3QWFA

Crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
261
structure length
261
Chain Sequence
b'TYIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17beta-hydroxysteroid dehydrogenase
publication title Structural Studies on a Fungal 17Beta-Hydroxysteroid Dehydrogenase
pubmed doi rcsb
source organism Cochliobolus lunatus
molecule tags Oxidoreductase
total genus 104
structure length 261
sequence length 261
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qwfA00
4M89A 4A10A 1EK5A 2PLAA 1K5HA 2WYWA 4R41A 1X1EA 4UUPA 1ZW1A 1E6EA 1UUFA 1ZZEA 3JD2A 3LT1A 4J1TA 3GF4A 4CMIA 4CV2A 4BB5A 1GR0A 3E8XA 4JN6B 1ENZA 4YVFA 4J2HA 4OJNA 3WQRA 2VYVA 5G4KB 3KYDB 3WS7A 1GDHA 3WJ7A 4O59O 1DOHA 4TRNA 2PR2A 4W7IA 3ETEA 3VKVA 4DA9A 1XU9A 3WTCA 2BGKA 3NT2A 4XR4A 3S2EA 2X1HA 3U4CA 3WLEA 1GUYA 4AFNA 5L9AA 4W7HA 4Z9FA 3EUWA 3IJPA 3UW3A 4UUMA 3I9OA 2HQ1A 3WX0A 1BXKA 2O3UA 1V3UA 5G4LA 1TB4A 3DHEA 4QECA 2Q1TA 3PRJA 4CQLB 3VKUA 2QQ5A 1E5LA 1GZ3A 1PZFA 1UXKA 4HFMA 4FGWA 4UVIA 3VZQA 5ILOA 4BNVA 3BMCB 1U4SA 2IEDA 1VPDA 4C7JA 2BF7A 3W4IA 5HRUA 1FJHA 2ZTLA 4AVYA 2BHLA 3OHSX 3UHAA 3DBRB 2E37A 2RAFA 1IY8A 1T4DA 3FD8A 2O2SA 1EEHA 1YOVB 3DTYA 5I7EA 1H6DA 4CM1A 3GZNB 3PYLA 2Q4EA 4INAA 2X6TA 3C8MA 4ONEA 2B35A 2HJRA 2VWHA 4EDFA 2GASA 2EGHA 2JCYA 1U5CA 1Z6ZA 4FFMA 4J7CA 1WVGA 4BKRA 5IFLA 1D8AA 1B7GO 1IHYA 1N2SA 3ZH2A 3RBXA 4XGIA 4E2YA 2B37A 5G4KA 3KYDA 4L75A 1X7DA 4JBGA 3PHLA 4HKTA 1DC3A 4NDNE 4E32A 3HJAA 5HS6A 3ZWAA 1EBUA 4GH5A 3K9QO 3WGTA 1Y6JA 1DC6A 3M6IA 3GVPA 4MVJE 4OSOA 4PRLA 1M67A 3RI3A 4BUCA 1U9JA 4QFDA 4CQLA 2OUIA 3GDOA 2O3QA 1VI2A 1YXMA 3A1NA 1Y8RB 3ZU5A 1ML3A 3KUXA 1N5DA 1LRLA 1W0CA 4WEOA 3PQEA 3GK3A 3G49A 3AK4A 4YAIA 4D41A 1GQ2A 1P1KA 3ASVA 2VRCA 3P5SA 3HFSA 4DQXA 2YZ7A 3A06A 3SJ7A 1YBAA 5GZ3A 4WCFB 1MX3A 1YOVA 3H3FA 1YQXA 4EGFA 4OL9A 1AXEA 4E13A 5JCJA 4PVDA 1ZSNA 1SC6A 5TJHA 3VH4A 5JYDA 4Y9DA 5FWNA 3KETA 1YBVA 1A4UA 1P77A 2Y93A 4LGVA 5DF1A 2D8AA 2BKAA 2E49A 2J6IA 3Q2IA 1EE2A 4JROA 3GRKA 1P0FA 2X4GA 5BT9A 3U09A 2Z95A 1DXYA 1ENYA 4A27A 4OQYA 4IMPA 2AEFA 4RF2A 1B3RA 3JQ8A 4TROA 3WOHA 3B1KA 4M49A 2WYUA 4XD2A 5JYEA 2OP0A 5G0WA 4NG5A 4I9HA 2A35A 1GUFA 4WUVA 5TS3A 2P68A 4CM4A 2VRCD 4L0QA 1MP0A 1VL8A 3ZW9A 3V1UA 1NWCA 5B4TA 2GPTA 2EW8A 1FMCA 3I9JA 1DDOA 4U6SA 4E4YA 1YH3A 1Y8RA 3ROPA 3M1AA 3DZJA 2DFVA 3F5QA 1UDBA 2IEBA 3PQDA 4NBTA 3P19A 1KERA 1OOEA 1JKFA 4UVHA 2OL4A 4EJMA 3QWIA 3PZBA 1E1LA 3ABIA 3QSGA 1YVEI 2PZJA 1HLPA 1LRJA 1WZIA 3GEGA 3TZ6A 5C7IO 2B0JA 3JV7A 1E3IA 3RAJA 2Q4BA 3OA2A 4PLCA 2EKPA 1QORA 1ZK1A 2HO5A 4BV9A 1EZ4A 3BYZA 4MKXA 7MDHA 5LDHA 2O4UX 3INGA 2HJSA 5JS6A 1X0XA 4M87A 1GQQA 1Z74A 4EZBA 4ZGWA 3RFVA 4CJXA 1YBMA 2FMUA 4RVGA 5AQ1A 3DMYA 2ILTA 3QVOA 2EKQA 4ND5A 4R4JA 4BNNA 1QV6A 1HKUA 1I3KA 3K8ZA 1OI7A 4O1MA 4CMCA 3TWOA 2AA3A 2OGUA 4TWRA 3V2UA 3I4CA 1X0VA 4M55A 4R68A 5JAQA 4GSKA 3LYLA 4J49A 3EVTA 5DT9A 4N5LA 2A9FA 4U5QA 4RVDA 3U0BA 1SB8A 1ADFA 3QIVA 4E5NA 1JA9A 3UCFA 1XWFA 3H6KA 3CKYA 1M2WA 1VL0A 1SCUA 5AOVA 1T1SA 5IZCA 1V9LA 5A5FA 3HZZA 3VOSA 3ON5A 5CP8A 4HBGA 1GU7A 1MFPA 4II2A 5KWEA 2E48A 3RUHA 1QRRA 1WDKA 3DONA 1B26A 5IN4A 1WP4A 3I1JA 1LSJA 1XA0A 5FFFA 2C5EA 2Q1WA 2YV1A 3DL2A 4J1NA 1M75A 4IS3A 4UUOA 1AUPA 4GGPA 4XYGA 3KZVA 2NNLD 4AG3A 4Q3AA 3LC7O 1Y5RA 3A14A 4XIYA 3OJOA 5TRTA 2DM6A 1BWSA 1EVIA 1PQPA 4Q39A 4K26A 3RUEA 4H7PA 3WG9A 1NQTA 1I33A 3CZRA 3ZNPA 3GN1A 4KP7A 4MP8A 2QRKA 4PZDA 2AQ8A 3N74A 1VSUA 4QUKA 5HA5A 1XU7A 4XKJA 3RC1A 2FN7A 3GMDA 4YJGA 1DLJA 1I2BA 4GX2A 1IPFA 1EQUA 1KETA 3FNFA 3O03A 4KWHA 5KVQA 2HMTA 2QRJA 4IJVA 1UXGA 4JJFA 2OOSA 1TEHA 2EJVA 5JAMA 2VNSA 3PHIA 1HE2A 5KJ1A 2C7VA 4C4OA 3ANNA 5G0TA 4WOKA 1E92A 1A27A 1UZNA 3O26A 2C5AA 1T26A 5EERA 2J3HA 5BSGA 3H5NA 2IRWA 1R12A 2WM3A 1EDZA 2WTBA 2IODA 3VPFA 3DXFA 1PJ4A 1C1XA 1QXSA 1IPEA 3QVSA 3H2SA 1FDVA 2ZB3A 5IDXA 5A05A 3HFGA 3IUPA 3KSUA 1DFIA 4CLEA 2WJPA 1ISMA 1G6KA 3H9JA 3IL2A 2BRUA 2AHRA 2CFCA 2GCGA 1DFGA 1X7HA 3ZHYA 5HS4A 2P9CA 5JMWA 2YDYA 4FJ2A 1BG6A 3IS3A 1I3NA 4GVLA 1CJCA 1DIRA 3VH2A 3U4HA 1EMDA 5BQFA 3O4RA 2RIRA 2AXQA 2IYPA 3DBLB 2DBRA 3PLNA 5C7OO 5EINA 4CLRB 4NNJA 1H6AA 1BXZA 3GY0A 1T4BA 3AY3A 3K2EA 3LF1A 5CPFA 1PJBA 3PWZA 2ZB7A 4TRJA 3OA0A 2CVOA 4YWJA 4DMLA 1PQUA 4HWKA 5TQVA 1ZO8A 1I36A 3H4VA 1EFKA 4MOWA 4XIJA 1GY8A 1QLHA 1Q7BA 3WMXA 1G1AA 3FR7A 2POQX 3MJTA 1H0KA 2J5KA 3EZYA 2V65A 3KYBA 3DZIA 3BTUA 1C0IA 1LLUA 1O0SA 1WDMA 4FD3A 2PD6A 3JQAB 3DOCA 4IY1A 3RUCA 2FP4A 1XELA 4M8SA 4MKRA 4UEJA 2NADA 2BFAA 4XGKA 2FPPA 1T24A 1OC2A 4J9UE 5AXBA 1PR9A 2GZ3A 4I5FA 3WLFA 3VHRA 5JY1A 2QX7A 4A0SA 3K2BA 3OH8A 4BQRA 4DPLA 4CL3A 3JCZA 1OFGA 1HYEA 2NTNA 4YT8A 2FHSA 1DO8A 3WNQA 2PKRA 2VT3A 3DTTA 3DBLA 1E1MA 1NQ5A 5DDIP 5EQFA 1N7HA 4D44A 3UAGA 4CLRA 1UR5A 3E5MA 4DGSA 3ZHXA 4N5NA 3GVCA 4FCCA 3JQDA 4CR8A 5H83A 2OBNA 4HY3A 4DC0A 4XYBA 2DLDA 2HMSA 4J90A 4RZHA 4LCEA 1I10A 4JQCA 2VHVA 3L4BC 2BD0A 4M86A 2AQIA 1W8DA 3RKUA 1TXGA 5I9LA 4MIEA 1ONPA 2W98A 2Q2QA 4DUPA 4CQMA 3C1AA 3ZNNA 4BO0A 2BELA 3BZUA 4OAQA 2OZPA 2Z5LA 2Y0EA 1BMDA 3BMNB 3GAFA 4KQXA 3GQVA 1PWXA 3NV9A 2Y1FA 4WKGA 5L95A 3S2FA 2D3TA 4FS3A 4UULA 3DHYA 3GHYA 4OM8A 2J3KA 5COAA 2VZ9A 3H5RA 2X0NA 1BW9B 2Y0CA 3COSA 3G1TA 3ENKA 5DN9A 4DIBA 2YQ4A 1JU9A 3KSDO 4Q3BA 4BNKA 4RPLA 2P5YA 4Z0TA 4RLHA 3JQ6A 1I32A 2DUUA 1PR3A 3DO5A 3OJLA 3S2GA 1RPNA 1NPYA 4J9VA 1EUDA 1NYTA 4H16A 3WMWA 1TT7A 5I7VA 4PZEA 4DQUA 4HUJA 1D7OA 4FOOA 1YE3A 3KO8A 3JQAD 3LU1A 3VTFA 4BO3A 1I30A 1XHLA 3JQ9C 5JC1A 3JQEA 1ENPA 3EAGA 1D3AA 1RWBA 1ZBQA 2B36A 3E48A 1T2CA 4GX5A 3RSHA 3KOUA 4XRRA 1B3BA 3EW7A 3ZU2A 3K30A 4DPKA 1NNUA 2BGLA 4XYLA 5TC4A 3S2IA 1DJNA 2HMWA 3TZKA 3PJDA 2O7SA 4PG7A 4AJHA 4TZTA 2AG5A 4Y8VA 5K9ZA 4PLTA 3G1UA 4CM5A 3BMNA 5JAZA 3ASUA 1LRKA 1Y9AA 3NX4A 3BMOB 2HMVA 2G0TA 4FDAA 4RVFA 5F5LA 2RBEA 4YJFB 2X5KO 2B4RO 2GERA 1BW9A 1ID1A 3FI9A 3HDHA 4QTZA 5IDYA 4BNYA 1YL5A 2G82A 4MVJH 1VM6A 1SEPA 1FDUA 3W8EA 2DBZA 1XDWA 2Q2VA 2PWZA 1C14A 3BHIA 2DVMA 3JTMA 3OP4A 1MA0A 1ULSA 4XQEA 1R15A 4DPMA 4LW8A 1LA2A 1JVSA 5L3ZA 1F06A 3H8VA 3LLSA 1AXGA 4YRDA 5LDGA 3NTQA 4PIVA 1U5AA 2YFQA 4D46A 2OFPA 4U0JA 4IXTA 2NVBA 2FPIA 3G3EA 2ZB8A 3GG2A 5IJZA 4W4TA 4NQZA 4Y6RA 1VSVA 3F46A 1PGPA 3AW9A 3CMCO 3D5TA 1VRWA 1E3SA 1NFQA 1LDBA 3RUDA 4FFNA 4UREA 4FFLA 3CH6A 1V8BA 1EDOA 3HNPA 2PD4A 3RFTA 3PWKA 4YJFA 1OZAA 4XWYA 1ZKMA 2PKQP 1HYHA 1I8TA 4P4NA 4DXHA 3IP3A 4MVJM 4J1SA 5JSFA 3OJFA 3DEYX 3OEWA 4RF5A 3INRA 2HSDA 3JYOA 2LDXA 3MTGA 4YEDA 4W9NA 4JJIA 2YQ5A 1DJQA 2ZYDA 3IP1A 5TLSA 2WE8A 3PPIA 1JLLA 2B69A 3F3SA 2ZTVA 3SBOA 1YQDA 3DDNA 4CM8B 2WD8A 3Q2KA 2VCYA 5B4VA 1QR6A 4N5MA 2G1UA 1CETA 4J1QA 2GF2A 4L4SA 4WLVA 5C3MA 2R6JA 4F46A 5ER9A 5CDGA 1NFRA 1QYVA 3F6YA 4GL4A 3TZHA 2FR0A 1Y1PA 1YB4A 1EUCA 4QO8A 5EMHA 2FZWA 4B79A 4R9RA 1ZEJA 4AJLA 2VRBA 4XA8A 2GD1O 4MIOA 6ADHA 2AMFA 2CZCA 4BL5A 1U8FO 1E0DA 4OSPA 4BO4A 5A4DA 4BVAA 2IZ0A 2I3GA 4BO8A 3PWSA 3UN1A 3ZCXA 4EEZA 2YFHA 1M66A 3HWRA 2VQ3A 5A5EA 2NU8A 4B4UA 1BHSA 1P3DA 2GN6A 2Y68A 2OP1A 3JQ7B 4WPGA 1HETA 5IXYA 3MEQA 2A94A 5L7WA 1MXFA 2Y66A 4GMFA 4F45A 5CG2A 3G0OA 3PGJA 3X2EA 4RV9A 3MJSA 4BNJA 4EUHA 1AE1A 4IGEA 4O63O 2RHRA 1DC4A 3KEOA 3FN4A 5T8KC 5B4UA 5JCXA 5HTOA 5TF4A 4O6VA 3IJRA 4ND2A 4CM8A 4CMEA 3AOEA 4MVJA 3AI3A 1ULUA 4XJSA 2O3SA 3AFNA 4PG5A 4ZQGA 4ALMA 3KYCB 4KOAA 2X22A 4HV4A 5DBGA 3O8QA 4ND1A 1KIFA 3WYCA 1V6AA 4RLSA 3JSAA 4Y67A 1C1DB 1SBYA 1B0AA 5THKA 4RDIA 3GG9A 2VT2A 2C0CA 4I08A 4IBOA 5CDYA 5T5QA 5DBIA 4Z6KA 1DFHA 4CL8A 5JAIA 3BTVA 1Q1NA 2PFGA 4NBUA 5G2OA 2Y1GA 1HYGA 2Z1NA 1SOWA 2XXJA 3U5TA 1DIHA 4Z9YA 4R3NA 5JPIA 3QVTA 2GYYA 1LC3A 1YKFA 3TF5A 4WEQA 2EJWA 3VVCA 4W99A 4NU5A 2X5JO 2HAEA 4OYRA 1A7AA 1I5RA 2HK9A 1CWUA 1JQBA 2D5AA 3QE3A 4YACA 4DQVA 3KYCA 2O23A 1UXIA 4D79A 1SPXA 1Z7EA 3NTOA 3UGKA 2YY7A 4CODB 2I99A 6LDHA 1C1DA 4DIFA 4KZPA 1Z82A 3RJ9A 5L53A 2UAGA 2JFFA 4CUKA 3JD4A 1V3TA 2IZZA 1HWYA 2LDBA 3QQPA 5T57A 3DWFA 1ISHA 3L6DA 1R4MB 5F1PA 4CM7A 2WEKA 5I8WA 2FSVA 4IZIA 3INTA 3BIOA 5B12A 3GUYA 1LSOA 1VLLA 3GDGA 2PTGA 1GD1O 4IIVA 1G0OA 4OXYA 4LK3A 1PZEA 1BXGA 1NHGA 4XDYA 3GNTA 2W2LD 2H5LA 1HDOA 1EBFA 4KWIA 3QV1A 4GVXA 4BMVA 4WOJA 3JQFA 2VHYA 1TT5B 2H1SA 1ADGA 5I9MA 2I3AA 4NK4A 1ZMTA 3JD0A 2EXXA 3ZWBA 3BHJA 1KVSA 4IXWA 4GKVA 4I5DA 4JXKA 1LEHA 2O3RA 3ZI0A 4DWVA 3NDJA 1LDEA 2YHUA 5GY7A 2Q1UA 1FK8A 5ER6A 4HXYA 3PDJA 4KUEA 4XZ3A 3H9GA 3S1LA 3WB9A 1VJ0A 4WLFA 4W82A 1C0PA 5C7LO 3KXDA 3DC2A 2WDZA 4IDGA 4I8XA 1AN9A 4YXFA 4CR6A 1R4MA 4JP2A 4K6FA 5CDSA 1D1SA 1ZNQO 4FW8A 2HLPA 2YV2A 3PVZA 1T2FA 2XF8A 2E6UX 1WXDA 3RASA 2NACA 1MUUA 2BI7A 2H9IA 2VHZA 2AG8A 3Q6IA 4CMGA 4X54A 2C07A 3R6DA 5U1PA 3CMMA 1CEQA 1A4IA 2CSUA 1DB3A 4BS9A 1T25A 1B2LA 2ZQZA 4A7PA 3E03A 4A2CA 3BMCA 3QLJA 5AYVA 3ZU3A 5JDIC 3WGZA 5J23A 2HRZA 4WNIA 4BNGA 4E33A 1E6UA 1TT5A 4ALIA 3ONDA 4FR5A 1ONNA 3TDKA 2OMEA 3U4DA 3DBRA 1HXHA 1DHTA 2G76A 4LISA 2R00A 2XPCA 4NFYA 5IZ4A 4OOEA 4MKZA 3GZNA 1RYDA 1LLQA 1NVMB 3C85A 3PJGA 3Q9NA 4P38A 2FR1A 3SLKA 1DC5A 3C3XA 3CPSA 4XEHA 3K96A 1LDMA 4YAGA 5L7TA 1KEVA 2JD1A 1K6IA 5KJCA 3ICPA 1N1EA 2YJZA 5KVVA 4PLGA 4U6QA 2NU6A 4F6CA 3G17A 3RUAA 4CMHA 2H6EA 1OC4A 2J5RA 1WNTA 1DBVO 2Y05A 3HB5X 1LQUA 1DRWA 4QX6A 4CLOB 1O5IA 4S1VA 1T2AA 1RKXA 4WLUA 1PJ2A 1GCOA 4RPHA 1B8VA 4MVJF 1ZVMA 1JN0A 1ISGA 1WWKA 1MLDA 1H9AA 4RPJA 1HDGO 5CFZA 4HNHA 1YB1A 5BSFA 2JD2A 4UEOA 3AY6A 4WCFA 2NVUB 3UXYA 4AJ4A 5DBFA 5CG1A 2Y1DA 2OHXA 3WFJA 1P9LA 4ZVVA 1L7DA 1ZH8A 1BTOA 3KM0A 3GEMA 4BIIA 1HE3A 4OH1A 1JKIA 1ISFA 2ZB4A 4TKLA 1YL6A 3D4OA 4OHUA 5L4LA 4B8WA 2TMGA 2ZCVA 3E82A 4JP3A 1E1NA 2G17A 3MJVA 4B4VA 1K6XA 1P0CA 3FPLA 3R1IA 4FQ8A 4OKIA 3D64A 3FBTA 3WTBA 3UVEA 2X86A 8LDHA 2YW9A 4P4GA 4G5HA 1U3VA 4EUFA 1AHIA 3RWBA 4CLOA 3PDUA 4IQGA 1OBFO 4LVCA 2B4QA 3HADA 3B1JA 4MVJI 2D0IA 5C37A 1I01A 1PSDA 1E7WA 4E5PA 2I76A 4KTVE 3ZWXA 1U28A 3R3JA 1LXCA 3TQHA 1LLCA 2EW2A 2ZK7A 1WZEA 2JD0A 4XB2A 3ETGA 3H9EO 3L9XA 1GAEO 4UVEA 5A02A 4NBRA 3RC2A 1NAHA 2UVDA 3DOOA 1HDRA 4CLDA 4CMJA 2NWQA 2GDZA 1QKIA 1YDEA 2Q49A 4AJKA 2JKVA 5KKCA 4DYVA 4R51A 2P91A 1M76A 3U4IA 4B7UA 4F6LA 3P7MA 5DCWA 4Q3DA 4BKPA 2VWQA 2Y0DA 4J0EA 1E77A 1P45A 3NJ4A 2IXBA 5FYDA 1SB9A 1YJQA 1TVEA 4BO1A 1DAOA 2CDCA 1M6WA 4QT0A 1KOLA 1VKNA 3MOIA 5IXSA 1K6JA 3CINA 3TL3A 4BGEA 3ZWMA 3MWEB 4TMFA 1PS8A 1SO8A 4ZQBA 3TNLA 2BI8A 3OM9A 3FR8A 3VH1A 2NV6A 4S3MA 1UXHA 1WPQA 4DVJA 4ALLA 5AXDA 4BNIA 1ZSYA 2BLLA 2HU2A 3OIGA 4BKOA 1N92A 3K73O 4E2ZA 5ICMA 2BH9A 4U7WA 4PLZA 4OXNA 3F1KA 3TRIA 2PZKA 2NTVA 2X23A 3HB4X 2B83A 2VHWA 4GPD1 3KEQA 2GN9A 4WJZA 4RJTA 4BNHA 4M1QA 4K28A 1UDCA 3BA1A 4BB6A 4BNWA 4ZA2A 2QYSA 1IULA 1I3LA 1KYQA 2QHXA 2X0IA 3OEYA 4AJJA 3Q11A 3RC9A 2C82A 4DMMA 4XRGA 4R1TA 3GZ4A 3ZWNA 2VTEA 4LRTB 3I6IA 3DBHB 1KVRA 2QW8A 4Z0HO 3M2TA 4NMHA 3WICA 4OKNA 1R4NB 4QFCA 1I3MA 3TOXA 1PTJA 4H15A 4AJ2A 4ITUA 1E1KA 5A9RA 2J5QA 3F1LA 5BNIA 5JNLA 3W8FA 1GL3A 1NVGA 1PS0A 4L76A 1H6CA 1YDWA 5FF9A 5L4NA 5JLAA 3ZV5A 5CEEA 5HM8A 5JW6A 5TX7A 3LT2A 1F12A 2ZYGA 4J0FA 2DQ4A 2GO1A 2V6FA 2EWMA 3DZGA 1IB6A 4B3IA 1YO6A 5A3JA 3SC4A 1EVYA 2AE1A 2QZZA 5DZSA 5ILGA 4W6ZA 1XQ6A 3JYQA 3GPIA 3FCOA 3AJRA 3MJEA 1PJQA 4IJWA 4R16A 3PJFA 1SOVA 1PQWA 4IM7A 1U2GA 1LI4A 3IUSA 4DLAA 2QG4A 1VL6A 2PY6A 2W4QA 3MOGA 4IS2A 2PV7A 2EERA 5A03A 2Q2WA 2DAPA 1V0JA 1Y8QB 3QRWA 4FC6A 4NIMA 3CSDA 1YB5A 4DBZA 3SX2A 5I7FA 3AM5A 1E3WB 2QIOA 3DBHA 1SZJG 2FOIA 3LC2O 3OECA 1NPTO 2WSBA 3OIFA 3AU8A 4R9SA 1HE5A 2RCYA 1NFFA 3I9MA 3OJ0A 2GN8A 5IG2A 1K0UA 1UP6A 4PZCA 2I66A 2VUTA 3FBGA 4E5YA 3JD3A 1Q0LA 1BRMA 2DTDA 2GN4A 4XDZA 3UF0A 4PGFA 3U62A 2J3IA 3ONEA 4H3VA 3V1YA 3BTOA 4CM9A 5TT1A 2ZQYA 1PL7A 4OOFA 3GVXA 1DSSG 3QWFA 3I5MA 5DULA 2BFOA 3I9LA 1GPDG 4LRSB 9LDBA 1IZ0A 4QQRA 3F9IA 1F8FA 1SAYA 1ZK2A 5KJFA 5I8ZA 1R16A 1XR3A 2X0JA 3GGGA 1KEWA 1HE4A 3E18A 3RBZA 4ALNA 4AJ1A 1PL8A 2AEJA 1VJ1A 3OICA 2P2SA 1UZLA 4G81A 4AJPA 2ZJ1A 3JQAA 3WNVA 4HFJA 3VDQA 3RU7A 3ZHZA 4J91A 2YUTA 3I4FA 4BMNA 3CUKA 4E5MA 4ESOA 2CF5A 4CM9D 5IDWA 5A04A 2C2YA 2Y67A 3K31A 2VWGA 3U49A 4NBVA 4PLHA 1GEGA 3TPCA 4AICA 3HUDA 4L4RA 3HE3A 4IMRA 5KKAA 1LJ8A 4ND4A 4NFHA 1CYDA 1A71A 2E82A 1LQTA 3EY4A 4Q3NA 1I2ZA 3U3XA 2C29D 2I65A 5H81A 3VPSA 2VHXA 4OO3A 4GMGA 3H9QA 2D5CA 1Z73A 4RL6A 1TLTA 2D2IA 4FBGA 4KUGA 5KJEA 1S7CA 1Z7BA 1BSVA 3VPXA 1I0ZA 1CQIA 2FY8A 2PNFA 3EZLA 1UP4A 3NDRA 3G79A 4U0KA 5F3RA 4R5HA 2GRAA 5COQA 1R37A 4PG8A 4QO7A 4R54A 1NR7A 1QV7A 1I2CA 1DIGA 1W4ZA 3ZNOA 1HL3A 3D3WB 3JYNA 5EL0A 2DU8A 5GMOA 4YR9A 2X9NA 4YQZA 1SMKA 3GR6A 1GPJA 3OFSA 4L73A 4FOSA 4IUYA 3NGXA 3TJRA 3IQDB 4YAEA 2CVQA 5BSEA 3RJ5A 4RPKA 4RQUA 2NVWA 3F4BA 1D1TA 3RUFA 2DKNA 1CQJA 3WGOA 4RGBA 1JW9B 1OMOA 3B1FA 4NR0A 4ZICA 5IDQA 5GZ1A 1Z45A 5ITWA 3K6JA 2X58A 1U3UA 4EUEA 1P1FA 3KV3O 1P74A 1JVBA 1L7EA 2Q1SA 1L1FA 4TQGA 5CAEA 1XGKA 3ZNQA 4Z9XA 1E7RA 3UICA 4YBZA 1X15A 1ZFNA 2YV3A 5FEUA 4RF4A 2FWMX 4GKBA 2ZKLA 4ZQHA 1U3TA 3CTMA 1GV0A 2G5CA 1NAIA 2GSDA 2JJYA 2TMDA 3GHHA 3FNGA 3ZWPA 4F3YA 4FFOA 5L7YA 3VTZA 3RQSA 3D3WA 3BMOA 4YTEA 4MVJP 3R3SA 1R6DA 1UH5A 2HUNA 4RORA 5DOVA 3OQ6A 4Q3CA 1U8XX 3L4SO 1PGJA 3HN7A 1PL6A 2GUGA 4I5EA 4PN3A 4KMSA 3OF2A 3VPGA 1O89A 1NP3A 4N7RA 1S6YA 1Y7TA 4CMAA 5KOIA 1J5PA 3Q9UA 2PA3A 4TSKA 4G65A 1M6HA 3AOGA 5BNFA 4BQPA 5JFOA 2NQTA 4EJ6A 5ITVA 4R1NA 5T67A 1P1HA 2Q45A 3WQQA 4QXMA 5G0SA 5T6BA 2HRBA 3ENNA 3DFUA 2UUOA 3PYMA 3GDFA 4FJ0A 1BVUA 2AW5A 1ZJZA 3EHEA 4PG6A 4HFRA 2NLOA 4YJHB 3PFWO 3WBBA 1QP8A 2SCUA 4YRAA 5JDCA 1TI7A 2UDPA 4NH4A 3OBBA 5IF3A 1X1TA 3NEPX 1PGQA 1ENOA 1ZUD1 1G0NA 1GEEA 1FDWA 2WE7A 2C20A 4FPXA 4IDCA 1A9ZA 3PI7A 2DBVO 1Y81A 2QYTA 1PEDA 3GUCA 3V5NA 5TIIA 1LC0A 3GMSA 1W6UA 4FFRA 4D3SA 5KVSA 1A5ZA 3C7CB 4LMPA 9LDTA 3A9WA 5BNTA 2IZ1A 3GC6A 4BNLA 1PU2A 4IDFA 4WLEA 1GADO 3DFZA 3FF4A 3CEAA 3QWBA 4ALKA 1B16A 3ONFA 1HT0A 4NHEA 4BO5A 3CE6A 4JNKA 4TKMA 1H93A 3OQBA 1KS9A 4CUJA 2VUUA 1ISJA 2DPGA 4BKQA 4RPGA 5EQDA 4B7XA 3E9NA 5EIOA 4L8VA 1KVTA 3ZWVA 4EITA 5JMPA 3FNEA 4YJDA 4YJHA 3O9ZA 3BXXA 4Y6PA 1IZ9A 3ZGYA 1LSSA 3M2PA 3KVOA 4RCVA 1E7MA 1KC1A 3LSYA 4E5KA 4HFNA 2I9PA 5H82A 5K6AA 3EYWA 3FRJA 4IIUA 2O4CA 5CDUA 1ZSVA 4PLWA 4CR7A 4QEDA 4R1SA 1AHHA 2YYYA 3WYEA 1RM5A 3GNSA 4YDRA 1PJSA 4R1UA 3JQ7A 4ROSA 2ZATA 1DEHA 2DC1A 2D1YA 5A3VA 3JQBA 2JAPA 2D4AA 1PJCA 4RF3A 4JCOA 1FF9A 4ZRNA 2WMDA 4K6CA 3RUIA 4NJOA 4XX0A 3VPHA 1ZK3A 3ANMA 4II3A 4AJEA 3FWZA 2AE2A 3JQFC 3GGPA 4CV0A 2Y1EA 4PRKA 3T4EA 1VJTA 3WGGA 4BMSA 1HLDA 1Q0HA 4KDEA 4XQCA 4E31A 5KTKA 1QYDA 1MC5A 1UJMA 2ZTMA 3TN7A 4EEXA 8ADHA 3UCXA 3V2HA 3AUUA 3NYWA 2W2LA 3HQ4O 3KRTA 3ROKA 3WQSB 5BSHA 1GYPA 1I24A 1NQAO 4JJGA 3WSVA 1GZ6A 3LT0A 4R3WA 3OSUA 2AQHA 4L9RA 1O6ZA 5FI5A 4URFA 2VYND 1GV1A 5T8KA 2JAHA 4TVBA 2GZ2A 3VAZA 5K0ZA 1LU9A 4YCAA 3WDSA 4UUNA 2NM0A 3WGIA 2EEZA 2VWPA 3DBVO 3FWNA 4LSMA 2I5PO 2FR8A 1XQ1A 2EV9A 4IDDA 4WK6A 5CPBA 4D7AA 3ROMA 1ZCJA 2EF1A 2FRDA 4GBJA 4O5OA 1UAGA 4RDHA 3K5PA 2X7HA 3V2GA 3C7AA 1J4AA 4E6PA 4LMRA 2JCVA 3KHUA 4J6FA 4NJMB 1YL7A 4AJNA 3DMTA 1DLIA 1E6WA 4ZJUA 4L74A 3LQFA 4MIYA 1NVTA 3AU9A 3NRCA 3N58A 1F8GA 4XQGA 3ROQA 4NI5A 1A7KA 4RVHA 3OIDA 1GCUA 2EKLA 3ZV4A 2F1KA 2R00C 1LTHR 4XR9A 2PGDA 2VZ8A 1N8KA 1LDNA 2AQKA 3Q0EA 2X0RA 3D1LA 3WBFA 3RU9A 4RO0A 1WMBA 3GPDG 3LC1O 3MCVA 4FFPA 3W6UA 5A1TA 1O8CA 5JC8A 4BV8A 3H9UA 2VNAA 5ADHA 1JKJA 1CF2O 5MGBA 1K3TA 1IE3A 1KBZA 2RH4A 5TSDA 1MB4A 4FN4A 2VYVD 2NQ8A 4TRMA 4DLLA 3RCBA 1FXSA 4BNXA 3I83A 4B7CA 3GA0A 5ICSA 4YT2A 2Z1MA 4BO7A 2X5OA 1GYQA 3L07A 1DHRA 3PK0A 4R5MA 3PIDA 1KEPA 4NJMA 1BDBA 5L45A 2VN8A 4J4TA 2NU7A 3SJUA 2J3JA 2X9VA 3ZHBA 3VZRA 3ZWCA 3QJ5A 2JCXA 1JDJA 2VUSA 1Q2XA 4DRYA 2C54A 4A03A 3JQ8B 4GWGA 4XGNA 1DRVA 1E5QA 1QYCA 3FTNA 4O0LA 4WCFC 4LVUA 4CM4B 2Q50A 4PFJA 3WGYA 1IOLA 1Y5MA 3QP9A 4DTIA 1VC2A 3VZSA 3L0DA 4IJUA 3EC7A 5F21A 5HWSA 3SEFA 4CM3A 3H7AA 3DZFA 3EDMA 3PGXA 2CVZA 4B3HA 2YHIB 2GNAA 2V7PA 2VOJA 1XSEA 5G0VA 3VH3A 2Q46A 3RD5A 1Q7CA 3TFOA 2CF6A 2JHGA 5TNXA 4BGUA 4GGOA 2UYYA 3FSRA 3VVBA 4D0SA 3OMLA 3UFXA 2GR9A 3RFXA 4RZIA 3LVFO 5KCZA 5U4QA 1YRLA 4DYDA 3LF2A 1ORRA 3HDQA 2JHFA 4OMUA 5I7SA 2D59A 3EVNA 3QWHA 2PK3A 5IN5A 2O3TA 4DC1A 4ZU3A 4CPDA 1P31A 3F4LA 4G2NA 4KDFA 4DBVO 3AUAA 3WYBA 1LNQA 1F14A 2I67A 3VDRA 1P1RA 3BHMA 4AL4A 4CUZA 4EBFA 1W73A 2C59A 4FB5A 2W90A 5IZCC 3ITKA 4L4XA 5A9SB 1ZXLA 5EESA 5JCJD 3K92A 4FC7A 1QG6A 1JWBB 5G0UA 1LDGA 1O9BA 1SNYA 3DQPA 3R0IA 4NBWA 4XYMA 2YHIA 5JDIA 3FPCA 5KVCA 5ES3A 4YPOA 2FSSA 3NDIA 3QY9A 3RBVA 4D43A 4WASA 2V6MA 3W1VA 4XB1A 4K1LA 3S55A 5L51A 3GRPA 3ORFA 3AI1A 1MG0A 4MVJG 3IKVA 4JBHA 4N18A 2CD9A 1WMAA 4CV1A 3RROA 1JAYA 2ET6A 1KVQA 2DBQA 3FTPA 4WNCA 4B4WA 4NPCA 3BTSA 1NTOA 3OQ1A 4I5GA 3LT4A 1UDAA 3PYXA 4Q9NA 1JAXA 1J6UA 3I3OA 1GUZA 3DR3A 4GX0A 4YT4A 2I6TA 4FJ1A 1Z75A 1PIWA 2J8ZA 4JX8A 3WGHA 2NVUA 3NJ8A 3AUSA 1NR1A 1IL0A 2E4AA 1OAAA 1JWAB 4YA6A 4YT5A 1T1RA 1C3VA 4E2WA 3D7LA 5A9SA 5L4SA 2GGSA 3E6AA 1WW8A 3NT4A 1J0XO 2X9GA 3L77A 4PLYA 1HSOA 5DCUA 4MO2A 3GN2A 4EJ0A 2O2YA 3RC7A 1R0KA 4FGSA 4D3DA 2O7QA 3HDYA 3IIEA 4BGIA 4MP3A 4Z3KA 4E0BA 1YONA 3KLPX 1H2HA 4YJGB 1IYZA 4B8ZA 5JO0A 4EI2A 1H9BA 3ZV6A 1GZ4A 4IQ0A 2VOEA 1MXHA 3WR5A 4UVDA 1ADBA 4C7KA 4ZQFA 3E9MA 2P9EA 3D4PA 4M54A 1KVUA 1XEAA 4BO2A 3D0OA 2CMDA 4ALJA 3AFMA 4E12A 1YS4A 1H94A 1ZXBA 3AY7A 3NKLA 4MINA 1P33A 1EVJA 4NZ9A 3IOYA 5A06A 1C1XB 5F1KA 4DLBA 1QSGA 1DAPA 5EJ2A 1RYEA 1ISIA 4RQTA 1H6BA 1O95A 3CIFA 4J7UA 3H5AA 1BVRA 3TFQA 3AUTA 4I9UA 2GZ1A 4GSLA 4IQ8A 2ZJ0A 4GAEA 5LCXA 3LDHA 2CDBA 4MJLA 5KIAA 3STHA 2PZMA 4P8RA 1K2WA 2Y1OA 5JXWA 3SC6A 1B8PA 1KY4A 4BNTA 2Y99A 1X14A 2QZ9A 2W8ZA 4R69A 2NU9A 2RH8A 3D4NA 3LZ6A 4WECA 3SXPA 5KNLA 2WWRA 3ZDFA 1XLTA 5CEFA 3I6QA 1EUZA 1X13A 2O48X 3FHLA 2PGLA 4CMBA 1EVZA 2B4TO 3GNQA 2PH3A 3QWAA 5DNAA 1YGYA 4BNUA 2Y1CA 4PG4A 3NT5A 3DZBA 1V3VA 5C5IA 4AJIA 1NHWA 2BFPA 2Q3EA 2HK8A 4GX1A 1HDYA 4YB8A 3RKRA 3NAQA 3JYLA 2RHCA 5AXAA 4ZRMA 2CUKA 3QVWA 3F5SA 4JBIA 1MFZA 1ARZA 4JGBA 1P1JA 1R66A 4RVSA 2P4HX 2EG9A 3PZRA 1PJ3A 3A28A 4GWKA 4E30A 1D4FA 4BKUA 3PFFA 4HX5A 4BO9A 5L40A 3WGQA 5MDHA 5F1OA 2WD7B 1E7YA 1F17A 4ILKA 3MTJA 1DRUA 1Q7GA 4XJTA 1FDSA 4ZHSA 4WGGA 4JK3A 4UEKA 3GH3A 1QYWA 5DOZA 3GEDA 2EP5A 1U1IA 4N54A 3LLVA 4I1IA 3A4VA 4BGVA 3IDSA 4JIGA 2OXIA 3HHPA 1PX0A 2QRLA 3AM3A 2JL1A 3ZV3A 3Q1LA 4IDEA 1U4OA 1U7TA 1U7HA 4XYEA 1VE9A 5A9TA 4BHTA 1HTBA 4J3FA 1CDOA 1E3LA 3GLQA 1PWZA 1R4NA 1GTMA 2O3JA 1XKQA 3ANLA 3B6ZA 1XG5A 1H5QA 3H65A 2Q99A 3O38A 3ZU4A 4CM6A 5CEJA 3QVXA 5B37A 1QMGA 4IINA 1YJ8A 2A92A 4XCVA 3UCEA 4CQMB 2BFMA 1GQYA 5ENVA 4ND3A 2IXAA 2EHDA 4YAJA 4YAKA 5CDTA 1A72A 2V6GA 3ULKA 3H3JA 1ZK4A 3P2YA 1ZEMA 3MZ0A 3E1KA 1UP7A 3U9LA 1PGOA 4P22A 2EIHA 1H2BA 3JQGB 2EP7A 4YRBA 4OQZA 1CERA 1GYRA 2WD7A 2HK7A 3NUGA 3C1TA 1LX6A 1WLYA 1Y9EA 2CDAA 3UH1A 5AXCA 3WFIA 3WSWA 1HZZA 3W6ZA 3KB6A 1NQOA 1SEVA 4BO6A 1Y8QA 4J4BA 2H63A 4XQ9A 4GLLA 3ZZNA 7ADHA 1XYGA 4UAGA 3X2FA 1NXQA 1P44A 1E3WA 5CHEA 1B8UA 2HDHA 1ZIDA 3PEFA 3T4XA 1EE9A 1PS9A 3FNHA 4PLPA 4BOYA 4TRRA 2A4KA 2B5VA 1LLDA 3ITDA 2NUAA 4IGFA 5HBRA 3PIIA 5AVOA 2OBYA 1NPDA 2C2XA 4AJOA 5TGDA 1DIBA 4J43A 3TSCA 2FZEA 4Z0PA 2X8LA 4LN1A 5TJ9A 4DL9A 3N7UA 4UVGA 1VKOA 4A26A 1HDXA 3BMQB 3V8BA 2AEMA 3JQGA 4EW6A 2DTEA 2ZTUA 1DIAA 5EPOA 4CV3A 4J16A 3V1TC 4LCJA 1IHXA 1V35A 2F00A 1FDTA 3NTRA 4J4HA 3P2OA 1HSZA 3SVTA 4GQAA 3GAZA 4CQMD 3KBOA 4MDHA 4P4LA 4PLFA 2R2GA 1MG5A 2DUWA 3D5QA 1NWHA 3DZHA 1QYXA 5FI3A 5JY6A 1KC3A 2GLXA 2UV8A 3I9KA 3IC5A 1ONOA 3L4BA 3C1OA 1JTVA 1ZK0A 4J2OA 1HZJA 2DFDA 3VZPA 3W8DA 5LC1A 1C0LA 1RJWA 4IDBA 3TOZA 4BNZA 4D0RA 2HMUA 5COBA 3I23A 4IDAA 4W9NC 2P4QA 3HG7A 1ADCA 3SLGA 4IJKA 3IKTA 3RIHA 5THQA 4NU6A 4NK5A 4Y6SA 1PZGA 3PP8A 1N9GB 4DIOA 3AWDA 3BMQA 4EYEA 2XAAA 3IMFA 3KSZO 1UAYA 3PXXA 1X7GA 5KJ6A 1T2EA 2WYVA 1NX6A 3TZQA 2HCTA 3DAGA 5JDCC 2JFHA 1F0YA 1ZJYA 3JQCA 4YYZA 1KEUA 1R0SA 3DOJA 5DCYA 1B14A 4PLVA 3T7EA 3ST7A 1U2DA 4WLNA 3WXBA 2CNBA 2VZ0A 2C7GA 4HADA 1GFSA 2XOXA 1AGNA 4OGWA 4CLXA 4IPTA 1RM0A 3PHJA 5BR7A 1BDMA 2BGMA 3JQ9A 1MGOA 1E3JA 3I9NA 3M1LA 4E3ZA 1TA4A 1LUAA 3MJ4A 2P5UA 5JE8A 1RM4A 4GLOA 3JD1A 2FPGA 3EMKA 4FIZA 4KTTE 4ZQEA 3WIEA 1C0KA 3B70A 1IUKA 3AI2A 5GZ6A 1N7GA 1NBOA 1HDCA 3MWDB 3Q3CA 4CMEC 3AOEC 3TZCA 3WIDA 4KUHA 2ZYAA 3PHGA 1RM3A 1N9GA 5TT0A 2JFGA 3PHHA 1DPGA 3CZMA 2VTDA 3JYPA 3GGOA 4J7XA 3HSKA 1YQGA 3I52A 3D3EA 3ZN2A 3RVDA 2ZIZA 3ADOA 4LSWA 1YWGO 1UXJA 2DT5A 4YQYA 2EGGA 1HDZA 4HNGA 3GT0A 4K9DA 5EN4A 3UOGA 2W2KB 4DREA 1XIVA 4WLOA 3PTZA 4D45A 5K6AC 2PZLA 3S8MA 4Z3DA 2ZCUA 3DAPA 3UUWA 3PJEA 1EFLA 2CY0A 3NGLA 2DTXA 3F47A 2OORA 1P1IA 4B4OA 5U9CA 1HEUA 2NTJA 3O8QB 3LK7A 4Q3EA 3C24A 4A5OA 1PZHA 3ZW8A 3BAZA 3JQBC 4PCVA 5IAAA 1CRWG 3HDJA 5DP2A 1Q0QA 2PGJA 3GFBA 1NM5A 3OJEA 4FSHA 1U3WA 4D3FA 2UUPA 4R01A 1WDLA 3T7CA 4RVUA 2PH5A 2DPHA 4IZHA 4B3JA 1E7QA 1R0LA 4I9NA 4MPDA 3QA9A 1O94A 2IE0A 4GI2A 3GFGA 3ADPA 3DHNA 3DAFA 2O50A 1NASA 3H2ZA 3PLRA 3HN2A 3ZWYA 1LDYA 4TVOA 3OETA 3L6OO 1EQ2A 1PJLA 1PGNA 3CXRA 1E3EA 4Y98A 5B1YA 3IAHA 4PVCA 1QLJA 1ZMOA 2W2KA 2XXBA 1CIVA 1EK6A 4E21A 2P9GA 4HP8A 3DZKA 5ENDA 1WAMA 4ZD6A 3MJCA 4ID9A 3VC7A 3ZWOA 4MP6A 5T64A 5JBIA 1HRDA 2HKIA 3QHAA 3EGOA 1A9YA 3E9QA 4U8GA 3L6EA 1LBEA 5I9NA 3AM4A 3QW2A 1BGVA 2VYNA 4TZKA 3DMTC 3KLMX 4JLWA 4CMIB 3ZWWA 2BMAA 3KTDA 1T2DA 3WJAA 4KQWA 3DB2A 3EK2A 5DP1A 3W4KA 3GVIA 2IYOA 4QSMA 3C7DB 4OIMA 2PKQO 4MVJD 4OXKA 4WCDA 2YDXA 5F5NA 5JO9A 4BNFA 3TL2A 1MC4A 3E5RA 1XCBA 1K89A 3ETDA 3PQFA 3B20A 1PJTA 4D42A 1BXGB 2OO5A 2V6BA 1B15A 4CMKA 1LSUA 3ICCA 1N1GA 3GOHA 2NSDA 3L9WA 4CLHA 1MV8A 3W4JA 4ZN6A 4A73A 2PD3A 1UZMA 4NFSA 1E7SA 3WWYA 3WWZA 4BNMA 4WE3A 1J49A 2IDZA 1KY5A 3UKOA 3GVHA 4E2XA 2B5WA 1HF3A
chains in the Genus database with same CATH superfamily
4A10A 1XMXA 2C8JA 3ODPA 2RKOA 1YGPA 2B8NA 4R41A 1WA5A 3PC7A 4K05A 1TGVA 1E6EA 1UUFA 1VE6A 2M6SA 1NNSA 2GM9A 3JD2A 4RYDA 2EKBA 4J1TA 1Z2EA 2ZUVA 5E6RB 1GR0A 3E8XA 4JB3A 1KKUA 4AZ3B 1GDHA 4KYTA 3FUVA 2QY9A 4O59O 4W7IA 3ED5A 2IXTA 2GZDA 2OSVA 3SJZA 4AFNA 1GUYA 1ISSA 2ILVA 2X3UA 2P40A 4HPJB 1KO7A 4JT8A 3UUEA 4B3TB 3I34X 1VLZA 7REQB 3RSGA 1OLXA 2D1TA 2O3UA 4BQFA 5HUHA 4JR1A 1EXVA 1BCRB 3DV0A 3PRJA 4XW2A 4MQEB 2HV9A 2P4UA 1NKTA 2QQ5A 2BGJA 4S35A 4KO2S 1ST3A 1L8AA 2ZIWB 4FGWA 4UVIA 2AJ8A 4LF9B 5ILOA 2QMUA 1KJWA 1XDUA 2GKGA 3FE2A 5C32A 2YWCA 4M8IA 2WZBA 1V16A 1N0HA 1SUWA 2H4JA 1GGEA 3K0CA 3MD9A 3SC2A 1U2EA 3L8HA 4Q9LA 2QD1A 3OHSX 4MWCA 3RSZA 5TY0A 4IW3B 3WL7A 5K2OA 3LXXA 3I2FA 1MEEA 3TTYA 1T4DA 2OAEA 1VCNA 2I33A 1EEHA 2O6LA 3JW8A 2CWWA 3DF7A 3A4IA 4TV8B 4HNAB 5DGIA 5L6LB 2X6TA 4G36A 4MAMA 2VWHA 5ED0A 5EWLB 3WIBA 4QNMA 5BSEA 3DEZA 3CLRC 4FFMA 1Z6ZA 4J7CA 4OQQA 1WVGA 4LJAA 5IFLA 5E6RA 4PS1A 1IHYA 4OQEA 3ZH2A 3KT0A 1FRVA 4LF5B 2R6R1 1DC7A 2FUG1 4PS0A 4L75A 3MN1A 5IEBA 4MHSA 2CDRA 3C3YA 1XDGA 1UDWA 4AZ3A 3PHLA 4HKTA 1UDRA 2AK3A 2B7CA 4E32A 1GGJA 3PXDA 3IODA 1SKBA 4RMGA 1QHHB 2WPDA 3S0JA 1EM8A 1DC6A 4OSOA 4RK6A 3T9DA 2C9BA 1GRQA 3ABQB 3LUAA 5E0OA 2QLNA 3TTSA 4C21A 4X9XA 4BUCA 4BV3A 4DFDA 1U9JA 1N2CB 2JAQA 3VSBA 1BCRA 3MMXA 3NUQA 13PKA 4HDMB 5HK9A 4RHCA 5KSZA 3PSHA 3H86A 2NYRA 3RVLA 4UNQA 3GDOA 2O3QA 4LKOA 1DWOA 1TJ5A 1SBCA 2CJFA 2FUG6 3FW1A 1OIVA 3O47A 3WWDA 5BRJA 2KM1A 4C0JA 2I71A 1AS0A 1B42A 3CKKA 4LXYA 4MQBA 4QU5A 1JSXA 4Z3OA 4OJYA 2QXYA 1GRRA 1YBAA 2XR1A 5KZMB 1MX3A 4O4HF 1D2RA 4J8PA 2GBPA 1JIJA 4TV8A 4OL9A 4HNAA 4CKEB 3VH4A 4PVDA 1G66A 3CZ9A 2FG6C 5AW9A 2I6FA 2QMOA 1ISPA 1AGXA 1BKSB 5EWLA 3EF3A 5FWNA 5FPQA 1IN6A 2OV6A 3HYSA 3ZQUA 1RAHA 4UHEA 3HZRA 4BLOA 2AOTB 2BKAA 5FORA 2M6LA 1XJQA 4JV5B 1EE2A 4JROA 2JGMA 3D4LA 1R00A 4CCYB 3U09A 2GTIA 3WMRA 2Z95A 1YIDA 1ENYA 4QJ3A 3L0IB 4IMPA 5G41A 1QHHA 2EVWX 4HNUA 2NX2A 4HNSA 4H7JA 1II0A 2WJYA 1KZ7B 2P68A 3H2KA 1IM8A 5KYGA 1N2CA 3OG9A 4L0QA 1G5IA 4EGSA 1MP0A 4HDMA 3U60B 1VL8A 3ZW9A 1E2QA 4KLCA 1ND6A 2Q5JA 4JVSB 3FZNA 3AUKA 1C8BA 2IHUA 4MTCA 3WL4A 2IXGA 4LNHA 4BQOA 1BMFA 1AGRA 1OQAA 4U6SA 4E4YA 2VG8A 1LH0A 1VBMA 1YH3A 3CSUA 4K7JA 4RD2A 4RXTA 3B60A 1ZR4A 4I50F 4EHJA 3DZJA 2DFVA 2XRMA 2D2VA 4DVGA 3QQ5A 5MF6A 1SC1A 2IEBA 3BQ9A 4IDQA 4GMXA 4V38A 2ZUTA 1K4KA 4S2EA 4IF6A 1IJEA 5D87A 3MCAA 4RHXA 4CKEA 4DR3B 3VUEA 1Z2AA 1YVEI 3W7BA 4HQRA 1HLPA 1LRJA 3GEGA 1VMEA 4MS4A 4DCGA 5ALVA 4ZO7A 5C7IO 3JV7A 3EGXA 1DG1G 3P0RA 2ECKA 3W5AA 1C2TA 3T3MB 1T1EA 4GSYA 3GI1A 1D1QA 1OAKA 2AOTA 2ATEA 3OTWA 5A4IS 3N0TA 4V0RA 2Q8PA 2EX4A 2I1VB 3TRJA 2VT7A 4NICA 3VJRA 1M8GA 2GAJA 3V4LA 3WLTA 1MB0A 4YUZA 1YBMA 4FVTA 1R3UA 1ODJA 4D0NA 4QJIA 1G8PA 3WZLA 3DMYA 1SURA 3O6VA 1G8AA 2EKQA 4ND5A 4BNNA 3TIXB 4ZHQB 3K8QA 1BVHA 2XGJA 1I3KA 2CJYA 4GYJA 4AU1A 2GVDC 2ZRAA 2QR2A 2Z9DA 3N2GA 4WKPA 1YASA 3TWOA 2OGUA 2PLNA 4GE0A 1Z35A 3RJZA 3IELA 1PK7A 2X42A 1YA4A 1N1MA 1ADJA 1MABB 2N47A 4R68A 1HO3A 4GSKA 3LYLA 5J58A 2PJUA 4N5LA 2GETA 2H4WA 2NW6A 2OKCA 3IJ5A 2O52A 1JHYA 1SB8A 1ADFA 2AL7A 1D2AA 3HBAA 4PC6A 2QE7D 3U4MA 1NBWB 3G5AA 4PWZA 4E5SA 3ESRA 1JA9A 4ZTBA 1DEXA 4G25A 4CQNA 3H6KA 3K4PA 4KMMA 1LWNA 3MRXA 5M3BA 4RAOA 5AOVA 2WAYA 4BP8A 2O2XA 3QNUA 1FTYA 5AVZA 1V9LA 2R7MA 4G0XA 2Y3IA 4Q47A 4DG8A 1JHMA 1BDHA 4MPTA 2RI6A 3D6UA 4X6LA 4QTXA 3SSNA 1MFPA 3UYKA 2B30A 4D8XA 1ZGCA 4LXHA 1PTJC 2E48A 3RUHA 3PD7A 1FTSA 3KSMA 2I7XA 5C35A 2J0SA 4MV0A 4FYXA 2Z8XA 2QD3A 1LSJA 2FX2A 3X2SA 4BJ5A 1XA0A 2FLKA 4AD8A 1U98A 3DL2A 3QVGB 1BS2A 5LZ4A 1CXZA 3FNBA 9MHTA 2PZGA 4AG3A 4ZJPA 4PNEA 4L9WA 5K4AA 2HSWA 3LC7O 4L0CA 1KI2A 3A14A 1DBIA 2FVXA 1G3QA 3OJOA 2JG3A 5TRTA 4IH4A 2FG5A 1PQPA 2QWXA 4K26A 4XFKA 3RUEA 3WG9A 2FLWA 4D9KA 4P4UA 5BQ3A 2YZMA 2YRWA 1T10A 1UM9B 3VR4D 2GEDA 3CZRA 4GU5A 4IIGA 2CLMB 4MP8A 3L0SA 3N74A 4PC2A 2GUWA 1MABA 2QORA 2ZUSA 1J9GA 4MV8A 1JUDA 4EGAA 3G85A 2FN7A 1Z4QA 3QUCA 4YJGA 5AUNB 1XD9A 4GX2A 1RMTA 4ME6A 2QRQA 3S40A 1TKBA 1NJ5A 4HEJA 5L3SB 2PT5A 1EX6A 5JADA 1JEDA 3HCBA 1UXGA 5DBOA 3B51X 5FNVB 1KI9A 4RSGA 1TDJA 2QD4A 3L7AA 4MPRA 4NEHB 1E2JA 4ZQCB 5JAMA 4HYTA 1MJNA 1SPBS 1P5ZB 4LJ9A 1JHPA 5H8WA 2UUCB 1JR3D 2C7VA 4C4OA 1E92A 2OYSA 3N5CA 5FA6A 1A27A 4C05A 1VLMA 4XM1A 2C5AA 1T26A 3WK4A 2J3HA 1WJGA 3B53X 1PP4A 3H5NA 5EGNA 2WM3A 4C7OB 2BE9A 2M98A 2G7MC 1P0MA 2YV4A 3VPFA 3DXFA 2ETXA 4P81A 3NOVA 2JEOA 2AJDA 4TUYB 2ZAOA 2IBSA 3BMXA 3QVGA 2GVNA 3QG1A 1XMPA 4IUCS 10MHA 3KPVA 3GLUA 4HTFB 1BA3A 5K0BA 1SXJA 1P2GA 4J75A 5DNWA 3SEQA 5KQRA 4CLEA 2CBZA 2JBHA 1G6KA 4FCVA 5K8IA 3A6DA 1DFGA 4IV0A 2PGOA 4MQ5A 3ZHYA 3ZUGA 1UM9A 1SUPA 3RVSA 1U1DA 2XHEA 3VJLA 5D2CA 2R1ZA 4G2TA 3B12A 3GLFB 3NTUA 3VH2A 4A8JB 4ENPA 4DRXB 2RIRA 4PN7A 4NMXB 3UJDA 1JAHA 3DBLB 3ZYCA 2B7BA 2XA2A 4NNJA 2RH9B 4ZOLB 2N1MA 3ZJVA 1EVQA 3U4AA 3MNFA 3UHFA 4FHCA 3IUYA 3KEGA 1SKYB 1T4BA 3QGMA 4NZNA 3VI4B 4CQJA 1U5BA 4DJ5X 2AKEA 2F90A 4IIHA 1PVVA 3FGNA 5ES4B 2P0EA 4CEHB 2OD7A 3IAAA 1FXUA 2YVKA 2DGDA 2IFTA 3T06B 3BE5A 1XXHB 2NXEA 4JB2A 4JHLA 4DMLA 4E5UA 4Z4FA 5FOUA 4E70A 3SZMA 4HATA 3DUFB 4Q05A 3WQBA 4OP1A 1QLHA 1Q7BA 2R1TB 4C7OA 5TVKA 5I4IA 4RLQA 2POQX 2J3DA 1GKIA 2EJTA 1U1FA 1PZXA 2QUBA 2W2TA 3EZYA 3GRUA 2V65A 3LXRA 3MK31 1G5QA 2G72A 3OZCA 2X1VA 3KYBA 1L3BA 3RE1A 4HTFA 1O0SA 3O84A 4Q7QA 1O96B 4FD3A 5KOJB 1GZUA 2WP8J 1YJBA 3K9GA 2NADA 2H57A 4I6GA 2DHRA 1MBZA 1T24A 3K4HA 3TI7A 4X24A 1JR6A 4J9UE 4XDGA 2RHMA 4I5FA 1FZQA 1ZHOA 1BE6A 3VHRA 5AKZA 3BFJA 3OH8A 3UOAB 3GLFA 2J1LA 4CL3A 2IXDA 1OFGA 3JCZA 4A8JA 4JEIA 2JI8A 2R1UA 2UZIR 4P7BA 4YT8A 2FHSA 2CLEB 1DO8A 3KCQA 3N1UA 1RZVA 3T7KA 3DBLA 1E1MA 3ONWA 5DGXA 3DZDA 5EQFA 1KAGA 1CPYA 1EUDB 2JGEA 2VYFA 1AHNA 4N5NA 1BGWA 3QM1A 4FCCA 3WGVA 3RTCA 2WYHA 1IZYA 3N8IA 3TLGA 4TM8A 1N34B 4CEHA 2OBNA 4IO1A 4XYBA 1JR3E 4QQ8A 3OZTA 3VGJA 2DLDA 2HMSA 2KS6A 1KYZA 2XYVA 4NHOA 4RZHA 3NVAA 3VISA 1LY1A 5F2NA 2VHVA 1XA3A 2BD0A 4G9EA 5C31A 3FWYA 1CQIB 5KYWA 1V2HE 2I91A 1KXZA 2W98A 2Q2QA 3TTXA 4DUPA 5JR3A 3KUDA 1W36B 2PTHA 2YWRA 4MEJA 3ZNNA 5KVQA 5KOJA 1O96A 2BELA 2DLNA 4GBGA 3KKEA 3VSEA 2NXCA 2I29A 1ZIYA 2Z5LA 3A0UA 2ROQA 4QBTA 1BMDA 4KQXA 5UKDA 1XZAA 2ZZKA 3X44A 4G5GA 3NKFA 3Q8XB 1Z0SA 2P5TB 5EP2A 5B1EA 1BDJA 2E6KA 2BONA 1BS1A 4UULA 4B9EA 2J3KA 1DE0A 4UCQA 4UAJA 4DIBA 1NXSA 1QIEA 2Y0CA 3DKKA 2YQ4A 4P9NA 3UKJA 1GGKA 1JJFA 3PFKA 2VDWB 4TN1A 5ALQA 4Q82A 2Z6AA 1I32A 2DUUA 2HHCA 2A9RA 1UFRA 3M34A 3OZIA 3MIZA 4QD3A 1EUDA 2JHAA 5B1IA 5C4IA 3WMWA 4IGIA 2G09A 1BRTA 3MUOA 3ETHA 4PZEA 3RJMA 3ZOKA 3I5AA 2AFIA 1VYTA 1RKQA 3QEMA 3VTFA 5BOVA 2ZVDA 4RU1A 1XHLA 4C2BA 1CRZA 1RC0A 4YGXB 4NU0A 3JZIA 5CTAA 4HNVA 5A0VA 2B4KA 3MVEA 4NCIA 4KL8S 1ZBQA 3AG6A 3SFTA 4BIMA 3RSHA 4MUJA 4LRQA 1NLYA 3CRQA 4XRRA 1HT3A 2ZE8A 1U90A 1DAGA 1K6MA 1Y1KE 2PKXA 1AD2A 3NIDB 5T6MA 3T9BA 3WC4A 4GRAA 4MPJA 3ZDZB 4XYLA 4LK2A 5HQ3B 4GT1A 1W2WB 2R4UA 3HFRA 4MYHA 4JLPA 2FETA 5BV2P 4TZTA 2HRRA 3ZCVA 3A31A 1W4AA 4JH0A 4Y8VA 5AIBA 4E15A 3C5WP 3DKRA 1JEYB 1DKRA 4YQFA 1LRKA 1NY5A 1W34A 2EC5A 2X6QA 2BY4A 3CKMA 2G0TA 4EY3A 5F5LA 2RBEA 4I3HA 2A9QA 4M88A 1S1MA 2X5KO 2GERA 2M6KA 4QDTA 3G5MA 3N39C 2WR8A 1XZLA 3MHPA 4QTZA 4DY4A 5EHXA 1X8KA 1YL5A 2VDWA 3JRWA 1SEPA 2O07A 1KA9H 3PNPA 1XTBA 2Q2VA 3JTMA 2PWZA 4HJXA 1VRCA 1UBOS 1NY6A 1Y4SA 2WAAA 1HGXA 3KALA 3HH8A 1WKCA 2JIRA 2FFBA 4W9RA 3R7LA 1JVSA 4ZVQA 3LLSA 5LDGA 4BCCA 3ADDA 4PIVA 1UKEA 3HJNA 2QVLA 2WG0A 3JVUA 1ABBA 3LBHA 2UYCA 5BR8B 2FWBA 1GA6A 3SX0A 3V55A 5BVGB 5KDDA 4RCZA 5IJZA 4W4TA 4Y6RA 1WW2A 3U37A 3GIWA 3BGOS 2V58A 3HO8A 1P7PA 3CMCO 3D5TA 3M89A 4Y9RA 3TKYA 1NM5C 1NFQA 1RZ3A 5GPBA 2CFIA 1JRLA 2JFPA 3KVRA 2C88A 1E6LA 4JI3B 1JEYA 3CH6A 1V8BA 1BHQ1 4MYDA 2WU0A 3PNQA 1FMJA 4QDOA 1UBJS 1R8XA 3QFHA 5HGJA 4XWYA 3IBYA 3CUEF 1G5PA 2PKQP 3FZGA 1JBEA 1HLFA 2FVYA 2FPMA 4WERA 5JNVA 1VYHA 1RRPA 2SHKA 3CVJA 3LP6A 1E99A 2ASVA 1VFPA 2CXHA 2D3WA 3VR3D 1VLJA 5CT8A 2RC5A 1LPMA 4KQ6A 5JS7A 3CW9A 2XE6A 3ICVA 4NYIQ 4NE7A 5TLSA 2ZYDA 4CN8A 1LCIA 2WE8A 4MI6A 1JNXX 1DKPA 3H4MA 4L95C 3OC0A 5L3VA 3A3YA 3PDHA 4NJOA 1YQDA 3SBOA 3ZU6A 3RYCA 2YVQA 2VCYA 1Q1AA 4F5ZA 5B4VA 1H3FA 1CETA 2GF2A 3QY0A 5DTQA 4JFRA 1E1DA 5BSRA 3VNRA 3G8BA 3LTNC 3TBFA 5CDGA 5AVXA 1A7JA 1RLMA 2H1IA 5BVGA 4DDUA 4WMLA 3RC3A 2XVYA 3BWCA 2NZUG 1KFBB 4KBYA 3QUSA 5DK6A 1MHPA 4COOA 5KYYA 1Z6XA 3W5DA 2HN9A 1O8BA 5BN3B 5K8TA 1G4HA 1U8FO 4P80A 3ZUPA 4FX2A 5AMXA 4H59A 4MMXB 4PAGA 3UHPA 3L93A 4LV6A 2IZ0A 1E1QA 3UN1A 3Q7SA 3SDZA 1FYWA 2YFHA 3V4ZA 5JAOA 1EDBA 4F86A 1U6JA 5A5EA 1VSBA 1VHLA 1XNJA 1IQUA 3DJYA 1ZGJA 4RZ3A 1BHSA 2NU8A 4NCXA 1P3DA 2GN6A 4E1VA 2OP1A 5JHHB 1HETA 3MEQA 5L7WA 2W42A 2YWJA 2GEUA 2Y1KA 2Y66A 1HRKA 4GMFA 3I8SA 3PGJA 3X1DA 3MJSA 3U80A 1C41A 4F85A 1LPBB 4OH7A 1XKTA 1H3NA 4MGYR 4B2YA 2O2JA 3CEJA 4ZRDA 2EWVA 3RIEA 1QK3A 1T9BA 2GTPA 3KEOA 4HRYA 5T8KC 2G4VA 1RHRA 5JCXA 5HTOA 3RS0A 3WK8A 3M7IA 3AOEA 1WSWA 2QN3A 1KEEB 2GCOB 1D5CA 3L79A 2XVXA 1MOPA 1PKXA 4L28A 1A95A 2AXPA 2WWHA 3OCVA 4XJSA 1RIIA 1K3UB 3KYCB 4I2VA 3TNJA 1OGJA 2CN1A 4ALMA 4HV4A 2Z4RA 4LCBA 4ND1A 2IE8A 2HT1A 3G2QA 1V6AA 3ODGA 4RLSA 3WBKA 2P3OA 1E61A 5JQGF 3D7MA 3ESDA 3MGCA 8MHTA 4RDIA 3SHQA 1J0CA 1QO7A 4OGKA 4BN0A 5B5SA 3GJQA 3QU4A 2VO1A 3DXXA 1IWPB 3CRRA 1L5KA 3B82A 1ESZA 5CDYA 2IS4A 2V7WA 3RODA 3RRZA 2QTLA 1UBUS 2C4UA 4GWLA 1DFHA 4RM2A 5DBIA 5HIKA 5HR5A 5DV9A 3FZYA 5JAIA 1B93A 1Q12A 4N0PA 1TGYA 1Q1NA 2PFGA 5HKBA 1Z39A 4RL4A 1AHPA 5K0JA 5AKXA 5L3RA 4E46A 3IUNA 2CLSA 3PCXA 3U3KA 4YRNA 1RZRD 3GBSA 1KI6B 3DMFA 4RMJA 4COKA 3OEED 1IG0A 2XXJA 2EFDB 3U5TA 2GYVA 4Z9YA 5JPIA 2PBLA 4G1FA 1K8XB 1RXSA 2EAUA 1RWOA 1CR4A 3QVTA 3W5VA 4X65B 1QNLA 4TV9A 1LC3A 1WS6A 1YKFA 3EODA 3KKKA 5EZYB 4AWAA 2WF8A 2FSFA 3HY6A 4NU5A 5ICFA 4OYRA 2HK9A 1HQYE 2PRZA 1JQBA 3EULA 3WFZA 1RI5A 2Q07A 4YMIA 3TL6A 3CEPB 1V11B 3KTAB 4C0QC 4DQVA 5T3YA 3KYCA 2GI4A 3NZEA 3REOA 2O23A 2K2QB 2QPTA 2Q3CA 4OHRA 1SPXA 4NC9A 3NTOA 3UGKA 4CODB 1PBNA 5ECWA 1BE8A 6LDHA 1Q3TA 1OA1A 1M5TA 2ANBA 3CYFA 3INYA 1L5SA 4R40A 3CVVA 4JJZA 3IAXA 3N2LA 4LJ7A 4N49A 1GSHA 1USKA 4O0MA 4W5RA 5CLJA 3HJFA 3M6VA 3ET5A 5K0TA 4RIEA 1NRIA 2X9QA 3ETLA 1NMEA 3K05A 1W59A 1E96A 4KRGA 2WQ7A 1WIWA 5P8WA 1D7AA 1QP4A 3L1HA 5F1PA 2WEKA 4LZWA 2OCPA 1XZMA 4V3CA 2P6OA 3INTA 2HXSA 2AG0A 1BH6A 3GUYA 4HEQA 1QRSA 1FMFA 4P3XA 3I04M 2HLDA 2CHUA 4QYWA 1VE7A 3A9CA 3NBFA 5K05A 3CJRA 2ZRJA 2QJRA 4YRGA 1X7WB 2C5LA 4HYQA 2ZP1A 1U1GA 4Y7DA 1E63A 3I6MA 3W34A 1HA3A 2F7SA 3IPCA 4EG7A 1BU5A 5GQSA 3R4VA 1UFQA 3FDFA 1EBFA 3J81k 4DTCA 3QV1A 5EZYA 2R4QA 1OI2A 3GLKA 3F8WA 2PGAA 4UMDA 2VHYA 3GCZA 4EWLA 3D5EA 3MILA 5JJKA 3UJPA 1Z4JA 2I3AA 3GT4A 1J9EA 3KTAA 5HIIA 4YREA 2V59A 3RREA 2HJHA 3KKPA 3FNRA 5HKAA 1T5SA 4US0R 4I5DA 4H6VA 2ZDHA 4LY0A 4HS9A 3WYGA 4L6AA 3QXSA 3H75A 2Q1UA 2E55A 2FMIA 4HXYA 3QEJA 4NARA 3B38A 2JPDA 3BGSA 4N7JA 4XZ3A 5CNIA 5ELLA 3WB9A 3TEMA 4EFMA 3U16A 4FKBA 4IKEA 5JI3E 4U4AA 2DSTA 1NUHA 4R8SA 3UT6A 3ZIAD 3KXDA 2LUOA 4B82A 3P5BA 4I8XA 4YXFA 4ZT5A 4CR6A 3N28A 1R88A 4KI0A 3CLUD 1T91A 4JP2A 1BYUA 2FG7C 1D1SA 2NPOA 3MCWA 4DMFA 5C46F 1AO3A 1DCMA 3DWEX 1CFZA 4LJLA 2PX8A 1T2FA 5TARA 3E2PA 5FNZA 1WXDA 5IULC 1KDPA 1UODA 3FY4A 4NONA 3TOVA 4F72A 4PQYA 1Z25A 2VHZA 2A2ZA 3Q6IA 1X7WA 3BRWA 2AD5A 2XWPA 3QU7A 4RIIA 3VPCA 2O8CA 3R6DA 3VO2A 1UKZA 2NAPA 2CSUA 4BVKA 1QH8A 4RIHA 4OEHA 3TSWA 1C2YA 4OFXA 2ZZMA 3ZU3A 4Q9IA 4FFBA 3MHTA 4DA6A 1P9WA 1ZJ4A 3AL0C 3EGWA 3IDFA 1TM7E 1V47A 2A33A 1CUIA 1NW5A 2G76A 3I04A 4G0NA 4GNRA 4LISA 5EHGA 2CNNA 4LHEA 4NFYA 1C50A 3FJ1A 2JIZD 1ATZA 2OHFA 3B6KA 2CEKA 4KE9A 4OU4A 1E2LA 3GZNA 3Q98A 4MUYA 3N5KA 3M81A 1LLQA 2VPPA 4H6WA 1JTEA 1KYTA 1S9HA 1JQEA 3Q9NA 4BWFB 1FJGB 4LOIA 5CLLA 4RX1A 2F55A 4BQNA 2VATA 1DC5A 3C3XA 1RJ9B 2N75A 4E7OA 1WM1A 5BNZA 2IEZA 3L8DA 1XZDA 3ICPA 4KE7A 1E89A 4G5OA 4I1UA 3DGFC 3IAFA 4PLGA 3CH7A 1ACMA 1N4DA 3UGTA 3BFPA 2WV9A 2BJVA 3RUAA 2H6EA 4F97A 3WNZA 3LIIA 1KZHA 2FMKA 2GZAA 1NJ2A 1Z4NA 2Y05A 4G0YA 3ZHTA 4L16A 4MDFA 2X8JB 1EVEA 5D85A 5CMLA 1IY1A 1NOIA 1NN5A 1T2AA 2Q8NA 1RKXA 2W6QA 3NC0C 1T9AA 3O1JC 4R05A 3I73A 1YZGA 4IHJF 4M98A 4LOAA 3QE9Y 4MUHA 3TSYA 4L50A 3Q88A 4TL9A 1BD4A 5CNMA 5EKSA 2QBYB 1H9AA 3ZDXB 4D96A 3SD7A 2LR0A 2YWXA 4FT4A 3GB9A 5TQJA 1OVGA 5BSFA 4NOLA 2GN1A 1R3DA 1WPGA 2F43A 1SCKA 1XZCA 3PF8A 3THXA 2NVUB 3QK7A 2DETA 4DKXA 3WAGA 3VM6A 5IFKA 1QBGA 2OYCA 1P9LA 3UC9A 4DR1B 1L7DA 4IV5A 4BIIA 1ZHHA 3GEMA 3P52A 5FXMA 3NFRA 1P0IA 1Q91A 1RJ9A 2ZB4A 4A0GA 1UK7A 5TE9A 3WMEA 5C5EA 2ZCVA 1CUDA 2QE7A 3E82A 2FMHA 1GAQA 5FLEX 1E1NA 3BM5A 4B4VA 1K6XA 1P0CA 4FQ8A 5EHNA 4OKIA 3KZKA 3D64A 2IU4A 3E23A 2RONA 3FBTA 3P0FA 5AICA 3UVEA 8LDHA 4N0MA 2AXEA 3BG5A 4W5TA 2VP5A 3BEDA 1M1YB 4A4DA 1V26A 2QI9F 1L8OA 4G1MB 2X8JA 3NDPA 4X44A 1YI1A 1XNQB 3ENZA 3IJEB 1W581 4OI4A 5FBRB 4MVJI 1S7GA 3AVYA 1XTIA 3U3MA 3PPWA 3P2KA 3T9EA 4R7TA 2WU8A 1HYBA 1ZGAA 4Z1MD 1ODFA 2C2HA 3I9V6 4PNPA 3ZWXA 2D1RA 3CR8A 4KNVA 4EF4A 3TQHA 1Y3CE 3DE6X 3OFKA 1AO0A 1N6OA 3JX9A 4L4YA 3ENQA 1SR8A 4QE3A 1U1EA 2UZ3A 3P9RA 2HQRA 3V3TA 3IRVA 4Q4HB 5IC6A 2DR0A 2WUEA 4MWGA 1TYBE 1M54A 1YDGA 3CWCA 1XLVA 2IUEA 1BGXT 4MULA 4QYTA 4UVEA 1L5HA 3VR4A 3AR7A 2XGSA 5IVKA 4OJKA 2LCFA 1HE1C 2H1WA 3ASYA 4ZQIA 5HG0A 4CLDA 3UXEA 1C7FA 2GFQA 2GDZA 1QKIA 4ZEXA 2R7LA 2OY0A 5KKCA 1Z08A 2WT4A 4R51A 4F6LA 3VKWA 4MRRA 4P5DA 1NVKA 2H48A 2Y0DA 3W6NA 4BDSA 2Z83A 1CJSA 3B3FA 5HIMA 1JDPA 1R18A 5FUVA 3HPQA 3AHDA 3AUYA 2ANCA 1SKQA 5ED4A 1M1YA 2CDCA 2ATCA 1M6WA 4QT0A 3W5HA 2OC9A 1VKNA 3Q8WA 1CQZA 5FUQA 3MOIA 1Z3CA 1K6JA 3MOSA 5IXSA 2XTNA 3CINA 4KO3S 4BGEA 4XJVA 1F6DA 2PFKA 4BRUA 1PS8A 3JRXA 1BEZA 1SO8A 1YRAA 1QX3A 2A5YB 2RK6A 5D6OA 1L7QA 5F7JA 4O4LF 4IKPA 1AOXA 2GK4A 2GMWA 3I72A 1RRFA 1F0NA 2VHQA 3VH1A 3A6KA 1SVOA 3O8OB 3BBPA 1TTPB 2NV6A 2NYVA 2VP4A 2VXOA 4JBLA 1C7JA 1R9JA 1ZNWA 2VSYA 4HGRA 5CCXA 1GKYA 3Q41A 2A84A 1GOTA 1BJTA 4LC0A 4N82A 4QAQA 2H9YA 4Q4HA 4YRTA 3ILYA 3G2NA 4ALLA 4EA8A 1YTUA 1R4AA 4WW0A 2DH5A 5ICMA 3QEAZ 1BD3A 5E3JA 3DJFA 3T9FA 4LRYA 4PLZA 4OXNA 4AM8A 1V3QE 3F1KA 3TRIA 4GBMA 2PZKA 2NTVA 4FU0A 1W87A 2B83A 4B71A 4HWSA 621PA 1XEFA 2FF7A 2GN9A 3P45A 2A9OA 3UQYS 4RJTA 1V45E 2CXPA 2REXB 4R3UC 1THMA 4Q9JA 3T3PB 3PC8C 2WRZA 4KCGA 4GZ5A 4BB6A 3AZOA 4HZGA 1A96A 2Y6UA 3I0NA 4H1HA 3JASB 1VE1A 4AJJA 1CX9B 4OK5A 1E1RA 5A3QA 1QAOA 4F96A 3GYBA 4BMXA 6CHYA 2VTEA 2WU1A 4Q01A 1IATA 1O95D 3DTVB 3OTQA 4K2AA 4Z0HO 1U2ZA 2LZ0A 3M2TA 4TYPA 2ZSEA 2AFHE 5CLIA 4CHGA 3FFAA 3PNMA 4QFCA 1L6IA 4NSNA 3O8OA 1XMVA 3ESYA 3SZGA 4ITUA 4TLDA 2E5WA 4NPAA 1BC5A 2J5QA 3OQIA 4YRJA 2EZ4A 5JNLA 1E18A 2QXTA 3W8FA 1TIKA 1SXQA 4EDHA 3OP1A 5CEEA 4PAWA 3EEBA 1UM8A 1B0PA 5JW6A 5TX7A 3UV3A 1O0BA 2JI4A 3I2YX 3L7OA 2H54A 3M33A 1NMZA 2ZYGA 5EKUA 1DJMA 2PMFA 2DQ4A 4QPJC 5MGNA 5I5GA 2WG2A 3HL0A 1KK1A 2EWMA 4G5XA 3DZGA 3QYFA 4NV0A 1OXTA 5AKLA 5E8JA 4ZMBA 5FTMA 3SC4A 2P1RA 4BMYA 4N8SA 4Q1VA 5KPDA 3PTLA 4QBGB 3IQFA 3W2EA 4Q34A 3MTEA 1ORDA 3R3XA 4GP7A 5ERYA 2YASA 3IUSA 4KV9A 3CY6A 3TW6A 1VL6A 2OR3A 2CW5A 3BICA 4Y1RB 5JVDB 2HCBA 2PV7A 4IS2A 3G2HA 1K8ZB 3EF1A 5ALKA 4YLGA 2QG6A 3ZE7A 1YB5A 4X6YA 4NOJA 3DTVA 1X1SA 3NV7A 2QZ4A 1SZJG 2FOIA 1TL7C 2WIGA 4FSXA 2RCYA 3BCRA 3I9MA 1KHHA 2GN8A 1K0UA 2IKQA 2VUTA 4E5YA 4IRXA 2I54A 5AW1A 1Q0LA 3LQ2A 5J2TA 4BY9E 4F2HA 4EKDA 2XCUA 2P69A 4WGFA 1V1RA 4XDZA 2PL5A 3V4PB 4PGFA 3KT3A 3PFNA 1FW6A 1NXTA 2P2NA 3L8YA 1JEAA 5TT1A 2XX3A 1W52X 2ZQYA 1PL7A 1CDDA 4OOFA 2XQVA 1VBFA 3WKDA 2IH4A 4ECEA 2BFOA 1WR8A 1YMQA 2ACWA 5DMHA 5EIHA 5FUWA 1Y1SA 5JRDS 3F9IA 4EG4A 2P8JA 1GZHB 2F3SA 5KJFA 1XR3A 4POAA 1CUCA 3PITA 3GT3A 1KEWA 3E18A 4ALNA 4DV3B 1RQPA 2H4FA 4ZO4A 1Q1BA 1PVDA 1UJ5A 2AEJA 2Q9AA 1T1JA 3BORA 3GUVA 5EAIA 3CBGA 2P2SA 5IKOA 5CFNA 3D1JA 1FB5A 1UANA 4MYRA 5JVDA 1Q84A 5K3EA 4AJPA 3KVVA 4NENB 3VDQA 5FD8A 5FOTA 4C76A 1HNWB 5FQNA 4EB6B 1FQWA 4CIAA 4UXHA 5B1SA 1KY2A 2ZS9A 4E5MA 4ESOA 2CF5A 2XITA 1EFDN 4R9UC 4WH0A 1LPSA 1QP7A 3CLTD 1TU0A 4X84A 4X93A 2C2YA 3DE1X 2QP3A 4HAZA 3ZJYA 3K31A 4Y2PA 4EG8A 2VWGA 5KX5A 3OX4A 4C07A 2QKYA 1RBMA 4F92B 2MDTA 3HUDA 3WLMA 1S2NA 3OZEA 1AC5A 2PO5A 4NFHA 1CYDA 3K9FC 2WB4A 2E82A 3M4NA 2QZSA 5K4HA 1I2ZA 5SZKB 4BAGA 3PGMA 5A62A 4ZT7A 4OO3A 1A9SA 1QC5A 1YC2A 3E3AA 5LOVF 1K9SA 3H9QA 1PFUA 2ZLBA 4LRUA 4KFCA 4KVZA 4R8VA 4INOA 4FBGA 4TS3A 1YS7A 1YRYE 2BHNA 1IK6A 3VPXA 1I1HA 2FY8A 3NDRA 4DSOA 1UP4A 1X2BA 2EYUA 3AF5A 1AB6A 1HYQA 2DZDA 2GRAA 3UBMA 2NO4A 1JLSA 3NHWA 2I6XA 2JHPA 5COQA 1QBKC 4PG8A 1MZPA 2J45A 3KKNA 3UJHA 4A8HA 2CKMA 1I2CA 1DIGA 1DRKA 1X3LA 4U3JB 1HL3A 1UBEA 3PL1A 4O2AB 5IARA 5C53B 1GNQA 1GNVA 1RZUA 1SMKA 3AF2A 3PFHA 3CF2A 3CW2A 4L3VA 4RAQA 4BU0A 5FUYA 4YUAA 3H5OA 1X74A 3BL8A 2ZBGA 4Q3KA 4WCVA 3GQBB 3NGXA 3IQDB 2QOEA 1FVFA 1CUJA 4K8RB 3GBVA 1H2AS 3C7KA 3P4XA 1GNRA 1PT9A 3IX7A 3QLVA 4NR0A 1KKMA 3H2GA 3GRZA 3TKLA 1Z45A 2FU5C 2XTMA 5B3AA 5GZ1A 1OU4A 5CK5A 4MCIA 5DISB 1U3UA 1Y1QA 2GPAA 3PQ3A 4EUEA 2DR3A 1KHTA 2CLIB 5IYZF 3WL8A 4EH1A 1L7EA 1QCYA 2H59A 3PUXA 4TQGA 1G20E 3ZNQA 3W3AH 5AK5A 3JZAA 5EY5B 3AW8A 1RCFA 5CX1B 4UTRA 3BIWA 4L3WA 4YCNA 4YBZA 1X15A 3SYLA 5A4MS 3SS8A 1IUNA 1KMNA 1PDOA 2GBCA 2YV3A 3H42B 4LDQA 1RJEA 1XOIA 3EWNA 2G5CA 4FMDB 1LB1B 1NAIA 2WBLC 3UAYA 1Q0ZA 2GFIA 2VKQA 4CDGA 1W30A 2QX6A 3GHHA 3NC1C 3JS5A 2AG6A 5F3DA 3NKVA 1I13A 4MB2A 4U3JA 3RQSA 3PQ7A 3RNLA 1RABA 4YTEA 3VVMA 4E08A 2PUCA 2PS0A 3UMRA 3AVWA 2ODAA 5KYXB 2JH8A 3OQ6A 1QG0A 3WRWA 4I9FA 2W6JD 3LHFA 3GQBA 4NS1A 3HN7A 1M8FA 3G0IA 4AMBA 4KMSA 2WKSA 1SHJA 2OB2A 5HDQA 3C4QA 3NUZA 5ALEA 1NP3A 3KG2A 3K1JA 1S6YA 1Y7TA 4HQNA 4M1WA 4BXOB 4L0DA 3U56A 4V0SA 2CHFA 2O1SA 5FO0A 4TSKA 4G65A 1M6HA 5DE3A 4LJ5A 1AJEA 3D1VA 3FRHA 2B6HA 3LO5A 4B3XA 2NQTA 1RLTA 1NR5A 5KYNA 4R1NA 1X1BA 3DH0A 5T67A 3OLXA 4X8LA 2C2OA 1T36A 1ZRNA 1Q6ZA 2Q45A 4JWKA 1K5GA 4H17A 4KG7A 4MUIA 4PXAA 4QXMA 3CT6A 5F2OA 5G0SA 5T6BA 3RYTC 1KI8A 3EGVA 1E9BA 1DVRA 3VR6A 4I4TF 4PG6A 5EFOA 1SHKA 2ZIVB 5CX1A 2DQSA 4HFRA 2C57A 2NLOA 2YCLA 4J94A 3WBBA 4AZVA 2SCUA 3S2SA 3LFTA 2A9PA 3IPXA 4CF4A 3HNRA 5CDFE 1K92A 3C70A 2JVJA 3EXIB 1ZUD1 3RH0A 1VMAA 2W6NA 1N6HA 3D8UA 1V96A 5DM4A 3LRPA 5HMMA 1SH7A 1NIPA 2IYEA 2YV5A 1WHSB 5TGTA 2QYTA 3TSAA 4RSHA 4XQ0A 2E0IA 4ZVTA 1LC0A 1CG6A 2ZI3A 1B00A 1W6UA 1YJ5A 4IIYA 1SVIA 4PHHA 4JP5A 4Q3LA 4D3SA 5KVSA 1K7XB 4M7OA 2VQEB 3C7CB 4LMPA 2O0JA 4MS1B 1AURA 3VNAA 1W35A 1GTRA 4DWOA 2Y1XA 5CVJA 1WXQA 1NMYA 3GC6A 4BXOA 4TTRA 3WXMA 3W2TA 2XB8A 2BEKA 3EZFA 3CEAA 3IULA 3VC2A 5BV8A 1RHQA 1G4AE 1HT0A 3NCHA 3ONFA 4NHEA 4BO5A 1HKHA 3CE6A 1JF8A 1UQUA 3LKBA 4NZMA 4GECA 3WHIA 4RQBA 3CUVA 1S02A 4RIGA 4BKQA 3ZIUA 1RZRA 5EQDA 1F2DA 3R6WA 3F7MA 3ZWVA 3R74A 2FDRA 2IZ6A 2C2KA 1C0EA 4M0MA 4UUQA 4YJDA 3DOUA 1VCHA 3VX4A 3KLOA 1OFUX 1IZ9A 1KMIY 2GM3A 4XTCS 3PBKA 1KR2A 1OZFA 2R0QC 3KVOA 1LVGA 1E7MA 1M0SA 4L8FA 4RCVA 4EG6A 4BVGA 3LSYA 1FFEA 4J1TC 4JVNA 5CT5A 3O75A 4F9FA 2QTFA 3M4YA 4I46A 4DIMA 4QU0A 2G9RA 4A1OA 5H82A 5K6AA 3FRJA 1CF4A 2XB6A 4IIUA 2DPYA 2OFXA 4DKJA 2J87A 3O4JA 4WFJA 1ZSVA 3KFVA 4LHSA 3VSDA 1CDZA 4UW9A 4C0HA 1AHHA 4F9GA 1LGYA 4DN6A 3TINA 5C8VA 2A4MA 1NF8A 1YCDA 2NXWA 3GNSA 2IOHA 2JJ8A 3JQ7A 4R1UA 3WGNA 1C4WA 2ADFA 1PBTA 4MS1A 2DERA 2O2EA 1TE2A 1WW3A 2JAPA 3K70C 5G53C 1XP5A 1F0PA 3IEPA 4P7GA 1Y7PA 4UNSA 1H8HA 3OQHA 4KXLA 3QKWA 2ZE5A 3CLVA 3CLUC 2FE4A 3EUAA 1J21A 2FQQA 2HRQA 2AOXA 3MIIA 2FZLA 2L19A 4PFKA 4XX0A 4YRSA 3OTOB 2H1HA 2P75A 1UWVA 4H77A 4P3NA 4KNWA 4LDPA 2ONJA 3MG9A 2FZ4A 3GRAA 1VJTA 2IIVA 4QVKA 4OX9Y 4N5IX 2AOVA 4MDYA 1N3YA 3BBLA 1NXXA 5IX8A 4QDUA 3QSYA 5JCOC 4UDYX