3QWGA

Crystal structure of esprdelta10, c-terminal 10 amino acids deletion mutant of espr transcription factor from mycobacterium tuberculosis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
TTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRSGNRTNPSGATMAALANFFRIKAAYFTDDEYYEKLDKELQWLCTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atypical DNA recognition mechanism used by the EspR virulence regulator of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords ESX-1 secretion-associated regulator EspR
total genus 33
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3qwgA00
1LLIA 3FYAA 1WIZA 3OP9A 2CROA 2KEIA 2PUAA 2PUFA 1ZUGA 2LCVA 4X4BA 3L1PA 4IWRA 2PE5A 4YG7B 1DW9A 2XSDC 4NDWA 2D5VA 2AW6A 3SCFA 2KEKA 2BJCA 2PUEA 3G5GA 4Z58A 2IVBA 4JCXA 1XWRA 3ZHIA 2IVQA 1JH9A 1R69A 3F6WA 3QF3A 1HF0A 4PU3C 3LFPA 1Y7YA 3H5TA 1ZZ6A 4I6UA 2PUDA 2AWIA 3O9XA 3JXBC 2LYPA 2OFYA 2FJRA 2LYRA 3KXAA 4YG4A 4X4EA 1L1MA 2XCJA 2O4AA 3BD1A 4X4CA 4JCYA 4Z5DA 1NEQA 2WIUB 3G7DA 3OQNA 1QPZA 1POUA 4I6RA 2AXVA 4X4GA 2XI8A 2IU7A 1CJGA 1QP0A 2LYLA 2BNOA 2GZUA 3BDNA 2IV1A 2EF8A 3TRBA 1UXCA 1ZZ7A 4GHJA 3VK0A 1CQTA 2PPXA 3HZIB 3UFDA 3JXCL 2PIJA 1ZVVA 2L49A 3FMYA 2CSFA 4MCXA 1BDIA 2ICTA 1E3OC 3U3WA 1LCCA 2IUOA 1WH6A 2L8NA 3DNVB 1PRUA 1ZZCA 1RZRD 1PRVA 2AUWA 3KJXA 2ICPA 2LYKA 3F51A 1ZZ9A 4JQDA 1B0NA 2WUSR 2GRMA 4YARA 1RIOA 4I8TA 4FN3A 3BS3A 3EUSA 3F52A 2R1JL 1OCTC 1ZPQA 4YBAA 3LISA 4Z5CA 1QP7A 4IA8A 1O4XA 3RZZA 2A6CA 2JVLA 2IVGA 1LQCA 3JXDL 1OSLA 3KZ3A 1RZRA 1LCDA 3ZHMA 3OQMA 3FYMA 1PERL 3SCGA 1SQ8A 1R63A 1EFAA 4IVZA 1LMB3 2PUGA 1ZZ8A 1UTXA 1S7EA 3OMTA 3QQ6A 2H8RA 4J1XA 4FBIA 2EWTA 2MQKA 5K98B 4X4FA 1JFSA 1YSEA 4J1WA 4Y42A 2BNNA 4PU7A 4F8DA 2PUCA 3SCHA 4X4HA 1IC8A 2HSGA 3B7HA 4Z5HA 1DWKA 4X4IA 3CECA 1QP4A 2KPJA 4GQMA 2MEZA 1ZS4A 1RPEL 2R63A 2XIUA 1WH8A 1PRAA 1RZSA 2AXUA 2HINA 4I6TA 3CLCA 2KZ8A 3GN5B 4X4DA 2OR1L 2LYQA 3S8QA 4PU8A 1X57A 2LYJA 4O8BA 1ADRA 2O49A 4MCTA 2XJ3A 3OQOA 3QYXA 3CROL 1ZZBA 1X2LA 2EBYA 3IVPA 2GRLA 3QWGA 3GN5A 1BDHA 1QQAA 2B5AA 4OB4A 2KEJA 4YG1A 5A7LA 2JCGA 1NERA 1Y9QA 1GT0C 2LYSA 1VPWA 1UXDA 1WETA 2PUBA 4Z59A 1PNRA 3MLFA 1ZAYA 3PXPA 2O38A 1JFTA 1AU7A 1QQBA 3GBFA 1JWLA 3R1FA 2BNMA 4PU4C 3D1NI 2AXZA 3ZKCA
chains in the Genus database with same CATH superfamily
1HQ1A 2CROA 2PUAA 3L1PA 4YG7B 2D5VA 3A9YA 4Z58A 1R69A 3F6WA 1HF0A 1Y7YA 3H5TA 2FJRA 2LYRA 2XXAA 2XCJA 3BD1A 5DRTA 4Z5DA 2JQEA 5GAGi 2BNOA 2GZUA 3BDNA 2IV1A 5DRYA 4GHJA 5DTRA 1ZVVA 2L49A 2IUOA 1PRUA 1ZZCA 1RZRD 2AUWA 2FFHA 1MFQC 3QFIA 2MXDA 4WVLA 4FN3A 3EUSA 3ME5A 3F52A 4YBAA 4Z5CA 1QP7A 2PXUA 3QOWA 2IVGA 4ER6A 1RZRA 3SCGA 2PXPA 3NROA 3QQ6A 1JFSA 2J7UA 1DULA 4F8DA 2PUCA 3ZPXA 2PXQA 1IC8A 2HSGA 3B7HA 1DWKA 1WH8A 1X57A 2O49A 4DE8A 3OQOA 1ZZBA 1QQAA 4EQZA 1Y9QA 1GT0C 1UXDA 2PUBA 2LNMA 3KL4A 3NZLA 3VWSA 2VEOA 3PXPA 2O38A 1JFTA 3DM5A 1JWLA 3UWPA 3ZKCA 2KEIA 5DT2A 1DW9A 2XSDC 3SCFA 1QZXA 4JCXA 3ZHIA 2PXVA 2HCSA 4PU3C 2XXQA 2XXPA 2OFYA 4YG4A 2O4AA 1L1MA 1NEQA 3OQNA 1QPZA 4X4GA 2PXFA 2XI8A 1QP0A 1U2ZA 3TRBA 1ZZ7A 3VK0A 2PPXA 2CSFA 4EZIA 1WH6A 3GZDA 2ICPA 3F51A 2GRMA 2V3CC 2R1JL 4IA8A 3RZZA 2JVLA 3JXDL 1LQCA 3KZ3A 3FYMA 1SQ8A 4IVZA 2PXTA 4ER5A 2EWTA 4X4FA 4PU7A 2L1PA 2PXDA 4GQMA 2MEZA 1ZS4A 4ER3A 1RPEL 2R63A 2XIUA 3CLCA 1PRAA 2AXUA 2KZ8A 3NDBB 2OR1L 2PXBA 3IVPA 3GN5A 2M4HA 2KEJA 4OB4A 4HRAA 4DE9A 2JCGA 1NERA 2LYSA 4Z59A 1QB2A 1PNRA 1AU7A 2BNMA 3D1NI 4EKIA 2PUDA 3A9ZA 1LLIA 3OP9A 2LCVA 4NDWA 2KEKA 5DTMA 1XWRA 3QF3A 1ZZ6A 3JXBC 4X4CA 4JCYA 2WIUB 3G7DA 2IU7A 4Q2JA 2EF8A 1UXCA 1CQTA 2YBDA 2PIJA 3FMYA 3SR4A 1LCCA 2ICTA 2L8NA 3DNVB 4OBMA 4EKGA 1PRVA 3KJXA 4ER7A 4JQDA 1B0NA 2WUSR 1RIOA 5DSXA 4I8TA 2PXKA 3LQXA 1ZPQA 3LISA 1O4XA 1OSLA 1LCDA 3OQMA 4EK9A 1R63A 3TFLA 2PUGA 1UTXA 1S7EA 4FBIA 2MQKA 5K98B 3M9LA 3A9XA 4X4HA 2LLWA 4Z5HA 3CECA 2KPJA 3PE5A 3QOXA 1RZSA 4I6TA 3GN5B 2LYQA 5JUWA 4PU8A 3S8QA 2LYJA 1ADRA 3MEJA 2PXLA 2XJ3A 3CROL 1BDHA 4YG1A 1VPWA 3GZDC 3MLFA 1ZAYA 3FYAA 1WIZA 4IWRA 2PUFA 1ZUGA 3GZCA 4X4BA 2PE5A 2AW6A 3TEPA 2BJCA 2PUEA 3G5GA 2IVBA 2IVQA 1JH9A 3LFPA 4I6UA 3OKZA 2AWIA 3O9XA 2LYPA 3KXAA 4X4EA 5DTQA 2HFZA 1POUA 1NW3A 2AXVA 4I6RA 3TELA 1CJGA 2LYLA 3OWQA 2ODRD 3HZIB 3UFDA 3JXCL 2LLVA 4MCXA 1BDIA 1E3OC 3U3WA 4ER0A 2LYKA 1ZZ9A 4YARA 3NXHA 3BS3A 1OCTC 2A6CA 3ZHMA 1PERL 1EFAA 1LMB3 1ZZ8A 2H8RA 3OMTA 4J1XA 2HCNA 1YSEA 4J1WA 4Y42A 2BNNA 3SCHA 4X4IA 1QP4A 3G0TA 2HINA 3R09A 4X4DA 2PXEA 4O8BA 2J7WA 4MCTA 3SX0A 3QYXA 1X2LA 2EBYA 2GRLA 3QWGA 5GAHi 2B5AA 5A7LA 1WETA 1QQBA 3GBFA 3R1FA 4PU4C 2AXZA 3GUUA
chains in the Genus database with same CATH topology
1LLIA 3FYAA 1WIZA 3OP9A 2CROA 2KEIA 2PUAA 2PUFA 1ZUGA 2LCVA 4X4BA 3L1PA 4IWRA 2PE5A 4YG7B 1DW9A 2XSDC 4NDWA 2D5VA 2AW6A 3SCFA 2KEKA 2BJCA 2PUEA 3G5GA 4Z58A 2IVBA 4JCXA 1XWRA 3ZHIA 2IVQA 1JH9A 1R69A 3F6WA 3QF3A 1HF0A 4PU3C 3LFPA 1Y7YA 3H5TA 1ZZ6A 4I6UA 2PUDA 2AWIA 3O9XA 3JXBC 2LYPA 2OFYA 2FJRA 2LYRA 3KXAA 4YG4A 4X4EA 1L1MA 2XCJA 2O4AA 3BD1A 4X4CA 4JCYA 4Z5DA 1NEQA 2WIUB 3G7DA 3OQNA 1QPZA 1POUA 4I6RA 2AXVA 4X4GA 2XI8A 2IU7A 1CJGA 1QP0A 2LYLA 2BNOA 2GZUA 3BDNA 2IV1A 2EF8A 3TRBA 1UXCA 1ZZ7A 4GHJA 3VK0A 1CQTA 2PPXA 3HZIB 3UFDA 3JXCL 2PIJA 1ZVVA 2L49A 3FMYA 2CSFA 4MCXA 1BDIA 2ICTA 1E3OC 3U3WA 1LCCA 2IUOA 1WH6A 2L8NA 3DNVB 1PRUA 1ZZCA 1RZRD 1PRVA 2AUWA 3KJXA 2ICPA 2LYKA 3F51A 1ZZ9A 4JQDA 1B0NA 2WUSR 2GRMA 4YARA 1RIOA 4I8TA 4FN3A 3BS3A 3EUSA 3F52A 2R1JL 1OCTC 1ZPQA 4YBAA 3LISA 4Z5CA 1QP7A 4IA8A 1O4XA 3RZZA 2A6CA 2JVLA 2IVGA 1LQCA 3JXDL 1OSLA 3KZ3A 1RZRA 1LCDA 3ZHMA 3OQMA 3FYMA 1PERL 3SCGA 1SQ8A 1R63A 1EFAA 4IVZA 1LMB3 2PUGA 1ZZ8A 1UTXA 1S7EA 3OMTA 3QQ6A 2H8RA 4J1XA 4FBIA 2EWTA 2MQKA 5K98B 4X4FA 1JFSA 1YSEA 4J1WA 4Y42A 2BNNA 4PU7A 4F8DA 2PUCA 3SCHA 4X4HA 1IC8A 2HSGA 3B7HA 4Z5HA 1DWKA 4X4IA 3CECA 1QP4A 2KPJA 4GQMA 2MEZA 1ZS4A 1RPEL 2R63A 2XIUA 1WH8A 1PRAA 1RZSA 2AXUA 2HINA 4I6TA 3CLCA 2KZ8A 3GN5B 4X4DA 2OR1L 2LYQA 3S8QA 4PU8A 1X57A 2LYJA 4O8BA 1ADRA 2O49A 4MCTA 2XJ3A 3OQOA 3QYXA 3CROL 1ZZBA 1X2LA 2EBYA 3IVPA 2GRLA 3QWGA 3GN5A 1BDHA 1QQAA 2B5AA 4OB4A 2KEJA 4YG1A 5A7LA 2JCGA 1NERA 1Y9QA 1GT0C 2LYSA 1VPWA 1UXDA 1WETA 2PUBA 4Z59A 1PNRA 3MLFA 1ZAYA 3PXPA 2O38A 1JFTA 1AU7A 1QQBA 3GBFA 1JWLA 3R1FA 2BNMA 4PU4C 3D1NI 2AXZA 3ZKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LLI A;  3FYA A;  1WIZ A;  3OP9 A;  2CRO A;  2KEI A;  2PUA A;  2PUF A;  1ZUG A;  2LCV A;  4X4B A;  3L1P A;  4IWR A;  2PE5 A;  4YG7 B;  1DW9 A;  2XSD C;  4NDW A;  2D5V A;  2AW6 A;  3SCF A;  2KEK A;  2BJC A;  2PUE A;  3G5G A;  4Z58 A;  2IVB A;  4JCX A;  1XWR A;  3ZHI A;  2IVQ A;  1JH9 A;  1R69 A;  3F6W A;  3QF3 A;  1HF0 A;  4PU3 C;  3LFP A;  1Y7Y A;  3H5T A;  1ZZ6 A;  4I6U A;  2PUD A;  2AWI A;  3O9X A;  3JXB C;  2LYP A;  2OFY A;  2FJR A;  2LYR A;  3KXA A;  4YG4 A;  4X4E A;  1L1M A;  2XCJ A;  2O4A A;  3BD1 A;  4X4C A;  4JCY A;  4Z5D A;  1NEQ A;  2WIU B;  3G7D A;  3OQN A;  1QPZ A;  1POU A;  4I6R A;  2AXV A;  4X4G A;  2XI8 A;  2IU7 A;  1CJG A;  1QP0 A;  2LYL A;  2BNO A;  2GZU A;  3BDN A;  2IV1 A;  2EF8 A;  3TRB A;  1UXC A;  1ZZ7 A;  4GHJ A;  3VK0 A;  1CQT A;  2PPX A;  3HZI B;  3UFD A;  3JXC L;  2PIJ A;  1ZVV A;  2L49 A;  3FMY A;  2CSF A;  4MCX A;  1BDI A;  2ICT A;  1E3O C;  3U3W A;  1LCC A;  2IUO A;  1WH6 A;  2L8N A;  3DNV B;  1PRU A;  1ZZC A;  1RZR D;  1PRV A;  2AUW A;  3KJX A;  2ICP A;  2LYK A;  3F51 A;  1ZZ9 A;  4JQD A;  1B0N A;  2WUS R;  2GRM A;  4YAR A;  1RIO A;  4I8T A;  4FN3 A;  3BS3 A;  3EUS A;  3F52 A;  2R1J L;  1OCT C;  1ZPQ A;  4YBA A;  3LIS A;  4Z5C A;  1QP7 A;  4IA8 A;  1O4X A;  3RZZ A;  2A6C A;  2JVL A;  2IVG A;  1LQC A;  3JXD L;  1OSL A;  3KZ3 A;  1RZR A;  1LCD A;  3ZHM A;  3OQM A;  3FYM A;  1PER L;  3SCG A;  1SQ8 A;  1R63 A;  1EFA A;  4IVZ A;  1LMB 3;  2PUG A;  1ZZ8 A;  1UTX A;  1S7E A;  3OMT A;  3QQ6 A;  2H8R A;  4J1X A;  4FBI A;  2EWT A;  2MQK A;  5K98 B;  4X4F A;  1JFS A;  1YSE A;  4J1W A;  4Y42 A;  2BNN A;  4PU7 A;  4F8D A;  2PUC A;  3SCH A;  4X4H A;  1IC8 A;  2HSG A;  3B7H A;  4Z5H A;  1DWK A;  4X4I A;  3CEC A;  1QP4 A;  2KPJ A;  4GQM A;  2MEZ A;  1ZS4 A;  1RPE L;  2R63 A;  2XIU A;  1WH8 A;  1PRA A;  1RZS A;  2AXU A;  2HIN A;  4I6T A;  3CLC A;  2KZ8 A;  3GN5 B;  4X4D A;  2OR1 L;  2LYQ A;  3S8Q A;  4PU8 A;  1X57 A;  2LYJ A;  4O8B A;  1ADR A;  2O49 A;  4MCT A;  2XJ3 A;  3OQO A;  3QYX A;  3CRO L;  1ZZB A;  1X2L A;  2EBY A;  3IVP A;  2GRL A;  3QWG A;  3GN5 A;  1BDH A;  1QQA A;  2B5A A;  4OB4 A;  2KEJ A;  4YG1 A;  5A7L A;  2JCG A;  1NER A;  1Y9Q A;  1GT0 C;  2LYS A;  1VPW A;  1UXD A;  1WET A;  2PUB A;  4Z59 A;  1PNR A;  3MLF A;  1ZAY A;  3PXP A;  2O38 A;  1JFT A;  1AU7 A;  1QQB A;  3GBF A;  1JWL A;  3R1F A;  2BNM A;  4PU4 C;  3D1N I;  2AXZ A;  3ZKC A; 
#chains in the Genus database with same CATH topology
 1HQ1 A;  2CRO A;  2PUA A;  3L1P A;  4YG7 B;  2D5V A;  3A9Y A;  4Z58 A;  1R69 A;  3F6W A;  1HF0 A;  1Y7Y A;  3H5T A;  2FJR A;  2LYR A;  2XXA A;  2XCJ A;  3BD1 A;  5DRT A;  4Z5D A;  2JQE A;  5GAG i;  2BNO A;  2GZU A;  3BDN A;  2IV1 A;  5DRY A;  4GHJ A;  5DTR A;  1ZVV A;  2L49 A;  2IUO A;  1PRU A;  1ZZC A;  1RZR D;  2AUW A;  2FFH A;  1MFQ C;  3QFI A;  2MXD A;  4WVL A;  4FN3 A;  3EUS A;  3ME5 A;  3F52 A;  4YBA A;  4Z5C A;  1QP7 A;  2PXU A;  3QOW A;  2IVG A;  4ER6 A;  1RZR A;  3SCG A;  2PXP A;  3NRO A;  3QQ6 A;  1JFS A;  2J7U A;  1DUL A;  4F8D A;  2PUC A;  3ZPX A;  2PXQ A;  1IC8 A;  2HSG A;  3B7H A;  1DWK A;  1WH8 A;  1X57 A;  2O49 A;  4DE8 A;  3OQO A;  1ZZB A;  1QQA A;  4EQZ A;  1Y9Q A;  1GT0 C;  1UXD A;  2PUB A;  2LNM A;  3KL4 A;  3NZL A;  3VWS A;  2VEO A;  3PXP A;  2O38 A;  1JFT A;  3DM5 A;  1JWL A;  3UWP A;  3ZKC A;  2KEI A;  5DT2 A;  1DW9 A;  2XSD C;  3SCF A;  1QZX A;  4JCX A;  3ZHI A;  2PXV A;  2HCS A;  4PU3 C;  2XXQ A;  2XXP A;  2OFY A;  4YG4 A;  2O4A A;  1L1M A;  1NEQ A;  3OQN A;  1QPZ A;  4X4G A;  2PXF A;  2XI8 A;  1QP0 A;  1U2Z A;  3TRB A;  1ZZ7 A;  3VK0 A;  2PPX A;  2CSF A;  4EZI A;  1WH6 A;  3GZD A;  2ICP A;  3F51 A;  2GRM A;  2V3C C;  2R1J L;  4IA8 A;  3RZZ A;  2JVL A;  3JXD L;  1LQC A;  3KZ3 A;  3FYM A;  1SQ8 A;  4IVZ A;  2PXT A;  4ER5 A;  2EWT A;  4X4F A;  4PU7 A;  2L1P A;  2PXD A;  4GQM A;  2MEZ A;  1ZS4 A;  4ER3 A;  1RPE L;  2R63 A;  2XIU A;  3CLC A;  1PRA A;  2AXU A;  2KZ8 A;  3NDB B;  2OR1 L;  2PXB A;  3IVP A;  3GN5 A;  2M4H A;  2KEJ A;  4OB4 A;  4HRA A;  4DE9 A;  2JCG A;  1NER A;  2LYS A;  4Z59 A;  1QB2 A;  1PNR A;  1AU7 A;  2BNM A;  3D1N I;  4EKI A;  2PUD A;  3A9Z A;  1LLI A;  3OP9 A;  2LCV A;  4NDW A;  2KEK A;  5DTM A;  1XWR A;  3QF3 A;  1ZZ6 A;  3JXB C;  4X4C A;  4JCY A;  2WIU B;  3G7D A;  2IU7 A;  4Q2J A;  2EF8 A;  1UXC A;  1CQT A;  2YBD A;  2PIJ A;  3FMY A;  3SR4 A;  1LCC A;  2ICT A;  2L8N A;  3DNV B;  4OBM A;  4EKG A;  1PRV A;  3KJX A;  4ER7 A;  4JQD A;  1B0N A;  2WUS R;  1RIO A;  5DSX A;  4I8T A;  2PXK A;  3LQX A;  1ZPQ A;  3LIS A;  1O4X A;  1OSL A;  1LCD A;  3OQM A;  4EK9 A;  1R63 A;  3TFL A;  2PUG A;  1UTX A;  1S7E A;  4FBI A;  2MQK A;  5K98 B;  3M9L A;  3A9X A;  4X4H A;  2LLW A;  4Z5H A;  3CEC A;  2KPJ A;  3PE5 A;  3QOX A;  1RZS A;  4I6T A;  3GN5 B;  2LYQ A;  5JUW A;  4PU8 A;  3S8Q A;  2LYJ A;  1ADR A;  3MEJ A;  2PXL A;  2XJ3 A;  3CRO L;  1BDH A;  4YG1 A;  1VPW A;  3GZD C;  3MLF A;  1ZAY A;  3FYA A;  1WIZ A;  4IWR A;  2PUF A;  1ZUG A;  3GZC A;  4X4B A;  2PE5 A;  2AW6 A;  3TEP A;  2BJC A;  2PUE A;  3G5G A;  2IVB A;  2IVQ A;  1JH9 A;  3LFP A;  4I6U A;  3OKZ A;  2AWI A;  3O9X A;  2LYP A;  3KXA A;  4X4E A;  5DTQ A;  2HFZ A;  1POU A;  1NW3 A;  2AXV A;  4I6R A;  3TEL A;  1CJG A;  2LYL A;  3OWQ A;  2ODR D;  3HZI B;  3UFD A;  3JXC L;  2LLV A;  4MCX A;  1BDI A;  1E3O C;  3U3W A;  4ER0 A;  2LYK A;  1ZZ9 A;  4YAR A;  3NXH A;  3BS3 A;  1OCT C;  2A6C A;  3ZHM A;  1PER L;  1EFA A;  1LMB 3;  1ZZ8 A;  2H8R A;  3OMT A;  4J1X A;  2HCN A;  1YSE A;  4J1W A;  4Y42 A;  2BNN A;  3SCH A;  4X4I A;  1QP4 A;  3G0T A;  2HIN A;  3R09 A;  4X4D A;  2PXE A;  4O8B A;  2J7W A;  4MCT A;  3SX0 A;  3QYX A;  1X2L A;  2EBY A;  2GRL A;  3QWG A;  5GAH i;  2B5A A;  5A7L A;  1WET A;  1QQB A;  3GBF A;  3R1F A;  4PU4 C;  2AXZ A;  3GUU A; 
#chains in the Genus database with same CATH homology
 1LLI A;  3FYA A;  1WIZ A;  3OP9 A;  2CRO A;  2KEI A;  2PUA A;  2PUF A;  1ZUG A;  2LCV A;  4X4B A;  3L1P A;  4IWR A;  2PE5 A;  4YG7 B;  1DW9 A;  2XSD C;  4NDW A;  2D5V A;  2AW6 A;  3SCF A;  2KEK A;  2BJC A;  2PUE A;  3G5G A;  4Z58 A;  2IVB A;  4JCX A;  1XWR A;  3ZHI A;  2IVQ A;  1JH9 A;  1R69 A;  3F6W A;  3QF3 A;  1HF0 A;  4PU3 C;  3LFP A;  1Y7Y A;  3H5T A;  1ZZ6 A;  4I6U A;  2PUD A;  2AWI A;  3O9X A;  3JXB C;  2LYP A;  2OFY A;  2FJR A;  2LYR A;  3KXA A;  4YG4 A;  4X4E A;  1L1M A;  2XCJ A;  2O4A A;  3BD1 A;  4X4C A;  4JCY A;  4Z5D A;  1NEQ A;  2WIU B;  3G7D A;  3OQN A;  1QPZ A;  1POU A;  4I6R A;  2AXV A;  4X4G A;  2XI8 A;  2IU7 A;  1CJG A;  1QP0 A;  2LYL A;  2BNO A;  2GZU A;  3BDN A;  2IV1 A;  2EF8 A;  3TRB A;  1UXC A;  1ZZ7 A;  4GHJ A;  3VK0 A;  1CQT A;  2PPX A;  3HZI B;  3UFD A;  3JXC L;  2PIJ A;  1ZVV A;  2L49 A;  3FMY A;  2CSF A;  4MCX A;  1BDI A;  2ICT A;  1E3O C;  3U3W A;  1LCC A;  2IUO A;  1WH6 A;  2L8N A;  3DNV B;  1PRU A;  1ZZC A;  1RZR D;  1PRV A;  2AUW A;  3KJX A;  2ICP A;  2LYK A;  3F51 A;  1ZZ9 A;  4JQD A;  1B0N A;  2WUS R;  2GRM A;  4YAR A;  1RIO A;  4I8T A;  4FN3 A;  3BS3 A;  3EUS A;  3F52 A;  2R1J L;  1OCT C;  1ZPQ A;  4YBA A;  3LIS A;  4Z5C A;  1QP7 A;  4IA8 A;  1O4X A;  3RZZ A;  2A6C A;  2JVL A;  2IVG A;  1LQC A;  3JXD L;  1OSL A;  3KZ3 A;  1RZR A;  1LCD A;  3ZHM A;  3OQM A;  3FYM A;  1PER L;  3SCG A;  1SQ8 A;  1R63 A;  1EFA A;  4IVZ A;  1LMB 3;  2PUG A;  1ZZ8 A;  1UTX A;  1S7E A;  3OMT A;  3QQ6 A;  2H8R A;  4J1X A;  4FBI A;  2EWT A;  2MQK A;  5K98 B;  4X4F A;  1JFS A;  1YSE A;  4J1W A;  4Y42 A;  2BNN A;  4PU7 A;  4F8D A;  2PUC A;  3SCH A;  4X4H A;  1IC8 A;  2HSG A;  3B7H A;  4Z5H A;  1DWK A;  4X4I A;  3CEC A;  1QP4 A;  2KPJ A;  4GQM A;  2MEZ A;  1ZS4 A;  1RPE L;  2R63 A;  2XIU A;  1WH8 A;  1PRA A;  1RZS A;  2AXU A;  2HIN A;  4I6T A;  3CLC A;  2KZ8 A;  3GN5 B;  4X4D A;  2OR1 L;  2LYQ A;  3S8Q A;  4PU8 A;  1X57 A;  2LYJ A;  4O8B A;  1ADR A;  2O49 A;  4MCT A;  2XJ3 A;  3OQO A;  3QYX A;  3CRO L;  1ZZB A;  1X2L A;  2EBY A;  3IVP A;  2GRL A;  3QWG A;  3GN5 A;  1BDH A;  1QQA A;  2B5A A;  4OB4 A;  2KEJ A;  4YG1 A;  5A7L A;  2JCG A;  1NER A;  1Y9Q A;  1GT0 C;  2LYS A;  1VPW A;  1UXD A;  1WET A;  2PUB A;  4Z59 A;  1PNR A;  3MLF A;  1ZAY A;  3PXP A;  2O38 A;  1JFT A;  1AU7 A;  1QQB A;  3GBF A;  1JWL A;  3R1F A;  2BNM A;  4PU4 C;  3D1N I;  2AXZ A;  3ZKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...