 4OIMA 1YWGO 4I5EA 4Z6KA 2ZB3A 1R16A 4BNXA 5IZCA 3VAZA 1DAOA 3DC2A 1N92A 2VRBA 5K6AC 4YT2A 3GA0A 1U8FO 2I66A 4NIMA 4BGVA 2O3SA 4PLFA 3CH6A 5ES3A 3V8BA 1VJ1A 3GVXA 1P1FA 3ZHYA 3RWBA 1QRRA 4J7CA 1VE9A 4L4XA 3FNHA 3JQFA 1VPDA 2VRCD 1U4OA 1YDEA 3NV9A 4JX8A 4FBGA 1EQ2A 1VI2A 1YH3A 5JO0A 5KWEA 1E3WB 2GZ1A 4DIBA 5CEJA 2LDXA 5CPFA 5AXAA 4BNTA 2NU7A 2NU6A 3GZNA 3WGQA 5BT9A 3U5TA 2B5WA 1GD1O 4EEZA 3NRCA 3Q6IA 4F6LA 3I1JA 1A9YA 3R3SA 1DFHA 2GD1O 4IJVA 5L95A 3H9UA 3EHEA 2DKNA 1EFLA 2RAFA 4R16A 3FWNA 4J4BA 1IZ9A 5DP2A 4FJ1A 3E82A 4ZHSA 1YQXA 4LSWA 2B5VA 5DBGA 3UGKA 3BMOA 3M2TA 2ZATA 3AW9A 2NTJA
chains in the Genus database with same CATH superfamily
2TMDA 1X7HA 4ZVVA 1RQPA 3WIUA 1G7CA 4UNSA 3REOA 3ZHXA 4EY6A 4O02B 2HQBA 4EI9A 2Q99A 4AWAA 3OQVA 4Q1EA 5KO2A 1CZNA 3PHLA 1DUIA 4FDUA 5DM4A 3UUFA 1I0ZA 2RFLA 3CXRA 5IBPA 4P3NA 1QV7A 1FRQA 1NF3A 1PQYA 4Q0MA 2GJAA 1KYQA 3OZXA 2Z98A 4HN2A 4KWCA 4N5LA 4W8HA 4F3KA 1GUYA 2MSEB 3BIOA 5DLDA 1D5CA 1CJUC 3SR4A 4F5ZA 2BELA 2CFOA 4JLMA 4M1WA 4BBZA 4BFWA 1UT6A 3JAKA 3IJPA 5FI5A 3P9XA 3RUAA 4IUBS 4XD2A 4CG2A 2R6DA 2IYZA 2XX3A 3WGHA 1CDDA 4G5HA 1ZCAA 2ZJFA 4BRSA 5A3QA 1G18A 1YZGA 4LI3X 2GYUA 3BRCA 5DZSA 5FT9A 3Q9NA 1VL0A 5FF9A 5FWAA 3FZNA 5BN4B 3M1LA 1VGVA 2NYAA 2QMEA 4EHJA 1YB5A 1L6IA 5CVCA 2XNSA 4QDZA 3CLHA 4X00A 5AJTA 4LGYA 2O2EA 2VF8A 5CDSA 3NP7A 1ODJA 1L8LA 5CFMA 1CF2O 2Y77A 3EIXA 3HADA 3M6LA 3Q7EA 3AR5A 2RJ3A 1GGHA 4ZCSA 3O0DA 4R71A 3GWZA 4KITB 2XTNA 1SU6A 2VEDA 1R4NB 4DXAA 2OZKA 3D8HA 3D6AA 5K9ZA 1CDEA 3MWLA 2IL1A 1MIOB 1RM0A 2LP4Y 2VTKA 2J3IA 1X3LA 1NZJA 3C97A 3L0SA 1KIFA 2UYOA 4P93A 4PLVA 1JAHA 2GKGA 2L17A 3R9KA 4F5YA 1DIGA 3P26A 4QBGB 4CEJB 4D9FA 3RFTA 4HGPA 4IWXA 3FWYA 4DJDC 3A0RB 1SBYA 1YD7A 5I8WA 2I3ZA 5AVKA 5ER9A 2JEOA 3MTQA 4BJ1A 2K2QB 1SPXA 2H11A 4G5QA 4MVJG 3VPFA 5LU8A 5M29A 3R9XB 3ZGNA 4MAAA 4ZHQF 1EDBA 4I1RA 2AC4A 2C2KA 3ID6C 1A95A 2QBYA 1YOBA 3K1JA 3E8SA 5LWQA 2J9GA 3A2LA 2WSLA 4U2DA 3VKWA 1SXPA 1M1UA 1TMGE 1VCNA 1V5FA 4ODIA 4OSOA 2PD6A 4KVAA 2JATA 3LGXA 1FF9A 5A06A 4I1IA 4D0RA 4GS5A 5AYVA 1RLMA 1T3HA 3AXTA 4IUCS 5CNJA 1NY5A 5AK5A 5LOVA 3W77A 1IOWA 1ZUIA 3ENWA 1WD5A 4NJMA 1JHQA 2BKLA 4UHEA 4RU1A 4I9NA 1GCGA 3ZJYA 3WGMA 3TBFA 3HWRA 1RIFA 1P0PA 3E8XA 1YZNA 3AYXB 3D3WB 3I05A 5E9AA 4AZ0B 1P2TA 2Q4EA 1E2NA 1D1TA 1AG9A 1ULUA 2EG5A 2JDIA 2NO5A 1C7QA 2RHRA 3C2QA 3NIGB 4K9RA 4QLOA 3FBGA 4MLCA 4LCEA 3KKOA 4H0FA 1GN9A 3U81A 5FTMA 3NQ41 1CUVA 4YDRA 1P7WA 1YZYA 2QTRA 3FFTA 1FTQA 2P1RA 2JA2A 3GGJA 2W2XA 4KUEA 4AX8A 4EQZA 3C85A 4E1BA 3WO1A 4KIJA 2CLLB 3NTXA 4A3SA 1FL9A 4PLPA 2Y1FA 3SYNA 3G7NA 3I6BA 5ALWA 2P6NA 1CQXA 1D7AA 1QHEA 4C0HA 3D9QX 1EFRA 2Q2OA 2WV9A 3EQZA 1US8A 2X8JB 2C00A 4CU2A 3QEAZ 1PJRA 2XTZA 3GEHA 3RRZA 3FLEA 1WQ1R 3A1TA 2BE7A 5EJMA 1E20A 2ZETA 4A4DA 4MKFA 2OILA 1VPTA 1WY5A 2Q1UA 3C48A 4GI2A 4WV3A 4I4CA 1QAOA 5C8YF 2O57A 4I3GA 3DLBA 1TZKA 3BAZA 4IF6A 4IZHA 5KREA 1R9JA 5H7XA 1AU9A 1YNOA 3QSYA 2CMKA 1CUFA 2OXFA 3A4YA 2OOKA 2IH2A 3UC5A 3AR7A 1YOVA 2V1UA 4F6RA 2NUAB 1KO4A 2C98A 2BGGA 4NBLA 1XEXA 1XZNA 5DBOA 3UAYA 3L79A 1ECGA 1YHYA 4JJ7A 4BMDA 1THGA 2PV7A 3OZIA 5BYKA 1FS6A 1GQOA 5JZSA 2BDTA 1QKJA 2WYOA 2WHPB 2XCUA 1RM4A 3LQKA 3KZNA 3D0RA 4P5DA 4IMJB 1BXRA 3K32A 1XF9A 3SX2A 3BXZA 4E5PA 2PD3A 2HXSA 3KK0A 5T64A 2IYRA 1WMFA 4MHTA 3OX4A 1FFXA 2H18A 1XC7A 2R1TB 2QQFA 4W99A 1XVTA 3RUPA 3TMYA 5JI2E 4YDSA 4U7HA 3WZMA 4PCLA 1T2VA 2IHKA 1RRPA 2IYTA 4L8YA 5E6SA 5F35A 4W1QA 4Z0TA 1D6SA 1V95A 3P4YA 1KDYA 1IMJA 2F17A 2KWIA 2WMYA 3IAS6 4H7IA 1Q7TA 4M37A 5DTJA 2LKCA 1CDZA 4O4LB 4F6CA 3GT0A 2LR0A 2XAAA 1V9SA 4N8SA 5D1NA 5HM6A 1WCYA 1BAPA 3QTBA 4KWHA 2POQX 5ELMA 4ND2A 4PX2A 2BDEA 4M0FA 1V5IA 2O2YA 3A9WA 3GUYA 3QE4A 5F9HA 4X93A 1MLDA 2RAUA 4JJ8A 4EY5A 4ZZIA 3PFKA 2YHUA 2G4LA 2XT9A 1C0IA 2P6PA 3F8SA 3WP1B 1XF1A 2XB6A 2WWYA 5TLSA 2XBLA 1CERA 2YTZA 4Y1EA 3FFWA 1J8FA 1GU0A 2IZ6A 2VSQA 4J16A 3G6KA 2ZQYA 3TD2A 1CJSA 1GSHA 2X9LA 4GKJB 1XDBA 2IZ7A 1HZZA 3K6JA 1A9TA 1E1CA 3FMGA 1M6VA 3UF0A 3U7FB 2GN4A 3G2IA 4WH0A 4MIEA 1NGSA 2YICA 1KPHA 3N8GA 4N6GA 4WVLA 4ZANA 3RYIA 4G5RA 2XDQB 1KTIA 1R5BA 4ZU6X 2FMFA 3D7KA 3PGVA 4FN4A 2BC9A 1RRMA 4G85A 4RX1A 3R6TA 2AR9A 4NOJA 2X5OA 3COPA 2G1UA 1CPYA 2FPPA 4JJKA 4DY6A 1NQTA 1R2QA 4WAUA 1UBFA 4XQGA 2HYIC 3V8RA 2IP4A 2WLTA 4AKSA 5KTMA 2F9MA 1SZDA 1EAYA 2ZJ4A 3A9CA 3OEWA 5L4NA 4BQSA 3OUUA 1ECBA 4AD8A 2HM7A 3I04A 1EFUA 3OQIA 4R1QA 3UUEA 1IY9A 2FQYA 5BSTA 4D4GA 2JFGA 1CJCA 3FUTA 1Z83A 1ZUNB 5B1IA 3COWA 3AEUB 4IWYA 1OAOA 2IHYA 3VR6D 4LZPA 2BHRA 3FHOA 4R8RA 1R27A 4EF6A 4BX3A 1V7CA 2PUEA 1DRWA 3WAGA 1DO2A 1FY2A 3UHJA 1QQ7A 3T5AA 1KK2A 1SFRA 3SC3A 1FTWA 1P8JA 2VBFA 2QL5A 4I55B 4UEKA 1KZGB 4U63A 2ZZMA 4Q7EA 2L19A 5EXXA 2GO7A 1Z4OA 3D6NB 2Q2QA 4KGZA 1BFDA 2QVZX 3H5VA 4I66A 4F2PA 5AVQA 4QEKA 4UPDA 4MVXA 4CF7A 3UKJA 1MEEA 1L5NA 2I9PA 2YBDA 2X4DA 3U80A 2IY9A 2J07A 2Q21A 2PWBA 3OX1A 1QRUA 3N0RA 1KMNA 2QQ5A 4NJEA 1U8UA 4P4LA 5I8ZA 4PG8A 1P9NA 1KDVA 1F12A 4K9PA 3O8QB 2QNBA 3LL7A 1DOHA 1H4SA 5MGNA 1MX5A 2R3SA 2RGYA 3JRNA 2QSUA 3AJ9A 3P9KA 4KE9A 4Q4DA 1Y8CA 1E9DA 1K75A 3NBZC 5F4ZA 1KU6A 5E3HA 2DUNA 4M88A 2REOA 4QPJC 4WOPA 4Q3CA 3VO8A 1E4VA 4TKLA 1Q2UA 3KDPA 3ONVA 4WTOA 5F2KA 3TI7A 3AF1A 4MPTA 1YVEI 4MJ3A 4B8ZA 3AIOA 1SHUX 3NAGA 4ED9A 4N5DA 3MUFA 1HLDA 3JSAA 1TM7E 1GNQA 4PSVA 1ORWA 1X1SA 1G21E 1FW8A 2GHRA 2C54A 3PCRB 3RU9A 3UIEA 4DADA 3P0HA 1GQSA 3ELDA 1H93A 1SCQA 5FI0B 1GP2A 3KXPA 2AFHB 1JR3D 1LKZA 3IBGA 5G4KA 7MDHA 1MOPA 4I1PA 5DHPA 2W83A 3WLNA 3E9DA 4NH0A 4JI0B 1ZDMA 2EWWA 2OBFA 4P0QB 1N4DA 4RPGA 2AI3A 1RYYA 4QDKA 3TLXA 3UGTA 4MRMA 4PNEA 2HDHA 1IVSA 2V4MA 4YIKA 3T4EA 4NU6A 1JTEA 1IZYA 3ELBA 5ALRA 1N7GA 1ZD2P 3D4LA 4MW0A 5HNKA 2XBMA 3HO8A 4CKEA 2C8LA 3FF1A 5AKYA 5KKAA 1Y98A 5LQSA 1VZ2A 5BW5A 3TINA 2JGRA 1P77A 2JH8A 2A92A 4QU5A 1JEDA 2B5OA 4YEDA 4IFTA 2HWKA 2OQ2A 1JG4A 2H2DA 2JLUA 1R0YA 3KQQA 2VCYA 1GPBA 3K09A 2XLCA 2Z6QA 1T9KA 2P67A 1EFDN 1J24A 2XWSA 1SOVA 2Y1KA 4FFWA 4RMHA 2J30A 5LQMA 3ZDBA 1RACA 2ZCVA 2Q4DA 4IYJA 3BORA 3O8LA 4QUKA 3HKDA 1TA4A 5UKDA 4Q7MB 4HSEA 3SS7X 3CGWA 4PX9A 3EG9A 1DP4A 1EE1A 1LNSA 2WKRA 5L7WA 2MU1A 4MUYA 3PDJA 3NIBA 4PXAA 2HUPA 5JV5A 4RESA 4QTYA 3LPAA 1DAFA 3S2UA 1QG6A 4BO7A 4YCCA 4O4HB 3AFIA 3B89A 1T10A 2O50A 3KOWA 1O4WA 2GAJA 2JVKA 3A9VA 3FCUB 3ORQA 3EEQA 5EZYF 2PE5A 1CCWA 2P0YA 1P62B 3AB8A 3EK2A 5GM1A 3CEJA 3ED5A 4RF2A 5CA0F 1N1EA 3GUCA 4L1KA 1KE2A 5EZQA 3DEZA 3HVKA 1MD9A 2HA7A 2HMVA 1HWYA 2XYRA 1THMA 1ZJ5A 4ND8A 4B3IA 5DCWA 1CB7A 1K8RA 4J1QA 2FPOA 2GD6A 1P1RA 1XBTA 3R3YA 5JAUA 2VTVA 3EQ8A 4WCVA 2NZJA 2AMFA 3ZGLA 5CB8A 3MJFA 3HU5A 2A94A 4JXJA 3V4PB 1QYXA 3REQA 5DNAA 2FMTA 4MW9A 4YQEA 5LUAA 1AKYA 4JQOA 1Q1NA 2Q4RA 1YZUA 1GGMA 4DDWA 1KC3A 1RBYA 1UL1X 4KXFB 4WEQA 3VZRA 4C4TA 1ZGJA 3M4NA 1BDBA 3D6JA 3VJKA 1L5KA 5CLLA 1ACMA 3TKLA 2AQHA 4JQZA 5KCZA 5EHGA 3SD7A 5T8KC 4LGVA 1SUDA 5TPWA 2NO4A 2XQVA 4KFRA 4R8LA 3C14C 5CVVA 3AY3A 1VLMA 3I2IA 4KX5A 4GMFA 5HK8A 4E1AA 1T2FA 1H4QA 1NURA 3JWIA 1P2SA 4JR1A 1GY8A 2XXAB 3H9GA 5TB5A 2LKDA 4AJ1A 2YRXA 4S1PA 2XGSA 1T26A 1QE0A 221PA 1Q0QA 1JDNA 2NAFA 1S4MA 3D3KA 3SE0A 2H1RA 2BMAA 1OAKA 3L0YA 1VCIA 5C0OE 5CCEA 1GR1A 3GJ4A 3DFZA 4ZT2A 1VLQA 5FI1B 1BIFA 2ZSBA 1JALA 1Z4KA 5CLIA 3TKAA 1Y4AE 4Q1FA 2RH5A 3WWEA 3ADPA 1KSFX 3ISTA 3D8NA 2V4UA 2JA1A 3JD1A 5HFNA 1AQYA 1W4CA 4MTCA 1QZUA 2R7MA 4OFZA 1XCOA 3EFEA 1DZ3A 1NMYA 1NMZA 3CEHA 4IR7A 1LBIA 4MULA 2OFFA 4XW2A 2B61A 4E13A 5IANA 5H68A 4W9MC 3EFOA 2YV2A 3CUTA 3E1KA 4OUDA 4UFPA 3GLGA 3FOFC 4L3VA 2A5FA 1P2UA 4L85A 5FYDA 4NK5A 4CODB 4BB6A 1T1SA 1VGQA 1XN1A 4HMOA 4RDIA 3RG8A 2BBSA 4AUNA 2BPOA 1L1EA 3IQWA 4EBFA 3LHSA 3UFBA 1IG3A 1QR2A 1C3VA 2QMHA 2R7AA 3RHTA 4GT1A 1VTKA 3ZE1B 1XVVA 2XUFA 4EG1A 2ZSHA 4D3FA 4V0RA 1YR1A 2J4FA 1QANA 2V8OA 3TW8A 1EA5A 3NWJA 1R50A 3M4YA 4QGBA 1FNCA 2J9ZB 1ADYA 4C21A 1PEDA 3LCCA 1K6EA 4PM4A 4G26A 4AKHA 1YRYE 4JQYA 2C4HA 3BJRA 2C8JA 3IPCA 5CFPA 4PO3X 4RAOA 1MPXA 2F9LA 4JT2A 5BQFA 1L8XA 3OTWA 3GXOA 1N2JA 4G1MB 4IJKA 2R0QC 2MSDB 4X8OA 1OR8A 4XTCS 1GTSA 3QVGA 4KQFA 1E3MA 1MABA 2Z57A 2YWFA 1AURA 2VL7A 3Q9UA 5DOZA 5J2TF 5KOYA 1SXQA 1C5KA 4LGCA 2VP0A 1DQYA 1V6AA 2REXB 4TSRA 2DFLA 3S2EA 2ODBA 3V4LA 3RARA 1J2JA 3ENVA 5EP4A 2DZDA 1CDOA 3U40A 3B3AA 1AV6A 3RTAA 2AFIB 2XHZA 5H4HA 2ZUEA 3TUZC 1P61B 4RFVA 5EQTA 5AIBA 1OMOA 3ACCA 3AM5A 2RAVA 1S2GA 3KTDA 4AROA 5ESXA 3W4IA 3PQ7A 1E94E 4Q39A 1GPJA 1ZD8A 3C74A 5ERGB 1P33A 3U13A 5KYVA 4B1FA 4MQEA 3LT0A 5BV8A 1FX1A 4HC4A 4UTRA 5BO5A 3U19A 2FDCA 2F3RA 3VNQA 1DBIA 2MSKA 1L5GB 3WWOA 1Y63A 3OICA 4MR8B 1OXBB 2DWPA 1Z0ZA 2I3DA 2ZI4A 3I9KA 3GA7A 3E0XA 3PUVA 1QIGA 4JXKA 2Z4SA 1UDXA 1WW8A 3EZYA 1H3FA 3AWDA 4IJQA 3RFUA 4I81A 3NYQA 1QIEA 3S70A 2JZCA 4ASUD 1G0NA 2DQSA 3AR3A 5JALA 4ZVTA 3ZLBA 2VYNA 1G5HA 2B82A 3CNLA 4AKTA 4HRAA 4DJJA 2ASVA 4L57A 1E69A 4RGQA 2DRIA 3PQ3A 4G6ZA 3LLUA 3OECA 4K9DA 2OC9A 3RJMA 3ZBPA 1PT9A 3RRBA 3VVMA 2Q4OA 1Z8HA 3R5SA 3KDSE 4FUTA 3IMEA 4L16A 4L4YA 1ZITA 4C7VA 1EX9A 1TDJA 2ZXEA 1AZLA 2CNOA 2QUKA 3CJQA 3HI4A 3JWEA 3QI2A 1HDEA 1T29A 3PFNA 4AMYA 1CJMA 1CFJA 1G5FA 1DXOA 1STOA 1G3UA 2D0IA 1NNSA 3FYUB 3O1IC 5KBYA 2HCJB 4G1EB 2BLNA 2GYYA 1SVNA 3DHEA 2BE9A 2VEOA 1Y7LA 1HLPA 1NFQA 4PFKA 4FILA 4RAQA 2UAGA 1ZK1A 3O92A 4L4ZA 3EPHA 4K8OA 5EJGA 4Q18A 4CQLB 3EGCA 3C7TA 4J75A 4EITA 1Z5OA 4MLPA 3KTAA 1IB0A 1THZA 3ORYA 3LI2A 4TV9B 4H7PA 4RADA 4ZEOA 1TZJA 4KTVE 3SJAA 3G8DA 4OM8A 1YVRA 3E7PA 1N6RA 3VTAA 3WO0A 2DFDA 3ZCTA 4II7A 4XGNA 1KI4A 2RH9B 1EK2A 2JFZA 3QW2A 1Q1BA 1R8XA 2GX6A 1OKKA 2F43A 3DWEX 4RVGA 4NEHB 4E5UA 5HZKA 1T2CA 3NASA 3DOIA 1ZVQA 3TVDA 3AEYA 1CIVA 2ZYVX 3D4BA 2OO3A 3NCTA 3DDWA 5J9FA 4UFOA 5KB3A 2V7TA 2D7CA 3O2NA 4KR9A 3DE5X 5C1DA 1O57A 3IQHX 4B3FX 5D51S 4A73A 3NGLA 3O2SB 1SH7A 3D0OA 4DIEA 4CEHB 4IIFA 1WXXA 2JFQA 3T15A 1KDPA 4HVTA 4RETA 2EW2A 1LXCA 4GQIA 5C8VA 3EQ7A 3EUFA 4Y30A 2BFMA 4Q66C 2CFIA 2I2BA 2I6TA 2ZPAA 3JVDA 5ICCA 4ND4A 1Z5PA 4G5SA 4KDFA 4Y2SA 5SV2A 3UJDA 1NXPA 3L8GA 5A1TA 1DJNA 4AJJA 2K7FA 4ENRA 2BGLA 3W7BA 4UTVA 2D4HA 5JNUA 3KETA 1RNLA 1G3IA 1PK9A 4MSUA 5CRIA 4X54A 1AO3A 1TVKA 2P2GA 1UKBA 4KQ6A 3ZIUA 5A5GA 1G7RA 5KNDD 4CN9A 1BE0A 1MFZA 3BIFA 3O31A 3R0JA 1Q7EA 4FCVA 5IDVA 3SZOA 5ALKA 1BVRA 1U3GA 4AICA 2AUNA 2IBMA 5FIUA 2W2KA 5F23A 4HXGA 3F9CA 5AKLA 4WKPA 3S3TA 3NYWA 2P65A 1IK4A 2OYCA 1SVUA 3KEOA 4MUHA 3QX8A 4LJKA 1C1HA 4RULA 7REQB 2I55A 4TQGA 2Q0SA 5JWRA 1A2KC 3GFQA 1Y9AA 2X0FA 1A2BA 1QTIA 4NDZA 4QEZA 3EB9A 3RQIA 5F5NA 4BPBA 3HBLA 3IURA 3CLSC 1USVA 2BKVA 5T6BA 4ARCA 4GSKA 3DPUA 3ECCA 3MQFA 2HQOA 3B1JA 4I1OA 4UKDA 4AAYA 5I7SA 2XUJA 1G2IA 2EGUA 2C5BA 2YHAA 4TWBA 2KW5A 3MCWA 3VX3A 4F1WA 1A4RA 4E33A 1XIVA 2C7RA 4S1WA 1DARA 2WK1A 3WYEA 3ICQB 4NZZA 4IINA 5G02A 3HUDA 4G8DA 1NKSA 2HMAA 3I76A 4B2PA 2G8NA 1PWEA 4W82A 3SR3A 2CVFA 5DGIA 2XLBA 2OHFA 3LK7A 1VM6A 4DV1B 3DUFB 3WLPA 1PV4A 5C51B 3UWMA 4A26A 2WUGA 5JTTA 1PJ8A 1V6CA 4NEGA 3QEMA 3MSCA 4OHMA 5EIBC 1T5TA 3EDCA 1DAMA 5IC5A 1GDTA 2YJNA 2GUWA 4K87A 2WUEA 1N2GA 1NSFA 4H7HA 4C4ZA 5BOSB 2OHGA 2IP1A 4ITVA 1KO5A 5DBFA 1DRVA 2GNPA 2NNWB 3PL1A 4TTQA 3RT7A 1M1NA 3ZTYA 1PNOA 1MC8A 3NHFA 5TGDA 3BWVA 1WZEA 1NLMA 3FMPB 2FKNA 3FZQA 4YJGB 1Y6RA 1FCJA 2Z58A 4UUMA 5ALSA 4OAOA 5FR1A 3WLIA 3RRMA 3SSNA 5EEGA 4CLOB 1CZOA 4INJA 1KOFA 2H85A 1OYVA 2M1ZA 1BYIA 4XPZA 5LYJA 3FB1A 2W6ZA 3I9NA 4M1KA 5CFOA 1JDSA 1KWGA 3DAHA 4EZIA 2C7BA 4LY9A 4E14A 1MH9A 1YDWA 4ENVA 4P4UA 2Z5VA 3HN6A 2K2WA 3TW6A 4RTJA 4H60A 2VO1A 3WMFA 3CLUC 1SC1A 3D1JA 1WP4A 3NW9A 4ER5A 3ZWPA 1XTTA 4XYLA 4HS9A 4OM7A 3UWDA 2FUG6 4I6GA 3FZGA 5C4GB 5K05A 5LDDC 3KSBC 3T3GA 4Z3DA 2C7QA 2H1FA 1GFIA 3G0BA 4HH1A 3RNLA 4ETIA 2YS6A 3VU3A 5CLQA 2VTDA 4C3VA 5TSDA 2OQRA 4PTYA 4NPCA 3H75A 3PEFA 1SVSA 1RHUA 2WHQA 3VC1A 3BKXA 5TR9A 1LA2A 4D96A 1HQDA 4DQ0A 1CP2A 2PSDA 1C1DB 4J16C 4V1CA 1ESDA 1KR2A 4WASA 1XKTA 3IKVA 4DYDA 3LD9A 4TN1A 5IASA 3WIEA 3BXEA 2QK4A 3O8RA 3SM3A 1IZ8A 2CXXA 5D5PA 1D1QA 4D4IA 1DEAA 5LZ2A 2PGDA 3H99A 3GFRA 5FL7A 3ZDEA 1XRNA 1XCBA 2DB3A 3B6EA 3I62A 1UK9A 1Z4IA 3ORFA 3RHFA 2QMOA 4NX2A 4YJFA 1EK1A 2PZ8A 4ON9A 4WSOA 5B6JA 3EVDA 4IM7A 1DJPA 1VL6A 4MV4A 3RTEA 3F6YA 3UAXA 4KMSA 3RIMA 2ZUCA 3QPVA 1BO6A 2AZ4A 3DVRX 4DCOA 2W71A 1D2EA 2YXNA 4ABYA 2OMEA 2QE7D 2QRVB 4TSKA 3CO0S 1QRSA 5JCPA 1T9GS 2PUBA 2W11A 4CVNA 5DSTA 2NT4A 5E2BA 4W6ZA 1U98A 1E6UA 1S7GA 2HB6A 4IZOA 5HIMA 3H11A 4ZI2A 2LUOA 2VWPA 3WV4A 4Q4HA 4DNOA 3STXA 1CZUA 4FJ2A 1D9XA 3ETHA 4WPGA 4O33A 5E9QA 5KNCD 1A7UA 1IU9A 4ARZA 2HRDA 2H16A 2PTHA 4KAFA 1F8FA 4JP3A 2ZLBA 4OAQA 2ZJ5A 3TFOA 5HGXA 2NP7A 1TC2A 1T6XA 4QDTA 4D98A 1NV9A 3GNTA 4XPIA 5A4KA 5KMGB 1N78A 4FZ5A 2R96A 4YUXA 4TKUB 3L02A 2OMKA 3GRRA 3I1YA 4ERXA 1VFNA 2UV8A 5TV2A 3D64A 1L5LA 3I23A 3PIRA 4DV0B 1IHDA 3UPTA 3ANXA 2OWDA 4COOA 2E4WA 2FZ4A 2JLVA 1YZTA 1ZCBA 1S2LA 1AX9A 5CNIA 2NZ8A 2IELA 3A9TA 3LFUA 3ZS8A 2NZYA 1ZIXA 2OBNA 4M8KA 1DQNA 2OB2A 2Y0CA 3AETB 4UOQA 5K51A 2P2SA 2A86A 2R5WA 5GJCA 3WRYA 2AH5A 2X86A 5AVTA 5JQWA 4Z7OB 1IZ7A 5HCIA 4B0OA 4BB9A 4AS1A 4JX9A 1D6NA 5JSQA 2J3DA 3L8ZA 2RHDA 3L46A 2O4CA 3D7LA 2JJQA 1IFXA 1EVJA 2Z83A 3BMCA 3WJAA 3QE0A 4BO9A 4UNNA 5HUJA 1TT7A 1N2IA 2V7QA 3QVTA 4PHFA 3ZWBA 3S6JA 2WEKA 4G0PA 4P35A 4DVJA 5IVHA 3TEMA 1J8VA 4Z1OA 1FMJA 1PG5A 3LPDA 4YMVA 2VNAA 4Q05A 5DI3B 5JQGB 1CUGA 4CQMD 3N58A 1XXHB 3OH8A 3AV3A 3CKLA 2X3FA 2RAPA 3L8HA 4G4GA 4EJSA 2DHEA 5J43A 3HWX1 1OPRA 4PZPA 2F8SA 2Q3MA 3F67A 6CHYA 2ZIXB 1K66A 5ALVA 5B7NA 2VXBA 4H6PA 3NKFA 4GP7A 1TIKA 3VPHA 1COWA 2QRKA 4MV5A 2XNKA 5L9AA 3SHVA 5GZ6A 5CB4B 3HCRA 5ESRA 1KPGA 3H4IA 1MQ9A 4OGGA 1XRLA 5C7LO 2X9GA 3CX4A 1XAHA 3K2IA 3OCJA 3C8MA 4JAVC 4K2AA 3NB0A 5ALYA 5CH3A 2QXYA 3HCWA 3VTZA 4E5NA 1DXYA 2XWJI 3BH7A 3QKTA 4PGGA 4GRAA 3ESXA 1WZNA 1W93A 4WQMA 2E4UA 3K09C 4N7JA 4H4CA 3A1SA 2Q62A 2NVUA 4PF1A 3C4VA 3N53A 5TT1A 3X1JA 2ERXA 3ENZA 3IPLA 2FEWB 4U2CA 2XZTA 2HTFA 5BR1A 1S8FA 2AHRA 1WHTB 2PCLA 1WSDA 3W8EA 1JHDA 1S2IA 4MRRA 4YRGA 3QUCA 1NLFA 3MJSA 5H80A 2AR7A 1LK0A 4BV9A 2CLSA 4YQYA 4CMIB 3MB5A 4BMNA 5A4JA 2D0DA 1G41A 2J3KA 3QF4B 4AXBA 4FZJA 4II3A 1Q7GA 4HNGA 1RE0A 1W5TA 4MS1A 4BGIA 3UJAA 2OCKA 5K1ZA 3BOSA 1HQYE 4RA9A 3KHTA 3U44B 3MT8A 1ENZA 3K5WA 4S1NA 3D2CA 3L7KA 1CQJA 1OXMA 2DBVO 3U2QA 2FEPA 4ENTA 1BA3A 3ZXSA 1IN5A 2GCIA 2QF7A 5E7JA 1GFSA 1ELOA 1T2EA 2HD4A 1WBBA 3UXYA 4OY3A 3ZC3A 2ZT6A 3UMVA 6GPBA 4DB2A 5KTPA 2HNBA 1GL3A 1UKVY 2HOQA 3OP4A 3WKCA 4O4LF 2V3VA 1ETHA 4LHZA 3RRYA 3BA6A 3WKBA 2A78A 4KMOA 2OZEA 4Y9UA 4C6HA 3W5DA 2H1LA 4CQMB 5FNVB 1Q6YA 4EYEA 4Z7JA 1KDZA 3B8HA 1J8MF 1JG3A 1DBSA 3HHEA 4HR7A 4MJLA 1M2OA 1ISPA 3ZXXA 4G24A 1E5QA 1FQKA 1SD2A 3WK9A 4BB0A 2C94A 3FLMA 4MHSA 1KR5A 4P7JA 4ENWA 4M8SA 4IH1A 5K7SA 2HNKA 2I99A 4KV7A 1E2IA 1OFUA 4GXTA 1TKAA 5KVAA 1PFYA 3PPIA 4DT1A 4DMUB 1H2BA 1FUYB 5D2CA 2VSOA 3S4YA 5CGQB 2GH1A 5B58C 4ZRDA 1UQUA 4I9UA 2B99A 3G88A 1E1YA 3UCXA 4A10A 1RQRA 1IRIA 3EXHA 2Q5OA 4XDZA 4ZOAA 5EJAA 5FUVA 1NP6A 1GO2A 1XYVA 2OECA 5BWLA 1XR3A 3ZVKA 4DR4B 1UJ6A 3KUKA 3P0JA 1YKGA 4LOIA 5DWDA 4I6JA 2MYUA 1F3LA 3M3PA 1AHPA 3BAFA 3FOWA 4N18A 4M8LA 3RV4A 5IXJA 1NBEA 2YBEA 1NR1A 4N82A 2PSSA 1PS9A 1I2ZA 4OBWA 1VJRA 1UMCA 4D26A 5A03A 2W2LA 1J9GA 3H0EA 5TQ2A 3JASB 5D3ZA 3A6GA 1SCDA 1GPNA 2JGDB 3KX2A 2R1UA 4BL5A 2C0CA 4TM8A 4OYYA 4O3MA 3ZKWA 1HZJA 1A98A 1PK7A 1ZJ4A 1L4FA 3IJRA 3MIIA 4IH9A 4F3RA 5INTA 1X70A 2E7ZA 5A3SA 3VR2A 3EWSA 2YWGA 2IIBA 1C9YA 3PDIA 1NYQA 2V0NA 3OM0A 4PZEA 4Y1RA 1IY1A 1P7PA 1ZK2A 3GNQA 5F1PA 3AC0A 4I4LA 5B1DA 3ZY3A 3ZW8A 5I6DA 3CEMA 2E5FA 3IAAA 1Y7TA 3KZOA 4I55F 3PQ5A 4HLDA 4FKZA 4WT7A 4DSOA 3OTQA 1G8JA 3B1WA 3U4MA 2X13A 4O8ZA 3G8YA 1V8BA 3TSOA 2QU7A 3ETNA 1N0VC 3ODPA 1JKJB 2II6A 3CX3A 3FIJA 3NPAA 1T3SA 1FFAA 1TPZA 4M0UA 8ABPA 4CIBA 3R3XA 4JLKA 4BYGA 1QGED 2UZ3A 3K9HA 3KVVA 3PFHA 1ADJA 5HBGA 3RS0A 2V9CA 5CT6A 1JX6A 1PVDA 3L2OB 1BHSA 4EX6A 10MHA 3NIFB 1GVNB 5DM70 1V7PC 5D3KA 3M5DA 4BECA 5LD2C 1V7ZA 4OSEA 5BOVA 2HMYB 5CM8B 5KIAA 3PDWA 1C7IA 3EZ2A 3QQPA 3M3DA 5FWYB 4CGZA 4L76A 1HO3A 4TYNA 3CEAA 3IE2A 4Y0NA 5B3JA 3RUDA 1XMQB 5AKZA 1NWHA 3SFVA 5IUJC 1SB9A 2A57A 5DM2A 3JVVA 1NVVR 1BKDR 2O1SA 3EDRA 1T3LA 2X7XA 1XD2A 3IUQA 4ZV7A 4WKOA 3UOAB 1FMLA 2BFAA 3H5RA 2HW8A 1MNQA 3FRJA 3QUAA 5J2UA 2ZJ0A 1L8AA 1RMQA 5BN5B 2E4YA 4HNAA 1M33A 4PU0A 2GKOA 3FYHA 2BGWA 1EP9A 1U6JA 4JVNA 2ZUDA 2GPNA 3GW8A 2X9QA 1SZCA 3HACA 4NU8X 4IFIA 1XZCA 2WKSA 3HGTA 3PCTA 4OI4A 2FW6A 3P2KA 1AHIA 4E3WA 4TT3A 1F6BA 1JQEA 3FMVA 1Z18A 4K0KB 3L3BA 1GGFA 3ZE0B 1EGAA 4N48A 1X9IA 3VI4B 1H2ZA 4HXEB 1HL3A 2OENG 4KI0A 4KQHA 3M81A 4GH5A 4IDDA 3WWZA 1KJIA 5IABA 1KU0A 2WVHA 2X77A 3VR5D 4HK4A 4OJYA 1ISMA 1GT6A 1KMMA 3CUKA 3NHZA 3BCRA 3Q88A 2PZFA 3F5SA 4KPGA 4WDQA 2B34A 2QR5A 4LTDA 3ZXUB 4WZAB 2I4LA 2Y05A 2ZJZA 5F21A 1W34A 3C6BA 2SECE 2EKPA 4MYTA 4MTLA 1NN0A 4G37A 1TC1A 4B3CA 1KZYC 1WTCA 4PHTA 4QQRA 5DHTA 3R6WA 4D4KA 3KLPX 1LLFA 1W5EA 4BO4A 1Z16A 3OA0A 3TS1A 5MFZA 2N9UA 4Q00A 2J67A 3GY0A 5EPOA 4ZT6A 4JT8A 4TV8A 3JQGA 3QJGA 4FYYA 5L3QA 5LL6P 2VBCA 3TSYA 1V0JA 2FPGA 4J0HA 4CIXA 3A3YA 4DCUA 3E9ZA 2E0IA 4JD5A 4A6DA 3KHKA 4NAVA 1MTOA 1I6LA 2Q5FA 1ZD1A 3T5CA 5IFKA 4R83A 4LX0A 3RSGA 1EVLA 1RI4A 2ON6A 4O2RA 4N0PA 2PS9A 4O4HF 2IV3A 4LRQA 1B3BA 1CRLA 4HG2A 4ZZ2A 1TUBB 3H7AA 3RC3A 4R9RA 3TEJA 2WQ7A 4C7OB 1W8DA 1AV7A 4M1YA 4A92A 3X1XA 1IYZA 2KLHA 2E6UX 1A50B 2GXSA 2YN0A 1CY1A 3AESA 2WRZA 1RQ2A 5IWCA 5AK3A 2VUIB 1RAAA 3RVOA 1Z75A 1X7GA 2XYQA 2XNDD 5EHZA 2INGX 5L6LB 2EF0A 1Z0IA 3LOQA 1QRTA 2QOEA 1VE3A 2HK6A 3IKTA 4NMMA 3WG9A 4OP2A 1TNDA 1K9VF 3I42A 2WWGA 5FWXA 1YQTA 2X9NA 3PHJA 3DLIA 4D6XA 1UUFA 1FRNA 1QO9A 4PFSA 3BFXA 1W19A 1KMCA 1SXGA 1YO6A 2PKYX 3Q7IA 1KYZA 1JF8A 1B42A 4RL6A 3EVFA 5JBNA 5DVZA 3O7MA 5ALFA 5DO9A 1LV7A 1JWAB 1SCKA 1ZEMA 3KPWA 4P36A 4TMYA 2ZIVB 3ECSA 4UXJA 5LQNA 1QFZA 4Z3OA 3CZCA 3I73A 4HKTA 2ATEA 3QITA 4FQ7A 1Y6QA 2JNWA 3GJ0A 3ORSA 3E18A 3OHMA 1J90A 4H3KB 4QRDA 2WG2A 4XZ3A 3NM4A 2Z4TA 1DBRA 3KT3A 3E9RA 1GR0A 4GI1A 1KY3A 4QOHA 1J7JA 3AW8A 4EHFA 1KI6A 3VYVA 2GJKA 1P9LA 1HYQA 4BLTA 4H17A 1WPGA 3IPRA 3UC9A 3LUHA 3U4QB 2XQIA 2CL7X 4Y0VA 2MT9A 3PUZA 3U6BA 1NF9A 2LE0A 1R74A 1Z6XA 2YWXA 1EG2A 3HMQA 3KVRA 2JS7A 4PG7A 1ZOSA 1C1XB 1ADBA 1RFLA 4Z4HA 4DV3B 2R8XA 1YL7A 3JAMA 1N5DA 1JE0A 4CL8A 4CV0A 2XGJA 3M4XA 2IY8A 3FFAA 2DQ4A 1X7YA 3QPCA 3SMVA 1T4MA 1OPXA 4UM8B 5FHRA 3WZLA 1RYZA 1TAHA 5NULA 1ZHOA 1ZU4A 3C6MA 2PJRA 4JBHA 1Q17A 2B7LA 5FHQA 4ZKEA 2BYTA 1YI8A 2RGEA 3LXXA 5AXCA 4PCAA 5BQXA 1XQVA 1QDLB 2GBPA 3KXDA 4WINA 4ANFA 4RORA 4TYWA 3K6RA 4Q3OA 2ZRFA 5KSPA 2D5CA 5HJ2A 1KDRA 2OB1A 1L5ZA 4LKOA 4JUBA 1X6VA 1H9CA 1YJCA 4KVFA 1BMFA 1FFWA 2FSUA 4KTTE 4BXOA 3EVGA 3X2EA 2ZIWB 2XKAA 5EJ6A 3W78A 3Q3HA 3U60B 1S8AA 1ZJYA 4BVGA 4FKMA 3C16C 1UWVA 4CI0B 2JB9A 4EJMA 2EF1A 1EVZA 2D5LA 1WIWA 2RHTA 2VT2A 3TO5A 4DWWA 2RI6A 5HHTA 2EATA 1A3CA 1DJLA 5ALMA 3NFYA 4RQAA 3HJCA 1M2GA 3K0KA 1M6EX 1GQFA 3PS9A 1YCHA 5F3WB 1FTYA 3VPGA 3G89A 1HT2E 5MGBA 2GFIA 4XYGA 2GRAA 5H3HA 4NMLA 4NVRA 3RH0A 1XWIA 4A8JB 4J7UA 3KZCA 4U3JB 1Z62A 1LD3A 2FY8A 4IGFA 1G6OA 2WAMA 2I65A 4QDUA 3RJ5A 1ILEA 1UMBA 1EFPB 3GPIA 3M5CA 5ALLA 1OI7A 1FYEA 2IYAA 4UTZA 5DKFA 3RS2A 1LPNA 2PHZA 3IHWA 3IP6A 5EE3A 1GGNA 2VPPA 2PXAA 3GRAA 1SHTX 4ZQIA 3K70C 1ID1A 3VDXA 2BHLA 4B80A 3ZI0A 3DAPA 3HA5A 3HB5X 1COZA 1RT9A 2ZUVA 3P32A 5EXPA 3R7AA 5AW3A 4AVYA 5E9WA 1M8PA 3PQDA 4WJLA 3HB7A 1Z08A 3BK2A 3A1WA 3JSXA 4UOZA 4BHTA 4GBED 2JFBA 1E2HA 3IA2A 3QYPA 5KC9A 3SQXA 1E4OA 1WDWB 3NYIA 3Q9LA 3W1VA 1IATA 1YB7A 4KBFA 4OXQA 4GUDA 2YOFA 1ZNWA 1GRVA 2GJ8A 3M89A 2RHOA 4TKVA 4TYMA 2Z9CA 1VA5A 3PGLA 3OZCA 4HQ6A 3TQHA 5H59A 3JARA 1EK0A 4JI6B 4WA8A 4CIYA 1DOAA 2SICE 3NO4A 3GAAA 3K05A 3HRKA 2PFKA 1K6JA 1PUJA 3K92A 4C1BA 3OZSA 4URFA 3NBMA 5KTTA 5ULLA 3FTCA 5B3LA 4BZXA 1RMYA 3IYLW 2DU8A 2ILTA 4ALJA 2XDWA 1AGYA 1Q44A 1U6KA 4E32A 1JHZA 5C5DA 5GADl 3TD9A 3VV3A 2AB0A 1GZ3A 3WTBA 3GFBA 1OCEA 3EZ9A 3QE3A 4HZUA 4UJ5A 1JFFB 3VZBA 4BP1A 3ZV3A 4N4AA 1P1KA 4B6GA 4X0EA 4H7EA 3KR0A 4L5CA 4BN5A 1BVUA 3LO5A 4LC9A 4MWZA 3KIPA 1FJHA 4P3PA 3K2QA 1D8TA 3QXSA 4ZOEA 1HNZB 4UVDA 3HR8A 2E4XA 3LX5A 4ALIA 1GLGA 3ETEA 1KXJA 3H6GA 4MUFA 3TB6A 1RU3A 3NEAA 3DHYA 4MPDA 2Q5QA 4GFDA 2XZDA 3QVVA 1TCUA 4RCVA 3Q3GE 1H22A 1KFBB 2GJ4A 4TV9F