3QWHA

Crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus in complex with nadph and kaempferol
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
260
structure length
260
Chain Sequence
b'YIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17beta-hydroxysteroid dehydrogenase
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Cochliobolus lunatus
publication title Structural basis for inhibition of 17 beta-hydroxysteroid dehydrogenases by phytoestrogens: The case of fungal 17 beta-HSDcl.
pubmed doi rcsb
total genus 103
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qwhA00
2XOXA 2LDXA 3PHLA 3PI7A 1KVQA 4S1VA 3WLFA 4OSPA 4IGEA 3ZV6A 1NYTA 4FC7A 5JSFA 1VLLA 3DR3A 5L4SA 4FFPA 4WLEA 5TIIA 3F9IA 1ORRA 2UUPA 4JBGA 3SLGA 5KVQA 4J1NA 5KOIA 3KZVA 2DQ4A 4TRMA 3AW9A 1H2HA 3JYLA 3WXBA 2AG5A 3MWDB 3ZWPA 4ZGWA 4CJXA 5L4LA 4OQYA 3PWKA 4AJJA 4IXWA 1EVJA 1GQYA 3PQFA 1EDZA 1E3EA 1Q2XA 4GMGA 4B3IA 1I3NA 3AFNA 2C20A 3O03A 3ONDA 1EVZA 3MOIA 4ZQGA 3ZWWA 3S2GA 1WVGA 1GZ4A 3WG9A 3ORFA 3WGIA 3GQVA 5JY1A 3L07A 1YRLA 2WTBA 5HA5A 3WNQA 1R4MA 2DC1A 2DKNA 1B3RA 3UFXA 4F46A 2JL1A 2VUUA 4BKOA 1EMDA 3ZV4A 3JTMA 2IE0A 4YQYA 4CQLA 2NNLD 5AXCA 1WP4A 2JCXA 2X23A 2PR2A 1MFZA 3A1NA 3D5TA 3DMTC 3KLPX 5K0ZA 2VHWA 5CPBA 3AUTA 3F6YA 3FD8A 2X5OA 2VHYA 2IXAA 1XA0A 3V8BA 3B6ZA 5DCWA 5F1KA 5FFFA 1P1HA 1IZ9A 2I99A 4MVJM 3JQAD 3U3XA 3H3JA 3WWZA 1P1KA 2IYPA 4OSOA 1KEVA 3RU9A 1E5LA 4OO3A 2DBVO 3GDOA 4KQWA 3S2IA 1Y9EA 5KJFA 1CQJA 1LDGA 1J4AA 1GPDG 2NTJA 1C0IA 1D4FA 2GZ1A 4YPOA 4MDHA 4UULA 2C07A 2O23A 1VE9A 2Q99A 3W8FA 1H9AA 3JQEA 3S55A 3IL2A 2QQ5A 2UDPA 2VWQA 1GPJA 1UP4A 2WM3A 3NDJA 2HUNA 4Q3CA 4RPLA 3ANNA 4MKXA 4WCFC 1SNYA 1UXGA 1V3TA 3TQHA 3A28A 4I5DA 4DIBA 3JV7A 4IM7A 3HB5X 1PS0A 4OKNA 1X7DA 3D0OA 2GCGA 3UN1A 2Q1WA 3OHSX 5DBFA 4AJ4A 4AJNA 4Z0TA 3FF4A 4PRLA 4JK3A 4LRTB 5AVOA 4KWIA 1DC5A 3OQBA 1NQ5A 3MCVA 4LMPA 3GC6A 1AUPA 2FP4A 3NAQA 4O1MA 3WJ7A 3RC2A 2PD4A 3O9ZA 3FI9A 3V2HA 3PTZA 1E7MA 4H16A 3E18A 1DLIA 4GX5A 4U0KA 4PLYA 3ETGA 2CDAA 1MG5A 2HRBA 3FNHA 4ALJA 4D45A 4H15A 1QRRA 1KVUA 2OGUA 1P1RA 1WW8A 2P9CA 1X0XA 4RLSA 5ILGA 2Y67A 4I5EA 5MDHA 3FN4A 3PEFA 1P31A 1SOWA 3AY7A 2NVUB 1NAHA 1R37A 1PIWA 1UXIA 1IUKA 4RQTA 1ARZA 4UREA 4BNXA 4ALIA 5DF1A 4OYRA 4YT5A 4XGIA 5TNXA 1R15A 4AJIA 4A2CA 4CMHA 4PLFA 2DVMA 3ZCXA 5G0VA 3KYDB 1S6YA 1CIVA 1OFGA 2EKLA 3ZHBA 2BFPA 3R3JA 1M6HA 2GN9A 3TZKA 4IJUA 4Q39A 4BQRA 2J5KA 2IEBA 4R1NA 5EL0A 1TXGA 2OBYA 3U09A 2GZ3A 3WGHA 3RFTA 2AEFA 2QHXA 3KB6A 2BF7A 4HFJA 3MJEA 5JCXA 4MKZA 1KS9A 4XCVA 5TJHA 3VPSA 5EJ2A 1U9JA 4CM6A 1LEHA 4DA9A 4AL4A 3GH3A 3A4VA 3QA9A 3MJ4A 5CDGA 5L7TA 1T4DA 3ABIA 4GVXA 3AI3A 4XJSA 4XRRA 3RD5A 1C1XA 3JQGA 1LUAA 4GQAA 1NP3A 4UVDA 1Z73A 3M2TA 3JQAA 1T1SA 3LK7A 4XKJA 4BB5A 4CMKA 3C1AA 4GX0A 4YXFA 1GFSA 1K0UA 4HY3A 4PG6A 5DP2A 2AA3A 3JCZA 3LC1O 3EW7A 3P7MA 1WZIA 4BMSA 1ULSA 4Q3BA 2O4UX 3WGZA 3ZHZA 3ZWAA 2VZ0A 1JVSA 4PN3A 5JMPA 4R5HA 3DBLA 3BHIA 4CM3A 4DYDA 4UUMA 4OL9A 3FPCA 1TT5B 1M76A 1DC6A 4QXMA 3ZV3A 4E2XA 3KYCA 5I7SA 3DC2A 3HN7A 1NX6A 1B0AA 2BD0A 1B15A 1QYWA 4BGIA 2X0RA 1LSUA 3WDSA 1U3TA 1F0YA 1KVSA 1IB6A 3RUEA 3H6KA 1LNQA 5TGDA 1E7YA 3O8QA 2ZYAA 3BMOA 1B14A 3I5MA 4NBWA 4ONEA 1E92A 3FHLA 3UOGA 1HSOA 3KSDO 4ROSA 3GEDA 4J7UA 2NV6A 2J3KA 3TL2A 5ENVA 4XIYA 3RKUA 4A27A 1E0DA 4AG3A 3RSHA 4Z3DA 3ONFA 4IINA 2HMWA 3ULKA 1NFFA 1PL6A 3HDJA 3PGJA 3VC7A 3DAFA 1N5DA 4B7UA 3H2SA 1PZHA 4KTTE 3AM4A 4R01A 3WX0A 4WLVA 4DRYA 2JCYA 2Q4EA 3W8DA 3IKTA 4RDHA 4E33A 3KSZO 5IXYA 2POQX 1HYEA 2FHSA 5AQ1A 3B70A 1P0CA 5IF3A 1RM3A 2FRDA 4YAIA 1PJSA 3DZKA 2HJRA 2VZ8A 5A5FA 1RM0A 2I65A 1E1LA 1I3KA 1I2CA 3WOHA 5TQVA 1T2CA 1E6WA 3DZIA 2JHFA 3QWFA 5THKA 1Z7BA 3WGYA 5CPFA 3ANMA 1SB9A 2BKAA 3IQDB 4CM9D 2PH3A 4J1QA 1PJ3A 3CUKA 4HV4A 2WYVA 1LSOA 2WDZA 4CM7A 2RH4A 3DHEA 3FR7A 1SC6A 4WUVA 4TRNA 1D7OA 4RVFA 1DIAA 1XEAA 1E7WA 1EZ4A 4Z3KA 4CM5A 3W4IA 3T7CA 3PQEA 4D0RA 2BGMA 2LDBA 4D41A 3ZNPA 2NVUA 4IS3A 5IZCA 3ROPA 4BO8A 1HYGA 3JQ7B 4BKUA 5TLSA 3VZPA 2GRAA 2AG8A 3VH2A 4QT0A 2EP5A 4ZD6A 4J1SA 3SC6A 3JQ8A 2GUGA 5COQA 2IODA 4MINA 5L51A 3HE3A 4HNHA 3INTA 3TFQA 4IZIA 3HNPA 3IUPA 1NQAO 2X0NA 1C0LA 1F17A 1VJTA 4RORA 4YYZA 1TLTA 1OOEA 3BZUA 4IJVA 4AJKA 4II3A 2C7GA 4TVOA 3WQQA 4BNNA 4BNVA 2J5QA 4DQXA 2YFQA 2G76A 1RM5A 4BO1A 3PJDA 5L40A 3MZ0A 1TB4A 3H7AA 5GMOA 4YJGB 3IOYA 4J43A 4MO2A 4ZHSA 2PKQO 5F21A 2QRKA 4R4JA 1DXYA 4AVYA 2CDBA 1ISGA 4U5QA 2ZIZA 2PGJA 3BTVA 3LZ6A 3PJGA 3PHIA 4P4GA 2AQIA 4B3JA 3RASA 4TRJA 5C37A 1H5QA 4RVSA 4YT2A 4CLEA 1PJLA 1CWUA 3JQ7A 4D3SA 1PEDA 1MC5A 3I9LA 3KO8A 3RFXA 1E3IA 4X54A 2NUAA 3OSUA 3QWHA 3AWDA 4CV0A 2XPCA 3DBRB 1Q1NA 4XB1A 3K2BA 5TS3A 3BTOA 4A7PA 4XX0A 2I3GA 1YH3A 2WMDA 1T1RA 2AQHA 4I8XA 5LCXA 4JGBA 1B8VA 1DAOA 1TEHA 4QECA 5ES3A 4Z0HO 4PG7A 4CV1A 1UP6A 5A9TA 2C0CA 2TMDA 2W2KB 5KKAA 2DT5A 4MVJI 5I9LA 1XLTA 4CMEA 3FNEA 4DBZA 2VQ3A 4YB8A 3STHA 1PL8A 1B16A 1PJBA 4JJIA 1ADFA 1DSSG 4O63O 1Y7TA 2AE2A 4CR8A 4DC1A 4CQMB 3TFOA 1X7HA 1GD1O 2I66A 2AEJA 5JYEA 1BXGA 3JSAA 1O6ZA 4PIVA 3H5RA 1L7DA 3GHYA 4BNLA 2Y1FA 1MLDA 1PGJA 1BXGB 3F4LA 3GT0A 1O94A 4NPCA 3RWBA 4CMJA 1D3AA 1M75A 2ZB7A 1HZZA 1U4SA 1Y1PA 4NDNE 3WFIA 3JYOA 2J5RA 1LLCA 3OMLA 3RVDA 4RVDA 5C7LO 3OF2A 5JXWA 2HU2A 3MOGA 1PZFA 4M89A 2V6MA 2YDXA 2O48X 3PFFA 2EERA 4N18A 3CXRA 1XR3A 5TF4A 1H6BA 1JTVA 2HMTA 3K73O 2D2IA 3RUIA 3I4CA 5JW6A 3GGGA 4TKMA 2J6IA 1ISMA 2X7HA 1YL6A 2OBNA 1I2BA 4JP2A 3PQDA 1ISFA 4EEXA 1NPDA 2VWPA 4DPKA 1U1IA 3H5NA 1TT5A 2EG9A 3D4OA 4PG8A 2I9PA 3Q11A 3OQ1A 4GSKA 4PLTA 4M49A 3FTNA 1JW9B 1NAIA 3DQPA 3ETDA 1I01A 4MP6A 4FFRA 4BB6A 4NNJA 1DO8A 1HF3A 5CDYA 2DPHA 4YJFA 2Q2VA 2P4HX 4L73A 2WD7B 1YDEA 1LRLA 4CQMA 4NJMB 2VYND 3TJRA 3KV3O 4BO5A 2CD9A 1ZK2A 4M55A 3Q0EA 3W4JA 3L0DA 1X15A 4Y98A 2OFPA 3INGA 4JP3A 2FPPA 1QYXA 3PLRA 5KKCA 3ZV5A 1ZSNA 3H5AA 3CH6A 4RPKA 4IGFA 5JFOA 4XQ9A 1U7HA 2C7VA 2B36A 1YBVA 4J4HA 2D1YA 1ONOA 4YJDA 1GAEO 1NNUA 3OJ0A 4WJZA 4C7JA 3RUCA 1ADBA 4CM9A 2V6FA 1NR7A 3FWNA 1U5AA 4W9NA 3CMCO 1OZAA 3I52A 1I36A 3KEOA 2QRJA 2YFHA 2VZ9A 3WNVA 4LVCA 3KXDA 4BKRA 4BS9A 4JLWA 2X9NA 4MKRA 3ANLA 4FFNA 4AICA 1HWYA 1VC2A 3TNLA 3VH4A 2P5YA 5EQFA 4E12A 3P2YA 1UAGA 3MEQA 3ONEA 4JJGA 3NEPX 1BDMA 1I33A 3C7DB 3I9KA 1LJ8A 1SEPA 2B5WA 3AOGA 4BO2A 1YO6A 5G2OA 3RJ9A 1HDYA 2Q45A 3DB2A 5A05A 2O3RA 3E82A 3H9EO 3GZNA 2G0TA 4R3NA 4YJFB 4DTIA 1A4UA 2HQ1A 3JYQA 1NHWA 1P1IA 1Z82A 3ROKA 2RH8A 1XIVA 5HTOA 4BNKA 1ENZA 1DAPA 3DOCA 2D5CA 2YHUA 2IEDA 3QJ5A 3NT5A 1B26A 1PWZA 1KBZA 1HSZA 1K3TA 3GZ4A 2X5JO 2CNBA 3PRJA 2D4AA 2VHZA 3WQRA 4E13A 3GA0A 2P68A 2W2KA 3GN1A 3HHPA 3U9LA 1CDOA 1EK5A 1OI7A 1PZGA 1RWBA 2GN4A 3GDFA 4UUPA 5JMWA 1LQTA 4Z9YA 5DT9A 2IYOA 1P0FA 4WECA 2UVDA 1LDBA 3W6ZA 7ADHA 5IDXA 4UEKA 2O2SA 1GUZA 1ZIDA 1M67A 2DTDA 2RAFA 3Q9NA 4NU5A 2R2GA 4PLGA 3HG7A 3RCBA 2RHRA 4R41A 1XSEA 3BMNA 5JCJA 4ZN6A 2I3AA 1DIHA 3FBGA 4XYLA 1WPQA 2ZTUA 1ZEMA 3BMNB 3IAHA 3JD2A 5IN4A 2X0JA 1H2BA 3VVBA 4CM1A 1N9GA 1C1DA 4RF2A 1YOVA 5U9CA 3L6OO 4WEQA 5I7FA 3FR8A 4R1TA 3SVTA 2CSUA 3RUAA 3QW2A 1CEQA 1K5HA 2WEKA 4OGWA 4LSWA 2OO5A 5JNLA 3DZGA 2ZK7A 1CJCA 5IZCC 1VKOA 3BHMA 5G0SA 4DQVA 3GHHA 4J2OA 5AXAA 4YAGA 3OQ6A 5L9AA 2PH5A 5TT1A 2Y1DA 3RROA 1EBUA 2GD1O 1FMCA 2BI7A 4IY1A 4GVLA 5TJ9A 5DOZA 3WGQA 3ZWVA 2P9EA 1T25A 2Q46A 4GX1A 4XWYA 2JHGA 4PFJA 3ROQA 1B3BA 3IP3A 1PU2A 3GLQA 1EUZA 1H0KA 1XYGA 5CDTA 1XKQA 2P9GA 4L4RA 1FK8A 4ALNA 4WLUA 1E3JA 1YB4A 3PHHA 4ILKA 4O5OA 5KWEA 2E49A 3F47A 4RCVA 1P1JA 5DDIP 3O38A 1M2WA 4N7RA 5G4LA 4J4BA 3VZRA 2H6EA 5A06A 3PZBA 5JO9A 3QV1A 4JBHA 4TROA 4FJ1A 1ZXBA 3VDQA 2IRWA 1ZK3A 1LQUA 3INRA 5KJEA 3MJSA 4I1IA 3D3WA 1U7TA 1ZFNA 4B7XA 5ILOA 4JBIA 4URFA 1PGOA 3E9QA 1Q0LA 4OHUA 1NR1A 1LLQA 4N5LA 1F8GA 3ADPA 4GMFA 4CQLB 1ZSYA 2DBRA 1HEUA 4E30A 4IJKA 4EUEA 4P4NA 3PFWO 4Q3DA 4E2ZA 2PGDA 4RPGA 3RAJA 1VKNA 4WCDA 1GADO 2NU7A 3K31A 4ZICA 2G82A 4PG5A 1CF2O 4FFMA 5C5IA 1ZKMA 1EVYA 2X0IA 1QMGA 4W4TA 3WJAA 3VVCA 4EJ0A 4G81A 3V1UA 4D44A 4GGPA 3KBOA 4R1UA 2B4TO 3TL3A 4E0BA 3G1UA 3VKVA 4YRBA 1WDKA 1WLYA 4NH4A 1PR3A 3NRCA 3V2UA 1VL0A 3C3XA 3ZN2A 4DIFA 1ML3A 2PZLA 2CY0A 2W8ZA 1UZNA 3I3OA 4XR9A 2Q2WA 3AUAA 4DPLA 2EKPA 4B4OA 1KETA 3KETA 4RF3A 4DMLA 1NM5A 2E4AA 5DP1A 1LTHR 1Y5MA 2UUOA 1P77A 5I7VA 3JYNA 3H3FA 4IQGA 2DPGA 4AJ1A 1YWGO 2Y66A 4GBJA 2XAAA 3L4BA 4BIIA 5GZ6A 1NWCA 4I9UA 3DBRA 4YA6A 4BNIA 4BGUA 4XR4A 1J0XO 1HDOA 2GZ2A 2PFGA 4PGFA 4W6ZA 1PQWA 1PGPA 4XYGA 3PDJA 1Q7GA 3TSCA 4CMAA 2QX7A 3F1KA 1UXJA 2O3TA 4WOKA 2VHXA 2I67A 4MIEA 4FW8A 1ZK4A 4CPDA 1K89A 4OXYA 2WSBA 1VJ1A 5T57A 1PGQA 4WOJA 4M86A 3HDYA 1WWKA 5B12A 5FWNA 3Q2IA 1T2EA 2EIHA 3PPIA 3PYLA 5CHEA 4CR6A 1LLDA 2ZCVA 3D3EA 5HM8A 9LDBA 3HJAA 4EW6A 4E32A 1DIBA 3W4KA 2E82A 1C14A 4R16A 2YW9A 4L74A 2UAGA 4O6VA 3OP4A 4F6CA 3AFMA 1BG6A 4J1TA 4OJNA 4J7XA 3D1LA 4QX6A 1ZJZA 1GV1A 2Z1NA 3GOHA 4YWJA 8ADHA 4IQ8A 4FB5A 3OICA 3ZWOA 4BGEA 1GEGA 4YBZA 3FNFA 2PZMA 4NBUA 3KLMX 2GGSA 3UAGA 4UVHA 2EHDA 3DONA 1JAXA 1BW9A 1QP8A 4KZPA 1NXQA 3LF2A 5ENDA 4FFLA 4IPTA 2I76A 5AXDA 4E2WA 2DTXA 1J5PA 3VTZA 4CLOB 5L4NA 3AJRA 3LC7O 5C7IO 1PX0A 5C7OO 1A4IA 2Z95A 1NQTA 3Q6IA 1Z74A 5T67A 2C2XA 4DLLA 4TVBA 2HLPA 4GPD1 1F14A 3GK3A 3KUXA 4XB2A 2G17A 4PG4A 1EE9A 7MDHA 2GPTA 2QRLA 4LCEA 5IG2A 1U5CA 1I3LA 3GEMA 4OOEA 5F5NA 1BXKA 2FR0A 1RPNA 3KVOA 1W0CA 4FIZA 4PZCA 5COAA 1PQUA 4AJLA 3JQ6A 1EVIA 4R68A 4BQPA 1HE4A 3C1TA 1YKFA 1ZBQA 1I5RA 3X2EA 1GU7A 3QIVA 4XZ3A 3VOSA 4KUEA 3QP9A 4QFCA 3GUCA 5GZ3A 3B1FA 4L8VA 3CINA 4XA8A 1DIRA 1MC4A 3ZW9A 1NPTO 1VI2A 2ZATA 1U2GA 3H9UA 4MP3A 4Z9FA 2WWRA 4Z6KA 3IJRA 3K30A 1IPEA 3GF4A 1PL7A 3I9NA 1XU9A 4QQRA 3FNGA 4LSMA 3S1LA 3WBFA 4L76A 3ZWXA 3W1VA 4QEDA 1FDUA 3K8ZA 1E1MA 5IAAA 4PLZA 4GKVA 4RVUA 1Z7EA 4J4TA 4YAJA 3U62A 4XJTA 3EVNA 3CSDA 4M87A 1MFPA 4CM4A 2YQ4A 3E48A 4RL6A 5DZSA 5LC1A 3OJLA 3TZ6A 5JAQA 1BWSA 4DQUA 3NTQA 3QLJA 3P5SA 3ZU4A 1HYHA 1YOVB 3WSVA 1V9LA 1F12A 3O26A 3LC2O 5EERA 3C85A 1W4ZA 3VAZA 5JAZA 4A0SA 4J3FA 3UH1A 1HDCA 3AI1A 1JN0A 3LT1A 2ZB8A 1EE2A 2VWHA 2JAPA 4OOFA 4MIYA 5G0TA 1VJ0A 2VOJA 4WK6A 5H83A 1MUUA 3LLVA 4YACA 3GDGA 3QSGA 1KOLA 5A04A 2Q49A 4GWKA 1LXCA 3I23A 2NSDA 3TDKA 2DUWA 3IC5A 2ILTA 1ENOA 2NTVA 2CVOA 1PJ4A 2X9VA 5F5LA 5A9SA 2JD2A 3PYXA 4MVJH 1L1FA 2X58A 1PJTA 4ZQEA 4TQGA 1LLUA 2PV7A 1LC3A 1EFKA 3QVTA 2JCVA 1XHLA 4ZQFA 1PJQA 2EW8A 3L9WA 1FXSA 1GEEA 2PLAA 4YR9A 1FDSA 4NJMA 4UAGA 4C4OA 1MB4A 5L3ZA 1Z45A 5JDIC 3LLSA 4FD3A 3SC4A 4CODB 2V65A 2WYWA 1HTBA 4Y9DA 4QFDA 5U1PA 3H65A 4Y67A 1FDTA 3IDSA 1MX3A 4JROA 5HRUA 3GFGA 1GQQA 1KEUA 3IUSA 1UXHA 2OL4A 2DM6A 1K2WA 4QO7A 1HDZA 1E6EA 5L45A 1N7GA 4HBGA 4RPJA 1J6UA 1DC3A 4RDIA 5CEFA 1H6CA 2QZZA 3PWZA 4IMPA 3AY6A 4EI2A 2C5EA 4OM8A 3ZU3A 3QVWA 1KC1A 2B37A 5JPIA 3U5TA 2H5LA 3WICA 4XYMA 1UDCA 1EBFA 1I10A 2J3JA 4BMNA 5A03A 3H9JA 3WGTA 2YQ5A 4FPXA 4R5MA 3H9QA 3UW3A 1NFRA 1PGNA 1SPXA 3KYBA 1SAYA 4I08A 4U7WA 3TZCA 2JD1A 2GYYA 1V0JA 1C3VA 2PK3A 4OQZA 5T6BA 2D5AA 4EJMA 5HWSA 2AHRA 1E7SA 4EEZA 1KIFA 3MWEB 2E37A 4EUHA 4YAKA 3OJFA 2V6GA 1DFIA 3ENNA 4CLRB 4CUJA 1DC4A 1ENYA 3D64A 2IZ0A 1EEHA 2VN8A 2W98A 3NX4A 2O3JA 2ZYGA 3MTJA 8LDHA 2P5UA 4KUHA 4BO9A 4N5NA 4KQXA 2FWMX 4D79A 3ZNNA 3VH3A 1Y81A 3GPDG 3L4SO 4E6PA 3WQSB 4BO3A 3FCOA 1DRVA 3EHEA 5K9ZA 3JD3A 3RC9A 2X8LA 5K6AA 3D5QA 5BT9A 3SXPA 2DAPA 4P22A 1EQUA 1I3MA 1V3VA 5CEEA 3PP8A 4IDEA 2D8AA 1DEHA 1UDAA 1X0VA 2QG4A 1AE1A 4FOSA 3RBXA 1LSJA 1VSVA 3AU8A 5F1OA 4OKIA 1T2FA 3NGXA 4JIGA 3NUGA 4BNJA 2Q4BA 1I2ZA 2Y68A 1PTJA 2BFMA 4ZRMA 1JLLA 1I30A 2HK9A 3JQAB 1LRKA 4K9DA 2CF5A 3ZHYA 3V1TC 2YV3A 3AOEC 4UEOA 2BMAA 3ZU2A 2VNSA 5FF9A 1N9GB 3WSWA 2C82A 1JQBA 4IBOA 1GR0A 3F5SA 3LF1A 4IDFA 1YQGA 4MP8A 1LC0A 2BGKA 3AM3A 3PIDA 1U3UA 3D3WB 4N54A 5TT0A 5GZ1A 1E77A 1UP7A 3HZZA 1C0PA 4Z0PA 4CM4B 2OXIA 1HDRA 1GZ3A 4NR0A 4PLCA 4FJ0A 3FSRA 2WJPA 4JXKA 1QSGA 2QYSA 3R3SA 2ZTLA 5AYVA 1ENPA 3R1IA 4I5GA 1QLJA 5JLAA 4NI5A 2YZ7A 2Y1EA 2J3HA 2X86A 1F06A 3W6UA 3JQFC 3RUHA 5B4UA 2NU8A 2JFHA 3UCXA 2SCUA 2FY8A 4DMMA 2DTEA 2GASA 3BTUA 4RV9A 3X2FA 1UJMA 4CMIA 4DGSA 5JDIA 1WXDA 1XU7A 3DHYA 1NVMB 4J9UE 1GYQA 3DFZA 4NZ9A 1A71A 1KVTA 3ICPA 1DHTA 3GZNB 3S8MA 3UVEA 2GR9A 4R3WA 1S7CA 3A14A 2DU8A 2EW2A 2F00A 2OZPA 2BH9A 4EYEA 1ZUD1 2Q3EA 2GDZA 5KJ1A 3ASVA 3DBVO 2Y1OA 4NK5A 3DAPA 3CMMA 1F8FA 4FOOA 5JDCC 4ID9A 4XRGA 4EITA 3E8XA 3QWIA 4PVDA 1GYRA 3DTYA 3I9JA 2X22A 5DOVA 1R4NB 4EZBA 3LVFO 1K6IA 3F5QA 3GY0A 3GVIA 3R6DA 2Q50A 1E6UA 3PLNA 5CG2A 2JFGA 5JC1A 1ID1A 2RIRA 3DZFA 4D46A 4WEOA 5I9MA 2XXJA 4IJWA 1ZO8A 1KVRA 2O4CA 3K6JA 1A7AA 4CLRA 2B0JA 2EGGA 1B8PA 1ZNQO 4E31A 3VPXA 1YQDA 3H2ZA 3Q2KA 3D4NA 4N5MA 1MXFA 5COBA 2EP7A 2O3QA 3L4BC 4FC6A 3LQFA 1A27A 2VT3A 1T2AA 4RF4A 4YCAA 3ZNOA 2OUIA 4CUZA 5DN9A 1EK6A 4BNHA 4I5FA 2C29D 2GF2A 2IZZA 4YT8A 2YV1A 1E7QA 4HFNA 3TN7A 3G49A 3CE6A 2GNAA 1LDEA 1ISIA 3KRTA 2EGHA 3GPIA 1ONNA 1VM6A 3BIOA 1E3SA 1R66A 1GL3A 4I9NA 1BDBA 4EJ6A 1ULUA 1GV0A 3WMWA 1K6JA 5DBGA 3ZWMA 1I8TA 1VL8A 4D42A 2X1HA 1BVRA 3F4BA 3JQGB 1MV8A 6ADHA 1P9LA 3RUDA 3UGKA 1HRDA 4XQEA 3DEYX 4UVIA 3UXYA 4IUYA 1W8DA 4FR5A 1NPYA 3SLKA 3OFSA 2YYYA 4RJTA 2Y93A 3ITDA 4U8GA 3NJ4A 2WYUA 4CL3A 2G5CA 3QVXA 2YY7A 2ET6A 1NQOA 1U28A 1VSUA 4ZU3A 1HE3A 1DFHA 3CTMA 3UUWA 4HNGA 2PD6A 1KERA 2V7PA 3E6AA 1JKJA 3BMQB 3B1KA 2AEMA 2HCTA 4BO7A 4MVJF 3Q3CA 4FCCA 2NQTA 1DJQA 2Z1MA 2VUSA 2DUUA 4BUCA 3OETA 1Z75A 3OECA 4Q3NA 3GFBA 4UUNA 3I6QA 4QTZA 3SX2A 4O59O 3H4VA 2UYYA 1QYDA 3GGPA 3SEFA 1HT0A 5TC4A 1ZMTA 5JO0A 1YONA 2F1KA 4ZVVA 1WNTA 1G1AA 1ZK0A 1O5IA 3JQFA 1U3VA 3GG9A 4AJHA 1ZXLA 3I4FA 5JC8A 1C1XB 1N2SA 2QW8A 3NYWA 2IZ1A 5ICSA 5MGBA 3DBHA 3GVCA 1B8UA 1ZZEA 3T4XA 1CETA 1MG0A 1SBYA 4F6LA 2AW5A 1EDOA 4LGVA 3ZNQA 3IIEA 5BSGA 1UZMA 1MA0A 3GRKA 2VRCA 3ON5A 5FI3A 2Q1UA 3WR5A 2GERA 3ZZNA 1LBEA 2D59A 1H9BA 2HJSA 3L6EA 1P74A 3OIDA 3WLEA 4RZIA 2ZB4A 4CLHA 4GGOA 2NU9A 1ZK1A 3OM9A 4BKQA 4BOYA 1E3LA 1SEVA 5BNTA 4J0EA 2UV8A 4U0JA 4W82A 4PZEA 4NK4A 1BW9B 3EUWA 4FGSA 1XDWA 5L53A 3ZWYA 1ZEJA 4J2HA 3I1JA 2HK7A 2JAHA 3T4EA 4IQ0A 2W90A 5IDWA 1W73A 1P45A 2B83A 2NQ8A 5JS6A 1E3WA 4L4SA 2PY6A 2BI8A 3VPGA 4Q3EA 4D0SA 4YEDA 4QO8A 4PLHA 4PLWA 3FWZA 4OXNA 4R1SA 2QIOA 3NT4A 4E5PA 5LDGA 2G1UA 1E5QA 4A26A 3ZWNA 3AI2A 2QYTA 4UVGA 1N7HA 3D7LA 4BV8A 2X5KO 4J7CA 4HFMA 1ZSVA 4DC0A 4E5KA 3ASUA 1X1TA 4E4YA 1NHGA 4Y6PA 4YTEA 1IY8A 4PRKA 5IDQA 3I9MA 4W9NC 5IN5A 1KY5A 4DLAA 1UZLA 4WCFA 4WNCA 5F1PA 5G4KB 4LN1A 1GCOA 1A7KA 4GI2A 5ITWA 1RYEA 4CLOA 3AK4A 3TPCA 4G2NA 5I8ZA 3RKRA 3ZGYA 3Q9UA 2Y0EA 3WYBA 3ZHXA 3DZHA 3HN2A 4WLOA 1PJCA 3GAZA 1PS9A 4B7CA 4FN4A 1R0KA 1FF9A 4CMBA 2NVWA 3PWSA 4JN6B 3P2OA 2VYNA 3I9OA 5FYDA 2O3SA 3UHAA 5FI5A 3TWOA 4BNUA 2QZ9A 1XCBA 3G1TA 4CV3A 2HAEA 4NFHA 2VHVA 3GMSA 3ZU5A 4YJGA 1O95A 1V35A 1R0LA 1BTOA 3BTSA 3K96A 4NFYA 5ICMA 1O9BA 5BNFA 3GN2A 4EUFA 4YT4A 1T26A 4PLPA 4M8SA 2W2LD 4CM8B 5J23A 4L9RA 4BNYA 5EN4A 1HLPA 1DRWA 2XXBA 1BMDA 4MPDA 3N58A 1M66A 3G3EA 1LX6A 2HSDA 2X6TA 3UKOA 4PVCA 3TF5A 2ZJ0A 2ZCUA 4XGNA 5EESA 2PD3A 3GVHA 4MVJG 4BNGA 4D3DA 4M54A 4NMHA 2NTNA 5L95A 5BSEA 3BYZA 4J90A 3M1AA 3Q1LA 3EYWA 1IULA 1MP0A 2NU6A 3DXFA 4B79A 4NBVA 3JD4A 4XYBA 5U4QA 4Q3AA 3P19A 2VUTA 1U2DA 2EJWA 5G0UA 3H9GA 2YDYA 4GSLA 4H7PA 4GH5A 1E1KA 1SZJG 1U8FO 4L0QA 2ZKLA 3CZRA 4IDCA 3DO5A 1IE3A 1YBAA 3NDRA 4FS3A 3UCFA 5I8WA 2YHIB 2PA3A 3GNQA 1B7GO 2B5VA 2H9IA 1A5ZA 1K6XA 5T5QA 4KDEA 2VCYA 4C7KA 1CQIA 2CZCA 6LDHA 3AUUA 2GN8A 4INAA 4YJHA 3WBBA 1IL0A 3HB4X 3COSA 3KM0A 4XD2A 1IOLA 4UEJA 1AN9A 3E9MA 3OEWA 2Q1SA 3M2PA 3VTFA 2I5PO 2JKVA 3AY3A 1QV6A 2Y0CA 4KWHA 2VYVD 4IXTA 2Q2QA 4DWVA 1JDJA 1OBFO 4D7AA 2FSVA 3CZMA 1I32A 2BGLA 4GWGA 3T7EA 1TVEA 3HFSA 3PHGA 1E1NA 3JQCA 2YUTA 2ZB3A 1EFLA 3GR6A 4ND2A 4WLNA 4CMIB 1IPFA 3GNSA 5K6AC 3KTDA 4WCFB 2OP1A 1EUDA 4J16A 3ZWCA 1WZEA 3RBVA 3DZJA 4W99A 5EQDA 1KYQA 4BO4A 1AHIA 1TA4A 1Y8RB 2RCYA 1M6WA 3E9NA 3O8QB 4F3YA 3VDRA 2CVQA 1PSDA 2FZWA 5EIOA 4CV2A 4RVHA 4O0LA 5L7WA 3BXXA 3IS3A 1Y8RA 4TZTA 3U4DA 1HDXA 3GNTA 1SMKA 3S2FA 4ND5A 1G0NA 2AMFA 1N92A 1NVTA 1HXHA 2IDZA 4P38A 3K9QO 5CDUA 2P2SA 5B1YA 3ST7A 3DBLB 4CQMD 1T2DA 3QRWA 2CMDA 2FMUA 4IDGA 2Y1GA 1G6KA 3RJ5A 5LDHA 3EC7A 1Q7BA 5AXBA 1H94A 4G5HA 4P8RA 4A5OA 3JQBA 1QV7A 2YHIA 3FPLA 4NU6A 2X9GA 4XDZA 4JX8A 1X1EA 3EK2A 3DOOA 2EEZA 2WD7A 3JQ9C 3HUDA 4ITUA 1PJ2A 4PLVA 1H93A 1UAYA 1AHHA 1O89A 1O8CA 2EXXA 3BMOB 4XYEA 5EPOA 3RFVA 5G0WA 2PKQP 4FSHA 1XELA 4K1LA 2HK8A 5ITVA 5KVSA 1LDMA 1FJHA 2EWMA 3B20A 2PNFA 4IDBA 4J9VA 9LDTA 1BXZA 1GCUA 3K5PA 3WWYA 3EY4A 2BLLA 3DAGA 3U4IA 1X7GA 4XEHA 2VNAA 3RUFA 1ADGA 3DMYA 4E5MA 1GQ2A 4CMEC 1XQ6A 3HDQA 4IS2A 2RHCA 5T8KA 2FPGA 2P4QA 1VPDA 4FGWA 5IXSA 4FBGA 3PDUA 4CMCA 3HSKA 5BSFA 1ADCA 4IIUA 1GZ6A 2DBZA 3LT4A 1YXMA 5KJ6A 4LISA 4WKGA 4FFOA 4RVGA 3RQSA 5CAEA 1X14A 4BV9A 4ZJUA 4Y6SA 4WNIA 2IXBA 3TZQA 2VTEA 3HADA 3PK0A 3RC7A 3DL2A 4J49A 1IZ0A 5BNIA 3EAGA 4ZRNA 5JDCA 3OA2A 5KVVA 4BNTA 1I24A 3DOJA 4K28A 3LSYA 2BHLA 4CLDA 1XGKA 5DBIA 2PZKA 1TI7A 4J6FA 3C24A 2EV9A 1JU9A 3PHJA 3RU7A 1LSSA 4R51A 2VTDA 1GYPA 3G0OA 1QR6A 3CPSA 4MIOA 3L9XA 4KOAA 3C7CB 2DFDA 5BR7A 5JAIA 2ZYDA 5TRTA 2B4RO 3BA1A 4FJ2A 3OIGA 5KTKA 1I0ZA 2CDCA 4R9RA 4D3FA 3QVSA 3JD0A 1R0SA 1KEPA 4PZDA 3EMKA 1N8KA 4A10A 2ZTMA 4JQCA 2RBEA 4IDAA 1D1SA 3QVOA 4P4LA 1JAYA 4MJLA 4BL5A 3E03A 3U4HA 5KIAA 1QXSA 2WE7A 2OMEA 4GLOA 3TOXA 4NG5A 2PGLA 3JQDA 4JJFA 3KOUA 2JJYA 1CYDA 1QYCA 1A9YA 1Y8QA 2CVZA 2PZJA 5IDYA 5HS4A 4ALMA 1XWFA 4TSKA 4MVJA 2VRCD 2HRZA 3G79A 4MVJP 4HP8A 3O4RA 3M1LA 4RLHA 1QG6A 3D4PA 1H6AA 4R54A 5FEUA 3L6DA 4FDAA 3MJTA 1JWAB 3GG2A 4TRRA 1IHYA 2PTGA 3EVTA 1NASA 3A9WA 4YRAA 1XQ1A 2ZQZA 3E5RA 3RC1A 1X13A 1P44A 2XF8A 2PWZA 1R4NA 2C5AA 3OH8A 2A94A 2X4GA 5C3MA 4LK3A 5JCJD 1J49A 4OMUA 3R0IA 5A9SB 1FDWA 4CMGA 3C7AA 3ETEA 1NWHA 3BMCB 3F46A 4L4XA 4U6SA 3ICCA 5A02A 4NQZA 2HMUA 3LT0A 4OAQA 3FBTA 4DL9A 4TMFA 5H81A 1UR5A 3SJ7A 3HQ4O 4U6QA 5L7YA 3PJEA 4BNMA 4Q9NA 4DIOA 3EZYA 2Y1CA 3K92A 2Q1TA 1GUYA 1LDNA 4HKTA 1EQ2A 1SCUA 1ZMOA 1V6AA 2A4KA 4GKBA 2H63A 2VYVA 3I6IA 2GSDA 4ND1A 3VHRA 1DLJA 3WGGA 3I83A 1WDLA 1QKIA 4IZHA 1YGYA 3IJPA 4DBVO 5T64A 4D43A 5B4VA 3GVPA 4BMVA 2NWQA 2A9FA 1QLHA 3AM5A 2O7SA 4CL8A 4BO6A 2AQ8A 3GRPA 3OEYA 4BNWA 1FDVA 2O2YA 4HXYA 5KVCA 2BFAA 2FPIA 4AJEA 1RKXA 4RZHA 3DBHB 5ER9A 1RJWA 1ZJYA 2Z5LA 3NJ8A 2HKIA 3MJCA 3RI3A 3E1KA 3JQ8B 4KUGA 1DHRA 2ZQYA 2CFCA 4QSMA 4HFRA 3BAZA 1YL7A 3V1YA 3ZI0A 4L75A 2OP0A 3PIIA 5H82A 3ZH2A 3NTRA 2R00A 3NT2A 2FSSA 3PZRA 3WB9A 4H3VA 3UICA 2E6UX 5A3VA 1VL6A 4WPGA 5IFLA 2Y05A 1YB5A 5CG1A 2DFVA 3UF0A 3HFGA 1JKFA 4AJPA 1SOVA 3QWBA 1R12A 3LU1A 1V8BA 3SJUA 3GMDA 3GVXA 5KCZA 3ZWBA 1Y8QB 2WE8A 4KP7A 3NKLA 1T4BA 2HDHA 4J91A 2C59A 4BNFA 5KNLA 1YQXA 3A06A 4ZQHA 3BMQA 4K26A 2B69A 3GUYA 4CUKA 1JVBA 1U4OA 1UUFA 1YL5A 4HUJA 3KYCB 3WS7A 4BGVA 4B8WA 3LT2A 1YS4A 2YJZA 4E21A 2NADA 4NIMA 5T8KC 3WYCA 1MGOA 1Q7CA 1PQPA 4XDYA 3QWAA 2FN7A 4TKLA 4UVEA 4B4UA 1AXGA 1YE3A 3E5MA 1NBOA 1YVEI 3WIDA 1NFQA 2Y0DA 3OJOA 3JD1A 4WGGA 4OH1A 4NBRA 5TSDA 3TZHA 2EKQA 3NTOA 1KEWA 4RF5A 4IDDA 2NACA 3F3SA 1DOHA 5CFZA 3K2EA 3IKVA 5I7EA 2O7QA 3PVZA 5DNAA 4YAEA 3EZLA 4ND3A 3MJVA 1QORA 1HE2A 4R9SA 3BMCA 5EMHA 1LU9A 3JQ9A 1Y6JA 4ND4A 4XQCA 1P33A 1HLDA 3GAFA 1BRMA 1EUCA 1U8XX 3VZSA 4LCJA 1OAAA 2CUKA 3DWFA 1RYDA 1P3DA 1WDMA 3KYDA 1NVGA 1YJQA 4TZKA 4IIVA 4JCOA 1VRWA 3WYEA 1BGVA 3OBBA 2OOSA 3HWRA 1Q0QA 4BO0A 3DHNA 5A5EA 3OA0A 3EDMA 5JBIA 4S3MA 5A9RA 1A72A 1SO8A 1Z6ZA 4IMRA 5ADHA 1WMAA 4OIMA 1PS8A 4R69A 3WIEA 4EGFA 1UDBA 4B4VA 1HETA 2TMGA 2NVBA 4A73A 2FR1A 1YB1A 2OHXA 1ISHA 3LYLA 4UUOA 4BKPA 1CERA 2YV2A 1PWXA 2BFOA 5DCYA 4EBFA 4GX2A 5A1TA 1ZH8A 2D3TA 2B35A 1DIGA 2B4QA 4J0FA 4B8ZA 3N7UA 1YDWA 1D1TA 3M6IA 4LMRA 1BSVA 2CF6A 4YRDA 2NLOA 2J8ZA 1GTMA 1BVUA 1ISJA 5HS6A 3V2GA 3NGLA 1ZCJA 3UCEA 2DLDA 1UH5A 4AFNA 5CDSA 2ZJ1A 4GL4A 2OORA 2NM0A 3CEAA 5B37A 2VOEA 3BHJA 4CM8A 1C0KA 4BNZA 2I6TA 4K6CA 4DXHA 1DBVO 3VZQA 4W7IA 2JFFA 1KC3A 3AU9A 1GY8A 1WMBA 4ZQBA 5DCUA 5JYDA 4JNKA 4HADA 5IZ4A 1JKIA 1OMOA 3GGOA 3KSUA 1DDOA 4YQZA 5THQA 2EF1A 3DTTA 2Y99A 2W4QA 2VT2A 1V3UA 5B4TA 2JD0A 3VH1A 4DLBA 4XQGA 2HO5A 4LW8A 1LI4A 1DFGA 1L7EA 3G17A 4B4WA 3ROMA 4DUPA 2DBQA 3QE3A 2O3UA 5GY7A 5JY6A 1NTOA 1OC4A 4NBTA 2WD8A 3C8MA 1A9ZA 1YJ8A 2GO1A 3MTGA 3NV9A 1ZW1A 3PJFA 3DDNA 1B2LA 4E2YA 5A3JA 1Y5RA 3WMXA 5A4DA 1JWBB 3ENKA 3F1LA 3ADOA 2W2LA 4HWKA 4KMSA 2AQKA 4LRSB 4ALKA 1T24A 3LDHA 4WE3A 3S2EA 4YJHB 3KHUA 2FOIA 1SB8A 4YDRA 4Z9XA 4AJ2A 2R00C 4G65A 4YVFA 4GLLA 4B3HA 4E3ZA 3OIFA 4Y8VA 1R6DA 1AGNA 5ER6A 2A92A 1W6UA 1KY4A 1UXKA 4ZA2A 1ZVMA 1DRUA 3JQBC 3N74A 3L77A 3FTPA 1IHXA 4DYVA 4MVJE 1O0SA 3U0BA 2AXQA 4Y6RA 3ZDFA 4II2A 4NFSA 3FRJA 5F3RA 5CP8A 2C54A 2V6BA 4CR7A 2E48A 1DJNA 4FQ8A 4XGKA 1RM4A 3NDIA 1BHSA 5JE8A 1R4MB 2EJVA 4ALLA 5G4KA 2J3IA 5I9NA 2HMSA 3B1JA 5HBRA 3QQPA 4HX5A 4MOWA 1JA9A 4BHTA 3TOZA 3PXXA 3WFJA 1H6DA 4XIJA 1TT7A 2C2YA 1CRWG 5BQFA 2BELA 2O50A 1WAMA 1QYVA 3RBZA 2A35A 3VPFA 1LRJA 3JYPA 3IMFA 4KTVE 3VPHA 1AXEA 2AE1A 3OJEA 4EDFA 4F45A 4I9HA 3VKUA 2PKRA 4M1QA 1N1GA 1U3WA 5EINA 3HDHA 2GLXA 3ZW8A 3WGOA 1E3WB 1E7RA 1DPGA 4K6FA 2P91A 3U49A 2R6JA 2ZTVA 3C1OA 1P1FA 4E5NA 4RQUA 3AOEA 3W8EA 1C1DB 1N1EA 5JAMA 4QUKA 4PCVA 4W7HA 2GN6A 1HL3A 3CKYA 1Q0HA 4RO0A 2HMVA 4DREA 1HE5A 1PR9A 3PYMA 5KJCA 1PZEA 4RPHA 3DMTA 4LVUA 5IJZA 3H8VA 3AUSA 3TRIA 3ITKA 2VWGA 3U4CA 5AOVA 1HKUA 2VRBA 1YBMA 3DZBA 4AJOA 3SBOA 3V5NA 3EGOA 4E5YA 3WTCA 4BVAA 1ONPA 4OXKA 4A03A 1G0OA 5DULA 3DFUA 1Y9AA 4GAEA 3WTBA 3QHAA 4DVJA 4DPMA 2FZEA 1DB3A 3IP1A 3GEGA 2BRUA 1HZJA 4WLFA 1OC2A 1GUFA 1GDHA 2D0IA 4KDFA 4WASA 1XG5A 2H1SA 4RGBA 3QY9A 1IYZA 4ESOA 5CEJA 1HDGO 1R16A 4MVJD 3RIHA 2FR8A 1D8AA 4NHEA 3CIFA 4NJOA 5TX7A 3PGXA 4CLXA 1LDYA 3KEQA 4TWRA 1MXHA 1LA2A 5BSHA
chains in the Genus database with same CATH superfamily
1GNTA 3EEQA 2XOXA 2LDXA 3PI7A 3NIBA 3IPLA 1JPUA 3ZV6A 5K8IA 3CX7A 2VJKA 4I2VA 5JSFA 3UMYA 4GZMA 5L4SA 4J0QA 4D9CA 2I3DA 4YYEA 5KNBA 4WLEA 1AQIA 1CB7A 3HBJA 2J0UB 3F9IA 2HDWA 4JBGA 1SURA 2B6NA 2BC9A 4FONA 2WJWA 3MTDA 5KVQA 5KOIA 4DCGA 4EATA 3KZVA 4MYTA 5MFPA 2BV3A 4OB8A 5ALUA 2QX4A 1V7ZA 3L82B 4K2HA 3ZWPA 4ZGWA 4JEUA 4YMVA 2CGEA 4TM8A 5KQGA 4KEAA 2YXNA 3PWKA 4JAVC 3R7SA 2DFNA 2WKPA 4EYOA 2DKFA 3DWIA 5JSZB 1GQYA 2KB0A 1EDZA 3PUYA 4P1ZA 1E3EA 1ZI8A 3UIEA 2PEZA 3ZK7A 3GXOA 5LMNB 1V5FA 5IKOA 1H3NA 3VDXA 3UK6A 5JJLA 3BRQA 4M21A 5H8WA 1GA4A 2W9XA 1GGNA 3K6RA 4B6SA 1U2DC 5HUHA 5HZMA 2DERA 3T7DA 3ORFA 3G5UA 3TW0A 3GQVA 3WGIA 3AW8A 2F3PA 3KHKA 4EKNB 4CETA 1MEEA 3GJZA 3NEJA 4LJSA 1BO6A 4GI7A 2DKNA 1R4MA 1HFEL 1YB6A 5CB4F 2XNKA 2JL1A 2XKKA 2VUUA 4KO1S 4BKOA 2B9EA 3JTMA 2BDUA 3NAZA 1E8MA 2F43A 2ODBA 1NI4B 4PBSA 4YQYA 2XUIA 3ASYA 3D5TA 2JCXA 3KLPX 4LNHA 3OLZA 4LRXA 1H69A 2VJAA 2CV1A 3A6PC 1HQDA 2HF8A 3FKQA 4GM1A 2QT9A 3F6YA 2WTXA 3OC6A 1S02A 3BRWD 3DBOB 4OJMX 5EJ6A 3V8BA 1WETA 1XDZA 1JEDA 1UZUA 3BBPA 3EXHA 3HVIA 1SBZA 2GCOB 1IZ9A 2I99A 5KNCH 3UFBA 1KJYA 1RQ7A 2YYSA 1Z56C 2WVJA 4YUAA 4K8RB 4OSOA 4Y18A 4CI9A 3ZQUA 1E5LA 3GRRA 3GDOA 1FLDA 2RI6A 1ACMA 2HPHA 1Y9EA 1JQAA 2JLCA 2VLBA 3SZMA 3NXSA 3TAUA 3JAMA 3GT7A 2VXYA 1IY9A 3H9BA 2G28A 1TO1E 2GZ1A 4YPOA 1RWVA 4XWOA 1JG6A 3ISVA 2Q99A 4UASA 3W8FA 4RPLA 1GPJA 2WM3A 1GA1A 4WCFC 3VYVA 3DWGA 4WY8A 1BEUB 2PWAA 2X42A 1V3TA 2ZUVA 2WQ6A 4ZDIA 3NBFA 1YZNA 1QYIA 3TQHA 4AP9A 5KNCA 3R20A 4I5DA 3M6LA 4HI0E 4Z4QA 3HB5X 4LTNA 4B43A 1PI3A 1W2GA 4QJ5A 5BSKA 1M5TA 2QMQA 2GCGA 3CX8A 1REQA 2WHRA 2VEDA 4MI9A 4QAQA 5DI3A 3I04A 4Z0TA 3H7IA 3FF4A 4JK3A 4UTVA 1VMIA 1CJKC 1EXWA 3QELB 3OQBA 6REQB 1FMTA 2FUG6 1NQ5A 4GXTA 3MCVA 5J5CA 3GC6A 5FJJA 3W9BA 1AUPA 3CPHA 2JIZA 3WJ7A 3O9ZA 3FI9A 1QGDA 2R96A 2Q5HA 1DLIA 2V5UA 4U0KA 3IDOA 4F71A 4O2BF 4X8HA 2JNWA 2A84A 5EWJA 5TARA 1PL0A 3AY0A 4INPA 4IOJA 1KVUA 3ND8A 1O1YA 3C5HA 2OGUA 3D8RA 4JJ6A 2CCGA 1X0XA 2XDWA 2PJDA 2XT6A 1RHMA 3SKYA 5ILGA 3OWOA 3P2EA 1C0EA 3RLIA 4UNNA 2R8EA 3FN4A 3PEFA 1M5UA 3CLUC 2NVUB 2ZYTX 1NAHA 1ADYA 4PSDA 1R37A 2F8LA 2ZB2A 1Z0JA 4A6XA 2ZQ5A 2YJGA 4RQTA 2LCQA 2FK8A 4BZQA 4GI1A 1XTIA 1FL9A 5JSYA 2PDAA 3QOWA 5CH3A 3VU8A 1RJGA 2CFTA 4XGIA 5TNXA 4CMHA 4JT8A 4MHOA 3VR1A 2DVMA 3ZCXA 4U39A 3W9SA 3RVSA 5EP3A 3HN6A 1CIVA 4DARA 1WF3A 3ZHBA 2A0XA 1S2IA 2J41A 3UHJA 5KTSA 3QEAZ 3VPAA 3B1VA 4EHFA 3L49A 3TBFA 4P35A 4C6TA 4EX7A 3UK0A 1QVWA 4N0EA 2BEKA 3P0FA 1TXGA 1XO1A 2FA9A 2OBYA 4ZHQB 3O0TA 5AM3A 2GZ3A 3W7BA 5KNBH 4KLNA 1ZIOA 2A4MA 1SUDA 2QHXA 3HYNA 1OFVA 3PPVA 4JYPA 4XTCS 4I81A 2F1OA 4KK4A 4XCVA 1BDJA 4G5FA 5CK4A 5HUQA 3UMSA 2CHVA 1KWKA 1LEHA 4DA9A 1NF3A 5KYXA 1FZQA 3WAKA 3LWNA 2BE7A 2CVHA 3B6JA 5H59A 2WTAA 3UJ9A 1MQ9A 1LUAA 2PMWB 5CB4A 1PJAA 1BCSA 2BZSA 4UMEA 2AOUA 4GX0A 3ND7A 4BB5A 1GFSA 4HY3A 5DHAA 2O52A 4YRGA 4YXFA 2BE9A 3LC1O 2G77B 3FI0A 1VOTA 4KQ2A 3KQWA 3X1WA 4BMSA 2FZ4A 3SZ3A 3KVVA 3N8KA 3AEUB 2AOUB 2IWHA 3ZWAA 4RNDB 3AVVA 3GT3A 4H7KA 5CXXA 4BLOA 2F8TA 1I3OA 3I12A 2IP1A 2DLNA 1J1ZA 4R5HA 3CT4A 4G89A 3DBLA 1Q6YA 4D8WA 2V7QA 3NOQA 1L7PA 1XTZA 2R1VA 3R6LA 1SBNE 2IITA 1MW8X 3RYFA 4GW3A 2D06A 2PMEA 3ZV3A 2IX3A 2Y71A 4E88A 5KCMA 3KYCA 5HM6A 1NT4A 1OTHA 1BC5A 1TCVA 2LKCA 1T0HB 4AROA 1G5IA 1NX6A 2BD0A 2VSQA 1QYWA 3TNJA 1TM2A 4A8JA 1LSUA 4BGIA 1Z47A 1U3TA 1JEOA 1WZUA 2D1QA 2A1TR 1C80A 3PPWA 1XLTC 3CR3C 1LPSA 1NA5A 4HJXA 5AKJA 5TGDA 4BRZA 3M6VA 3O8QA 3I5MA 1B14A 4NBWA 1Y37A 4HCJA 2OCGA 4ONEA 2AFHE 5JATA 1E92A 3FHLA 1JH8A 1D2GA 2V7EA 4PFQA 2W8BB 5EKXA 3R77A 2OHJA 2EX1A 2Y4OA 1GTZA 4L22A 4OHFA 2HA5A 1NSFA 1EJ2A 4JB0A 4OYYA 4DOMA 4E2FA 4Z3DA 2J3LA 3ONFA 4MDEA 1R0YA 2C5HA 3DO6A 1GPBA 4QPDA 3Q6MA 3Q3EA 8ATCA 1N5DA 3HCWA 3OE5A 2NUTB 3DXXA 2SNIE 2CNOA 2VG8A 4FINA 3O1HB 3Q7RA 1PHPA 2UZIR 4KTTE 4NAUA 2WW8A 5E1DA 3WE7A 4RDHA 1S2MA 4E33A 2B4KA 4G56A 4L6CA 1HYEA 3VJMA 2L19A 3VPCA 3LYHA 1MAAA 3CVWA 2AKYA 1RM3A 1X1RA 1S5PA 2CK3D 1N3LA 2FRDA 1UBMS 3DZKA 3IAXA 2PLRA 3LC0A 4RKYA 5IS2A 3ED5A 3PE6A 4HS4A 1S2LA 3BQ9A 1E1LA 3D3KA 3CEPB 4KGXA 3UJ8A 2FCAA 3ZLUA 4CCAA 3K1ZA 4CKBB 4LXGA 1RPZA 5TQVA 3LX5A 4DKXA 2ZXUA 1SG9A 1K8ZB 5THKA 4F72A 1Z7BA 4C2UA 2ATXA 2QVBA 1GR1A 4H17A 2HN9A 4QRHA 1HL7A 1SB9A 4W5WA 1T15A 2XUKA 2BGJA 1Q83A 4PCAA 3K8OE 2WYVA 2Y0BA 1ILEA 1SCAA 2NO7A 1LSOA 1J70A 4LRUA 4JMLA 1HA3A 1OFHA 1YJAA 3FR7A 3O3NB 4IV0A 4U2EA 2RAVA 3EVDA 3PR1A 5EEHA 1CJUC 1NJ6A 2IYRA 1CP3A 3RRBA 1XEAA 1K8RA 1VQ1A 2G71A 5K8UA 3THRA 2REBA 3FPKA 2YWDA 2ZFUA 4H6XA 3T7CA 1HG0A 2QSZA 3JVUA 2LDBA 2ID4A 4D41A 3ZNPA 4C76A 1SD1A 1XDDA 3NV7A 4HAOA 2C3OA 4DA4A 3E23A 4IS3A 2IEZA 4MCHA 3ROPA 1LTKA 1HYGA 1R9NA 3OTWA 2AG8A 3R0XA 1TX4B 3TCXB 2O8EB 5M5BA 3EVEA 3JQ8A 5L51A 2YMQA 1KI1A 4MULA 3INTA 3QPCA 4IZIA 1XRQA 4KQGA 1Y7HA 1NQAO 4M8LA 3NBZC 1F17A 1Y5IA 4PYQA 1USWA 1XTJA 2GAIA 3F3MA 3BZUA 2Q3LA 2H1IA 4II3A 4BNNA 3AHIA 4DQXA 4RD0A 3PJDA 4PWZA 5HCUA 1UPBA 5AHKA 4W5RA 2X7XA 3KTOA 3LYAA 1RBYA 3W90A 5IANA 1NZDA 2O5EA 3KFVA 2B5OA 4QKQA 1DXYA 4I3GA 1IU9A 3FJ1A 4B48A 4BEWA 1SXIA 4U5QA 1R64A 3HABA 4BP9A 3FFBA 3PENA 2FQQA 3EARA 4UW9A 3T5DA 1QPZA 3LZ6A 5E6SA 1E62A 2YIVX 5JCPA 1GQFA 1IEQA 1GSHA 5DTIA 2REQB 5M3BA 1AH2A 1ODIA 2WJ6A 5LZ2A 3SXUB 2NYVA 1H5QA 3BREA 3B3JA 5EXTA 5HPYB 4CLEA 4N41A 4KREA 4ZEMA 1MC5A 3KO8A 1E3IA 3SVLA 4MO9A 3OSUA 3L8YA 4CV0A 1ZU4A 4RLQA 3TE6A 1RI4A 2R8XA 3K2BA 3KAKA 3ZD8A 2F9FA 1VHWA 1A04A 3I5AA 5IKXA 3GZTB 5FV7A 1NXVA 4NAHA 3TNYA 1YH3A 5F2OA 4AAYA 1I6WA 1VHTA 1RAIA 2CLCX 3H83A 4ER5A 4UU7A 1B8VA 5ES3A 4Z7NB 4MZXA 4U00A 4V0LA 3L0YA 4CV1A 1EGAA 1YR1A 2HA4A 3AINA 4QPCA 1K3FA 3O47A 1U04A 1UOPA 1YMUA 2W2KB 1D2MA 4KLZA 4MWCA 2ILVA 2CB0A 4FYWA 4KQEA 4R2LA 5TPZD 4M36A 1RWXA 1XLTA 1U2EA 1Y89A 4UBKA 5TXGA 4YB8A 5I9LA 4YRZA 5JSUA 1B16A 5JAPA 4NYMR 4I8IA 2AE2A 2H1VA 3QY0A 3RJTA 1G63A 2FEOA 4BBJA 4H7JA 4HWSA 2XDQB 2Q5LA 3BIFA 4PIVA 1UBFA 3H5RA 4LFBB 1TCCA 4X1YA 2NO1A 3VO2A 3BGSA 1MLDA 2H00A 5EJ4A 3RWBA 4UCXA 3GT0A 2I29A 1O94A 1VLVA 1PK8A 2PBFA 3IAM6 1AQ6A 2BJVA 3JW8A 5KMGB 1D3AA 2PZEA 3CNBA 2JAOA 1M75A 2YFKA 1JMYA 2WAMA 4CR7A 1U4SA 1Y1PA 4NDNE 3DMFA 5IKMA 1WCIB 4F2PA 5B3AA 1WEHA 2WA1A 3OMLA 3RVDA 3UHPA 1CF4A 4ESEA 3GEHA 5JXWA 2HU2A 1EFVA 3I6BA 5SY6A 4CHTA 2IXDA 1EEXB 3LOUA 4M89A 1U1DA 2GWHA 2ISQA 5F1YA 4D9MA 2O48X 4N18A 3K15A 5ALFA 2HCJB 1J9EA 4DLRA 3ZE8A 2HMTA 2D2IA 1MNAA 1BFKA 4GMDA 3RUIA 4FGKA 5JW6A 3SR0A 1KAMA 4KI7A 1KEEA 2HNKA 2YXBA 1D8TA 2WJZB 3K6SB 3T3GA 4O2AF 1ISFA 4EEXA 1YJCA 2ODPA 1NPDA 2B8TA 2D7JA 1BGWA 4H6PA 2XHEA 1U1IA 2ZR9A 3LXUX 3BRSA 3O9MA 3QU2A 3G0DA 4HUQA 4M7WA 3CLHA 2R1VB 2ZSBA 3HM2A 1AV6A 2O5RA 2NZWA 1AZLA 2FSUA 2J3MA 4OHRA 3OQ1A 4HVAA 2X0EA 4AKEA 3E84A 4M49A 1JDTA 3A3PA 2B98A 1Y3AA 1E6LA 2IF2A 4QUIA 4FX2A 4KQHA 1NAIA 3DQPA 7MHTA 4HRAA 3ETDA 4EKIA 1I01A 2V4ZA 2F3UA 2GJ4A 1T2VA 3RRMA 5BN3B 3VJRA 3EZ2A 4D92A 1SJ9A 2QN6A 5CURA 5FI1B 1DO8A 2DPHA 3LQRA 4LYYA 1E1DA 1Z6AA 2KWIA 5T7BA 1MABB 4GO1A 3EXHB 2SKCA 4L73A 5HFNA 4MUFA 1XA4A 1LRLA 4CQMA 4JUBA 3F6RA 4EFLA 3W5HA 2CWWA 1T3TA 4KN6A 4M9CA 4RXMA 2WT4A 4NEHB 5P8WA 4HO1X 5CW1A 1YRWA 1VL5A 3B1XA 4HWTA 1MCZA 3IPAA 4I50B 3Q0EA 2ICAA 3X1DA 5CCBA 3L0DA 4MUJA 5KO2A 1ESZA 2WWXA 2ZSFA 3INGA 2DPYA 1GG5A 2J31A 3D1VA 2HBZA 4JP3A 3PLRA 3LG2A 4NZNA 3R7NA 4F3TA 2EGUA 4XM1A 1JTFA 3P1JA 3D4IA 3LKDA 3G1WA 3MPOA 1NBME 4IGFA 2VDKB 3HDTA 2PSEA 2ZE8A 4PPQA 4UPVA 3TSYA 5BV2P 1AK1A 1U7HA 3KPJA 4RYDA 5AK5A 2A5JA 1YQQA 4LIPD 4K9KA 2D1YA 5EGSA 5HKKA 2BEVA 4RDCA 3AR5A 4XWAA 3OJ0A 4WJZA 3HMQA 4JLUA 2VJNA 1HEYA 1ADBA 3MCUA 4RGQA 3A1FA 4URUR 4YFVA 3RUCA 2GEFA 5ILQA 4TL9A 4G23A 1II0A 3MWKA 4UUQA 1LPOA 3V8MA 4UUBA 1H85A 2YFHA 5C9ZA 3GRFA 4M98A 4WN9B 4BN5A 2HWUA 1TVCA 2OO5C 1GGVA 3A70A 4TLAA 2WF5A 4ZJYA 4BKRA 4G4SO 4IUCS 4BS9A 2GAJA 5BPFA 1EK1A 2F9MA 4FFNA 4GGMX 1V1MA 3IT0A 2OENG 1E1RD 3CLTD 4UM7A 1X1CA 3VI3B 1DP4A 1FE8A 2XUGA 4OAPA 3Q15C 4OLFA 3RAGA 1OREA 2C1ZA 2O2XA 1P2UA 3JZAA 1PNRA 1H5UA 4RU1A 1Z8NA 2O20A 3LM8A 4FBMA 1I33A 2D74A 4X61A 2K7FA 3RJ9A 2E5WA 1A8QA 3DB2A 2Q45A 4N3CA 2B21A 5A05A 1OWOA 3E82A 4UBJA 2CJWA 4U7FA 1CG6A 2FLVA 2G0TA 2W71A 3OPVA 4IH1A 3UAZA 5EHZA 1CUUA 4H9GA 4TL7A 4K9OA 4BX8A 5JALA 2HQ1A 4IIDA 4C89A 5ALDA 1JIKA 3JYQA 4HOYA 4FKZA 5AO9A 4PQYA 2XE8A 1NHWA 4C7OB 3V1LA 1E59A 1A5SB 1XIVA 2ZIWB 4BJ6A 1Q84A 4BNKA 2ADOA 1ENZA 2BSQA 2CB9A 5A62A 4NNOA 1RQRA 2B7CA 4CZ2A 4LF5B 5KTYA 1YACA 5EZSA 4KJXA 3ZQKA 2V0GA 3UENA 1FFYA 2EYUA 1YR9A 1LQ2A 4MYHA 5EFOA 2Q5EA 1QHIA 2VTKA 1TM4E 3BX1A 4D8TA 3E81A 1RFGE 3EGDB 1KBZA 2ANBA 1K3TA 2Z3ZA 3DGFC 4PYKA 4O8ZA 4FWTA 3QJGA 2IKQA 1J07A 1FFCA 1U0HC 5HK8A 5CCDA 3T7JA 1NW3A 4EA6A 5JFGA 5JSZA 4BEVA 4Q19A 5IVKA 1X3LA 1JG3A 1MA3A 2P68A 3GN1A 5FO1A 1CDOA 1Z4OA 1RWBA 2OCXA 1T1JA 1UFQA 3DZCA 4LJ5A 5JMWA 1LQTA 3H16A 1YD7A 3M3HA 3L7IA 4KODA 5DT9A 1DQNA 1U0RA 3KC2A 1H2FA 4PR0A 2FDXA 3H1GA 4LK2A 3D5EA 4UEKA 4EHAA 3T1QA 1N6PA 1ZIDA 2DTDA 4HPWA 4HXFB 3Q9LA 4CFSA 1QH0A 1LV7A 1ZAKA 1UADA 2ZR7A 1J00A 2R7LA 4NNPA 4OUDB 4ANFA 1XSEA 3BMNA 4DLTA 3FYTA 3AIIA 4NATA 5JCJA 3RU3A 2PVPA 3USES 5KYNA 3SIPA 2UU9B 1I0IA 5IAGA 3FBGA 3AR4A 2AYXA 2Y2UA 1QRAA 1WPQA 3MUNA 3WK5A 4XYLA 4IH9A 5A9RA 3BMNB 1RW4A 3ORSA 3KJXA 2KHZA 1N9GA 2PRZA 3KNZA 3GJXC 4K6KA 4IWNA 4RF2A 5D5QA 2XLBA 5JCOA 3L6OO 5EXDA 4EA7A 1G3QA 2AEEA 4LXUA 3S2UA 1D07A 3KQLA 4B5LA 2Q5CA 4ITVA 3QF4A 2ZI7A 1U3GA 4OU4A 1QQ5A 1MOSA 2ZE7A 3HJNA 3G02A 2AV6A 2Y1XA 3D8TA 1VJ5A 1CEQA 4F04A 2O2IA 4YH1A 2ZJ7A 3HYSA 1DQZA 4PBRA 3T54A 3AVQA 1MQSA 2EJCA 3GJ6A 3KKMA 1EUCB 1EP3B 1CYEA 1A50B 5D00A 1UZAA 3BHMA 5IZCC 4AMVA 3S40A 1P5HA 3ZJUA 4O29A 3GHHA 2G72A 4FHFA 3ESXA 3ESYA 5E6RA 3CY6A 5ICEA 2O8FA 4FYIA 1GPH1 1V1MB 2FNAA 2GEBA 3WMFA 2FW6A 4M2LA 1HH4A 4FEYA 3U4MA 3MAGA 4GX1A 5AW6A 4DMRA 1PBNA 1L5OA 5JS8A 3ROQA 1B3BA 3IP3A 2CUNA 1IWOA 1AQLA 1GQRA 2LE0A 4HNUA 1H0KA 3FM9A 3G2IA 4MTLA 1XYGA 1N5KA 2DOKA 1UPTA 3A6KA 1XQYA 4LWOA 4CIDA 2DR3A 3I1YA 3HH8A 1Q74A 4NZPA 3I8OA 3O4JA 3AESA 1NG9A 1QE0A 1SG6A 2NZVG 2IBTA 1QAOA 4ZZ0A 1GNPA 2H2IA 5AW1A 3DVAB 2NU6B 2XD9A 3PCXA 2R85A 2RBGA 3DP7A 4GPIB 5EY5B 1XCMA 3W5AA 1ONBA 2IRWA 5KJEA 1ATZA 3GGJA 2OOKA 1U7TA 1ZFNA 2G70A 2H31A 3MJSA 4OMDA 3UPDA 5AW7A 3OX4A 1F4VA 3UEOA 3ORYA 1PGOA 1ODSA 1S3GA 5H1YA 2WOOA 3AP1A 1LLQA 2C96A 4UEQA 4DMGA 4BZPA 5F73A 4UE6A 1NI4A 3FFTA 3A9TA 1BZYA 5ESWA 5LJIA 3U44A 4Q3DA 2ID8A 1QFJA 6GPBA 1PHRA 2YKGA 3RTEA 3BFVA 4UM8B 2QR5A 1E9SA 2EJUA 3K31A 4HATA 2PRYA 2UKDA 4L72A 4IIEA 2QTAA 3T7IA 2B78A 2CXQA 2OV4A 4K9PA 4PG5A 3TIGA 2REQA 1EVYA 2X0IA 1QMGA 1V2GA 4QM6A 2CJFA 1RAGA 4G81A 1W19A 3H2JA 4FFSA 1MHPA 1YUNA 3AZOA 3CYFA 2QAJA 3VKVA 1NGSA 3IKJA 5A7FA 4YRBA 4CQNA 4DWOA 2OLKA 3QE4A 3NEYA 1FYEA 2NIPA 1XCOA 2XWBF 3OBIA 3Q10A 5B6IA 1DO0A 4DIFA 2V5AA 4QZVA 2YYAA 3A04A 2CY0A 2LRHA 3EQ8A 2RBKA 2W8ZA 2A33A 3VR5D 1PD1A 1DJMA 2Q41A 4EGCB 2PGNA 1COWA 1O0CA 4AZVA 2EKPA 1W87A 1NP6A 2O06A 2ZBFA 3D3NA 2HA6A 3J7AC 3QMWA 2OWEA 1EWVA 1WXXA 1K27A 1YCHA 3I1FA 4E11A 4NZOA 2OB1A 2JJ1D 2E4AA 2QENA 1Y5MA 4P84A 4QOFA 4HDRB 5DP1A 2UXCB 1OWPA 1X1AA 4NH0A 4EHIA 3DG9A 1CNMA 4GBJA 1EYZA 5GZ6A 1NWCA 4TMXA 3S5UA 2ZRQA 4MRNA 3DBRA 4TQUS 5E1BA 1SA0A 1CZOA 3FOCA 4H4EA 4I50F 2GZ2A 2PFGA 4W6ZA 1PQWA 1DNPA 4BLWA 5CIWA 3G8CA 1PGPA 5DKFA 1Q7GA 5JNRA 5J2TB 4PGAA 4Z9AA 4M1TA 2CXRA 4TLCA 1ZK4A 4D4LA 5GJBA 3DW3X 4OXYA 1XVTA 1G9XA 1KK2A 4IIYA 2NMVA 4LXTA 3H4TA 4WOJA 4HQLA 4M86A 3WGMA 3OVMA 4AQDA 5CDFE 3KJHA 1B6TA 1X9IA 2D1TA 4P5DA 2A67A 3TK1A 5CHEA 1C7JA 1LLDA 4L51A 2WHPB 4IVPA 4KKXB 5GIOE 3PU6A 4JSTA 3DXZA 3H04A 3HJAA 1JPJA 4IIJA 4NCNA 1RLIA 1J99A 3F6PA 1J06A 2OKCA 4R16A 3E15A 2YW9A 5AUPB 2QNBA 2PUGA 3RTBA 5HSGA 1KFBB 3HJHA 1QGZA 4CF4A 4AF6A 1VHJA 1STOA 4KAXA 1BG6A 1PV2A 2V5VA 4J1TA 4OJNA 4JT4A 2VL7A 5JSQA 3D1LA 4DFDA 1GP2A 1GV1A 1LY1A 2R65A 1DUSA 3GOHA 4OFBA 4QQKA 5IPFA 2CEKA 3LY9A 1XV5A 3HVJA 1NKVA 4HD8A 4W1SA 1W0JA 1GEGA 1TO2E 3U7QA 1EZ1A 2GKSA 2QN2A 3FNFA 4BGEA 4OQ4A 1DAEA 4FDTA 1Y1KE 4UVHA 3H4IA 5DM1A 1PW5A 4BX0A 1BW9A 1QP8A 3GJ3A 4HTFB 1NXQA 3LF2A 4QTTB 2OHFA 3O3MB 4EJSC 5JS7A 3N0VA 3WL6A 3V4PB 4Z8XA 2I76A 3IFSA 4A82A 4E2WA 3VTZA 1MZPA 5ALQA 1TVKA 2IPNA 4NJEB 4XUCA 1OYYA 1U7UA 3LC7O 3RQIA 5JPDA 3AHHA 3Q6IA 1ESDA 2AMVA 3QU7A 1FDRA 2C2XA 2MYTA 5T67A 3BJMA 3KDPA 4HGRA 2ZBUA 1JAIA 3KUXA 1Q1EA 3E7DA 4I4TF 4RIHA 5TGTA 4KPEC 3V8QA 1NQWA 1JEYB 2RD2A 3TBKA 3DE3X 5ALPA 5FADA 4JLSA 1U5CA 3HI6A 3M3DA 1I3LA 1KZYC 3GEMA 3G68A 3INNA 4ZAYA 4ZI2A 3IB3A 3ZDQA 5EKSA 4X1IB 1YE8A 3R7LA 5CUQA 5DGDA 4Y2GA 4Y2SA 4ZT5A 3JQ6A 4R68A 4BQPA 1HE4A 1TJ3A 1YKFA 1ZBQA 4BMZA 1JNXX 5H3HA 4DQLA 2FFHA 4XZ3A 1MH9A 4Q7EA 3B1YA 1KRXA 4LGCA 4UMDA 4Z99A 4B35A 2A1UB 3GUCA 2P6NA 3B89A 8GPBA 4OB6A 4XA8A 4UKDA 4JHLA 4AMBA 1QIDA 1CZKA 4UTOA 5EJIA 3ZW9A 3H9UA 1VGVA 3EBPA 1EA7A 5DB4A 4C07A 4EENA 4BNDB 2H85A 1CZHA 1L4KA 4UDYX 5EIBC 1IPEA 3GF4A 4Q21A 4HQ0A 3R7WA 1PL7A 2UVPB 2NZUG 3Q41A 1YS1X 5AHXA 3HI4A 2V7XA 3N07A 2ZIXA 1UCFA 4JITA 5DNWA 3ZKAA 3OQMA 3WLSA 1JQEA 1DMSA 1HFJA 3B5IA 3KR1A 4RVUA 3VR4H 3KUDA 4YAJA 3AWIA 4ZT6A 5J2UF 3EEIA 4R7TA 4ZI3A 1QH1A 1MBZA 3F0TA 3EXEB 2JIBA 3HEAA 4OSEA 5JZOA 3LVQE 2Y77A 4ML3A 1RKBA 2FWJA 3OJLA 5DZSA 5JAQA 3A32A 5IUNC 2I9KA 4DQUA 1QTQA 3NTQA 3ZCTA 3T9CA 1C3EA 5FL7D 1T3HA 1JP7A 4PAQA 3K94A 1F12A 1NKTA 1XMJA 2ERCA 1GFWA 3LC2O 3O26A 3DEJA 1AVTA 2JZCA 3AIKA 5E1MA 4J3FA 1F6BA 3UH1A 2VSNA 3F4KA 3A6EA 3QVJA 1J2YA 4H7FA 4L5IA 5CA0F 4NXMB 2VWHA 2B2CA 1P39A 1JLSA 3UQZA 3FPAA 3HVKA 5H83A 4YUZA 5KMGA 4ZALA 1XVVA 1KOLA 2ZTSA 5A04A 2F8MA 3OCUA 1PFKA 2BEUA 5CLGA 4H1HA 1YS2X 3CNEA 3UWDA 2ILTA 1A8PA 2FYTA 3L02A 2NTVA 4CN8A 4G0UA 3BWVA 2HFKA 2YWRA 2I2XB 3O4HA 5J5AA 5ALKA 5F5LA 4HRXA 2WB2A 1D4AA 3IAEA 2QY9A 1LLUA 2PV7A 1F0KA 2Q3FA 4M6WB 3VKFA 1XKTA 2CXOA 2JCVA 2PVCA 3MMZA 4R2WA 1IQPA 4RL4A 3B6KA 1KQOA 3RSGA 1X80B 5AI9A 1U9CA 1UFVA 3VKHA 2EOAA 3W5BA 1XU4A 1XTPA 3KU1A 3MMXA 1KI9A 4FS8A 4MROA 1IDOA 5B1SA 4YR9A 4G01B 3TRFA 4GDMA 5DMHA 1B76A 3G9QA 3GP5A 4EVRA 2HTEA 3KQSA 5DO9A 2FSFA 3ECSA 1WO8A 1DAIA 4HDAA 1X1DA 2V65A 2X7JA 3NYIA 1WULS 3KT0A 1E94E 5ANRB 5FBKA 3IUEA 3K0EA 4EB3A 1FDTA 5HRUA 5HR5A 4FK8A 3HUEA 2FUG1 2MMGA 2I4IA 1GQQA 2PSFA 3L93A 4ALIA 3IXMA 4E3WA 1CB0A 2I62A 3BL6A 2QMHA 3R4VA 3MWEA 3ZE0B 2F90A 2EQAA 1N32B 4HGZA 4BDTA 3AJAA 3NTLA 1ID8A 3DM5A 1XTRA 1GZHB 3HCBA 2CWDA 3NHRA 1H2ZA 5I4IA 6PFKA 2Y0PA 4MQ5A 2G80A 2P9TA 4B82A 2Z6AA 3UT0A 2NXNA 1DWOA 2IYXA 5ALMA 2C57A 3KPYA 4ZCRA 3VR0A 4G1MB 5LOVF 2PHZA 3ZU3A 4ZICA 4C6RA 2WJYA 3NIFB 3RR2A 5DM4A 1E2QA 4B80A 5EZ6B 4E5DA 4EG1A 1KXZA 5BQ3A 1B6SA 1E2UA 2IIVA 1G21B 2MIIA 1M54A 3CSSA 4NMWA 5FPQA 5IHPA 3WICA 1U8EA 1UDCA 1EBFA 4I7EA 4NEQA 4X6UA 4H08A 3H9JA 3OP1A 2PRKA 2FW9A 1X70A 1HZZC 3MB5A 4KWTA 4M1YA 2EKDA 3UW3A 5JROA 1EBBA 3HXPA 2VSYA 1PGNA 1THTA 1YKGA 4NV3A 1J1UA 3RVMA 1SAYA 1KY2A 4I08A 4U7WA 1FYVA 1OHHA 2XIJA 2WYHA 3IVAA 5GV8A 2GYYA 1V0JA 4IEFB 2PK3A 3CW9A 3V32A 4OQZA 3K3PA 1RI3A 3LECA 3TGWA 4Y9SA 3MWEB 4EUHA 1A9OA 4NPHA 4YAKA 2VP9A 5AKKA 5A7HA 4BVFA 1Y1SA 3NBMA 2WFLA 3JVEA 4CLRB 1KJQA 1WW3A 3G2QA 4IEIA 3D64A 2JK0A 1DIOB 3UK2A 3N8GA 1KSFX 3B12A 2W98A 3DMRA 3KTAB 3UUFA 1V3QE 3LP8A 2ZWMA 1VLQA 3H5LA 3MRTA 3NX4A 2O3JA 4MQFA 5IK2A 1I2DA 4UHKA 4RANA 2PFSA 3WQBA 2JW5A 2WICA 3F71A 3JAKA 3Q7TA 4LA4A 4QPJC 5EAIA 3UK1A 2Q8PA 4WI1A 5HYVA 4EMUA 4XVQA 3WIUA 4UD2A 2VP6A 2WM8A 3NHWA 4F6RB 3ZNNA 3EOAI 5DIFA 1Y81A 3GPDG 4FQ7A 2GM4A 3K8QA 1Z36A 2GZSA 4BC0A 1DQYA 2CLEB 3JD3A 4J2TA 3RC9A 4B85A 1SUAA 1TIKA 1FUUA 4HQNA 3ZCSA 5K6AA 4NABA 3VR4A 5ITSA 1ZCZA 1NUSA 4E70A 2K2WA 5CEEA 3PP8A 4HC4A 3MLEA 5AJXA 3LCMA 3STVA 2C4UA 4K46A 1ZVKA 4KH0A 4P3NA 2QG4A 3MQ2A 1AE1A 1P2TA 2W6JD 2XCIA 5DISB 1PKEA 4L4UA 5FL7A 2H1OA 3OE7D 2DCUA 3OJWA 4HYYA 4H1UA 5DNVA 1UWCA 3E7WA 3NUGA 1UPUA 5FLYA 1K98A 2Y68A 4NTZA 5BN4B 1W5TA 1CNFA 3QLTA 5D5HA 2PZ8A 5EMKA 3V1TC 3R24A 5KI6A 1A8SA 3NW9A 2AW3A 2CFIA 4QASA 1JLKA 3C4VA 5B7QA 2VNSA 4YV7A 2G8LA 2VHJA 5G1PA 5K3EA 3PGA1 4X71A 2WNSA 3X1ZA 3WLMA 1YQGA 2G88A 5KS2A 1F48A 2BGKA 4B33A 3AM3A 3PIDA 4N54A 4RDXA 4B3GA 2XRFA 3R5SA 4BX2A 2OXIA 1HDRA 3ZHSA 1WU7A 5LU8A 2C7RA 1ES9A 2AL7A 1ZZGA 3U4QB 1D03A 1W76A 1BDHA 3IDFA 2QYSA 2R8YA 3QHPA 3R3SA 3C8UA 4G4GA 2PM8A 3MT0A 1E98A 4U7PB 3C39A 4OQDA 1W88B 3R1IA 2EYQA 4MW4A 2E21A 2IUFA 3RHTA 4I5GA 2HHHB 2XSZD 3B6IA 2R44A 2QXTA 4LX8A 3IODA 4NI5A 2J3HA 2X86A 3R9XA 1N1DA 3FVWA 1SQ5A 4LX0A 2GTPA 3W6UA 3RUHA 4MUYA 1XMVA 1ZM9A 5E0OA 3FOBA 1DS6A 1FNNA 1K08A 2DPXA 3EDQA 2NU8A 5LZ9A 2AX4A 3TS1A 1NBMA 5KYYB 2I1WA 3SR4A 4DMMA 2H16A 2GASA 3BTUA 4K6MA 3TLMA 1UJMA 2J0QA 4DGSA 3GJ0A 2OGTA 1WXDA 2H3HA 3TCKA 3DHYA 4TS9A 1GYQA 4KXYA 4RKFA 2JKYA 5LNK6 5HF9A 1T1GA 2P9YA 5LBIA 1KH1A 4EB8A 3OTHA 3GWZA 3II6X 3PDIB 4RS4A 3THWA 4MWBA 2VHEA 1Z4JA 2D2XA 4OHZA 2OQRA 3IBCA 4GE3A 1PD0A 1S7CA 4HN2A 1OI3A 5DBHX 5I51A 4MV0A 1JSLA 4XLTA 4EG5A 4BJ3A 3EXIB 2Q3EA 1XNQB 4ZAWA 2HXYA 2O19A 2AR7A 4D8VA 3C70A 2C83A 2JGDB 5LB2A 3ASVA 1FBNA 3OD1A 4Q4AA 3S7TA 4HDKA 1F8FA 4XRGA 2G4LA 2QU7A 2QZ4A 5LXTA 3E8XA 1XMIA 1EP2B 4P7BA 3T5MA 1E3QA 1GPKA 2XI4A 1M7HA 4YO8A 4TYWA 1TGYA 2IW3A 1TE2A 4OTZA 3TLYA 2GAAA 2HU8A 1GRVA 5FPKA 1QHSA 4N3GA 1NVXQ 4MW0A 3FB4A 4Y2JA 3NWOA 3EFOB 3JALA 1M2NA 3K4HA 2QYOA 2ZBRA 4TX1A 3UK7A 5LYJF 2Q50A 1CR0A 2K7ZA 3S8YA 3BB3A 5JC1A 4H7DA 3THOA 2OFWA 4D46A 1VLMA 4WBNB 1FXWF 1M2OA 1MVNA 2ZETA 4ZV7A 3ZE9A 2XTJA 2XXJA 2C03A 4IJWA 1U02A 1D4OA 1X6VA 3HJUA 3TYXA 1Q1GA 1ZMBA 1ZO8A 2GPAA 1BKYA 4R2KA 1KVRA 1UANA 3K6JA 4ARCA 1BOOA 4UEWA 2EGGA 3R0JA 5HIMA 3KB2A 1YQDA 1UK7A 3H2ZA 5ELXA 4Q05A 5LUBA 3D4NA 1G8MA 4DV7B 2RFLA 3QM1A 4DCOA 4KH1A 5COBA 1QIJA 4ISBA 3PD1A 1X1SA 2AI2A 3JSXA 4M83A 5AJZA 3VO9A 1IM8A 2PWPA 2JLQA 1O8BA 3CLKA 4RF4A 3CXUA 4ZI7A 2Z43A 3RF6A 1CFJA 2DQYA 1RT9A 3AB8A 3LDUA 5DN9A 1EK6A 5K05A 2Z4TA 2PX4A 1IXSB 2Y1WA 2OCDA 1XZQA 4YT8A 3DCIA 3PEWA 1GVHA 1SIOA 3EIEA 2GNAA 1EUYA 2P1ZA 3KRTA 1KSJA 4YLGA 1ONNA 2I4OA 3BIOA 3LBNA 1COWD 1BH2A 3EG9A 5CBKA 2IT1A 1R66A 2YX1A 4DEXA 5K3OA 3K9WA 3FSGD 1IBMB 4OBXA 1BDBA 3A9CA 4EJ6A 1K7EB 1DT5A 1GV0A 3I05A 3UYKA 1PUXA 1I8TA 4GPAA 1OXVA 1KO4A 5G1NA 1DKUA 4YAFA 5DM60 2WIAA 3SE0A 5LQRA 4B1FA 5A4IS 2DHCA 3OZWA 3AHGA 3UGKA 4FR5A 3RSOA 4D4JA 4WCDA 3B5JA 4PO9A 2W70A 5HJ5A 3SLKA 3OFSA 1GQSA 3Q5DA 5J9FA 4RJTA 1XNRB 2QTWB 3KZKA 4FMPA 2NO0A 2W2OA 3NJ4A 4WKCA 2ZG6A 3LMKA 1EGMB 2BFDB 3PXEA 1RC1A 1DX4A 2WHXA 1NQOA 3NVAA 2ZYIA 4ZU3A 1HE3A 3K9NA 5HQJA 1T34A 2PT7A 4US1R 3FVVA 4MA0A 1N6RA 3B3QA 3L7LA 3HFRA 2QUJA 4EA9A 3AJ9A 4DF3A 3HKEB 3T61A 3OZRA 4C5CA 2MSLA 3DYIA 3E2MA 3L8MA 4FGLA 3B1KA 5JZ9A 5KAMA 2AC4A 3ABOB 4Q01A 5EXEA 4DDTA 3CLSD 3E7FA 4FCCA 5HK9A 1Q0TA 1V96A 3MMPA 2QJOA 2XF2A 2VUSA 2Z1MA 3LVBA 2NUPB 3QG1A 2C8JA 4ZFNA 2AZXA 4BUCA 3ZYZA 1PRYA 1CUXA 1IOZA 4WJLA 4Q3NA 1CQXA 3EGIA 3SX2A 4O59O 5BV8A 1I9CA 1VIYA 2QAGA 2UYYA 3TXXA 1KYXA 4F60A 1U63A 2XVYA 2W7TA 2EBHX 4KVAA 1ZL2A 5EPEA 2NV2B 5TC4A 1TW2A 4X3CA 1BD4A 4AN4A 4B3FX 1YONA 2ZT8A 4LC0A 4FDUA 4GEGA 2ZREA 3MIZA 4B9EA 1ZRSA 5I45A 3LPDA 4QYXA 4RCZA 4DV5B 1ZXLA 3NASA 3V8EA 2AWNA 1C1XB 4EG3A 3NYWA 4GOXA 4R8LA 4Y30A 1HK7A 3DBHA 3AP2A 4Q1FA 1B8UA 1ZZEA 4G9GA 1CETA 2GSWA 3EGEA 3GD7A 4X63A 5TPZA 4OHYA 1XHEA 3ZNQA 1C4KA 4Q34A 2DECA 3IIEA 3W5SA 2TYSB 1UZMA 5BSGA 5LP1A 4G1VA 4WNAA 1T5LA 3GRKA 4N6GA 5DI9A 3FYDA 2B8EA 3L6UA 4CG3A 2Q1UA 3FPSA 2GERA 3ZZNA 3WYFA 1RMYA 1M6VA 2Y27A 1YCFA 3SX4A 4QNRA 3I5YA 4RZIA 2J08A 1XEWY 2WABA 3V46A 2ONKA 3TEJA 1HDIA 2WC1A 4C4RA 4CLHA 1G6Q1 4RA9B 4U1RA 4BFVA 1ZK1A 1VRVA 4BKQA 5FAXA 1F2VA 1SEVA<