3QWHA

Crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus in complex with nadph and kaempferol
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
260
structure length
260
Chain Sequence
YIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of 17 beta-hydroxysteroid dehydrogenases by phytoestrogens: The case of fungal 17 beta-HSDcl.
pubmed doi rcsb
source organism Cochliobolus lunatus
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords 17beta-hydroxysteroid dehydrogenase
total genus 103
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qwhA00
2PFGA 4MJLA 3WGOA 3M1AA 3R3SA 1P0FA 1DXYA 1ZK0A 2UUOA 1YB1A 3ONEA 4IJKA 5DDIP 2IZZA 4JP3A 4GX0A 3S2IA 2C07A 2AG5A 3KYDA 1BXZA 4CMBA 5EQFA 3ITDA 3N58A 4PG4A 3RFVA 3PXXA 3U3XA 1NAIA 3WFIA 5FEUA 2C2YA 2I66A 3F4BA 2UUPA 4FIZA 3EUWA 5T64A 4A2CA 4IQ8A 4R1NA 5A05A 3VAZA 1NWCA 4GX1A 1M66A 1ENZA 3ZWCA 4FC6A 4C7KA 3DFUA 4JBGA 1X14A 2X9VA 4UEJA 3JQBA 1P0CA 3WSWA 4U6SA 3F3SA 1ZJYA 3CKYA 3VH2A 3WDSA 4RORA 1PR9A 3ADPA 1PZHA 3CTMA 3PFWO 4BO2A 2DUWA 4ALNA 1LQTA 3HFGA 1JKJA 3V2GA 4Z6KA 4OAQA 3K2EA 1YWGO 4GGPA 1XELA 4WCDA 4J4BA 5IZ4A 3R0IA 4J4HA 3S2FA 1LLUA 3VZSA 4CM6A 3H5AA 2E48A 3UUWA 1B8VA 4DPLA 3U62A 1YDEA 2D1YA 2BFOA 2DPHA 1I01A 1ZMTA 3L9WA 1LSJA 1U5CA 4J49A 5B4TA 2PV7A 4BKRA 8ADHA 1IL0A 2GZ3A 1U28A 3DL2A 3LDHA 1RM5A 1Z6ZA 5B1YA 3NUGA 1Z7BA 4IDGA 4MO2A 4Z9FA 4FJ1A 4IMRA 5LC1A 3AU9A 4HFJA 1Q7BA 1DRWA 3DZJA 5TS3A 3HFSA 2P9GA 4PIVA 3DBRA 4FB5A 2I3AA 1I32A 4UAGA 2WYUA 4UULA 4J0EA 1I30A 4W6ZA 3MJ4A 3UW3A 5KOIA 3C24A 4HBGA 3I9JA 1Q1NA 1MUUA 5AXBA 1BXKA 4YRBA 3GGOA 3WGGA 3INGA 2B37A 2QW8A 4XDZA 1Y7TA 4I5FA 1D8AA 5CG2A 2YY7A 1KVTA 1HWYA 1XLTA 3PK0A 5L3ZA 4FGSA 3UKOA 3W6ZA 3ZWNA 3ZWAA 4BV9A 3PDJA 5L4NA 3IS3A 4N7RA 4QQRA 5CAEA 4CMEA 3GA0A 4TROA 2Q1SA 5HS6A 3WICA 1LU9A 1M6WA 4Z0HO 3GEGA 5TNXA 3TFQA 3D4NA 1HXHA 4YAGA 2O3QA 1UR5A 1GL3A 1ZEMA 2NSDA 4GVLA 2AEMA 2WYVA 1F14A 4IJWA 1XHLA 4PZDA 2IODA 3O26A 4BNUA 2DKNA 4BQRA 1A7KA 3AFMA 3D64A 3I52A 3PJFA 4JROA 4MOWA 3GEMA 1TT5A 2C29D 4BKOA 1Y8QB 1BXGA 2QYSA 4LN1A 3QVXA 1FMCA 2DTEA 2GUGA 1VI2A 4YT5A 3D3WB 3OA0A 5I7SA 2Y1GA 1FK8A 4HNGA 4DYDA 1HF3A 1SZJG 3TOXA 4CM8B 5JAZA 1ISFA 3RUFA 4MVJP 2EXXA 2PR2A 3DC2A 2HJRA 1Y9EA 1MP0A 1VL0A 2NTVA 3S1LA 3IP3A 4X54A 2CVOA 3SJ7A 1A71A 3ETGA 3OQ6A 1W6UA 5IZCA 5JCXA 3ROQA 4BNFA 1YOVA 3GFBA 3OF2A 1GUFA 3CPSA 3X2EA 2X86A 3A06A 1E3JA 3HDJA 2HMWA 3VKUA 2RAFA 1I8TA 2I76A 1LDEA 2UV8A 4RPGA 4XJTA 4GQAA 4E32A 3GUYA 1R4NB 4CM7A 4GLOA 3O9ZA 4XA8A 1MV8A 1TVEA 4MVJD 2VRCA 5JPIA 1HDZA 1DIBA 5DNAA 4CLRA 3CH6A 3D4PA 3U9LA 3FWNA 4I1IA 4QO8A 1PJCA 3LT2A 3RFTA 1UXKA 3NYWA 2HAEA 4D3FA 1ZO8A 5IJZA 1EK5A 2F00A 1OC2A 1BMDA 2FMUA 4CMIB 2GCGA 2VHXA 2EP5A 2O7QA 1Z74A 3GRPA 4BMNA 3L6EA 4R69A 3AM5A 2AW5A 1FJHA 2O2SA 2O3RA 2RBEA 3GVPA 4WOJA 3TZKA 2EV9A 1H6BA 1PR3A 5TF4A 4AJPA 4B79A 1WZEA 4OKIA 1DC4A 4YAEA 2P9CA 1UZMA 2VRCD 3JQFC 3E9QA 2B69A 5GZ6A 3U0BA 1UH5A 4LCJA 3I9OA 4H3VA 1X1EA 4KP7A 5KVQA 4CM9D 3VPXA 3T7CA 1R4MB 2IZ0A 4EUEA 2HMUA 1QV7A 3BXXA 4OXYA 3MOIA 5A1TA 1QYVA 1SOWA 1LQUA 3TSCA 1DHTA 1WWKA 2W2KA 3QVWA 3GNSA 4NFYA 3WJAA 4ZN6A 3V5NA 2C0CA 1UAGA 3O4RA 3DZFA 3V2HA 1K5HA 1I5RA 4DIOA 4DYVA 3H65A 5JSFA 5ITVA 5CDSA 2ZTLA 2VOJA 5JMWA 1Y8RB 3HG7A 4J6FA 3QRWA 1E92A 1WMAA 4UEKA 1PGPA 1GU7A 3ZU3A 4CM9A 4YJGB 2W2LD 2R2GA 2PKQP 2GR9A 3KYBA 3RU9A 4NI5A 4DC0A 3N7UA 1YBVA 4JBHA 3SBOA 2G0TA 3BMNB 1ISJA 3F47A 3EVTA 2IXBA 1SCUA 1UZLA 1YDWA 3IJPA 4AG3A 3H9JA 4FR5A 5KIAA 4B7CA 3F6YA 3PWZA 3PI7A 1PIWA 3IAHA 4Q3EA 4R5HA 4QO7A 5K6AA 1JKFA 2PWZA 4LMPA 4KZPA 4YJHB 3M1LA 1QYDA 4IJUA 1BWSA 3BTUA 4IDBA 3M2TA 3JQ7A 2ZYAA 2HK7A 3SEFA 3AFNA 4NR0A 3E1KA 1YQXA 3K8ZA 3VZPA 1QKIA 1OBFO 3S2EA 2P5UA 3DBLA 4BNGA 3G1UA 2JFGA 5CFZA 3D3WA 5HTOA 3H3JA 1YRLA 4U8GA 3LF1A 3NDIA 3TL2A 5CEJA 5DZSA 5B12A 2VWGA 2C54A 3E03A 3NKLA 4UREA 1SNYA 3H9QA 1GPDG 5G0SA 3WQSB 4AJ2A 1A5ZA 2GN9A 3IP1A 4OMUA 3TJRA 1ADCA 1E3WA 1BHSA 1SMKA 3DOOA 5B4UA 4J1SA 4W82A 4DIBA 3K6JA 4DLAA 2PZJA 4GI2A 1SEPA 3TFOA 1HETA 4J3FA 5F1KA 1QORA 4GSLA 5F3RA 1LRJA 1RM4A 3RUHA 1ID1A 4CQLB 1UJMA 4XRGA 2EJWA 1GYRA 1Z75A 3CIFA 4IQ0A 3RC9A 3IKTA 5JCJA 4YWJA 4BNWA 1OAAA 3OFSA 4RDIA 2FOIA 1PSDA 3H9EO 4J9VA 1HTBA 2EERA 1K3TA 3MWEB 4WCFA 4XWYA 3ZV6A 4E33A 2GRAA 4CLOA 4TRMA 4I5DA 4Y6SA 3L4BC 4RPKA 1K6XA 3UFXA 1GQQA 3JD2A 2J8ZA 4JNKA 3OP4A 3A9WA 1LBEA 4RV9A 3F9IA 3P5SA 3AOGA 4UVGA 2VT3A 4RO0A 4DRYA 2XF8A 2W4QA 2QHXA 3VH1A 2BFAA 2B4QA 4DREA 2WDZA 1LLDA 2X9NA 4PLPA 4BHTA 3PDUA 1GAEO 3VPSA 1H2BA 3RVDA 2QRJA 3L0DA 4A0SA 4L75A 2DBRA 4N5MA 3WYEA 1I0ZA 3SC6A 3PEFA 2IEBA 1JQBA 1UDBA 3GVIA 4CV0A 3FNHA 4PLWA 3W1VA 1ENPA 4ZQEA 4CM8A 4XGKA 3ASUA 4MKXA 3WJ7A 1U8FO 5JW6A 1LXCA 2E49A 2HCTA 2ZKLA 1H2HA 2A35A 2ZTVA 3LK7A 4OSPA 4TWRA 3VKVA 4NQZA 1BDMA 1GEEA 1Z82A 3PPIA 5TRTA 4GWKA 1PTJA 3MWDB 1ZSNA 2FHSA 4EYEA 5KVVA 3G17A 1YJQA 3OIDA 3WQRA 3WWYA 4PRKA 4TQGA 3QY9A 4LSMA 4EBFA 5LDGA 4ND1A 5HWSA 1U8XX 1JKIA 5A3VA 3UCFA 4WASA 4BKUA 4CLXA 1I2BA 5DOVA 4RPJA 2P91A 1B0AA 3AI3A 2IRWA 4ND5A 4BS9A 4HFRA 4FS3A 1GV1A 4GVXA 3TZCA 1NQ5A 3I6IA 5JDIA 4IJVA 3UAGA 1IE3A 3PQDA 3RUEA 1R15A 2VTDA 3LC1O 3DBVO 2YHIA 2B5WA 3NJ8A 4WCFB 4UVIA 4PG6A 3KYCA 3OICA 1HDXA 5L51A 4D3SA 5BSFA 1J49A 2HUNA 5C3MA 3GN2A 3Q2IA 4WLEA 1L1FA 5KJFA 3E18A 4II3A 5FI5A 2VUUA 1NTOA 4N5NA 4QT0A 3U4IA 3Q9NA 1GZ4A 1QP8A 1ONPA 1NPYA 2UVDA 2GN8A 4QX6A 5K0ZA 4IXWA 3FCOA 5F1PA 4CQMA 5F5LA 3WSVA 1PQUA 2UDPA 2Y0CA 2ZCVA 3KLPX 2GZ1A 1D4FA 5HA5A 4EUFA 4ZHSA 1Y8QA 3F5QA 3OEWA 3EZYA 1Y1PA 4XQ9A 2Q4EA 4GBJA 3MOGA 1DAPA 1GTMA 1P9LA 2ZB7A 3BHMA 4Z3DA 5JC1A 3QHAA 1MG5A 4TRNA 3PHGA 1ZH8A 3OIGA 2Q1TA 3AW9A 2PZMA 2VWHA 1PJLA 4AJ1A 4FPXA 2VHZA 3VOSA 4ONEA 3QE3A 5L7TA 3V1YA 3VZRA 1I2ZA 1KEWA 1X7GA 1O6ZA 2B83A 3OSUA 3QWFA 3Q1LA 4RZHA 4FFOA 2XPCA 1VL8A 3N74A 4I5EA 5KJ6A 2O7SA 5JO0A 4OH1A 3U4CA 4QECA 2NUAA 3UCEA 3EK2A 1MX3A 4BL5A 1PL6A 2G17A 1RJWA 3PWKA 1CEQA 1ZXLA 2Z1NA 3ENNA 3H2ZA 4GAEA 4CLRB 1XQ6A 4CUJA 2B36A 1C0LA 4HUJA 1JAXA 5KVCA 1TA4A 1E77A 1HDYA 3NV9A 4M89A 4QSMA 3LQFA 3DHEA 1KC1A 4EEZA 2VNSA 1J0XO 3UVEA 4BQPA 1EVYA 3WOHA 4N18A 1OMOA 4UUNA 3SJUA 5KTKA 4HFNA 1C3VA 2EP7A 4I9UA 2JKVA 1VRWA 4A03A 3E5MA 2FR1A 1RYEA 3PQFA 4EI2A 2PGLA 5G4KB 1YBAA 5BT9A 4FFMA 4PRLA 3IKVA 2Z5LA 4E31A 1W4ZA 3I3OA 3AY3A 1H94A 3ANLA 3QWIA 1AHHA 1ADGA 4ND2A 5THQA 3QIVA 4ZJUA 4I9HA 3RJ5A 4BO1A 1WXDA 3QLJA 2X5JO 1DIAA 2Q49A 3AOEA 1HDCA 4IINA 1EFLA 2CVZA 3WFJA 3E9NA 3P2OA 5H82A 1CERA 3DHYA 4RVDA 1ADBA 1T25A 3ONFA 4I08A 4R01A 5COAA 2DTDA 2X5OA 1C1XA 1PS0A 1HZZA 1GQYA 3HQ4O 3WLEA 3OQ1A 4OL9A 1LC0A 3ZWXA 5JE8A 4NBUA 5DOZA 3KLMX 3W8FA 4RPHA 2RHCA 4TRJA 1IUKA 2A9FA 1PL8A 4OGWA 5A5EA 5L95A 1Y8RA 2GGSA 3RD5A 4IGFA 4PLHA 4GKBA 5EPOA 3VH3A 5FI3A 4E5MA 3FF4A 3CXRA 1B26A 1NHGA 4KTTE 4MIYA 5A5FA 5A9SA 3LC2O 4MVJE 3RUAA 2VHVA 1C14A 4L8VA 1F0YA 4E5YA 1NP3A 3QWHA 1GEGA 1WAMA 4BO4A 5IDXA 1NFRA 4BKPA 2VTEA 4MP3A 1BVUA 2VYND 2F1KA 4B4VA 5IDQA 3RIHA 5L9AA 2NACA 1B2LA 4J43A 1GV0A 3HADA 2QZ9A 3NRCA 1T2AA 4OXNA 4AJHA 4CM4A 4C4OA 1D1TA 2ZIZA 1GFSA 4HX5A 4O6VA 4BGUA 1ISGA 1HDRA 1DRVA 1T2FA 5DT9A 3JD0A 3WWZA 2XXJA 4P4NA 2EKQA 2HMTA 3WIEA 1P31A 2EF1A 4RPLA 3VPHA 4CM3A 2JFFA 3OBBA 1N9GA 4OOEA 4S1VA 3SX2A 4K28A 3JQ7B 1PWZA 5KVSA 3L6OO 1XCBA 3DHNA 2ZQZA 3DWFA 3BMQB 5TLSA 3JQAD 4IDCA 4IZHA 2RHRA 3V2UA 4U5QA 3RROA 4Q39A 2O4UX 4M55A 3VTFA 2NLOA 1U2GA 2D8AA 2HU2A 4MVJI 2O3JA 1U4SA 3QVSA 3F4LA 4NBTA 4NH4A 1D3AA 2JHGA 3UF0A 2FRDA 4CM1A 4ITUA 1JU9A 1HZJA 4J1TA 4JQCA 3HN2A 1Y81A 4U0JA 1VJ1A 1XYGA 5CDUA 3GN1A 3WX0A 4CUZA 4JGBA 3ZWPA 1U7TA 1UUFA 2JCXA 4WCFC 1EDOA 3C3XA 1YQDA 5IN4A 4TZKA 4MPDA 4P38A 2HJSA 4U0KA 4CQMD 4BO0A 1E6WA 3NT2A 2EGGA 2VT2A 2Y1DA 2OXIA 4D44A 1Z7EA 4AVYA 3AY7A 1DFGA 5DF1A 2Q45A 3TL3A 2B4TO 5LDHA 1BW9B 3JYQA 4OM8A 1ARZA 1YL6A 3Q3CA 1CQIA 3ZZNA 2OFPA 3ZHXA 4OOFA 4BB5A 1KIFA 1JVSA 1XKQA 1FDTA 2H63A 2JJYA 5BNIA 1PZEA 2VYNA 1EBUA 3AY6A 3QP9A 5EL0A 1C1DB 4XYEA 4JJGA 2BELA 1BVRA 3EZLA 3ITKA 4DA9A 4R54A 1B8PA 5ICSA 4FGWA 1UXIA 4E5PA 3HN7A 3NTQA 4XEHA 3NAQA 4DC1A 4Y9DA 3QV1A 4LSWA 3V1UA 4GWGA 2NU8A 3ZHBA 1O0SA 3I5MA 3RUCA 3WGIA 4HY3A 3DONA 3WYBA 1BSVA 5CPFA 4J91A 1N9GB 3EAGA 3BMCA 1MG0A 1I3NA 3K5PA 2R6JA 2Y05A 3PYLA 3IOYA 2I6TA 5JO9A 3ZWWA 5BR7A 4BGVA 5JYEA 2C5AA 3CINA 2FN7A 2DFDA 3U4HA 1EEHA 3GAFA 1HKUA 4BNZA 4R1SA 2BI8A 1E5QA 4XRRA 1CETA 4NJMA 5DBFA 3FHLA 1GYQA 4M8SA 4YJFB 5B4VA 4YAJA 1DDOA 1H6AA 2DC1A 5BQFA 3TWOA 3GQVA 3PLNA 1B8UA 3PHLA 3VVCA 3FBGA 4PLGA 1HE3A 2Y1CA 1E7MA 3JYNA 4GSKA 3OECA 4LRSB 2CFCA 2VWQA 4NFHA 3WB9A 1EE9A 2A94A 4F3YA 1YVEI 3Q11A 5A9SB 3K96A 4N54A 2OORA 3D0OA 4JIGA 3KETA 2Z1MA 5JAQA 5KJEA 3SLKA 1WDKA 4IDEA 1YB5A 4RLSA 5T6BA 1FDUA 2ZK7A 3DZHA 5DULA 1ZK4A 4DQXA 5DBIA 3I6QA 4E21A 5JDIC 1EMDA 1NVGA 2Q2VA 4OIMA 3RBXA 2RH8A 4NNJA 5EIOA 1DOHA 4I9NA 2D5CA 4MDHA 3JSAA 3DBLB 3JTMA 3GZNB 4BNTA 3G1TA 2YQ5A 4FC7A 5U9CA 3BMOB 2D2IA 3NX4A 1DSSG 3HDQA 2HSDA 5T5QA 1XEAA 1HSZA 4NPCA 5A3JA 3FR7A 2YV1A 3WNQA 1PGNA 5I8ZA 5JNLA 1NNUA 2P68A 1NQOA 4YJFA 1E3IA 2DTXA 2YV3A 4XIJA 3RWBA 4JK3A 2VYVA 4AJKA 1XIVA 1ULSA 4YT4A 1NR7A 4BO7A 2HDHA 4D42A 2AQKA 4KTVE 1E1LA 1PQPA 3WG9A 4RL6A 1EBFA 4RZIA 3OEYA 1OOEA 2VZ0A 2DU8A 3C85A 4J7XA 3VHRA 3WMXA 4TMFA 5LCXA 5G0TA 3GFGA 1U3TA 2JFHA 4NDNE 2FWMX 1X7HA 2GSDA 1WLYA 2V7PA 4Y98A 3GHHA 3ZGYA 4CMIA 1EVIA 4DMLA 1P1HA 4YACA 1NFQA 2VRBA 2VQ3A 2YYYA 3KYDB 4XYBA 5JFOA 1V35A 2XOXA 4QFDA 2PY6A 4AJIA 1PJ2A 3AJRA 1W8DA 3PIDA 1NPTO 4BNMA 3S55A 3ABIA 3KM0A 3L4BA 4YQYA 1ZSVA 2B5VA 2X1HA 1ZW1A 4XYLA 2A92A 2ZATA 1WDMA 3PVZA 1P1JA 3D3EA 2HQ1A 4L4RA 2ZCUA 4HV4A 1SBYA 2AEJA 2ZB8A 4RF3A 1EUZA 1MFPA 4H16A 1R16A 1PU2A 2CMDA 1XQ1A 2PTGA 3NGLA 5KKAA 2QIOA 1JN0A 2IXAA 3G49A 5ADHA 1AHIA 3ZU2A 3D7LA 4F45A 5T8KC 2HK9A 2O2YA 2OP0A 2C7GA 4MVJG 4ALKA 5IDWA 2ZTMA 3P19A 2QX7A 3HNPA 1EVJA 4FOOA 5TC4A 2E4AA 5A06A 2DBZA 4FFRA 4RVFA 4BOYA 2QG4A 2GN4A 3ZI0A 1LA2A 1U9JA 1Q0LA 1YJ8A 3JQ9A 3VDQA 4M54A 3M6IA 2AQ8A 1PJBA 3JQ8B 3JYLA 1E1MA 4PVCA 4BO3A 1DEHA 4LGVA 4CQMB 4XX0A 4W7IA 1LRKA 2V6BA 4YAKA 1M67A 5COBA 1TT7A 2GO1A 1N7HA 2ZJ1A 4M87A 5GMOA 1H93A 2PLAA 3TF5A 3MJVA 1IZ9A 1YL5A 4CLDA 3RAJA 4L4XA 4CV3A 5JCJD 5DCUA 2JAPA 3GZNA 3KV3O 4WEQA 4ZRNA 1VE9A 4CMJA 3LU1A 2PD4A 4YAIA 1IY8A 2GZ2A 2X0IA 3GDOA 2X23A 3OJOA 4J0FA 5IXYA 1B16A 3JQAA 2GASA 3BTOA 4II2A 1M76A 3HSKA 5T8KA 1RKXA 4NBRA 3ULKA 1F17A 4AICA 2X7HA 1P74A 4YEDA 4XKJA 4RVUA 2LDBA 2NWQA 1QLHA 2Q2WA 3W4IA 2Y99A 3RC1A 4ZVVA 4L74A 4UUPA 4B7UA 2DM6A 1F06A 1LDBA 5GY7A 4C7JA 4RCVA 4PLCA 2SCUA 1M75A 2YFHA 1RM3A 3GNQA 1MGOA 4KUGA 2UYYA 3UICA 2I5PO 1E1KA 3H5NA 3AU8A 2W2LA 3JD3A 3LF2A 2EGHA 4R9RA 4NG5A 3DZGA 3LLVA 4IIUA 2VNAA 4OQZA 1YOVB 1Q2XA 1LDNA 3KTDA 3E8XA 1H6DA 5A9RA 4BMVA 1RYDA 1DFHA 1XWFA 2CUKA 1NQAO 3C1AA 4FN4A 2POQX 2C20A 4TRRA 1E6EA 1FDSA 2WWRA 4MP8A 3PQEA 3ZWYA 4E30A 1VJTA 2BKAA 1DRUA 2EW8A 3OJLA 3A4VA 4DBZA 4U6QA 1NX6A 4MKRA 2FPGA 4G81A 2X0RA 4J4TA 3W4JA 4XB1A 4YTEA 2GERA 1YONA 2PD6A 4HXYA 4PN3A 2Y67A 5TX7A 1DIGA 3HDHA 1D1SA 1YL7A 1NR1A 5I7FA 1E3SA 1YE3A 3F1LA 1SAYA 5K9ZA 4PLZA 4PLTA 2BGLA 1LUAA 4PZEA 2G1UA 1FXSA 2OHXA 2BHLA 3DTTA 2J5KA 2VUTA 3SLGA 4NIMA 2DT5A 1KC3A 1MFZA 1R0SA 3ADOA 1GZ3A 2J3KA 3UCXA 1HEUA 2VHYA 2JCYA 1GUYA 1LLQA 3NDJA 5A02A 3KSDO 2J3JA 3JQFA 2B4RO 1I33A 3KB6A 1V9LA 1K89A 3LT1A 3PYMA 1CDOA 1DC5A 3RSHA 1KVRA 2WTBA 4KQXA 4NHEA 1XA0A 3Q0EA 3CUKA 3ZN2A 5IAAA 3WGZA 2AA3A 1Z45A 1P1RA 3JCZA 4YA6A 1XG5A 4DTIA 1T24A 4TKMA 4NZ9A 4EGFA 3COSA 3GOHA 5TIIA 1O8CA 1XU9A 3IJRA 2EJVA 4B4OA 1HE5A 4W9NA 5KCZA 3FSRA 3IC5A 3JQ8A 3JD1A 1PJ4A 3AI1A 3OMLA 2X6TA 2GD1O 2O50A 1BXGB 2XXBA 1MA0A 3ENKA 3GG2A 1Q0HA 2Y66A 3DZKA 2E37A 1ZK2A 1XR3A 2FSSA 4L76A 5HRUA 4K6CA 4RLHA 4MIEA 1FDVA 4BGEA 4GGOA 4KWHA 4TSKA 1SB8A 1YQGA 2YDXA 1NVTA 3IDSA 4DLBA 1J4AA 4ZRMA 2NTJA 1GY8A 4CR8A 3RASA 5DCYA 3KO8A 2NNLD 5L4SA 4IM7A 4KOAA 4R1UA 2E82A 1XU7A 3KOUA 4UVEA 1P44A 1XGKA 1LI4A 3LC7O 4FBGA 3Q9UA 4JCOA 1V8BA 1PQWA 2J3HA 3E48A 3OA2A 3L07A 2QRKA 4J7UA 3KYCB 4G65A 1J5PA 4XD2A 3RI3A 1NPDA 3WLFA 4BGIA 5J23A 1PJSA 3HJAA 3V1TC 4PGFA 4D46A 2ZTUA 4YRDA 4DVJA 3GGPA 1JWAB 2QRLA 4YPOA 3ZWBA 3PGJA 1U5AA 4CM5A 3B1KA 3WXBA 3HDYA 1MXFA 4BNNA 4NBVA 4A73A 2VOEA 4CMEC 1EUCA 3OJ0A 1UAYA 4XR4A 1BRMA 2JL1A 5ES3A 1JA9A 4TVBA 4IXTA 4BO6A 3WS7A 5C7IO 1TI7A 4E0BA 5I9NA 1E7WA 2BLLA 2Y68A 1ZEJA 1G6KA 4AJJA 4EZBA 4O1MA 2C5EA 1KBZA 1W73A 3JQEA 4AJLA 1A9ZA 1EVZA 1M2WA 1X15A 3C8MA 1E3LA 1K2WA 1N1GA 1PGOA 5COQA 2ZB3A 3VTZA 3KXDA 1E7SA 2X22A 4PLFA 5G0WA 2I65A 4GMFA 3KHUA 4IDFA 3W8EA 1G1AA 3UN1A 1T4DA 3EC7A 4D3DA 1K0UA 1GQ2A 2BH9A 5IF3A 1RWBA 1UZNA 2DQ4A 2H6EA 4N5LA 1GCOA 4CODB 5EN4A 5I7EA 3FWZA 1NWHA 1X1TA 4LVUA 5FWNA 2G76A 3GDFA 3X2FA 4JJFA 1A7AA 3FI9A 1WNTA 1NFFA 1HLPA 2TMGA 4R16A 1LSSA 1YO6A 3QVOA 1UDCA 2C59A 4BIIA 3ZDFA 3P2YA 1KYQA 5U1PA 3WIDA 1AUPA 2PKQO 5ENDA 4J9UE 1ZBQA 4E6PA 3GMSA 1VSUA 3BHJA 3DZIA 4H15A 2JAHA 4NJOA 4ZQGA 4YB8A 3SC4A 3IUPA 1PGJA 1UXJA 4BNYA 1A4UA 4P8RA 3F5SA 4HWKA 3ZW8A 4YBZA 3ON5A 4S3MA 4CMKA 1CJCA 4JJIA 3TPCA 1PWXA 4O59O 2PZKA 3DAGA 3OIFA 4PG5A 4CL8A 2J3IA 3HZZA 2HKIA 4J2HA 4D41A 4J7CA 3R3JA 1R0KA 3FNGA 4CQLA 5H83A 4Z3KA 2CD9A 1R4NA 4BO8A 1MC5A 1LDYA 4RF4A 1ZK1A 1E5LA 2Y1FA 1IB6A 4IS3A 4B4UA 1AN9A 3I1JA 1P33A 2X58A 2E6UX 2GPTA 1WW8A 2AEFA 4DQVA 3U5TA 5EJ2A 3K92A 1AXEA 4B3HA 5L7YA 5BSEA 5GZ1A 3H8VA 1AXGA 2YZ7A 3G79A 1I3MA 5CG1A 4R4JA 2NTNA 2I67A 2ILTA 2WD8A 2V6FA 1YXMA 5JLAA 1Y9AA 1QRRA 3GHYA 2VZ8A 1UXHA 1VM6A 4XZ3A 2OGUA 1X7DA 4EJ6A 3CSDA 2WEKA 3NEPX 3AUUA 5AVOA 5FYDA 3RC2A 1BG6A 4WJZA 2PH5A 3JQGA 3GVXA 1SC6A 4WPGA 4B7XA 2BRUA 5CDTA 4WKGA 1XSEA 5CDGA 4FJ0A 1X13A 1J6UA 2OL4A 3QW2A 1OFGA 5AXCA 4K26A 3VPFA 4E2WA 3B20A 1H6CA 2UAGA 3PTZA 2NVBA 1MB4A 2OP1A 4XGNA 4BNXA 3DAPA 5FF9A 4MIOA 4YR9A 3TRIA 5C37A 3TZHA 3A1NA 5JMPA 4NU5A 1P1KA 2P5YA 1UDAA 5KJ1A 3DBHA 3FNFA 3KBOA 5IZCC 1U7HA 2DUUA 1QYXA 4KMSA 4GPD1 2YJZA 1H9BA 2Q1UA 3ZHYA 4R3NA 4B8ZA 4YDRA 4CMAA 3FTPA 3TOZA 3FPLA 1ZVMA 2V6GA 1ISIA 3O03A 4LISA 3P7MA 2OBYA 3FPCA 1N8KA 5ILGA 4GL4A 5KJCA 4PZCA 6ADHA 4EUHA 5HS4A 2EKLA 3WMWA 3OJFA 4OHUA 1WVGA 1DIRA 2HO5A 3MJTA 3L4SO 2D0IA 3STHA 3DO5A 2RIRA 2Y0EA 4U7WA 1C0KA 2GLXA 3JQCA 4O63O 4Q9NA 3KUXA 2Y0DA 1KEPA 3K30A 3ZNNA 4FFLA 1MXHA 1PZGA 4RF5A 5THKA 5KKCA 4B3JA 3ETEA 3BTSA 3GT0A 4FJ2A 3ZV5A 2I3GA 3ORFA 2O4CA 3FD8A 1LTHR 3W8DA 3LVFO 4J90A 4ZD6A 2BFMA 1P45A 1ENYA 3DOJA 4ALJA 1KS9A 1E0DA 4LW8A 4W7HA 3R1IA 1EDZA 3B6ZA 4NK4A 4Q3CA 5A4DA 1AGNA 1HT0A 5JY1A 2IYOA 4EEXA 1PS9A 2VN8A 1ISMA 2NADA 1VKNA 2W2KB 3DOCA 4ZQBA 4AJNA 4B3IA 3RU7A 1B3BA 1N92A 2I9PA 4R9SA 5I9MA 3RC7A 3ICCA 1VSVA 5IFLA 3I9NA 3NJ4A 5ER6A 4WK6A 4CJXA 2IZ1A 3H5RA 5CP8A 5IDYA 4E2YA 1PJ3A 4QEDA 5JAMA 1ZIDA 5BNFA 4BV8A 2O3UA 1VPDA 4KDEA 1HDOA 2EIHA 3L9XA 4W9NC 4YT8A 4ZICA 9LDTA 1W0CA 5ENVA 2PA3A 3T7EA 1NAHA 5K6AC 3H9GA 4NK5A 3DQPA 1UXGA 3NTRA 3DEYX 1UP7A 2NU6A 4PFJA 4QFCA 4RQUA 4B8WA 1K6JA 2QQ5A 4Z0PA 1VKOA 3MCVA 3JQGB 3JQ6A 3GAZA 1EQ2A 4DQUA 4F46A 2NVUA 4L4SA 2CDBA 4DPKA 2AMFA 2FP4A 4BO5A 3BAZA 2NV6A 5ICMA 4RF2A 3PFFA 2WD7A 4W4TA 1UP4A 1LX6A 1T1RA 4Y8VA 3I9LA 4GX5A 5JY6A 2CDAA 4JBIA 4OYRA 1QXSA 4YCAA 1KEVA 1NYTA 3PGXA 2NM0A 4BUCA 3ZU4A 2EEZA 4DMMA 1FDWA 1GCUA 4W99A 3WNVA 2ZB4A 1ZSYA 1GADO 2DBQA 3WBFA 1EE2A 4CL3A 1R4MA 1PEDA 4Y6PA 3C1TA 3OHSX 2CF6A 1T1SA 5I8WA 3MJEA 5CHEA 3QVTA 2W98A 1ZXBA 5DBGA 3FTNA 5G0UA 4R5MA 1IPEA 1V3TA 5G0VA 4K6FA 4YJDA 3EYWA 2J5RA 2Y1EA 4KQWA 1ZZEA 3GH3A 2BF7A 2EHDA 3L77A 3VDRA 5C7OO 3DR3A 3PZRA 5CDYA 2BI7A 4R68A 1HYEA 2X9GA 3GDGA 3HUDA 4IBOA 4OSOA 1PGQA 2GF2A 1ONOA 4OO3A 2Q3EA 2PNFA 3VVBA 5DP2A 3I4FA 3CE6A 4TVOA 2R00A 3BZUA 3HE3A 4FOSA 3AWDA 4CM4B 1P1IA 2DBVO 3ST7A 1NXQA 3DZBA 9LDBA 2AQIA 2ZYGA 3RCBA 1DAOA 2J6IA 3OH8A 4D7AA 4DGSA 4IY1A 4O5OA 2AXQA 1DJNA 3ETDA 2B0JA 4RJTA 1LEHA 2P4HX 2D59A 2DLDA 2R00C 1M6HA 2QZZA 4AJ4A 1NQTA 3WR5A 3WTBA 1XDWA 1MC4A 5DCWA 4P4GA 4YT2A 2HMSA 5L45A 4YJGA 1KETA 2ZYDA 4E12A 3CZMA 5A04A 1TEHA 1PJTA 4RGBA 3ZV3A 4GX2A 1GZ6A 2H1SA 1NVMB 5T57A 3UXYA 1QMGA 3AUSA 4IS2A 4ZU3A 3UH1A 4CV1A 1TB4A 1GYPA 4K9DA 1R12A 4E2ZA 5JBIA 3GGGA 1LSOA 3PJDA 1DO8A 1HRDA 1QG6A 4HNHA 1ZNQO 1ZMOA 3WGYA 1DIHA 1HE2A 2FPPA 3ZWMA 1TLTA 4D79A 3AK4A 2FPIA 3H9UA 4CUKA 2PKRA 4MVJH 3M2PA 3GEDA 4MVJF 4XYMA 3S2GA 1T4BA 4XR9A 5FFFA 4IDAA 3GRKA 1E7YA 7MDHA 4HADA 4GH5A 4UEOA 1HDGO 3VH4A 3ONDA 5L7WA 3FR8A 2Y93A 3C1OA 1DBVO 1G0NA 5F1OA 1I10A 1BDBA 3DB2A 4XYGA 4ZGWA 2IE0A 2PH3A 1GR0A 1L7EA 3I23A 5GZ3A 5JDCA 3EMKA 5DP1A 5CEFA 1D7OA 1KY5A 1U3VA 3I9KA 1EQUA 4IDDA 1TXGA 3KVOA 4Q3DA 3JD4A 1DC3A 1P3DA 3RUIA 4I5GA 3K73O 1VL6A 4H7PA 4XGIA 4A5OA 2OOSA 2YUTA 2Q1WA 3ROMA 1KEUA 1X0VA 4NBWA 2YDYA 5IN5A 4IMPA 1Y5MA 4OQYA 4D0SA 4BB6A 4PLVA 3RQSA 3ZWVA 2DPGA 2VZ9A 3I4CA 3BHIA 2XAAA 4E2XA 3QA9A 4E5KA 4JX8A 1RPNA 3ROPA 1RM0A 3ZCXA 1WZIA 5EMHA 3HHPA 3PP8A 1E7RA 3U4DA 4WE3A 4UVHA 3RFXA 1QV6A 1KOLA 2IYPA 3ZNPA 2X8LA 2GYYA 1L7DA 2BFPA 4Q3NA 5TSDA 3FBTA 4ND4A 2HRZA 3L6DA 3H7AA 3U09A 4Z9YA 2OBNA 4LK3A 3WGQA 1C1XB 2VYVD 3LYLA 1A27A 3F1KA 3CEAA 2WSBA 3ZNQA 3T4XA 1EZ4A 1YS4A 3PZBA 4INAA 3JQBC 2OO5A 4B4WA 1T2CA 2VCYA 1YH3A 4J1NA 4QUKA 4KDFA 1C1DA 1JDJA 1ZFNA 2O48X 4WLNA 1H0KA 3SXPA 4YRAA 4QTZA 1U1IA 2IDZA 1DC6A 4MVJM 1IHXA 5JS6A 3UOGA 1U3UA 3GF4A 1R66A 3MEQA 5I9LA 1LLCA 2ET6A 2YV2A 4XQCA 3ROKA 2IEDA 5EERA 3PIIA 4M86A 2CSUA 1GUZA 4ND3A 2W90A 2JHFA 2NVUB 4KUEA 4FDAA 1ML3A 4XJSA 4J2OA 4BKQA 4YXFA 4EJMA 5BSHA 1PL7A 3WGHA 2BGMA 3OJEA 1SO8A 4ALMA 3TN7A 4I8XA 1O9BA 3CMCO 4AJEA 5C5IA 1Y6JA 1YKFA 3TZ6A 3OETA 1X0XA 4L73A 1N7GA 3NTOA 1ISHA 2LDXA 3DBRB 3EY4A 2JD1A 4CLEA 4DUPA 4ID9A 3B1JA 2Z95A 3DXFA 2B35A 3PLRA 5EINA 1CF2O 4XIYA 3QWAA 4FQ8A 4TZTA 2ZJ0A 2HK8A 2I99A 3JQAB 2WE8A 5F5NA 3H2SA 3SVTA 2C7VA 2NVWA 3HB4X 4QXMA 3DMTC 3KEOA 1O94A 3QSGA 2EG9A 3LLSA 3WYCA 2P9EA 1B14A 4LRTB 1QLJA 1SB9A 3H3FA 5G4KA 1T26A 3I83A 4R1TA 1NHWA 2EW2A 4WNIA 3INTA 3U49A 3ZHZA 3NDRA 2FSVA 3NT4A 2VHWA 5EESA 1I24A 3WQQA 5TJHA 4E5NA 1CWUA 4XCVA 1E6UA 2YQ4A 5IG2A 3F46A 3QJ5A 3GVHA 5BSGA 5KNLA 2O3SA 1OZAA 3AM3A 3PJEA 2DFVA 4FSHA 1PZFA 1PS8A 4FW8A 4WGGA 3C7DB 3ANMA 4WLOA 1V3VA 2NQ8A 2BMAA 1U3WA 5HM8A 4BVAA 1KVUA 1DPGA 3BA1A 1BW9A 4E4YA 3GPIA 1SEVA 4E3ZA 4P22A 1N2SA 3RBZA 4CLOB 3PHJA 3ZH2A 1EK6A 2Y1OA 4ALIA 2NQTA 2EKPA 3GLQA 4NU6A 1CYDA 3RJ9A 1R0LA 2X4GA 4EDFA 2YHIB 2G5CA 3WTCA 3PHHA 1DB3A 5TGDA 1C0IA 4ALLA 1GD1O 4PLYA 4EW6A 1Y5RA 4BNJA 4AJOA 2OMEA 2O3TA 3D5TA 4WLVA 2W8ZA 1WDLA 3KEQA 3TDKA 1BGVA 1IULA 3OQBA 4WECA 1ZJZA 1ZK3A 1I3KA 2CVQA 3E9MA 4YYZA 1TT5B 1T2EA 2Q2QA 3JYOA 5MGBA 5C7LO 5AYVA 1Z73A 1NBOA 1I2CA 2D3TA 1A9YA 2CF5A 3DAFA 1K6IA 1ZKMA 2NU9A 5DN9A 5AXAA 5EQDA 2AHRA 3GVCA 4BO9A 3ZW9A 3MTJA 5AOVA 3INRA 1ULUA 4M1QA 3A14A 1ORRA 1R37A 5L40A 2C2XA 3ANNA 4PVDA 3AM4A 3CZRA 2VWPA 4KWIA 1KY4A 3IIEA 4IZIA 4Y6RA 4A10A 3K2BA 4A7PA 2FZEA 4CR6A 4PCVA 3W4KA 4LCEA 4CPDA 4E13A 3PJGA 3IL2A 4XB2A 3I9MA 1DLJA 3LT4A 2O23A 4DXHA 3ZV4A 5TQVA 3C7AA 1PJQA 3KSZO 4IQGA 4D45A 3QQPA 4K1LA 3ZU5A 4PG8A 1DHRA 2BD0A 2WM3A 4R41A 2PZLA 4Z9XA 3WBBA 5CEEA 2AG8A 3E5RA 2H9IA 2JD0A 1OC4A 3IUSA 3RKRA 4MVJA 1QYWA 4WOKA 1PX0A 1I3LA 2WYWA 1IHYA 4J16A 4A26A 1EFKA 4ZQHA 2OUIA 3TQHA 2YW9A 3MTGA 3E6AA 3VZQA 5JXWA 4CMHA 1P77A 1KVQA 5G4LA 4DWVA 2HMVA 4XQGA 1CIVA 3DMTA 1E3WB 4WEOA 1LC3A 1ADFA 2FR0A 4NFSA 1I36A 3AI2A 3B70A 4RVHA 4CMCA 1S6YA 1LNQA 2BGKA 2FY8A 1A4IA 3D4OA 3WGTA 4BNHA 4F6CA 4WLFA 4GKVA 2P2SA 1Q0QA 2Q46A 5A03A 3TZQA 3PWSA 1O89A 2AE2A 1HLDA 4L0QA 3W6UA 5JYDA 2CZCA 1YGYA 3CMMA 4Z0TA 3MJSA 2PGJA 3BMCB 7ADHA 4BNIA 3DDNA 4DLLA 1WMBA 3GZ4A 1HSOA 1LDGA 3KZVA 3BTVA 3TNLA 5H81A 5ITWA 4NJMB 1LSUA 2HLPA 3PHIA 4UUOA 4OKNA 3G3EA 3JYPA 4R3WA 4UUMA 4Q3AA 2AE1A 4FFNA 3KRTA 1HE4A 1U2DA 5B37A 2CDCA 2CY0A 2WE7A 3BMOA 4HFMA 4PG7A 4URFA 3A28A 8LDHA 4G2NA 5MDHA 4EITA 4KUHA 1N1EA 3LZ6A 4D0RA 3ZNOA 4MKZA 1NM5A 3K9QO 3EVNA 1H5QA 3QWBA 3RKUA 1JTVA 3EHEA 4J1QA 3UGKA 2Q99A 2V65A 2WD7B 4O0LA 1CRWG 2D5AA 3FRJA 6LDHA 2G82A 2V6MA 4GLLA 4IGEA 1HYHA 1KVSA 4MP6A 1B3RA 3EDMA 2X0NA 1JWBB 3VC7A 4DPMA 1WP4A 4UVDA 3GPDG 3JV7A 1WPQA 4L9RA 1H9AA 5JDCC 4P4LA 3JQ9C 3AUTA 5I7VA 2GNAA 3GMDA 1B15A 1JVBA 1N5DA 3MZ0A 4WUVA 5A9TA 3RUDA 4CMGA 1U4OA 1VC2A 4DL9A 1E7QA 2FZWA 3GNTA 4IIVA 4RVGA 2J5QA 2OZPA 1O95A 3OM9A 1F8FA 1R6DA 2H5LA 1F8GA 1IOLA 4JLWA 3DBHB 5G2OA 1BTOA 4RDHA 4YVFA 1HYGA 1UP6A 5ER9A 4BMSA 4ESOA 3LT0A 3E82A 3RBVA 3JQDA 3K31A 3O8QA 2Q50A 3GK3A 4CV2A 1QR6A 1JW9B 3HWRA 4HKTA 4LMRA 4RQTA 4ZQFA 4A27A 3IQDB 4M49A 4CLHA 3Q6IA 3FNEA 3EW7A 4OJNA 2FR8A 2GN6A 1S7CA 2PD3A 4XQEA 5HBRA 3BYZA 3KSUA 2GDZA 3VPGA 2AQHA 4JXKA 1G0OA 1VLLA 3D1LA 1IYZA 1MLDA 1P1FA 5ILOA 2DVMA 4YJHA 3B1FA 5KWEA 1NASA 2X0JA 2YHUA 1IPFA 3H6KA 3PRJA 5TT0A 4F6LA 1LRLA 3ASVA 3UHAA 1T2DA 4D43A 1FF9A 4HP8A 4YQZA 3FN4A 4FCCA 3D5QA 1YB4A 4WLUA 3DFZA 4EJ0A 4ZA2A 1ENOA 1GPJA 1E1NA 4WNCA 1CQJA 3BMNA 4JP2A 1ONNA 4BNKA 3R6DA 1QYCA 4MINA 3ZWOA 1GDHA 1B7GO 1OI7A 1ZUD1 2EWMA 5TJ9A 2DAPA 4OXKA 3NGXA 3AUAA 1F12A 5IXSA 3O8QB 4Q3BA 5L53A 1Q7CA 3AOEC 1HL3A 4FD3A 3HB5X 2RCYA 3EGOA 2C82A 4DIFA 1DFIA 4Y67A 1SOVA 1ZCJA 3DTYA 3V8BA 1SPXA 5AXDA 2TMDA 1V0JA 2HRBA 2PK3A 3H4VA 2D4AA 1VJ0A 3C7CB 4IPTA 1E3EA 1KERA 1QSGA 4ROSA 3GY0A 1EUDA 2QYTA 4GMGA 1JAYA 4IUYA 1LDMA 1A72A 2WJPA 2Q4BA 4JN6B 1Q7GA 3GUCA 2A4KA 2YFQA 3MJCA 5JC8A 5F21A 1LJ8A 3ICPA 4XDYA 3IMFA 4ILKA 3LSYA 2WMDA 2P4QA 4BNVA 2ZQYA 4LVCA 4RVSA 4FFPA 2CNBA 4R51A 5TT1A 1V3UA 3PYXA 3BMQA 5CPBA 1DLIA 1AE1A 2JCVA 4TKLA 3Q2KA 4DBVO 3GG9A 2PGDA 3NT5A 3T4EA 5L4LA 1JLLA 3DMYA 5T67A 2JD2A 3G0OA 5U4QA 2X5KO 5AQ1A 4BNLA 4CR7A 2RH4A 5JAIA 3BIOA 1C0PA 1IZ0A 4AFNA 4G5HA 3GC6A 1V6AA 1O5IA 2NU7A 3GR6A 3O38A 1YBMA 4NMHA 2VUSA 1DJQA 3S8MA 4AL4A 5BNTA
chains in the Genus database with same CATH superfamily
1NDQA 4JZKA 4JQYA 4DR3B 2OAQ1 3EVEA 1P0FA 3TTUA 2XCQA 2FQYA 2YBEA 1MVLA 2NUTA 5DDIP 3UJ8A 1A88A 1H2XA 2GJSA 2WV7A 3EMBA 3I1YA 1I7QB 4GX0A 2VJPA 3BRWA 2O8CB 1BXZA 5IKEA 5C81A 5BN3B 3ITDA 3MWJA 5DYNA 4BX2A 1BE1A 1O03A 3UMVA 1J70A 5WRFA 2YZNA 1ABFA 1XCJA 1X39A 3F4BA 2NO9A 5DM2A 4DQLA 4FIZA 3DO8A 1UPUA 3PDIA 4B32A 5A2GA 2HW8A 2PUFA 3T8YA 1OIVA 1OWPA 5A7FA 3VAZA 4PQRA 1PVVA 3SHTA 2O8CA 2H4HA 3FHOA 5B3KA 4AW9A 1OT5A 1X14A 3LX5A 4PAQA 5JNVA 2VI5A 1XJCA 3FVWA 3F71A 1N7IA 2JW5A 3QKSB 4MA4A 5FTMA 3CKYA 4AO8A 2Z9BA 4C2AA 2FDRA 3OJXA 3AGPA 1K92A 1Q6YA 1Z4LA 1PR9A 4PYLA 5JQGA 1PZHA 2DUWA 3Q7TA 3SFTA 1MTZA 4CKWA 1X87A 2NMVA 4IDQA 4Z6KA 4G0OA 1MGPA 3SLRA 4BBJA 1D2AA 1OBOA 4KIUA 4GGPA 2P9YA 1WUTA 2PEZA 4M21A 2CNWD 3VNRA 4QC2A 2C9YA 3W9BA 3CF6R 4F06A 5UKDA 5EC8A 3VZSA 1Z0UA 1YMUA 3H5AA 3FCXA 5EG5A 2OGWA 3HUUA 4YQFA 5IARA 3H05A 2GQ0A 4RY0A 4JC5A 3U62A 4MV9A 2HMAA 3LKZA 3TLXA 4DDHA 1A2BA 2DPHA 4H6XA 1I01A 2OHHA 1T5OA 3T9CA 4D57A 2XKBA 1CV2A 3PUIA 3LDFA 4IRMA 4ZDIA 2V54A 1TVKB 3DR5A 3MIIA 1K4YA 1RPAA 1Y48E 2CXTA 3JWEA 4Y1RA 2NXEA 4HD8A 8ADHA 5IRCD 2ZWAA 1K3UB 4EZIA 1XVUA 3DL2A 4JYPA 1RRKA 4MO2A 3QSYA 1QDEA 5J4YA 1LB1B 1WZNA 2ZRCA 4IMRA 2P9BA 4L4UA 3AU9A 4X9XA 5LC1A 3UXHA 1Q7BA 1QFXA 3AESA 1P6XA 1ZICA 3D6TB 2P9GA 2V0GA 3HABA 1XE3A 1AF4A 3KVRA 4ZT7A 3F5DA 3B38A 3LW7A 3NHBA 4LTDA 3UAZA 3I09A 2NIPA 4FB5A 3NHJA 1UINA 3HNRA 4UULA 2C9BA 5AK0A 1I30A 1GNPA 3A3KA 2WF8A 4HQNA 4OLHA 2KLBA 4X1YB 3UW3A 1Q1NA 3QX8A 2AFIA 2XOKD 4LDPA 4YRBA 3A6PC 3WGGA 3ZIAD 4DNQA 2B37A 2HREA 4XDZA 4F4UA 2SECE 2VQSA 2XRZA 1D8AA 1ODIA 2PIAA 1KVTA 2YY7A 4X1IA 5TS2A 4FGSA 4DRXB 5LU9A 4AG6A 3PDJA 3IS3A 3MWYW 3OURA 5E1BA 3KVVA 4QQRA 4D80A 3OQIA 1KQPA 3KIPA 2O05A 3J80A 3FMGA 1YVRA 4Q7KA 3IAS6 4HB0A 3CH7A 5CT9A 3WICA 3T5MA 3GEGA 4LRXA 4V0NA 4YXWD 2RSLA 4TV8B 2YTZA 2CNKA 4Y9UA 1NJ1A 2E4YA 4KO4S 1JXOA 1X7ZA 2GZMA 2O3QA 4XLZA 1UR5A 5ED4A 1JKXA 2VJDA 2C3OA 2FLKA 1KZ1A 2VUHB 2W6ZA 3DFFA 4Q00A 5EEGA 1KO7A 1IG3A 1XHLA 1ZL0A 4IJWA 4RK0A 1YRYE 2IODA 4G0PA 1XTZA 4BNUA 1E2NA 4C5AA 4YWHA 4DIDA 3KZCA 4D0GA 1WBDA 4MOWA 4KXYA 2XZOA 1JDPA 1TT5A 1TCUA 3HY4A 1NMYA 1WPRA 1P61B 3T7TA 1J9GA 2PX0A 1XD2A 2VJCA 1FDOA 3KPWA 2DTEA 2GUGA 1T8SA 4KI0A 2G5TA 3QFCA 1FK8A 2WW8A 1TD9A 1TPZA 1HF3A 1A82A 3SK0A 1M2VA 1TC1A 4NZOA 4I6JA 1D5CA 2PR2A 3DC2A 3EGDB 1EVQA 4TQUS 4CMJA 4L7QA 2QS9A 4WN3A 5DH9A 3M4ZA 4QELA 2AJ8A 1VL0A 3VDXA 3BE5A 4X54A 4RJJA 5AK5A 1SVUA 1QOZA 1ODKA 4YCDA 3ZTYA 5DISB 2X6QA 1XXLA 1SCIA 3ETGA 1TO2E 5AM2A 4QUAA 1JG4A 1ULBA 2PBZA 5I7OA 1E5XA 3ELBA 1QCYA 3FPGA 4MGZR 3HB0A 3OF2A 3X2EA 3H87A 2X86A 2BUBA 5ADWA 4IG9A 3B3JA 3FGOA 5ARCA 1CUZA 1EFRD 4MLPA 4O08A 5EVCA 3VKUA 3DXZA 2Q5OA 2J9FB 2XIQA 1N6OA 2I76A 3GIDA 1E69A 1KO1A 2JI9A 3CWCA 4HUQB 4JB0A 4NQRA 4XJTA 2ZM5A 4ZZ3A 3UJPA 3CVVA 4GLOA 2IKSA 1H1TA 4FYPA 5BYBA 4TTIA 2LTAA 1TVEA 1PDOA 5JPIA 3FXAA 2GVDC 5DNAA 4E1AA 2REQB 3CH6A 1BCSB 2ZWIA 4HI0E 3U9LA 3FWNA 4JU9A 4CLRA 4LNAA 5CLLA 4GYKA 2OYRA 4LJRA 5ALJA 3HB7A 1NI4B 4ZQCB 4GOKA 5IJZA 3VYRB 2V58A 3Q9SA 4XVUA 3EG9B 2GCGA 5KQGA 2EP5A 3TG8A 3GRPA 3WLAA 3OQOA 3CPEA 1AQJA 3FZGA 2AW5A 1A1SA 2W2QA 5K4HA 1JVNA 4IP0A 4REOA 4WOJA 3G2IA 3GT7A 5B2EA 4KPUB 4TMWA 3O1LA 1DDGA 3PF8A 2JFQA 2RH9B 5FJJA 4OKIA 2VC2B 3MB5A 5HJEA 2ZIWB 4O3MA 1DC4A 2D7JA 3E27A 1DG1G 3F96A 1PDVA 4C4YA 4CTJA 4K2HA 3DOEA 2UYOA 1DWOA 4JL6A 2H29A 2JIOA 1LPNA 4GKAA 3W6PA 4H3VA 2XWQA 2JI6A 2BM8A 4F60A 5IVPA 5DRYA 4KP7A 4EW1A 4CM9D 3AVXA 2HRDA 3FYSA 4EUEA 5DB4A 1CK4A 2HXSA 1QV7A 1R8QA 3MOIA 1AS0A 3PD0A 1SOWA 3O95A 3D02A 6GPBA 2L82A 2W2KA 5BQPA 2K6GA 3QVWA 4HDOB 4B6PA 4C4PA 1D4OA 4LZNA 2ZI7A 1GGVA 1ZN9A 3HU3A 4ZN6A 4KPEC 3V5NA 3NNNA 3QPBA 1Q92A 2QQEA 3FLAA 3TS1A 1UAGA 3WMFA 4M22A 2BC9A 3WYFA 1LNZA 3DZFA 4FZ5A 4LBZA 1QUFA 5JLJA 4I1RA 3QBEA 2VA8A 3NC4A 3OU7A 2ZTLA 4NC9A 5NULA 2RGCA 3W04A 4Q7LA 421PA 2OHVA 3QRWA 5EIAA 1XMOB 3K1AB 1EUCB 3D3QA 3KUCA 3EVAA 1ISSA 2AOWA 4UBLA 2BISA 3QBVA 3NRJA 3VA7A 1M6NA 1WL8A 2C5SA 1JHDA 2RBKA 4R2LA 4C04A 5A5GA 2O8DA 1PSZA 1ZL2A 2GPJA 1UJ4A 1JMVA 3EVTA 3F47A 3FAKA 4HC4A 2IXBA 4JD5A 4BNDB 4Q48A 2DETA 2ZJ4A 1UZLA 3KALA 1POWA 3KQNA 3K2QA 1ZI8A 2KPOA 4FR5A 3IBFA 4L8FA 5ALZA 5AWFC 4B40A 2JGMA 4Q1VA 1L8AA 5K6AA 2FMFA 1JKFA 1FSSA 2PWZA 1SURA 4BFYA 4BFTA 4X1KB 3ZR4B 1F48A 4LMPA 4FGJA 3BCRA 1K75A 2AUNA 4ZIRA 1QYDA 2CFSA 4JYBA 1BWSA 1VCOA 3O8OA 3BTUA 1RC0A 2OXTA 3S0JA 2IUTA 4OBXA 3QW4B 4MR8B 4R8KA 1GGEA 3J7AC 3G9ZA 2HK7A 4DCOA 2BKLA 3ONWA 4NV3A 4QJIA 4NR0A 1KJQA 4LHXA 4C2TA 1QJ4A 3CWQA 3E1KA 3K8ZA 4BRSA 3N2GB 2PL5A 5B58T 4YI3A 3C7KA 3G1UA 1U2PA 2JFGA 1BYIA 3D3WA 4EPYA 5HTOA 2BBOA 3LTNC 4U8GA 5FADA 3WLOA 4M7RA 2DERA 1NVAA 2QM0A 2YX1A 1CY1A 1DJOA 1W36C 2ZAYA 1NE7A 3MK31 5EZYA 5HDQA 1G8PA 1K4KA 2MYNA 1Q21A 2VWGA 4MQ6A 3NKLA 4MW4A 4X20A 3SR4A 1QDLB 4ZZ1A 4JODA 4PGGA 3DYIA 3DUFA 1GPDG 4L2IA 4LGCA 2OO3A 5F64A 5G0SA 4AMZA 3HYCA 3IP1A 3KUDA 4W1RA 3TJRA 1ADCA 1DKLA 1BHSA 1TJPB 1PBNA 1SMKA 2EJUA 2C7QA 3F7TA 1XVIA 1ODCA 4DIBA 1EXNA 5IASA 3N2NA 4KG7A 1RMQA 1P5RA 5ALKA 4A2WA 2AK3A 4E22A 4G3XA 4Z8XA 3S7ZA 3A58B 3HL0A 3IBGA 1SXPA 1OPXA 1NW8A 3BDAA 2VHTA 3DL4A 1DRKA 4RS3A 5DWVA 4ZVOA 5BPFA 4CQLB 1ZD1A 3HP7A 2PX2A 3MRXA 3IIIA 5E4TA 1BH6A 2F2TA 2YRFA 2IGBA 1I0LA 1JQ5A 3LPNA 4MEBA 4YWJA 4ENRA 3U4QA 1WHTA 2GPBA 3H9EO 2PU5A 2PGIA 3AHGA 4WCFA 2ORYA 5LMZA 4AD8A 3N39C 3QNUA 3VU9B 1P19A 2OCAA 4BN0A 1X7XB 1P60A 1I6WA 1TTHA 4LQDA 2YRWA 5JECA 3ZJ5A 4JFRA 1FNMA 1IOWA 1JHUA 5KZMB 3JD2A 3TW8B 3CEPB 3B9PA 3MWFA 1KYXA 4JEMA 1PN3A 1LBEA 1SUCA 3QUCA 2YIVX 3OQJA 3P5SA 3RLIA 2X1MA 3RVOA 3U7QB 4E1VA 4YR7A 1CUGA 2PT5A 3M49A 2ZXEA 3ZUGA 3M4YA 1YA6A 4DV2B 4DC1A 2W4QA 4DAEA 2QZPA 4Z9BA 3VH1A 5TVGA 2XUOA 5CFNA 5A4IS 3EPPA 3OZAA 3C3AA 5D85A 3K94A 2I91A 3L1JA 1YJ5A 2J4CA 5BQ5A 1DKNA 5AM1A 1JHAA 3N8NA 3GELA 4B31A 4NMMA 1D0SA 4L75A 3NXKA 1QVZA 1UBNA 4QUIA 4UDOA 5BO5A 4HQ0A 1I0ZA 3H13A 5KI6A 1K2VN 5LJLA 2Q9CA 5HJ7A 1YZUA 1ENPA 4OA8A 3GRAA 3NG1A 4ZQEA 2VDQB 4CM8A 4K9RA 5JW6A 4OBBA 1DT3A 1LXCA 1CTQA 2E49A 3VKVA 2A35A 2ZTVA 1GM5A 3RW9A 3SR3A 1T8WA 4NQZA 1GEEA 3HRKA 1KGSA 1O54A 4GWKA 4KOEC 4O2BA 1ZSNA 2FHSA 3X44A 4EYEA 1FB5A 3WQRA 5A0TA 1NKVA 1HYBA 4TQGA 1RNLA 4LHZA 5IMSA 2ZYTX 4BFLA 2SNIE 1ZVKA 4LSMA 5BW8A 1NI4A 5LDGA 1ZJWA 1KZ4A 4OATA 5DXJA 5HWSA 4N3NA 1H4SA 1G2PA 1XMVA 2RC6A 2QN7A 4LWQA 1DAIA 5H9VA 4KQCA 4B4DA 2I2FA 2EU8A 1UPAA 2W71A 5DOVA 2VP9A 2P91A 1S8OA 4P1ZA 5H4GA 5SY4A 4Z1MA 4KKXB 4I4LA 3CRW1 3CYFA 5J59A 4LYYA 3U26A 4BS9A 1YZ3A 4ZO4A 1GV1A 5K8UA 4UHJA 3RK0A 4U9UA 1BE8A 1O6GA 2ZS9A 1MW9X 4PHCA 2B0CA 4A3SA 4M3NA 3I6IA 1FXUA 2ZROA 2X19A 3IHLA 1TM4E 3G5TA 5IAKA 1IE3A 1PI3A 4MUGA 1OBVA 2P9QA 2B5WA 3K32A 3NJ8A 1U6KA 1T1IA 1X3SA 5CMLA 4LHEA 1HYQA 4JKYA 4RK4A 5D6OA 3TBHA 5BSKA 5L51A 4BQOA 4JLBA 2ZBQA 3CLRC 1OB2A 4DTCA 4II3A 5FI5A 5ESWA 5E8JA 4QT0A 2OFFA 4QQNA 5CB4B 1RAAA 1WUHS 1N6PA 1GZ4A 4LG1A 4MYTA 4Q19A 2B8NA 4AZ3B 5K0ZA 3UM9A 4FKMA 4CQMA 3O4GA 4C43A 3S70A 2GZDA 1XPOA 4RV5A 3PC8C 3C5WP 4P7GA 1NQWA 3KLPX 1D4FA 5HA5A 4KSBA 3CLUD 2EJTA 2IOFK 4LJ5A 1Y8QA 2X2EA 3F5QA 3OEWA 1CUCA 3CW9A 1BA3A 2X41A 2ZJ3A 2Q4EA 3L40A 4RWZA 4NYMR 5IWCA 1TK3A 3N8GA 2P27A 2UZ1B 3ENQA 4DV1B 1MOZA 4JDPA 3RVLA 5JAOA 5EIHA 2V1XA 3H2KA 4XVHA 4CNBA 5JC1A 1M83A 4QBGB 3WIOA 4Q1CA 2ZJFA 4ZVLA 3ICQB 1PJLA 4XWTA 4MKIA 4D9EA 2B1QA 5IM4A 5L7TA 1PJAA 2A1TR 3P9RA 1KEWA 1PW5A 5H9WA 4B6QA 1O6ZA 5D86A 1DVRA 2JNWA 2WSYB 1U1GA 1RACA 2AFVA 2Y6UA 4ZU6X 1SG0A 1M2OA 2I4NA 4FFOA 4E94A 1XZMA 4WH0A 4FYMA 3RREA 1TA9A 1ZM7A 4I5EA 5SZKB 3PC4A 3BSYA 2X7XA 4UPEA 4WA8A 2Q7XA 3U4CA 1R5JA 4BL5A 1MX3A 2FZKA 2R4UA 4Z0NA 1TRHA 1QF9A 4O29A 1CEQA 5HSGA 3LBFA 1VHJA 1A69A 1B73A 1NVEA 3OQVA 4AF8A 4E1BA 2QL7A 4N49A 3Q3EA 2P2NA 2IZ7A 2JH3A 4CUJA 3QUSA 1X2BA 4FBMA 2V4MA 4HAWA 1QQ5A 3RF7A 4E51A 3K4HA 2XMCA 4RZSA 4XFJA 3DEHA 1ZVVA 3WYNA 1E77A 3NV9A 4PN7A 5I47A 3A10A 4EEZA 3PPXA 1CR6A 2INGX 5GPBA 3T3MB 5JHHB 2AW3A 4EUNA 4B80A 3ETLA 1OMOA 5LYJF 4FHDA 1DO0A 4HMOA 1JP7A 1P4HA 2OHGA 1LLFA 3E5MA 6REQB 4XM1A 2NZ2A 2QN3A 5TARA 1RYEA 3VBCA 1NBHA 1UK7A 5A5VA 2D2VA 5K7SA 4QU5A 5G4KB 3C3DA 3VAAA 2WKWA 1PFQA 3R3YA 4BQIA 3KSRA 4YJKA 4ZVKA 3ROFA 4BAUA 1RC1A 1BQ3A 1Z4JA 1BDHA 1U2DC 1H94A 4QPNA 4PBRA 2ECPA 2F8LA 4RA6A 1JHMA 3S2SA 1B8OA 4B3CA 5I4CA 3R0VA 4HDRB 1E4YA 5THQA 3QIVA 4E15A 4ZJUA 3T3DA 2QTCA 1JG3A 1UFQA 2ZU6A 3OFND 1E6LA 2P3OA 4UU0A 1WXDA 2FJUA 2X5JO 3AOEA 3SFVA 3WFJA 1G20A 3UO8B 2CVZA 3EBLA 5KX5B 1XZGA 3PKIA 4B81A 3QEJA 2RIPA 3RHZA 1JBKA 3MXTA 5K2OA 1M34E 3G2MA 5LDDC 1W0JA 1ADBA 4I08A 3NORA 3U61B 1Y8CA 2DTDA 2ODAA 3IDAA 4N0DA 2PLFA 4I55F 2B9EA 3L06A 4RY9A 4O33A 1YB6A 5TE9A 1MMFB 5CA0F 1G41A 4K3UA 4OL9A 3WK8A 5CNKA 5DOZA 3LY9A 1RHMA 3W8FA 2XCRB 2RHCA 2NOAA 5DI3A 1ISPA 2IHYA 1Y8RA 4AIRA 5KYYB 4D3YA 1P62B 2GGSA 4TXNA 2IEAA 3TLAA 3WL8A 1T0HB 3LQ4A 5LYJA 3GD5A 1KOFA 2NZWA 4KVAA 1CNEA 5AHKA 3SYRA 4W5TA 4E7OA 1D4AA 1WTCA 2XEDA 3BREA 3BAFA 3PT9A 1D7AA 2A3NA 4KTTE 4CGYA 3NHZA 2H18A 4X3OA 3ZWQA 4B7AA 1HKHA 4KQEA 2HR1A 3IKJA 3IYLW 2J6HA 4IO1A 5AVUA 3QWHA 3ZTWA 4I2NA 2TRSB 2ZSUA 4LJKA 3KOZA 1NFRA 2H07A 3Q3IA 1U4NA 4BKPA 3KZOA 4JLSA 5GVRA 3R3ZA 4CFZA 3LQRA 5L9AA 1KWKA 4Q9DA 3HADA 3BBPA 1T2AA 3QTTA 4AJHA 3P97A 2O59A 4C4OA 1D1TA 1GDDA 1GFSA 2ASEA 4BGUA 5JTUA 3IV9A 4PPYA 5CITA 1HDRA 3TJMA 1N7JA 3BE8A 3MQ4A 2FVXA 4CIBA 4B3TB 4WAUA 5HKKA 2ZG6A 3BL6A 2XXJA 4YRTA 1Z33A 1UT6A 4OU4A 1ORIA 1PW7A 1T3LA 1C4WA 3FUUA 3HGQA 3OZSA 4RPLA 5K2MA 4URVR 4UARA 3R8FA 2P9HA 3QPAA 4OOEA 5DTEA 2C8LA 3C6ZA 3ICEA 3DHNA 3HEMA 1CUFA 4F5ZA 4DMHA 2WUWE 4WBNB 5I4IA 1SCAA 1W1WA 3HR4A 1T5IA 1PLKA 5DGTA 4B9EA 2IITA 1N5RA 1XDUA 1MQSA 1TZ2A 1L6IA 2CHFA 3MTBA 1O8BA 3ZTTA 4M46A 4B75A 2IYFA 1RLMA 3QVSA 4D6YA 4MR9B 2C4HA 4NH4A 2VAWA 3UHJA 1HR0B 4F4CA 4BTEA 1N75A 1Y9DA 2JHGA 3MXOA 1XZFA 2IELA 3ZJVA 4QDTA 5KAPA 4ITUA 2YXDA 1HZJA 1AMOA 5EJFA 4PZLA 5G02A 3OWXA 4HWSA 3QENA 1OVGA 4GYJA 5JADA 1XYGA 3ENVA 1NXVA 1L4FA 5IHXA 4BCBA 2HRRA 2FKNA 3WX0A 1WUIS 3V8EA 1Z16A 3I8XA 5JEEA 3UGJA 1KBOA 4NLLA 4H9GA 1WM1A 1BS1A 1UUFA 1Z5PA 2JCXA 1XN1A 1VG1A 2TMYA 4ZVMA 1TGVA 5E38A 3HDTA 4YAOA 4K0RA 1OZGA 1OHHA 4D4JA 4P38A 5JS1A 3OG9A 4U0KA 3KSAC 3ABRB 1E6WA 1P5JA 2VBGA 3SJZA 4KK3A 1FUUA 2EGGA 3KT3A 3NP9A 4MWSA 4REMA 3AY7A 4TL8A 3CZ5A 3EQ9A 2Q1XA 3BVPA 3WZLA 1BHO1 4R7TA 5T4FA 3PNBA 1VLMA 2Q45A 1FX1A 2AOUB 5ALYA 3A04A 4O4IB 5DX8A 1R8XA 1ARZA 3Q3CA 3OZDA 1G20E 4GLJA 4QRDA 3ZZNA 4HRYA 1PR1A 1KH2A 4OOFA 1ZZGA 1XKQA 1RCTE 1P2UA 4F71A 4QGBA 4AZ0B 1KSJA 3WLSA 1TIKA 1C1DB 2PVPA 4UATA 4CDNA 1TMYA 3NPAA 4JJGA 4DGQA 2QQFA 2OO7A 3PNMA 3GDHA 1BVRA 1M72A 2P90A 2ZQ5A 3PHCA 4DWOA 4DA9A 4XFKA 1AKNA 3UHOA 1GGFA 3EZ6A 3HXLA 1TW3A 1QTNA 4FGWA 4NMXB 1IWOA 4KJZA 4ARCA 4E5PA 3FYDA 2NZXA 1P7CA 3MMNA 4RIIA 1HEIA 1USKA 1Z6AA 1CR1A 1J5XA 2B7BA 2E1PA 3QV1A 4LSWA 4GWGA 3V1UA 2ZZMA 3ADDA 5D1HA 1HQDA 2FU5C 3B7PA 1NJGA 1M8KA 1T6NA 3DMFA 3DUWA 1SD5A 1N6RA 3LCMA 1FNNA 3EW9A 3SOZA 4DABA 5JRDS 3PWTA 4OFZA 4C76A 2IXEA 3IOYA 2Q3HA 3ISJA 1SKYB 4BMOB 2WWIA 4MW5A 4U7HA 2BEWA 3HBJA 4WOBA 3WWEA 2C5AA 5JYEA 2GXAA 1IN6A 1FP2A 4IEIA 1BEEA 5HUJA 5I6DA 2OWDA 2V4ZA 5JJIA 3GGSA 2JIZA 1YZNA 2BI8A 1E5QA 3AVUA 3DG9A 4GXTA 4NJMA 2NX2A 4YJFB 4Y2YA 2ZJAA 4HEA6 1F5NA 4PNEA 1T9GS 2XXAA 3VVCA 2FMTA 3VYUB 4IOJA 3QTBA 5HF9A 1L5QA 3MC1A 4OB7A 3RWOA 3W7BA 4GSKA 1CEYA 3A6LA 1T91A 2OFXA 3CG4A 3G2JA 4LRSB 2NUAB 3UXEA 3WB9A 2CLFB 4F3YA 1ODSA 1W0KA 2RARA 1HK7A 3K96A 4HQ6A 4HVTA 3FCEA 5A9SB 1UZAA 3K6SB 4OQEA 5JAQA 1BRTA 1WDKA 4IDEA 4DDMA 4LQLA 4MUAA 1BKYA 1V37A 2GBCA 3TPFA 2ZK7A 1NKTA 2FOLA 1UWLA 2NYRA 3C5EA 4H0CA 3I37X 4Q03A 2PGOA 2NYVA 4X24A 1CZRA 4DQXA 4FU0A 3L1VA 3CF0A 1P0QA 5JDIC 5HNKA 4P98A 1UC4B 4OIMA 1G3UA 5EJGA 5EIOA 1AZTA 3TNJA 1DOHA 4L0DA 4I9NA 2MIIA 4WQMA 5K03A 4QM7A 3IODA 3L05A 4QOEA 3DBLB 2YQ5A 1RR6A 4RMIA 3JR7A 1DJLA 2CZGA 1DSSG 2D2IA 3QYAA 3T9DA 3ZHRA 1ISRA 1BC5A 2HSDA 1C81A 1V39A 2ODQA 5IU6A 2KE5A 1L7PA 2O2GA 2V7XA 3P4YA 3FR7A 3ORRA 4IIJA 4F11A 1GPMA 2VRWA 3GZJA 1NNUA 1DCTA 4O4LF 2NSHA 1ZR2A 1E3IA 2WY2D 2VZLA 1Q1AA 1VCNA 1XIVA 1TJYA 1ULSA 3G89A 5CUQA 5DIZA 3TG2A 2FF7A 1IVSA 2AQKA 1Z4MA 4AT1A 1PQPA 1G5IA 1QX4A 3NYRA 3TM5A 1U0BB 2XSZA 3D0RA 4F85A 4ND6A 4OVKA 3OEYA 1EFPA 1NLZA 4YHBA 3C85A 1X8LA 2SKEA 3VNQA 3WRXC 4GP6A 4BZZA 1U3TA 5G1NA 4ACBA 2WWGA 4F9EA 5KNDH 3NHKA 3RRNA 1U7XA 2IDJA 4CMIA 1AKMA 1W49A 3NHLA 1W30A 2PXXA 1NFQA 2VRBA 5LL6P 4H3SA 3RIYA 1E1RA 4Q18A 4BASA 5JFOA 1Q2UA 3R09A 1NN3A 1W85B 1XRPA 4TKUB 4IVPA 1OZ0A 4AZ0A 2ONYA 1XCPA 4BNMA 2CXPA 2EQAA 3KZ1E 3S55A 3KR9A 4PSCA 3KM0A 4Q4AB 1G6Q1 4YQYA 1E99A 4JHXA 3WBJA 4ERXA 4N6OA 4JSTA 4INJA 2AZ4A 2JFVA 2IS2A 3DCJA 4U7GA 2C9OA 1EG2A 3F98A 1G59A 2HQ1A 4LEIA 4PR3A 1IG0A 3B5JA 1MDFA 3QFSA 4EMBA 1SBYA 3VSBA 3M3PA 4P5PA 4EELA 5LP6B 4GI7A 3UFBA 1EWQA 1RIFA 4AN0A 1QGUA 4EIWA 3OX1A 3MGCA 3P52A 4NMWA 1YI1A 5A3QA 5EE5B 4AKTA 1J5EB 1QNFA 2CMDA 2B78A 1ND6A 5KKAA 3J81A 5EHNA 3SHVA 1NRWA 1SELA 3KOWA 4I2VA 3VYVA 3B9BA 3R5SA 3D7LA 4KCGA 4L8LA 4NESA 3EH1A 4JC4A 4ALKA 5B2FA 3A6EA 3NEJA 3O7WA 1XK7A 4QE3A 1G2IA 3HUEA 3SEZA 3AWIA 1KYIA 2E4AA 2NV2B 3CUSA 4FFRA 3R3HA 1EAMA 3I64A 4BOYA 3VSDA 2JIDA 5A4JA 3M6XA 1OREA 1RWNA 4QPJC 4NPAA 1T5TA 1Q0LA 5CDFA 4C0SA 1DAHA 2AQ8A 2QP9X 3N2KB 1P4AA 2YCBA 5E3JA 1QFJA 1DEHA 3N0RA 4LGVA 4CQMB 1DAEA 4W7IA 2E4XA 2NTYC 3U4GA 1Q0TA 1M67A 5COBA 1TT7A 5TMDA 3SDZA 2OPHA 2REQA 1UFKA 4DN6A 1HLFA 4M87A 5GMOA 4B84A 4OQLA 4DC9A 2ZRAA 2GKGA 2QX8A 3Q5DA 2C31A 1GZDA 2X4IA 3ASZA 4EG7A 5BR8B 1YL5A 2ZRJA 1IU9A 4CG2A 1GTSA 2H9YA 3DV0A 4IJMA 5JRJA 3R3WA 3AVWA 1UBMS 1E9FA 1TAQA 3KV3O 4Z7JA 2FPOA 3E22A 4KK4A 1VE9A 4G89A 5J2UB 1MQAA 2XMRA 2PD4A 3LU1A 3PITA 2GZ2A 4J0FA 2VCEA 3OJOA 1GTVA 1GPWB 2I4LA 4YAIA 1B16A 5IXYA 3JQAA 2GASA 3HGMA 5T8KA 3HSKA 2C7BA 3KAKA 1SRRA 2I4OA 3W9SA 2AJLI 4KJXA 1U1EA 2QRGA 1GPNA 1P74A 1OX4A 4RVUA 2LDBA 4C7VA 2WB2A 4RXUA 3GX1A 2ZBVA 2DM6A 1TQHA 1RE0A 3H0EA 1RRFA 4BLOA 4CF3A 4ASUD 3ZX4A 1ID8A 1C5KA 2OV6A 1OVMA 4LJSA 2OBFA 1KXJA 1JEEA 3OIVA 4R8SA 4MUHA 1RM3A 1WO8A 4HRVA 4UOZA 2YL2A 2IYVA 2ZI5A 4JBYA 1CUEA 1TAUA 4QUGA 2O8EB 1TZBA 3LUFA 3AU8A 4BDTA 2R8RA 3HXPA 3LF2A 1HDIA 3LWDA 2WT4A 4PFKA 4B5LA 4CDRA 1NGSA 4IIUA 2VNAA 4LNUA 4TTQA 4D96A 1Q2XA 3A0RB 3KFLA 3DEFA 3M6UA 4OHXA 4UBMA 2NV0A 2R66A 5F7ZA 2CUKA 3V7NA 5IYZB 3GJ7A 2GBFA 2WOOA 3KR2A 4MP8A 3FTCA 3ZWYA 3PQEA 4YMGA 5ICCA 5CIYA 4D02A 1M7BA 2XB2A 1DRUA 5HKOA 1BX1A 2B82A 3IOMA 3GJ3A 1AQ6A 3IVMA 3SQXA 4U6QA 2HT1A 4MKRA 1RS0A 2FPGA 2QSZA 4ENWA 1V1MA 2Q6IA 2X0RA 3KYJB 5K8VA 2CXNA 3W4JA 3WJ1A 2QPLA 1MOPA 3M6AA 4G84A 4ISBA 1YASA 4QYMA 2H1OA 4EEKA 1H22A 4B8YA 2DPLA 4W63A 3V4PB 4OB6A 4PN3A 1B8NA 2JJ1D 2AFIE 3P27A 3L7DA 3I73A 4P3YA 1V5EA 3EG9A 1YL7A 4BJ5A 5I7FA 2LV8A 3SYTA 4OQPA 1YE3A 3VHXA 3X1DA 4UNNA 4QATA 3VHQA 5E2BA 4MWDA 3IB3A 1NXPA 3IUQA 2GTHA 2DKOA 5DTIA 2WLSA 1PAUA 2BGLA 2OHXA 5E7IA 4DWWA 2BHLA 2KWIA 2WSLA 3QEMB 2JLAA 3TX2A 1D0VA 2JBAB 3SLGA 3O3CA 4NIMA 1XJWA 1QG4A 2HCRA 5DBHX 2GLTA 2FFBA 2IPLA 4OD0A 2QMYA 3UGTA 3HV2A 4C0XA 3BJMA 3DSRA 2DF8A 4HDMB 3FUXA 2I03A 1AO0A 3AQIA 1YDMA 2Z56A 1IHDA 2JCYA 3QPCA 2PS9A 1MOSA 1J7JA 2HNKA 5A02A 4K9LA 3L84A 3OFJA 4OMCA 3PYMA 3T3IA 5KU7A 1RRMA 4MZXA 2G9NA 5F23A 5JNRA 3DKPA 4KQXA 1MAVA 4NHEA 3UV7A 3CUKA 5IAAA 4UD2A 2H7CA 1JU3A 1PR6A 3C6XA 1VLHA 3C3KA 4QODA 5AJTA 1XG5A 4FFVA 1T24A 1TM1E 1TUBB 5MHTA 3A3YA 1YQQA 2EBHX 5FA8A 2E5WA 5TIIA 3T4UA 1CT9A 4QQKA 4RTNA 1AHNA 4W9NA 2IVFA 3FJ1A 3AI1A 2GD1O 2WHEA 2XXBA 3QVMA 4XXHA 4AKSA 4LYFA 4M8NE 5JPDA 3HXOA 4G0UA 2Y66A 1VMIA 4PYQA 1ZK2A 1ULTA 1W581 4GP9A 2GEVA 4L76A 2AWOA 3FWPA 2BAGA 4GUDA 4J07A 1PYOA 1RJEA 3U37A 4B43A 1YQGA 3NBZC 4EY8A 2FH5B 2AJDA 2R97A 4ZRMA 3W5VA 3R41A 1PG5A 4YCSA 2IYYA 3FYHA 4FMDB 5DCYA 1B2RA 3RTCA 5FBRB 2DUJA 1T9HA 4ANFA 2P0AA 4EG3A 4QBIA 4KOAA 3TO5A 2E82A 1X7YB 4UVEA 1P44A 5G3YA 2EEPA 3Q9UA 1PQWA 1QG0A 1P7PA 1PD1A 2CDRA 2QYOA 3E48A 3M9LA 2QRKA 2IC5A 4XD2A 1J5PA 3DGEC 3RI3A 2W2MA 2YWHA 4BGIA 5J23A 2PT9A 2BGJA 3ETJA 4DCUA 2AZMA 2IEYA 4FFDA 4GEGA 5JARA 3O8OB 3C4QA 4GVPA 5GONF 4AX4A 3KXIA 1S8FA 2QRLA 4GHWA 3F7NA 5FP0A 1N4DA 3W2EA 3ZWBA 4HXGA 3TOSA 1KHTA 1ML4A 3C6MA 4HEA1 4U3JA 4DCGA 3USCS 1KR5A 2E0IA 4C07A 5HRAA 1HTTA 4CT4B 1BOOA 2OV1A 2VOEA 2AEEA 5FBVB 3T1QA 4CMEC 4K6MA 3R6GA 4XR4A 5JOQA 1BRMA 1J56A 1R3UA 1SM4A 4LXHA 3MT7A 3TTYA 2C8KA 4ZTUB 1Z22A 4G26A 4WL0A 3WS7A 3HR7A 5C7IO 5HCUA 5FTKA 1GDTA 4E0BA 1K4MA 4F3TA 2KBFA 4RXMA 3WISA 1E7WA 2V7UA 2X2PA 1ILEA 1E3DA 3D9QX 3LC0A 3T5DA 5HM6A 2WYHA 4J0IA 1W73A 1S5PA 2FWBA 1A9ZA 4G37A 1M2WA 3Q2OA 1E3LA 4DJAA 1UDWA 5JHGB 4QD3A 5ARBA 4DT1A 3KXDA 4I19A 2ZUCA 1E7SA 2VDMB 3JPYA 4PLFA 5LUAA 2BBWA 2WU1A 1KF0A 4X45A 2JDIA 2ZIUB 2NUPB 3UN1A 2WHQA 3U4AA 1K0UA 5FA6A 4YDQA 1C7FA 1UZNA 2DQ4A 4AY4A 3MMXA 2YVQA 1KDVA 4KH0A 2FN8A 1WDWB 3MYYA 4IIXA 1VE7A 1B41A 3ZZ0A 1I1OA 1H8EA 1PYGA 3HP1A 3K16A 2HNBA 3PV0A 4S1PA 4TOIA 1X1TA 3T9EA 1ZM2A 4E08A 3K6SA 1S4QA 4ZT5A 3EC2A 2G76A 5DGHA 2RK6A 1PV1A 2G8LA 3HL4A 1NZFA 5EWLA 1YSCA 1A7AA 3PSHA 3UHFA 3R74A 1BD3A 1GU0A 4LV5B 1Y6FA 1B0ZA 2TMGA 2WUEA 3B5EA 4R16A 1YO6A 5ESRA 2C59A 3PC6A 4BIIA 3P2YA 1KYQA 1NOJA 1HFJA 3BH0A 1AUPA 5U1PA 3OT4A 1POXA 3JALB 2AR7A 1ZBQA 4TTVA 7REQB 3GMSA 1VSUA 1VDMA 1YR2A 2PXHA 1M1XB 5LBIA 4HZIA 1RI1A 2BEKA 5AVQA 2AWNA 1X7ZB 1AS3A 3AYXB 3D6AA 3IDZA 3PBKA 4QOJA 4DLVA 1Q0RA 3PUXA 4BNYA 4KR2A 1NYRA 1A4UA 3ZW8A 1RQPA 1GJRA 3LHIA 1TYEB 1XZQA 1PZXA 3ON5A 2QLNA 2QRHA 3PQ5A 3Q88A 4Q12A 4OHPA 4DBLE 2WDPA 2X13A 2XCOA 2HDNB 3TPCA 1UBOS 4X6XA 1SZCA 2PZKA 5CB8A 1P0PA 3OIFA 1V71A 3K9NA 1N2OA 2A5LA 3HZZA 3LLMA 3MAJA 2Q4TA 4FX2A 4J7CA 2YASA 3IUYA 1HUQA 4YV2A 1SIBE 5EIXA 5JMTA 3H0KA 4BYGA 1WTAA 3V00A 2Q7OE 3CTPA 4RF4A 4IS3A 3ET4A 1AN9A 1PK8A 4ZALA 1OXUA 1DAGA 1COWA 1P33A 4OCZA 4ZT6A 4DLSA 1JR2A 4E5SA 3GLGB 3U5TA 5EJ2A 3L1UA 3FFXA 4ENQA 2GYWA 1MJFA 1NRIA 2ZUFA 5JAPA 2FZGA 2QU8A 4MUFA 3GWGA 2Z6AA 4ENPA 1GNLA 4KGXA 1Z4PX 4MYRA 2DFKB 1SHZA 1KJNA 1NJ8A 1YXMA 2CVPA 2DQYA 4JC8A 4R9UC 5JLAA 3L82B 2CUNA 1UXHA 1VM6A 5ERXA 1MO5A 3A4MA 3MWDA 1TC2A 2GHQA 4LOHA 2WZQA 4EJ6A 5KNDA 1OH7A 2CXOA 2I2WA 2NZYA 2PH5A 5EQJB 2LCFA 3GVXA 4OMFG 1GPAA 1CQJB 1GTZA 1OI2A 3QOFA 4CIAA 1UJNA 3EA5A 2CT8A 1E4VA 5LQNA 2OL4A 3HHEA 1UT8A 1Y1TA 1R9NA 2HWXA 2JEZA 2PS0A 3CG0A 3DF9A 3LNCA 4K26A 2CB9A 4MUJA 1H6CA 2UAGA 4B17A 3K70D 5EJ5A 1O7JA 1MB4A 2OP1A 2OV4A 2Q21A 3DAPA 4TMVA 4OGGA 2J7PD 2JGIA 2IEIA 3N2LA 5FF9A 4GMKA 3WMGA 2QZJA 1GRNA 1F2TB 1ZBDA 3PNYA 1ADJA 5JMPA 5LP6A 1LZLA 2QSYA 1AHPA 4R84A 3FNFA 4MGYR 3TMKA 3IQHX 3RRMA 4CVNA 1DGQA 1UJ6A 2MSKA 1WQ1R 5IZCC 4NYJR 3I0ZA 2GCOA 3HO8A 3DJYA 2G06A 2RH5A 1PFGA 1UOPA 2ZYIA 3DCIA 8AT1A 2QL5A 3L0YA 2QTZA 1N5JA 2D00A 4GPD1 2YJZA 2Q1UA 2WJZB 1X1AA 2QV7A 1DBSA 3DMNA 1WXWA 3EDOA 2R0QC 1VBMA 4RD1A 4C78A 1KPHA 4EKNB 4IF6A 3FPLA 3OZUA 4MR8A 2NUPA 5HHTA 4P7FA 4DHWA 5DLDA 4LISA 2OBYA 5FTWA 3WGMA 4AUNA 3A27A 4OXXA 1HG1A 1CS4C 3H11B 5ILGA 1CPYA 1SKMA 3DMHA 5FUYA 4EQZA 5HS4A 3BB1A 4I3HA 2EKLA 3OJFA 4OHUA 2IWHA 5AW9A 1DIRA 4Z86A 5KYNA 1FNBA 2EZ9A 1JIJA 4GXNA 3S7TA 1II8B 3MJTA 5GGYA 3EZGA 2BHRA 2D0IA 3L4SO 4IW3B 2WJAA 4C06A 2R7MA 4BPBA 5IM4F 3G9TA 1C0KA 2GLXA 2AFIB 2HSWA 4OG2A 3KUXA 4PWYA 4Q9NA 2Y0DA 1QHHB 3HEBA 3K30A 1CUHA 4XM0A 2VP3A 1XBTA 4U2BA 3ABZA 4EO4A 3AZOA 3R7FA 3TVDA 4RTMA 3BTSA 2NUTB 2GX6A 4LOAA 1F4PA 2FSVC 3ZV5A 4CG0A 1U0RA 5JMOA 3FD8A 4TYMA 2FWNA 3DXXA 3LVFO 1SKYE 4ZD6A 1Q77A 1W46A 3N1UA 1OZFA 3KFVA 3VR4D 1O3YA 3AHFA 1CVLA 1NMZA 4DNOA 2X1VA 3AX6A 4NK4A 4X60A 4Q3CA 4RVNA 3ZHCA 4JIMA 2EYUA