3QWGA

Crystal structure of esprdelta10, c-terminal 10 amino acids deletion mutant of espr transcription factor from mycobacterium tuberculosis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
TTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRSGNRTNPSGATMAALANFFRIKAAYFTDDEYYEKLDKELQWLCTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atypical DNA recognition mechanism used by the EspR virulence regulator of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords ESX-1 secretion-associated regulator EspR
total genus 33
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3qwgA00
4X4HA 2CSFA 4Z5CA 2LYQA 2A6CA 1S7EA 2AXUA 4PU7A 3QF3A 3TRBA 1ZPQA 3OQNA 4I6TA 3G5GA 2KEIA 2OFYA 1ZAYA 4X4IA 3SCGA 4X4DA 1LCDA 2O4AA 2OR1L 2XSDC 1R63A 2B5AA 1O4XA 2PPXA 2WIUB 1QQAA 1GT0C 2PUEA 2CROA 4YG1A 4MCXA 1RZRD 3FYMA 1QP7A 4J1XA 3UFDA 1UXCA 1PRUA 3BD1A 2H8RA 4PU3C 3B7HA 4I8TA 4GQMA 1X2LA 4Z5DA 3ZHIA 1Y9QA 3BDNA 3R1FA 4IA8A 1RZSA 1B0NA 3G7DA 2XJ3A 4NDWA 3QYXA 2ICTA 1ZS4A 4I6UA 1WH8A 3SCFA 3JXBC 1ZZCA 1JFSA 1VPWA 1WETA 3O9XA 1PRAA 3F51A 2L49A 2LYLA 4F8DA 3HZIB 1LLIA 1WIZA 4Y42A 2IVGA 1ADRA 4FBIA 1ZUGA 4OB4A 2EBYA 1BDIA 1QP4A 2XI8A 1OSLA 2PUGA 1ZZBA 1X57A 4PU8A 1PRVA 3LISA 3QWGA 3LFPA 3JXCL 1POUA 4Z59A 1LMB3 3F6WA 1NERA 1OCTC 2AXVA 3D1NI 2HINA 2IUOA 1QQBA 2GZUA 4IWRA 3QQ6A 4JCXA 1ZVVA 2GRLA 2WUSR 2PUAA 2O49A 1E3OC 4YG4A 1RPEL 3CLCA 3CROL 1R69A 2D5VA 3PXPA 4X4GA 1JFTA 5A7LA 4YARA 4YG7B 2EF8A 3EUSA 4JQDA 2GRMA 3GN5A 3BS3A 2L8NA 2BNMA 2LCVA 1IC8A 4PU4C 2AUWA 2KPJA 3U3WA 1SQ8A 1RIOA 4MCTA 1XWRA 3FMYA 4O8BA 3JXDL 2R63A 3ZHMA 1L1MA 4J1WA 1LQCA 2AW6A 4Z58A 1ZZ8A 3RZZA 1CQTA 4IVZA 4X4BA 3VK0A 2O38A 2IVQA 2BNOA 4I6RA 1DWKA 3FYAA 3KJXA 2LYKA 1HF0A 1PERL 3ZKCA 2BJCA 2BNNA 2EWTA 2LYPA 2IU7A 1ZZ6A 4GHJA 3GN5B 2JVLA 3GBFA 2ICPA 2KEJA 1AU7A 2LYJA 3OP9A 2JCGA 2KZ8A 3KXAA 3KZ3A 3MLFA 3F52A 2LYRA 3S8QA 1LCCA 1DW9A 4X4EA 1BDHA 3H5TA 2LYSA 4YBAA 1CJGA 4FN3A 1QP0A 2PUBA 1ZZ9A 1EFAA 2PIJA 4JCYA 2AXZA 1UXDA 1ZZ7A 2IVBA 3OMTA 5K98B 3OQOA 4Z5HA 1QPZA 2MEZA 2PUDA 1Y7YA 4X4FA 2KEKA 2XIUA 2R1JL 1JH9A 1NEQA 1UTXA 2FJRA 1JWLA 1RZRA 2PE5A 2PUCA 2HSGA 3DNVB 1WH6A 2PUFA 4X4CA 3OQMA 2IV1A 3IVPA 2MQKA 1PNRA 3CECA 3L1PA 1YSEA 2XCJA 3SCHA 2AWIA
chains in the Genus database with same CATH superfamily
3QOXA 2AXUA 4I6TA 3G5GA 3GUUA 1LCDA 3OWQA 4YG1A 4MCXA 2H8RA 3B7HA 3BDNA 4EK9A 1B0NA 1NW3A 1WETA 3O9XA 3NDBB 2PXLA 1LLIA 2PXPA 1ZUGA 4Q2JA 4PU8A 2JQEA 3QWGA 5DTRA 2IUOA 4IWRA 2GZUA 1U2ZA 1E3OC 2D5VA 4YG7B 3EUSA 3GN5A 2BNMA 3NROA 3QFIA 2XXQA 3JXDL 4O8BA 2R63A 3KL4A 1CQTA 3TFLA 3KJXA 2BJCA 2IU7A 1ZZ6A 2LYRA 1CJGA 1QP0A 1EFAA 2AXZA 2IVBA 3NZLA 2PUDA 4Z5HA 3R09A 2KEKA 5DTQA 2R1JL 2PE5A 4X4HA 2CSFA 4Z5CA 1S7EA 4DE9A 2OFYA 2PXUA 2FFHA 1R63A 2ODRD 1O4XA 5DTMA 2HFZA 1QP7A 3UFDA 3BD1A 4PU3C 4GQMA 4Z5DA 4ER7A 3R1FA 4IA8A 1QZXA 3QYXA 1JFSA 2VEOA 2LYLA 1WIZA 1ADRA 4FBIA 2EBYA 1QP4A 2PUGA 1X57A 3SX0A 1QB2A 3F6WA 1OCTC 2AXVA 3D1NI 2HINA 3QQ6A 4JCXA 2O49A 4YG4A 2HCSA 2YBDA 4YARA 2V3CC 3NXHA 1DULA 3VWSA 2PXFA 4PU4C 3U3WA 1RIOA 1XWRA 2AW6A 2LNMA 3GZCA 2IVQA 2BNOA 1HF0A 1PERL 3SR4A 4GHJA 3GN5B 3GBFA 2ICPA 2LYJA 2JCGA 3KXAA 3KZ3A 1LCCA 1DW9A 1BDHA 3H5TA 4YBAA 1ZZ7A 1QPZA 2MEZA 4EQZA 5GAGi 5DRYA 1MFQC 2MQKA 3G0TA 3L1PA 2XCJA 4PU7A 3QF3A 2KEIA 4X4DA 2O4AA 2OR1L 2PXDA 1QQAA 2WIUB 2PXBA 2PUEA 4ER0A 2PXKA 2M4HA 4J1XA 1PRUA 5DSXA 4I8TA 1Y9QA 3TEPA 2PXTA 1RZSA 3G7DA 2XJ3A 2LLWA 1ZS4A 5DRTA 3A9YA 3JXBC 3LQXA 2J7WA 2XI8A 1OSLA 3LISA 3JXCL 1POUA 4Z59A 1NERA 4ER5A 1QQBA 1ZVVA 2GRLA 2WUSR 2PUAA 1RPEL 3CROL 1JFTA 2PXVA 2EF8A 2PXQA 3BS3A 2L8NA 2AUWA 2KPJA 1SQ8A 3M9LA 2XXAA 3ZHMA 2XXPA 4Z58A 1ZZ8A 4IVZA 3QOWA 2O38A 2LLVA 3GZDA 3A9ZA 5GAHi 3ZKCA 2BNNA 5DT2A 2LYPA 2KEJA 1AU7A 3MLFA 3F52A 3S8QA 4X4EA 2LYSA 2HCNA 2PIJA 4JCYA 1UXDA 3OMTA 3OQOA 4EKIA 4HRAA 1Y7YA 4X4FA 1JH9A 1NEQA 1RZRA 2HSGA 4ER3A 4X4CA 3OQMA 3GZDC 4EKGA 3A9XA 1PNRA 3CECA 2AWIA 3ME5A 2LYQA 2A6CA 3TRBA 3OQNA 1ZPQA 1ZAYA 4X4IA 3SCGA 2XSDC 2B5AA 2PPXA 1GT0C 2CROA 1RZRD 3FYMA 5JUWA 1UXCA 1X2LA 3ZHIA 4NDWA 1VPWA 2ICTA 4I6UA 1WH8A 3SCFA 1ZZCA 1PRAA 3F51A 2L49A 4F8DA 3HZIB 4Y42A 2IVGA 4OB4A 1BDIA 1ZZBA 1PRVA 3LFPA 1LMB3 1HQ1A 3CLCA 1R69A 3PXPA 4X4GA 5A7LA 4JQDA 2GRMA 2L1PA 2LCVA 1IC8A 4MCTA 4WVLA 3FMYA 1L1MA 4J1WA 2J7UA 1LQCA 4OBMA 3RZZA 4X4BA 3VK0A 2MXDA 4I6RA 1DWKA 3FYAA 4DE8A 2LYKA 3PE5A 3UWPA 3OKZA 2EWTA 2JVLA 3TELA 3OP9A 2KZ8A 4EZIA 3MEJA 4FN3A 1ZZ9A 5K98B 2XIUA 1UTXA 2FJRA 1JWLA 2PXEA 2PUCA 3DM5A 3DNVB 1WH6A 2PUFA 2IV1A 3ZPXA 3IVPA 1YSEA 3SCHA 2PUBA 4ER6A
chains in the Genus database with same CATH topology
4X4HA 2CSFA 4Z5CA 2LYQA 2A6CA 1S7EA 2AXUA 4PU7A 3QF3A 3TRBA 1ZPQA 3OQNA 4I6TA 3G5GA 2KEIA 2OFYA 1ZAYA 4X4IA 3SCGA 4X4DA 1LCDA 2O4AA 2OR1L 2XSDC 1R63A 2B5AA 1O4XA 2PPXA 2WIUB 1QQAA 1GT0C 2PUEA 2CROA 4YG1A 4MCXA 1RZRD 3FYMA 1QP7A 4J1XA 3UFDA 1UXCA 1PRUA 3BD1A 2H8RA 4PU3C 3B7HA 4I8TA 4GQMA 1X2LA 4Z5DA 3ZHIA 1Y9QA 3BDNA 3R1FA 4IA8A 1RZSA 1B0NA 3G7DA 2XJ3A 4NDWA 3QYXA 2ICTA 1ZS4A 4I6UA 1WH8A 3SCFA 3JXBC 1ZZCA 1JFSA 1VPWA 1WETA 3O9XA 1PRAA 3F51A 2L49A 2LYLA 4F8DA 3HZIB 1LLIA 1WIZA 4Y42A 2IVGA 1ADRA 4FBIA 1ZUGA 4OB4A 2EBYA 1BDIA 1QP4A 2XI8A 1OSLA 2PUGA 1ZZBA 1X57A 4PU8A 1PRVA 3LISA 3QWGA 3LFPA 3JXCL 1POUA 4Z59A 1LMB3 3F6WA 1NERA 1OCTC 2AXVA 3D1NI 2HINA 2IUOA 1QQBA 2GZUA 4IWRA 3QQ6A 4JCXA 1ZVVA 2GRLA 2WUSR 2PUAA 2O49A 1E3OC 4YG4A 1RPEL 3CLCA 3CROL 1R69A 2D5VA 3PXPA 4X4GA 1JFTA 5A7LA 4YARA 4YG7B 2EF8A 3EUSA 4JQDA 2GRMA 3GN5A 3BS3A 2L8NA 2BNMA 2LCVA 1IC8A 4PU4C 2AUWA 2KPJA 3U3WA 1SQ8A 1RIOA 4MCTA 1XWRA 3FMYA 4O8BA 3JXDL 2R63A 3ZHMA 1L1MA 4J1WA 1LQCA 2AW6A 4Z58A 1ZZ8A 3RZZA 1CQTA 4IVZA 4X4BA 3VK0A 2O38A 2IVQA 2BNOA 4I6RA 1DWKA 3FYAA 3KJXA 2LYKA 1HF0A 1PERL 3ZKCA 2BJCA 2BNNA 2EWTA 2LYPA 2IU7A 1ZZ6A 4GHJA 3GN5B 2JVLA 3GBFA 2ICPA 2KEJA 1AU7A 2LYJA 3OP9A 2JCGA 2KZ8A 3KXAA 3KZ3A 3MLFA 3F52A 2LYRA 3S8QA 1LCCA 1DW9A 4X4EA 1BDHA 3H5TA 2LYSA 4YBAA 1CJGA 4FN3A 1QP0A 2PUBA 1ZZ9A 1EFAA 2PIJA 4JCYA 2AXZA 1UXDA 1ZZ7A 2IVBA 3OMTA 5K98B 3OQOA 4Z5HA 1QPZA 2MEZA 2PUDA 1Y7YA 4X4FA 2KEKA 2XIUA 2R1JL 1JH9A 1NEQA 1UTXA 2FJRA 1JWLA 1RZRA 2PE5A 2PUCA 2HSGA 3DNVB 1WH6A 2PUFA 4X4CA 3OQMA 2IV1A 3IVPA 2MQKA 1PNRA 3CECA 3L1PA 1YSEA 2XCJA 3SCHA 2AWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X4H A;  2CSF A;  4Z5C A;  2LYQ A;  2A6C A;  1S7E A;  2AXU A;  4PU7 A;  3QF3 A;  3TRB A;  1ZPQ A;  3OQN A;  4I6T A;  3G5G A;  2KEI A;  2OFY A;  1ZAY A;  4X4I A;  3SCG A;  4X4D A;  1LCD A;  2O4A A;  2OR1 L;  2XSD C;  1R63 A;  2B5A A;  1O4X A;  2PPX A;  2WIU B;  1QQA A;  1GT0 C;  2PUE A;  2CRO A;  4YG1 A;  4MCX A;  1RZR D;  3FYM A;  1QP7 A;  4J1X A;  3UFD A;  1UXC A;  1PRU A;  3BD1 A;  2H8R A;  4PU3 C;  3B7H A;  4I8T A;  4GQM A;  1X2L A;  4Z5D A;  3ZHI A;  1Y9Q A;  3BDN A;  3R1F A;  4IA8 A;  1RZS A;  1B0N A;  3G7D A;  2XJ3 A;  4NDW A;  3QYX A;  2ICT A;  1ZS4 A;  4I6U A;  1WH8 A;  3SCF A;  3JXB C;  1ZZC A;  1JFS A;  1VPW A;  1WET A;  3O9X A;  1PRA A;  3F51 A;  2L49 A;  2LYL A;  4F8D A;  3HZI B;  1LLI A;  1WIZ A;  4Y42 A;  2IVG A;  1ADR A;  4FBI A;  1ZUG A;  4OB4 A;  2EBY A;  1BDI A;  1QP4 A;  2XI8 A;  1OSL A;  2PUG A;  1ZZB A;  1X57 A;  4PU8 A;  1PRV A;  3LIS A;  3QWG A;  3LFP A;  3JXC L;  1POU A;  4Z59 A;  1LMB 3;  3F6W A;  1NER A;  1OCT C;  2AXV A;  3D1N I;  2HIN A;  2IUO A;  1QQB A;  2GZU A;  4IWR A;  3QQ6 A;  4JCX A;  1ZVV A;  2GRL A;  2WUS R;  2PUA A;  2O49 A;  1E3O C;  4YG4 A;  1RPE L;  3CLC A;  3CRO L;  1R69 A;  2D5V A;  3PXP A;  4X4G A;  1JFT A;  5A7L A;  4YAR A;  4YG7 B;  2EF8 A;  3EUS A;  4JQD A;  2GRM A;  3GN5 A;  3BS3 A;  2L8N A;  2BNM A;  2LCV A;  1IC8 A;  4PU4 C;  2AUW A;  2KPJ A;  3U3W A;  1SQ8 A;  1RIO A;  4MCT A;  1XWR A;  3FMY A;  4O8B A;  3JXD L;  2R63 A;  3ZHM A;  1L1M A;  4J1W A;  1LQC A;  2AW6 A;  4Z58 A;  1ZZ8 A;  3RZZ A;  1CQT A;  4IVZ A;  4X4B A;  3VK0 A;  2O38 A;  2IVQ A;  2BNO A;  4I6R A;  1DWK A;  3FYA A;  3KJX A;  2LYK A;  1HF0 A;  1PER L;  3ZKC A;  2BJC A;  2BNN A;  2EWT A;  2LYP A;  2IU7 A;  1ZZ6 A;  4GHJ A;  3GN5 B;  2JVL A;  3GBF A;  2ICP A;  2KEJ A;  1AU7 A;  2LYJ A;  3OP9 A;  2JCG A;  2KZ8 A;  3KXA A;  3KZ3 A;  3MLF A;  3F52 A;  2LYR A;  3S8Q A;  1LCC A;  1DW9 A;  4X4E A;  1BDH A;  3H5T A;  2LYS A;  4YBA A;  1CJG A;  4FN3 A;  1QP0 A;  2PUB A;  1ZZ9 A;  1EFA A;  2PIJ A;  4JCY A;  2AXZ A;  1UXD A;  1ZZ7 A;  2IVB A;  3OMT A;  5K98 B;  3OQO A;  4Z5H A;  1QPZ A;  2MEZ A;  2PUD A;  1Y7Y A;  4X4F A;  2KEK A;  2XIU A;  2R1J L;  1JH9 A;  1NEQ A;  1UTX A;  2FJR A;  1JWL A;  1RZR A;  2PE5 A;  2PUC A;  2HSG A;  3DNV B;  1WH6 A;  2PUF A;  4X4C A;  3OQM A;  2IV1 A;  3IVP A;  2MQK A;  1PNR A;  3CEC A;  3L1P A;  1YSE A;  2XCJ A;  3SCH A;  2AWI A; 
#chains in the Genus database with same CATH topology
 3QOX A;  2AXU A;  4I6T A;  3G5G A;  3GUU A;  1LCD A;  3OWQ A;  4YG1 A;  4MCX A;  2H8R A;  3B7H A;  3BDN A;  4EK9 A;  1B0N A;  1NW3 A;  1WET A;  3O9X A;  3NDB B;  2PXL A;  1LLI A;  2PXP A;  1ZUG A;  4Q2J A;  4PU8 A;  2JQE A;  3QWG A;  5DTR A;  2IUO A;  4IWR A;  2GZU A;  1U2Z A;  1E3O C;  2D5V A;  4YG7 B;  3EUS A;  3GN5 A;  2BNM A;  3NRO A;  3QFI A;  2XXQ A;  3JXD L;  4O8B A;  2R63 A;  3KL4 A;  1CQT A;  3TFL A;  3KJX A;  2BJC A;  2IU7 A;  1ZZ6 A;  2LYR A;  1CJG A;  1QP0 A;  1EFA A;  2AXZ A;  2IVB A;  3NZL A;  2PUD A;  4Z5H A;  3R09 A;  2KEK A;  5DTQ A;  2R1J L;  2PE5 A;  4X4H A;  2CSF A;  4Z5C A;  1S7E A;  4DE9 A;  2OFY A;  2PXU A;  2FFH A;  1R63 A;  2ODR D;  1O4X A;  5DTM A;  2HFZ A;  1QP7 A;  3UFD A;  3BD1 A;  4PU3 C;  4GQM A;  4Z5D A;  4ER7 A;  3R1F A;  4IA8 A;  1QZX A;  3QYX A;  1JFS A;  2VEO A;  2LYL A;  1WIZ A;  1ADR A;  4FBI A;  2EBY A;  1QP4 A;  2PUG A;  1X57 A;  3SX0 A;  1QB2 A;  3F6W A;  1OCT C;  2AXV A;  3D1N I;  2HIN A;  3QQ6 A;  4JCX A;  2O49 A;  4YG4 A;  2HCS A;  2YBD A;  4YAR A;  2V3C C;  3NXH A;  1DUL A;  3VWS A;  2PXF A;  4PU4 C;  3U3W A;  1RIO A;  1XWR A;  2AW6 A;  2LNM A;  3GZC A;  2IVQ A;  2BNO A;  1HF0 A;  1PER L;  3SR4 A;  4GHJ A;  3GN5 B;  3GBF A;  2ICP A;  2LYJ A;  2JCG A;  3KXA A;  3KZ3 A;  1LCC A;  1DW9 A;  1BDH A;  3H5T A;  4YBA A;  1ZZ7 A;  1QPZ A;  2MEZ A;  4EQZ A;  5GAG i;  5DRY A;  1MFQ C;  2MQK A;  3G0T A;  3L1P A;  2XCJ A;  4PU7 A;  3QF3 A;  2KEI A;  4X4D A;  2O4A A;  2OR1 L;  2PXD A;  1QQA A;  2WIU B;  2PXB A;  2PUE A;  4ER0 A;  2PXK A;  2M4H A;  4J1X A;  1PRU A;  5DSX A;  4I8T A;  1Y9Q A;  3TEP A;  2PXT A;  1RZS A;  3G7D A;  2XJ3 A;  2LLW A;  1ZS4 A;  5DRT A;  3A9Y A;  3JXB C;  3LQX A;  2J7W A;  2XI8 A;  1OSL A;  3LIS A;  3JXC L;  1POU A;  4Z59 A;  1NER A;  4ER5 A;  1QQB A;  1ZVV A;  2GRL A;  2WUS R;  2PUA A;  1RPE L;  3CRO L;  1JFT A;  2PXV A;  2EF8 A;  2PXQ A;  3BS3 A;  2L8N A;  2AUW A;  2KPJ A;  1SQ8 A;  3M9L A;  2XXA A;  3ZHM A;  2XXP A;  4Z58 A;  1ZZ8 A;  4IVZ A;  3QOW A;  2O38 A;  2LLV A;  3GZD A;  3A9Z A;  5GAH i;  3ZKC A;  2BNN A;  5DT2 A;  2LYP A;  2KEJ A;  1AU7 A;  3MLF A;  3F52 A;  3S8Q A;  4X4E A;  2LYS A;  2HCN A;  2PIJ A;  4JCY A;  1UXD A;  3OMT A;  3OQO A;  4EKI A;  4HRA A;  1Y7Y A;  4X4F A;  1JH9 A;  1NEQ A;  1RZR A;  2HSG A;  4ER3 A;  4X4C A;  3OQM A;  3GZD C;  4EKG A;  3A9X A;  1PNR A;  3CEC A;  2AWI A;  3ME5 A;  2LYQ A;  2A6C A;  3TRB A;  3OQN A;  1ZPQ A;  1ZAY A;  4X4I A;  3SCG A;  2XSD C;  2B5A A;  2PPX A;  1GT0 C;  2CRO A;  1RZR D;  3FYM A;  5JUW A;  1UXC A;  1X2L A;  3ZHI A;  4NDW A;  1VPW A;  2ICT A;  4I6U A;  1WH8 A;  3SCF A;  1ZZC A;  1PRA A;  3F51 A;  2L49 A;  4F8D A;  3HZI B;  4Y42 A;  2IVG A;  4OB4 A;  1BDI A;  1ZZB A;  1PRV A;  3LFP A;  1LMB 3;  1HQ1 A;  3CLC A;  1R69 A;  3PXP A;  4X4G A;  5A7L A;  4JQD A;  2GRM A;  2L1P A;  2LCV A;  1IC8 A;  4MCT A;  4WVL A;  3FMY A;  1L1M A;  4J1W A;  2J7U A;  1LQC A;  4OBM A;  3RZZ A;  4X4B A;  3VK0 A;  2MXD A;  4I6R A;  1DWK A;  3FYA A;  4DE8 A;  2LYK A;  3PE5 A;  3UWP A;  3OKZ A;  2EWT A;  2JVL A;  3TEL A;  3OP9 A;  2KZ8 A;  4EZI A;  3MEJ A;  4FN3 A;  1ZZ9 A;  5K98 B;  2XIU A;  1UTX A;  2FJR A;  1JWL A;  2PXE A;  2PUC A;  3DM5 A;  3DNV B;  1WH6 A;  2PUF A;  2IV1 A;  3ZPX A;  3IVP A;  1YSE A;  3SCH A;  2PUB A;  4ER6 A; 
#chains in the Genus database with same CATH homology
 4X4H A;  2CSF A;  4Z5C A;  2LYQ A;  2A6C A;  1S7E A;  2AXU A;  4PU7 A;  3QF3 A;  3TRB A;  1ZPQ A;  3OQN A;  4I6T A;  3G5G A;  2KEI A;  2OFY A;  1ZAY A;  4X4I A;  3SCG A;  4X4D A;  1LCD A;  2O4A A;  2OR1 L;  2XSD C;  1R63 A;  2B5A A;  1O4X A;  2PPX A;  2WIU B;  1QQA A;  1GT0 C;  2PUE A;  2CRO A;  4YG1 A;  4MCX A;  1RZR D;  3FYM A;  1QP7 A;  4J1X A;  3UFD A;  1UXC A;  1PRU A;  3BD1 A;  2H8R A;  4PU3 C;  3B7H A;  4I8T A;  4GQM A;  1X2L A;  4Z5D A;  3ZHI A;  1Y9Q A;  3BDN A;  3R1F A;  4IA8 A;  1RZS A;  1B0N A;  3G7D A;  2XJ3 A;  4NDW A;  3QYX A;  2ICT A;  1ZS4 A;  4I6U A;  1WH8 A;  3SCF A;  3JXB C;  1ZZC A;  1JFS A;  1VPW A;  1WET A;  3O9X A;  1PRA A;  3F51 A;  2L49 A;  2LYL A;  4F8D A;  3HZI B;  1LLI A;  1WIZ A;  4Y42 A;  2IVG A;  1ADR A;  4FBI A;  1ZUG A;  4OB4 A;  2EBY A;  1BDI A;  1QP4 A;  2XI8 A;  1OSL A;  2PUG A;  1ZZB A;  1X57 A;  4PU8 A;  1PRV A;  3LIS A;  3QWG A;  3LFP A;  3JXC L;  1POU A;  4Z59 A;  1LMB 3;  3F6W A;  1NER A;  1OCT C;  2AXV A;  3D1N I;  2HIN A;  2IUO A;  1QQB A;  2GZU A;  4IWR A;  3QQ6 A;  4JCX A;  1ZVV A;  2GRL A;  2WUS R;  2PUA A;  2O49 A;  1E3O C;  4YG4 A;  1RPE L;  3CLC A;  3CRO L;  1R69 A;  2D5V A;  3PXP A;  4X4G A;  1JFT A;  5A7L A;  4YAR A;  4YG7 B;  2EF8 A;  3EUS A;  4JQD A;  2GRM A;  3GN5 A;  3BS3 A;  2L8N A;  2BNM A;  2LCV A;  1IC8 A;  4PU4 C;  2AUW A;  2KPJ A;  3U3W A;  1SQ8 A;  1RIO A;  4MCT A;  1XWR A;  3FMY A;  4O8B A;  3JXD L;  2R63 A;  3ZHM A;  1L1M A;  4J1W A;  1LQC A;  2AW6 A;  4Z58 A;  1ZZ8 A;  3RZZ A;  1CQT A;  4IVZ A;  4X4B A;  3VK0 A;  2O38 A;  2IVQ A;  2BNO A;  4I6R A;  1DWK A;  3FYA A;  3KJX A;  2LYK A;  1HF0 A;  1PER L;  3ZKC A;  2BJC A;  2BNN A;  2EWT A;  2LYP A;  2IU7 A;  1ZZ6 A;  4GHJ A;  3GN5 B;  2JVL A;  3GBF A;  2ICP A;  2KEJ A;  1AU7 A;  2LYJ A;  3OP9 A;  2JCG A;  2KZ8 A;  3KXA A;  3KZ3 A;  3MLF A;  3F52 A;  2LYR A;  3S8Q A;  1LCC A;  1DW9 A;  4X4E A;  1BDH A;  3H5T A;  2LYS A;  4YBA A;  1CJG A;  4FN3 A;  1QP0 A;  2PUB A;  1ZZ9 A;  1EFA A;  2PIJ A;  4JCY A;  2AXZ A;  1UXD A;  1ZZ7 A;  2IVB A;  3OMT A;  5K98 B;  3OQO A;  4Z5H A;  1QPZ A;  2MEZ A;  2PUD A;  1Y7Y A;  4X4F A;  2KEK A;  2XIU A;  2R1J L;  1JH9 A;  1NEQ A;  1UTX A;  2FJR A;  1JWL A;  1RZR A;  2PE5 A;  2PUC A;  2HSG A;  3DNV B;  1WH6 A;  2PUF A;  4X4C A;  3OQM A;  2IV1 A;  3IVP A;  2MQK A;  1PNR A;  3CEC A;  3L1P A;  1YSE A;  2XCJ A;  3SCH A;  2AWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...