3QWHA

Crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus in complex with nadph and kaempferol
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
260
structure length
260
Chain Sequence
YIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17beta-hydroxysteroid dehydrogenase
publication title Structural basis for inhibition of 17 beta-hydroxysteroid dehydrogenases by phytoestrogens: The case of fungal 17 beta-HSDcl.
pubmed doi rcsb
source organism Cochliobolus lunatus
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 103
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qwhA00
2P5UA 4FW8A 4N5MA 3GC6A 1YBMA 2YHUA 1P3DA 1C14A 3ITDA 1NFFA 1U1IA 2OGUA 4GGPA 5A3VA 3BHIA 4R01A 5FYDA 1E7WA 1NAHA 3IL2A 3Q9NA 1RPNA 4YBZA 2D59A 5TC4A 5B4TA 4ALIA 3EZLA 1RKXA 4OOEA 1DLJA 2W2KB 2YQ5A 3JQGA 4Z6KA 3JV7A 5HA5A 4FD3A 1XR3A 1PL8A 5F1PA 1U3WA 2VRBA 2ZQZA 1KEVA 1XQ6A 5HBRA 4JJIA 1FDSA 3HFSA 2NTJA 1BXKA 4UUMA 2JD1A 5TGDA 4PLVA 4QTZA 3I9LA 1LLQA 8ADHA 4MP6A 5A9TA 1EVYA 2OBYA 5AOVA 3OICA 4MJLA 1O6ZA 2HDHA 2IEDA 5G2OA 4M87A 3OA2A 2PZMA 2X4GA 2BRUA 2CVZA 2FSSA 4NJMB 1LEHA 4TKLA 4IDFA 3LLSA 3NT5A 1FF9A 3VKUA 1Z6ZA 2O7SA 1DRWA 1QKIA 4BNHA 4BS9A 3NT4A 2ZK7A 2NWQA 5FI5A 4INAA 4LK3A 3QWIA 1BW9A 1KEPA 1MV8A 4MIEA 3TQHA 2RHCA 3AU9A 1OOEA 2O7QA 1PJQA 2QQ5A 3PHLA 3BMOA 4TRNA 2VYND 3WTCA 1TEHA 4R1SA 1Y8RA 3L6DA 5JE8A 2WYWA 5T5QA 2I9PA 2OL4A 4PFJA 1HDYA 2Y1OA 5JBIA 3WFIA 2RH8A 4J7CA 4MVJI 1Q0QA 3I4CA 3LYLA 1H6CA 1HSZA 4D0SA 4Q3BA 1LSJA 4Z3DA 3W1VA 1KS9A 1LTHR 1YDEA 2QW8A 3ADOA 2JKVA 5JSFA 5LC1A 4ZQEA 5F3RA 4GWGA 4MVJM 1QLHA 4XB2A 2NTNA 3SJUA 3OBBA 1WP4A 4IJVA 4E12A 3DAGA 1FMCA 2DBRA 1CYDA 4WLOA 3VPSA 3GDFA 4YAEA 3WFJA 3H8VA 2YDYA 3OJ0A 4F45A 1H5QA 4GL4A 1PGNA 1EK6A 3PFFA 1YJ8A 5ER6A 1CRWG 4EEXA 1IHYA 1OC2A 3ORFA 1WNTA 1HDXA 3WDSA 1ENZA 1PS0A 4DL9A 2UUPA 5A5FA 4DC0A 5CDTA 2OXIA 4PG7A 4O59O 1XG5A 1XEAA 3A14A 1QV7A 2NADA 3ZHBA 2NLOA 3R3JA 5H82A 3V1UA 3I9MA 4RDIA 2EHDA 1ZUD1 3DZIA 4S1VA 2B4RO 2OOSA 3WQQA 2Y68A 4KP7A 4J16A 5JO0A 1CIVA 3BMQA 1V9LA 2W90A 3EC7A 4YCAA 4O5OA 1WZEA 4JP2A 3P2OA 4P4NA 3H4VA 2XF8A 3ZWXA 2WMDA 1PTJA 1U5CA 4AJNA 4NBTA 1NP3A 2V7PA 2ZATA 1N5DA 2ZYDA 2BKAA 3AFNA 3MEQA 4JP3A 2QZ9A 2O48X 4DLBA 3WNQA 3GG2A 4PRKA 2X5OA 3WIEA 3NX4A 4DRYA 4TZKA 4BNFA 1ADGA 3F5SA 3BTVA 1LRLA 4RV9A 2IZ1A 1E1NA 4FC6A 4U6SA 3DQPA 2O23A 4ND1A 5JY6A 4M54A 3ZWWA 3ONEA 4BO3A 3ONFA 3VPGA 3OJFA 4YA6A 1N1GA 3F46A 1PL7A 3U09A 2PA3A 3PDJA 2J5QA 2UDPA 2Y66A 3BAZA 3S55A 5FFFA 3ZU5A 4FFOA 2B83A 3OQBA 3LK7A 3JQ7A 1P1KA 2EP7A 1UDBA 2HRZA 4WLUA 1CEQA 1PR9A 4LVCA 3IKTA 3I5MA 2GGSA 2I66A 3LZ6A 1I2BA 4CMKA 3ON5A 4WNIA 1K6XA 4PVDA 1K6JA 1P44A 1I10A 5IDXA 4LRSB 3Q11A 2GPTA 3ETGA 4HXYA 2XXBA 1F8FA 4QEDA 1YBAA 3QWFA 3ZZNA 5H83A 3F6YA 2D3TA 4HX5A 1JDJA 1YB4A 1LA2A 1UDAA 1GD1O 1EZ4A 4WCDA 1KVQA 1HETA 1PQUA 2DPHA 2FRDA 4HFNA 4I5GA 4JN6B 1KVRA 3DONA 1P1RA 3ICPA 1LDNA 4OM8A 5F1KA 4YR9A 2C29D 1FK8A 3NKLA 4MKXA 1V35A 4MO2A 3C1TA 4GGOA 2VQ3A 3Q0EA 5TQVA 7MDHA 4X54A 5HTOA 5COQA 1I33A 1AHIA 2UVDA 1C3VA 1YQXA 2EJWA 4NK5A 2PKRA 1ZMTA 1EUZA 1R4NA 4LSMA 2V65A 2GDZA 5TSDA 1ZSNA 4HV4A 4YQZA 3QVXA 1E1MA 1EK5A 1I32A 4FFLA 4L9RA 5L4SA 4JBHA 4PN3A 4B3IA 2BFAA 4YJGA 4FFPA 2WE7A 4CJXA 3GOHA 3H6KA 5L53A 2GZ2A 1IHXA 1DAPA 3UOGA 4DBZA 4YVFA 1JVSA 2P5YA 3PJDA 5HRUA 2DFDA 3AI1A 2B5WA 2FY8A 3DR3A 3HDYA 1SMKA 3O9ZA 5CDYA 3WGGA 1SAYA 1PJ2A 5AVOA 2ZCVA 2BHLA 2NV6A 3U49A 3U62A 3GEDA 1EEHA 3WS7A 3WYBA 3QP9A 1PGPA 4CQLB 3FNFA 3H9UA 1HE5A 1NHGA 2W2KA 2Y1FA 3G3EA 3K8ZA 3WJ7A 4B4VA 4TKMA 3UVEA 3DHEA 4IPTA 3PHHA 4II3A 4WASA 5I9MA 5AYVA 3SC6A 1WVGA 4NK4A 1Y8QA 2RHRA 1ZJYA 2J3IA 4XYBA 5JFOA 2VN8A 1DBVO 5TS3A 4R9RA 5GZ1A 1NNUA 3DXFA 3PIIA 1Z45A 3PP8A 3VH1A 2EW2A 3OQ1A 2ZJ1A 4ITUA 1HDRA 1QSGA 2VYVA 3M6IA 3VAZA 4XDZA 1KIFA 4BOYA 1E0DA 4YEDA 2Y05A 4D45A 2E37A 4CM7A 3JYLA 4L74A 2JD2A 2G1UA 4ZQBA 2EIHA 1B8UA 5TIIA 4IDDA 4DLAA 5DP2A 4I9HA 2VHWA 1G6KA 3H5AA 3GA0A 3GNQA 1ZK0A 1KY4A 1O0SA 1WAMA 3M1LA 1YWGO 5B4VA 3IUPA 4XZ3A 3MJTA 3JQBC 1JLLA 1M66A 1EDOA 1ZSVA 3H3FA 1DC6A 4IXTA 3FR8A 1C0PA 3FPLA 2Q1WA 3FNHA 4CR8A 2ZTUA 4LISA 4L4XA 1GPDG 2ZKLA 4PLCA 1R12A 4B3JA 3OF2A 3ZW8A 4DPKA 3UCXA 1JN0A 3O26A 5BSFA 5L7TA 3V2HA 3PQEA 2OHXA 1DC5A 1T2FA 4YTEA 4B7CA 3NRCA 3ZU2A 4BUCA 3A4VA 4WECA 1E77A 1MA0A 2X9NA 1LQTA 1DC3A 2X0RA 1KVTA 3TOXA 4IZIA 2DTXA 2C20A 2HMVA 2CZCA 4JROA 4WGGA 3RU9A 3ZWAA 4IQ8A 2UUOA 5G0SA 5KJCA 2XPCA 3KM0A 1CDOA 2BI7A 1TLTA 3MJCA 3R1IA 3JYPA 4L8VA 5KTKA 4F46A 4OQYA 1NFQA 1K0UA 4RZHA 3D3EA 5T8KA 4BIIA 2QZZA 4AJ4A 3SJ7A 1Y81A 3OHSX 2VCYA 3GGPA 3KTDA 1BMDA 4Z0TA 3ZU4A 5U4QA 3L4BC 2FR0A 4RVFA 4WK6A 2GCGA 2PKQP 3E1KA 1ULSA 1Z73A 3DEYX 1ZXBA 2OBNA 4RVHA 4JBIA 1WDKA 1VLLA 5MDHA 1NXQA 3JD1A 4G65A 1I2ZA 3BIOA 4UVHA 5JCJD 4KUHA 3QWAA 1A9YA 4Q3EA 1D1SA 3NAQA 4IJKA 4CMIB 1GCUA 3HUDA 4GLLA 5ICMA 1PJSA 2X58A 3P7MA 2OZPA 4IGFA 4NFSA 4DIOA 5L3ZA 1X0VA 3R6DA 1Q7BA 3LT2A 5EINA 4XGIA 4P4GA 4DA9A 3K96A 4YQYA 3GAZA 5DF1A 5DDIP 2HJSA 4XQGA 2ZJ0A 3ZN2A 5IJZA 5KJ1A 2D5AA 3E6AA 1V3VA 5DOZA 2AQIA 5ES3A 1XKQA 2GR9A 5JDIC 4K1LA 4NI5A 3H65A 3CSDA 3PJGA 3ZHYA 1FDVA 2R2GA 4PG6A 3AM4A 3OJEA 2ZB8A 5L4NA 1VJ0A 2CVQA 4UREA 3BTUA 3GH3A 2OORA 2X9VA 3ZNQA 1PJLA 1VJTA 4RF4A 4FJ2A 3ZWNA 1PJCA 4NBVA 3V1YA 1BTOA 2ZB4A 3GMDA 4ND2A 4CLHA 3DFZA 4RVGA 1B0AA 4WNCA 3FWZA 4J4BA 3ROPA 3HG7A 1FJHA 4R5HA 1DIBA 1NM5A 4CL3A 3QV1A 2D1YA 3NT2A 3BMOB 1WLYA 3CTMA 4NZ9A 3I9KA 1Y8RB 3WGHA 1R6DA 3GVCA 3ETDA 1Y6JA 4BV9A 5CDSA 4LN1A 1YRLA 3T7CA 1ZXLA 3WQSB 3JQ9C 3TNLA 2VRCA 4AJ2A 5G0WA 4QFCA 1AXEA 1DOHA 2QRKA 1LJ8A 4ALJA 3B1KA 5A3JA 3HADA 4RQTA 4XIYA 3QA9A 2IXBA 1J5PA 1MFPA 1YQGA 3PXXA 3ZHXA 1LXCA 1I24A 1RM3A 1B3RA 4H15A 3EY4A 5T64A 5I7EA 1CF2O 3DAFA 4PLGA 2ET6A 4EYEA 1GAEO 1W73A 1UJMA 1DJQA 1M6HA 3LVFO 5CPBA 1J0XO 1GDHA 4GBJA 1GZ6A 3KRTA 2W4QA 1TT5A 1JKJA 1PGJA 4FCCA 4GVXA 4UVDA 2PV7A 2BF7A 2AEMA 4RJTA 2HSDA 3G1TA 1ONNA 3I9NA 3UH1A 2YHIB 3EW7A 4BKUA 4MVJD 3ZWYA 1XWFA 5GZ6A 5K6AC 3VDRA 4J6FA 3KHUA 3TDKA 1YXMA 4I8XA 5G4KB 3VVCA 3NDJA 3RD5A 4RGBA 1U8FO 1R4MA 4EUEA 1Z7EA 3QW2A 1VC2A 4AJOA 2FZWA 2FZEA 2ZYGA 1ENPA 4AJIA 4OGWA 4ID9A 4ZRMA 3WIDA 4E31A 4OYRA 2YJZA 4P22A 4RF3A 1JW9B 3Q1LA 2GZ1A 4UULA 3BMQB 4GSLA 4R54A 1L1FA 3JQ8B 1K2WA 1HRDA 3SLKA 4RPLA 3DC2A 5F1OA 4DIBA 1ISMA 3PGXA 2TMDA 4DMLA 2GRAA 1MG5A 3EAGA 2E48A 3PHJA 4CLOA 5KVQA 5B37A 2PH5A 4ND5A 4B8WA 4ZQFA 3DZHA 3U4CA 1N7HA 3JQBA 3LLVA 1Q2XA 4MINA 2DPGA 4NQZA 3ADPA 4HBGA 2CDAA 3C3XA 1CQIA 4CQLA 3ENKA 4LW8A 3BHMA 2AE2A 4HUJA 3C7AA 1ISJA 3U0BA 3GAFA 3AUSA 4JJFA 2FHSA 3RUAA 4BNIA 5CAEA 3W4KA 2Z1MA 3ROKA 4JXKA 1F14A 3VZRA 2Q45A 2YDXA 1IE3A 1UH5A 4AJKA 3DBLB 3WX0A 3WB9A 1QYCA 2P91A 4IDBA 5JYDA 4JQCA 4BB6A 3TF5A 3DBRB 3WSWA 2R00A 3BMCB 5DCUA 4D43A 1MLDA 4XWYA 3WLFA 5AXDA 4CMEC 2SCUA 1YE3A 3CMCO 3EZYA 3S2FA 4B4WA 5JLAA 5T57A 2R6JA 2GO1A 4UUNA 2FPGA 1R0SA 3K92A 4NBRA 4BNYA 3E9MA 5DNAA 4E2ZA 2ZYAA 1P1IA 4YAGA 1F0YA 2DVMA 1E6UA 3C85A 3DL2A 3RKUA 2B0JA 1I36A 1VPDA 2E82A 4BMNA 2HKIA 2VZ0A 1K3TA 2JAPA 2PZJA 3F3SA 1TB4A 3L4BA 4NMHA 2NACA 4GX5A 1XIVA 1B16A 4E4YA 5IDQA 4CM3A 1UZNA 1ZBQA 2Y0EA 3MCVA 4KOAA 4DYVA 4TRRA 1PGQA 3WGTA 1ORRA 4FIZA 1J49A 1IZ9A 3LT1A 4E13A 2Q49A 4BKRA 4HNGA 1OAAA 3CUKA 4FFRA 5JC1A 2HK9A 3ZWMA 3U5TA 3IQDB 3ETEA 1KC1A 2FP4A 4XQEA 3ROQA 4BMVA 4NDNE 4PZEA 4ZRNA 1DFIA 5FF9A 2AEJA 2CNBA 3KEOA 3PYMA 1O89A 2PGJA 4DTIA 4NR0A 1LC0A 1H9AA 3ZWCA 1ZEMA 1LX6A 1AHHA 4XYLA 3UF0A 4BNXA 3GHHA 4EW6A 4IINA 2Q46A 5A05A 3TFQA 5IZCC 5KIAA 4R1TA 5A03A 3A28A 3PHGA 5JDIA 1UR5A 2OMEA 1EBUA 4E5NA 4MP3A 3VPXA 1YVEI 4CM1A 1JA9A 1YB5A 2Q50A 3PI7A 5TF4A 4PRLA 2VWQA 5JAIA 4LMPA 4MP8A 4A26A 3QJ5A 2X0JA 1DFHA 1QV6A 3AK4A 1JVBA 1WXDA 2VT3A 4ONEA 3IS3A 3DHYA 2AW5A 2GN4A 1T2AA 3H5RA 3M2PA 3MOIA 2FR1A 3HZZA 4MKRA 3RUDA 1MUUA 1Y8QB 5JDCA 4CMIA 4IJWA 1UUFA 2YFQA 3GFGA 4I08A 1ML3A 5MGBA 3HDQA 4E3ZA 5F5LA 4BNWA 4BQRA 1BDBA 2WSBA 5EN4A 1Y5RA 2VHXA 2Y1GA 4LVUA 1L7DA 2AQKA 4E21A 2EGGA 1GADO 3VPFA 1KBZA 1QORA 2WE8A 3ZGYA 3JQ9A 5H81A 2V6GA 4BV8A 3D5QA 4XGNA 2D5CA 4MVJF 1BVRA 1VI2A 2GLXA 3SLGA 5L51A 2J6IA 4DLLA 4XX0A 1PQPA 4OHUA 4XYEA 4J1QA 2RH4A 2RBEA 1RYDA 3CIFA 3NUGA 5ITVA 3QSGA 3WGZA 4TQGA 4EZBA 5BNTA 4JCOA 1X1TA 3HB4X 4Y6PA 4N54A 2W98A 1FDUA 4J1TA 1YKFA 4QO8A 1LI4A 3JQEA 2ZTLA 1ARZA 1EE9A 1SO8A 1AGNA 1VKNA 1E1KA 1V6AA 3I9OA 1JWAB 5L40A 3L4SO 3PYLA 3UHAA 4PLPA 1GR0A 4E5MA 2X86A 4WLFA 2Q99A 4B8ZA 4J4HA 3JD2A 2YZ7A 4LGVA 1PR3A 1VM6A 1LDBA 3QVWA 2QX7A 5K6AA 4L4RA 3G1UA 4Z0PA 4YXFA 4FFNA 3HSKA 3OP4A 3HDJA 4HFRA 5I8ZA 2Y1EA 2G82A 5IDYA 4ZJUA 5TJHA 2O3UA 1GQ2A 3GY0A 1LSSA 2JCVA 3HB5X 5I9NA 4D7AA 3PHIA 3BZUA 3GF4A 4IDCA 2PFGA 2JHFA 1PU2A 1U4SA 5HS6A 2I67A 1C0LA 2I65A 1JU9A 1B14A 2FPPA 1I3KA 3GR6A 1E7SA 1ZJZA 2VYNA 3CPSA 1ZIDA 3P5SA 4H3VA 4IQGA 3CZRA 1NPDA 3BMNA 5LDHA 7ADHA 1ZK3A 2PKQO 3B1JA 1M6WA 3UFXA 4BO1A 1ZK1A 5C7LO 1GYRA 2IODA 2O3QA 6ADHA 1N8KA 3M1AA 1Z75A 2FPIA 3LT4A 3HQ4O 1BWSA 4YACA 2YHIA 4CPDA 4N18A 4WCFB 2W2LD 1GQQA 4PGFA 3ZCXA 2H5LA 3RBZA 1SBYA 2DBVO 4R16A 2WYVA 2BLLA 2EW8A 2AG5A 1M2WA 3VOSA 3W8EA 5G4KA 4DXHA 2BELA 4R3WA 1WDLA 3I23A 4XIJA 3DO5A 1V8BA 2NVUB 4FJ0A 3OIDA 5ILOA 4E32A 3ZW9A 2C59A 4OSPA 3OJOA 3FHLA 4BO8A 4CQMD 4WEOA 5HM8A 1U8XX 4L75A 1HL3A 4OQZA 3VH3A 3ZNNA 2NQTA 3GHYA 3I6IA 4M8SA 3RFVA 3OA0A 2YV2A 2J5RA 2RIRA 3PGJA 4CL8A 1ZCJA 4D79A 4UUOA 1W6UA 1TXGA 3JQ8A 3LU1A 4RO0A 3QRWA 4GMFA 5DN9A 3TSCA 4E2XA 4YRDA 1HE4A 4O0LA 1H6DA 3H9GA 5KJ6A 3ZWOA 3DZFA 1P1JA 4EJ6A 5CG2A 4B4UA 3W6UA 5CPFA 1XDWA 3EHEA 3SC4A 2BGKA 3C1AA 1VSVA 5ENDA 1X15A 2D2IA 3TRIA 3I83A 5K0ZA 3JYOA 4KTTE 1MGOA 3HHPA 4H7PA 4WCFC 3JQAD 5BSHA 3T4EA 1PZHA 1PSDA 3NTRA 4FQ8A 3W4IA 1T1RA 1DFGA 4Q3AA 2XAAA 1V3TA 4TVOA 4BNZA 1C1DA 4DUPA 3DBLA 2O2YA 1GPJA 2VTDA 3JD0A 4P4LA 4RDHA 4HFJA 5EPOA 3WMXA 3BA1A 3DBRA 5CHEA 5DBIA 3H9EO 1K6IA 4IM7A 1H6BA 3ZU3A 3AUUA 2AHRA 3AJRA 3BMCA 2DLDA 3K2BA 5L7YA 5KVSA 1EUCA 1G0NA 1U5AA 2B37A 3GDGA 3GFBA 4W82A 1GL3A 1EE2A 3RC1A 4IGEA 4D3SA 2DTDA 3K30A 4EUFA 4J4TA 4YYZA 5IZCA 1V0JA 1U3VA 2J3HA 4CUJA 2C5EA 2Y0DA 4MIYA 2DQ4A 1R15A 2NU7A 3IJRA 3VTFA 1WWKA 3IOYA 3B20A 1UXIA 1RM0A 4W9NC 3JYQA 1TT5B 2WD8A 4BMSA 3TPCA 3NGXA 3PQFA 3AFMA 1A27A 2YV3A 3D64A 4BNTA 2HAEA 1B8VA 3H3JA 1K5HA 4J1SA 4PZCA 4F3YA 4IIVA 1E3EA 2GYYA 3RUHA 2J3KA 3E9NA 4BNNA 1EDZA 3MJSA 2X7HA 1R4MB 2BD0A 2Q4BA 2O3SA 3GLQA 3FWNA 5IDWA 3ABIA 5IN4A 1R0LA 1P1HA 1JKIA 1PZFA 4CR6A 2NTVA 2C2XA 4UEKA 3INTA 5KKAA 3R3SA 1Z7BA 3TN7A 4CM8B 1VKOA 2ZTMA 5CDGA 2WJPA 2AA3A 1LDGA 3DMTC 3H9JA 3DOJA 3K9QO 3Q6IA 4BNKA 6LDHA 3GPDG 3PZBA 2EKQA 1ISHA 5CEJA 1DXYA 3JD4A 3PEFA 4GVLA 1LBEA 2IDZA 4CLOB 3N7UA 3BTOA 4P38A 2P68A 3EYWA 1VE9A 1KY5A 2AE1A 4GKBA 4FS3A 1EVZA 1ZNQO 2EGHA 4XJTA 3BHJA 4MKZA 4Z3KA 3UKOA 1OZAA 2PK3A 3Q3CA 4RORA 4A27A 2DBZA 4G5HA 3AOEC 4B3HA 4BKQA 3FNEA 1T4BA 2DU8A 4OSOA 4RVUA 4J0FA 2VTEA 3DBVO 2AXQA 3L9XA 4FOSA 2VHZA 3ZNPA 3TWOA 5JC8A 3ZWVA 2X0NA 4PCVA 2JD0A 3GVIA 3N58A 2Z5LA 1PZGA 4KQXA 3RC9A 3B6ZA 1RM5A 3NEPX 2H1SA 2PGDA 3OIFA 4OMUA 5IG2A 4B7UA 5AQ1A 5THKA 4IMRA 3VKVA 3UN1A 1GV1A 3F47A 3PIDA 2HMSA 2PD6A 1YDWA 2B69A 4KUGA 4M86A 4BO9A 4OKNA 3RJ9A 1O9BA 5CEEA 1P31A 1S6YA 1O94A 2C07A 1HDGO 3A1NA 3NTQA 1LLCA 2P4QA 4BGIA 4R51A 2O3JA 1M76A 1E3JA 3KVOA 1S7CA 4B4OA 3U3XA 3T7EA 3AW9A 3VPHA 1TI7A 1DIGA 4XR9A 1LSUA 5U9CA 4CR7A 3DOOA 4RPGA 1UAYA 2CDBA 4W7HA 3RC7A 1QXSA 1DIAA 1H2BA 5C7OO 1UZLA 1LRJA 2X0IA 3CINA 4RF2A 3GNSA 4DC1A 4Z9YA 4OAQA 1U3UA 4I9NA 4CLRA 4TWRA 1N1EA 4CV2A 1VSUA 4YWJA 4U0JA 3LC1O 3ITKA 2ZQYA 1CWUA 1TA4A 2VUSA 1GYQA 2GUGA 3BTSA 4WUVA 4BHTA 3GDOA 4OL9A 1SNYA 3KUXA 3UAGA 3WR5A 2HMUA 3AUTA 4CMHA 5TX7A 4AJEA 4H16A 4YB8A 4J9VA 3DFUA 4EJ0A 2OFPA 4TRMA 1X7GA 1U2GA 2Y1DA 2YV1A 1LLUA 1N7GA 2NU6A 3RAJA 2O2SA 3QVSA 3ZNOA 3RCBA 1HYEA 3KEQA 3ANLA 3U9LA 3KZVA 4U5QA 4Q3CA 1IPFA 4B7XA 2VZ8A 2O3RA 2PD3A 2VOEA 1G0OA 3WGQA 1J6UA 3HJAA 5FWNA 1ADCA 2EXXA 1T2DA 3GG9A 5I7FA 4G2NA 5JW6A 4I5EA 4MVJH 1AUPA 3LQFA 4WCFA 1E3WB 3RQSA 5B12A 9LDTA 4ZQGA 2I3GA 3RSHA 2Q2QA 2O4CA 3UICA 5JNLA 3E18A 3ZI0A 5CG1A 1DHTA 2ZCUA 3TZHA 1GEEA 3INRA 1YS4A 3AY6A 4MDHA 1E3IA 2HRBA 2NVUA 5IAAA 5A9SB 1KC3A 2BGMA 5C5IA 1SC6A 4N5NA 4UEJA 3FCOA 5G0VA 2QRLA 5EQDA 2VUUA 2X8LA 2D4AA 4HP8A 2LDXA 2BFPA 5JCJA 1ZK2A 3I6QA 5F5NA 2V6BA 3GN1A 1UZMA 1U7TA 3OJLA 4BGVA 2VWPA 4CM9A 1GEGA 1Y9EA 2PTGA 4Q9NA 3KXDA 1I8TA 4BL5A 3K31A 1BDMA 4DQXA 3O38A 2DM6A 4OOFA 4ZD6A 1I3LA 1TT7A 5T6BA 4B79A 1A7AA 4C7JA 3AM3A 1GZ3A 1T4DA 2C2YA 5L95A 3H5NA 3ONDA 1Y7TA 3WMWA 2D8AA 3IUSA 1WMBA 5TLSA 1U4OA 1DRVA 4K26A 3KLMX 4AFNA 4DYDA 5EMHA 1YBVA 1WW8A 4R1NA 4Y9DA 2J3JA 3JD3A 4Y8VA 2Z95A 2OUIA 4E0BA 1ONPA 1HEUA 1DIRA 4TZTA 4RF5A 5JAQA 4IBOA 2JCXA 4W7IA 4IY1A 3VH4A 4XGKA 3PTZA 4XQCA 3WGOA 5TT0A 2GASA 5BT9A 3UCEA 3DMTA 4GX1A 2J8ZA 4AJ1A 2WDZA 1EMDA 1MX3A 1C1XA 3E5MA 2HK8A 2HQ1A 2F00A 1QP8A 4O6VA 4D46A 1P45A 3LC2O 3BMNB 3KYCB 4G81A 3ZV3A 3KSDO 2VUTA 1ZO8A 2AQHA 2Y93A 4WOJA 1DLIA 4QQRA 3DWFA 3H2ZA 5GMOA 1GTMA 5KWEA 1SZJG 1ZSYA 4TROA 2NVWA 1Q0HA 4KMSA 1HTBA 1E5QA 3FR7A 2G17A 1GQYA 5IF3A 4RLHA 5A1TA 1E5LA 3F4LA 3AOEA 4D0RA 3PQDA 1HLPA 4RQUA 3V2GA 5A4DA 1NWHA 2J5KA 3VDQA 5L45A 1I01A 1A4IA 2YFHA 1GY8A 2HO5A 4ROSA 5U1PA 5I7SA 3MJEA 1Q7CA 4BO4A 2P9EA 1BSVA 1NWCA 1A7KA 3HFGA 3RU7A 1QYVA 3RUIA 4ALMA 4CM8A 3ZWPA 4CM5A 2LDBA 5TJ9A 2PLAA 1DRUA 2I5PO 3F5QA 4IDAA 4A73A 4MVJA 1MG0A 3S2GA 3TZCA 1PS9A 4ZVVA 3DB2A 5IXYA 1E1LA 1XELA 4NU5A 1KERA 1W4ZA 3IDSA 2PWZA 1P0CA 3RASA 3HE3A 1ZVMA 3QLJA 4GKVA 5LCXA 3OEWA 3GMSA 4XRRA 1E7RA 1K89A 4OKIA 1FDWA 2PD4A 1MB4A 4DMMA 4CQMB 1ZFNA 4NH4A 4R5MA 1I5RA 5HS4A 4I5DA 4DWVA 2CMDA 3WJAA 1U3TA 1HDOA 2BMAA 4LMRA 1H6AA 4DGSA 5L9AA 3L6OO 3PLRA 1C1DB 4YJFB 5KVVA 2VOJA 3KYDA 3NTOA 1HYGA 1T25A 1X7HA 4FC7A 4QX6A 1AN9A 3MZ0A 3WGYA 1H9BA 4N7RA 3SXPA 1PJ3A 1N9GB 1NPYA 3WG9A 4CMGA 4S3MA 2ZB7A 2YQ4A 4AJJA 3WGIA 2EERA 3E5RA 4FDAA 3TL2A 3NV9A 5I8WA 1XYGA 1E6EA 2H63A 3JQAB 3QVTA 4RPHA 4ZN6A 2X22A 5DULA 3C7DB 3GUCA 4RPKA 4RVDA 5KVCA 2IRWA 4FPXA 4IQ0A 4YJDA 1ENYA 1LRKA 2JFFA 5TRTA 2NM0A 4GAEA 5KKCA 3SVTA 1HZJA 2Y67A 4KDFA 2V6FA 3F9IA 4IZHA 1LUAA 4EITA 2FR8A 3RBVA 1LDYA 1Y9AA 1P9LA 4NHEA 2E49A 1BRMA 4RLSA 4IS2A 3MTGA 4CMAA 3NGLA 2I76A 3WOHA 2GN6A 2YW9A 4JNKA 1LLDA 4CLXA 4E2YA 3WLEA 3L6EA 4EJMA 1PL6A 3JQDA 3QE3A 3JQ6A 3HNPA 1B2LA 3TZKA 3DBHB 2WYUA 4BO0A 3ST7A 5C37A 3D1LA 4O1MA 1DC4A 4UVIA 3EK2A 4DREA 1H93A 1PS8A 2B4QA 3CKYA 3GT0A 1VL0A 5DOVA 2AMFA 1R0KA 1YJQA 4FN4A 4WJZA 3FN4A 2EEZA 4GI2A 1RYEA 3RKRA 3TOZA 2JAHA 2IZ0A 3UW3A 3C1OA 4Y6RA 2DBQA 5FEUA 1PWXA 3PWZA 2CVOA 4E5PA 4GMGA 1N2SA 1Z74A 2BFOA 3DZKA 5JAZA 4ZGWA 3GZNA 3TZ6A 4BGUA 1DO8A 3EGOA 1HT0A 2POQX 4J1NA 3DZJA 1MP0A 2HK7A 1EFKA 1G1AA 2CD9A 2EWMA 2B35A 4L4SA 1DAOA 4E6PA 1U7HA 1CQJA 1KEWA 2HMWA 1IYZA 3CMMA 4L0QA 3RROA 1D8AA 4PLTA 1IULA 1XLTA 1PJ4A 3RWBA 9LDBA 3CE6A 4DQVA 3U4IA 2AG8A 2C7VA 3Q9UA 4J0EA 4PLYA 1SEPA 1I3NA 1F8GA 3ZHZA 1MFZA 4AL4A 1E3WA 1PX0A 3KLPX 2Q3EA 1YGYA 1A72A 4BVAA 1NYTA 5EIOA 4YT5A 1ADFA 1JQBA 1X0XA 3TL3A 1E7QA 5F21A 3H7AA 4Q39A 2IE0A 2QYTA 2W8ZA 5A9SA 3D4PA 4J43A 4FOOA 4OXKA 4WEQA 3EDMA 1BXGB 3AWDA 1EBFA 4UAGA 2QIOA 5BNIA 2X9GA 3OIGA 4IDGA 4N5LA 4CM6A 4EEZA 3LSYA 5BNFA 3MJ4A 3OQ6A 4R69A 4AVYA 2Z1NA 2PH3A 2P9CA 2V6MA 4YAKA 2JL1A 3ZV5A 4BB5A 4BNUA 4CMBA 3IP3A 2QYSA 4M1QA 3JSAA 2A35A 1HDZA 3TZQA 4ND4A 1F06A 5IFLA 3B1FA 2NU8A 1HWYA 1JTVA 2GZ3A 1QYXA 1NVGA 1O95A 3FRJA 4J2OA 4ZHSA 4U7WA 5BSGA 2FWMX 1YQDA 3F1LA 1W0CA 3D5TA 3NDIA 2EF1A 3G79A 5ITWA 5ER9A 2IXAA 4IJUA 3AU8A 4CM4B 2A9FA 2UV8A 4EI2A 5EL0A 1U2DA 4JBGA 1WPQA 1JAYA 3EMKA 1EUDA 3O03A 4ZA2A 4I9UA 4GX0A 2A94A 3ZV6A 5I9LA 4C4OA 3PWSA 3OM9A 1M67A 3VTZA 1NQ5A 4Z9XA 4CLRB 4K6CA 1IPEA 2VHVA 4C7KA 2PNFA 1B7GO 2HLPA 3LDHA 4CLDA 3L0DA 4J7UA 1OMOA 4QUKA 3D3WB 3O4RA 1V3UA 1PJTA 1UXJA 1MC5A 2Q1TA 3KYCA 5IN5A 2E6UX 4D3DA 3AOGA 4TSKA 3E9QA 3WBFA 4Z9FA 1VL8A 4ILKA 1DSSG 1BVUA 1O5IA 4AICA 1HYHA 2A92A 2WWRA 1YO6A 2VWHA 1SB8A 3PFWO 3PLNA 5COAA 1E7YA 2DUWA 1PZEA 3C7CB 3WBBA 8LDHA 4FGSA 4XYGA 4XEHA 4UVGA 1A9ZA 4YRAA 1YOVB 2NNLD 2DTEA 2X5JO 5CEFA 5TNXA 2UAGA 1XQ1A 3ANMA 4NFYA 1ONOA 5CFZA 1YL5A 1VJ1A 4NBUA 2IYPA 2HU2A 5J23A 1MXFA 2H9IA 3NDRA 3AY3A 5G0TA 4RVSA 2E4AA 3Q2IA 4BNGA 2WD7A 4CMEA 4XKJA 4HWKA 2DAPA 1SEVA 3VC7A 3I3OA 5KJEA 2W2LA 3OSUA 1NQAO 1Z82A 4NJOA 4EDFA 4ESOA 3LC7O 4R9SA 4CV0A 3DHNA 3GVPA 1I0ZA 4XB1A 1ADBA 3WNVA 4Q3NA 1ZH8A 4CQMA 3OETA 4JJGA 1DPGA 4WKGA 3F4BA 1ISIA 1NAIA 3UCFA 4PG8A 4MVJG 3VVBA 2RAFA 4Y98A 1A5ZA 5T8KC 2YUTA 1T26A 4R4JA 4WLVA 5JXWA 1UDCA 1GUYA 1ZW1A 2DFVA 4YDRA 1NX6A 2VT2A 1PWZA 3P19A 3HN7A 4J9UE 4XDYA 4YJFA 1LDMA 1ZEJA 2ZTVA 5BSEA 1UXKA 1XGKA 5KCZA 1MXHA 5A02A 3FD8A 2CUKA 2QRJA 3IC5A 3KO8A 4JX8A 4OXNA 4R3NA 1N9GA 2AQ8A 1ISFA 4L76A 5JYEA 4PVCA 3JQFC 3IIEA 4KDEA 3CZMA 2HMTA 3V8BA 1P0FA 5A9RA 3H9QA 3WQRA 1J4AA 2X5KO 3JQAA 1RJWA 3SX2A 2IEBA 3COSA 4NBWA 4E5YA 2D0IA 5BQFA 4R41A 1P74A 2CF6A 2QG4A 5GY7A 3ASVA 3K2EA 5COBA 4OO3A 5KJFA 1NPTO 4EBFA 1O8CA 3RUCA 3VZSA 5THQA 1C1XB 3FF4A 3ZDFA 1SOWA 4RCVA 1ZMOA 2PR2A 3U4HA 2O3TA 1XSEA 4YJHB 2FSVA 2VNSA 3JQCA 1GYPA 4GPD1 4J90A 3TFOA 1T24A 4GLOA 3RI3A 5HWSA 3PJFA 1DDOA 2Y99A 1PQWA 5DCYA 2G5CA 3WWYA 4NNJA 4XR4A 2BH9A 4J3FA 3DBHA 4ALLA 1SPXA 4WPGA 3QQPA 1B15A 2P4HX 1ENOA 1F12A 1PJBA 3STHA 3V5NA 1NBOA 1UXGA 3O8QB 4FR5A 4HADA 3OH8A 1YB1A 4FBGA 4JK3A 3ROMA 5L7WA 1EQ2A 4R68A 1QMGA 4BNJA 2JHGA 3K5PA 3OFSA 4UVEA 2QHXA 4A2CA 3I1JA 1CERA 5K9ZA 2Q4EA 3D0OA 5CDUA 1PGOA 4E33A 1KVSA 3B70A 5LDGA 3WICA 4D44A 1CETA 2B5VA 4NU6A 1UAGA 1PIWA 3DMYA 5DBFA 1E3LA 4DQUA 1C0IA 3AY7A 4BO2A 3SBOA 4M49A 4MOWA 3G49A 1ID1A 2Q1SA 3C8MA 4MPDA 4ND3A 3RVDA 1D7OA 3ASUA 1VRWA 1Q1NA 4AJPA 4YAJA 3V2UA 4W4TA 1SOVA 2Y0CA 3JCZA 4PZDA 1Y1PA 5CP8A 3S1LA 4NG5A 1YH3A 1NQTA 1Q0LA 2IZZA 4ZU3A 3FTPA 1P1FA 1ZZEA 4GWKA 4LSWA 1M75A 3KYDB 3FNGA 4JGBA 2Y1CA 3NYWA 2AEFA 2VYVD 4DVJA 1KVUA 2B4TO 3QHAA 1QYDA 3WXBA 4FSHA 1BXGA 2GF2A 5IXSA 2HCTA 1BGVA 1OC4A 4J7XA 4K6FA 2EKLA 4TRJA 2JCYA 3GVXA 3OEYA 1A71A 3HN2A 4Y6SA 2C0CA 3AM5A 2I3AA 3RC2A 3WSVA 2CY0A 3W8DA 3W6ZA 4HFMA 2FOIA 4KZPA 3IP1A 2O4UX 4IUYA 3PPIA 1ZKMA 2CF5A 4QO7A 4I1IA 4AJHA 3X2EA 3PWKA 3S8MA 1XHLA 4CV3A 5B4UA 1I30A 3GK3A 4QFDA 4ZQHA 1JAXA 4JLWA 4HY3A 1Q7GA 3GPIA 2XXJA 5ICSA 1ISGA 5IZ4A 3G17A 3L9WA 1LU9A 4LCJA 3OMLA 3GNTA 2I6TA 1D4FA 3E03A 4CLEA 5A5EA 1GCOA 4RL6A 3GRKA 4XYMA 4XA8A 3FBGA 3KETA 3INGA 3BXXA 4AG3A 1HE3A 1HE2A 1LQUA 3VZPA 2ZB3A 1GU7A 3V1TC 1A4UA 3E8XA 4CM4A 1XU7A 3PVZA 4QXMA 4A0SA 1E6WA 1UXHA 3GRPA 1H2HA 3MJVA 4NJMA 3AUAA 4E30A 4PLFA 1C0KA 2GNAA 1HXHA 5L4LA 5AXCA 3MWEB 5G0UA 1DEHA 3GEGA 3WWZA 3GUYA 2UYYA 4I5FA 4QSMA 5DBGA 3RBXA 2Q2VA 3LF1A 3OECA 4BNVA 2P2SA 3S2EA 2DT5A 2X1HA 2X6TA 3FTNA 3GZNB 3Q2KA 1WDMA 1X13A 3I52A 3U4DA 2WEKA 1JKFA 3HDHA 1AXGA 4MIOA 1P33A 2GD1O 4CUZA 4TVBA 2R00C 3D3WA 3WYEA 1TVEA 5FI3A 4QT0A 5JMPA 2BI8A 4FFMA 4CUKA 1NFRA 5DT9A 4BKOA 4BGEA 2IYOA 1WZIA 3MWDB 4FGWA 3N74A 4TMFA 1D3AA 3CEAA 4AJLA 4UEOA 3JYNA 2YYYA 3HWRA 2I99A 5JPIA 2O50A 1YOVA 4PLZA 3DZBA 4RPJA 5JO9A 3TJRA 4OIMA 1NR1A 1KETA 2JFHA 2FMUA 4PG4A 1UP6A 4YT4A 5C7IO 4F6LA 1E92A 1EVIA 2RCYA 2CDCA 4WLEA 3JQFA 4PLHA 1D1TA 4LRTB 4UUPA 4BKPA 1UP7A 1PEDA 3MTJA 4W99A 3D4OA 3JQGB 3DZGA 3PYXA 5DP1A 1KOLA 1ZK4A 4PIVA 4KTVE 4CM9D 2PY6A 3CXRA 4D3FA 5I7VA 1H0KA 4BO6A 1OBFO 3P2YA 2GERA 3ENNA 3RFTA 3IJPA 4NPCA 3NJ4A 3GQVA 3VZQA 1QLJA 4WE3A 4CODB 1HF3A 1QRRA 1EVJA 3FBTA 2GN8A 2OP0A 2ILTA 3JTMA 5KNLA 3MOGA 2EKPA 1BHSA 4W9NA 4YRBA 3S2IA 4CV1A 2NU9A 2HJRA 3DTTA 1AE1A 5JMWA 3ANNA 4DPLA 1GUZA 5ENVA 1HSOA 2P9GA 4BQPA 3KYBA 1IZ0A 2F1KA 5JY1A 2WTBA 1XA0A 3D7LA 1LNQA 4Q3DA 2VRCD 4KUEA 1OI7A 1W8DA 4OH1A 5EQFA 2TMGA 1JWBB 3L77A 4M89A 4P8RA 5JCXA 2EP5A 5T67A 4HNHA 5JDCC 3ZWBA 3KB6A 3KSZO 1BW9B 1QG6A 1EQUA 4BO7A 2CFCA 5EERA 4YAIA 4RZIA 1T1SA 1U9JA 2NUAA 1XCBA 3AI2A 4Y67A 3ZV4A 1NR7A 1X1EA 2WM3A 3UXYA 1R66A 4PG5A 4CMCA 4YJHA 1GUFA 4XD2A 5AXBA 1HLDA 2BGLA 3K73O 3GVHA 3A06A 4D42A 2VZ9A 1N92A 3EVNA 1DB3A 4DIFA 1QR6A 2A4KA 3QIVA 5EESA 2C54A 2BFMA 1B26A 4BO5A 4IXWA 3FSRA 3O8QA 4WLNA 3PK0A 3W8FA 4EGFA 4NIMA 3VHRA 2ZIZA 3H2SA 4XQ9A 4J49A 4A03A 2NVBA 3A9WA 3PZRA 3WTBA 2EJVA 1LDEA 5G4LA 2WD7B 3GZ4A 3R0IA 4LCEA 3ZH2A 1I3MA 4ZICA 1RWBA 3GGOA 2JJYA 4KQWA 1T2CA 3CH6A 5A06A 4J91A 3X2FA 1KYQA 2GSDA 1YONA 3NJ8A 4L73A 1DIHA 1GZ4A 3EUWA 1RM4A 4KWHA 3PDUA 1IOLA 1FDTA 4F6CA 5AXAA 1DHRA 1UP4A 4E5KA 1R16A 5DCWA 3F1KA 4ALNA 1DJNA 1XU9A 1T2EA 3LF2A 3DAPA 3QWHA 4OXYA 1X7DA 4DPMA 4U6QA 1IUKA 1SCUA 2CSUA 4U0KA 1FXSA 3IAHA 3QWBA 1IB6A 2C5AA 2OP1A 4JIGA 3BYZA 5DZSA 5B1YA 1ULUA 3IMFA 2XOXA 3W4JA 3E82A 3KSUA 3LT0A 4MVJP 2EV9A 2EG9A 3SEFA 1YL7A 4K28A 1E7MA 2Q1UA 2VHYA 2VNAA 2DC1A 3PRJA 3M2TA 1I2CA 1NHWA 3DOCA 1HDCA 4GSKA 1B8PA 5A04A 3D4NA 4D41A 4M55A 1NVMB 3GGGA 1EFLA 1VL6A 3FPCA 1IL0A 3G0OA 3ULKA 4CMJA 4U8GA 4FJ1A 5JAMA 1B3BA 3ICCA 2VWGA 3RUEA 1LSOA 2NQ8A 3C24A 3EVTA 3L07A 3RUFA 2HUNA 5JS6A 3UGKA 3WYCA 4URFA 4Z0HO 4GH5A 1QYWA 1P77A 1SB9A 4A10A 3IKVA 1LC3A 2PGLA 1YL6A 3JQ7B 1BXZA 4KWIA 1X14A 2GN9A 3QY9A 1Y5MA 4K9DA 2B36A 3RIHA 1L7EA 4A5OA 3FI9A 5TT1A 1OFGA 4YT8A 4IDEA 4XRGA 1R37A 3T4XA 1KEUA 1H94A 4HKTA 4IIUA 1NQOA 4FB5A 4A7PA 1NVTA 2DKNA 4BNLA 4R1UA 4XJSA 5ILGA 4QECA 4BNMA 1GFSA 3UUWA 4DBVO 4GQAA 1WMAA 4PLWA 1GV0A 1IY8A 4II2A 4MVJE 3QVOA 5C3MA 1MC4A 2C82A 1E3SA 4WOKA 3VH2A 4ALKA 2YY7A 4EUHA 4J2HA 2JFGA 4YPOA 2DUUA 3KBOA 3RFXA 3AI3A 5KOIA 4W6ZA 2H6EA 2FN7A 3GEMA 2PZLA 3KOUA 4IS3A 1F17A 2X23A 5ADHA 3DDNA 4O63O 3KV3O 3RJ5A 4OJNA 2PZKA 4E2WA 1U28A 3I4FA 1CJCA 3E48A 4XCVA 2Q2WA 1R4NB 1NTOA 5BR7A 3I9JA 2C7GA 5EJ2A 1BG6A 2NSDA 4NFHA 3GN2A 1HZZA 4GX2A 4YT2A 2OO5A 2G76A 3PJEA 2G0TA 4IMPA 1NASA 3DTYA 1HKUA 3K6JA 4YJGB 5GZ3A
chains in the Genus database with same CATH superfamily
2EF0A 2BGGA 5JQGA 3D8BA 5AK4A 4PSAA 1QIJA 5T41A 5FYDA 2IPAB 1E7WA 3IV6A 3O73A 5GONB 5T6MA 2GBFA 1QWSA 3R3VA 5IJAA 5TC4A 3SZRA 4AKIA 1SXGA 2QMEA 2ZIWB 3QJYA 5EIWA 3RJMA 2CXTA 3T7TA 3W5CA 4KR7A 4IO1A 2F4VB 3NIFB 4BJHB 2YQ5A 3QPBA 2BDEA 3GT3A 4PTLA 1GKLA 3AVUA 1X6VA 1GOTA 1MPTA 4ECEA 3M0EA 1J0DA 4FD3A 1ECBA 1EXNA 4KACA 2VRBA 2CMGA 4MQLA 5CX1A 3TVDA 3BGIA 1XQ6A 1U9IC 5B2EA 1FSZA 1KA9H 4FSXA 3KV1A 2QM7A 1RHMA 1OT3A 1PX2A 3DE4X 3WLAA 1FDSA 1OYVA 1SVMA 3M49A 4GBMA 2XNKA 3HFSA 3GEPA 4WXRA 1E0AA 1W2GA 3EXEA 3KXLA 4LJ7A 4R1PA 4DCJA 5BXYA 2XUZA 3OY2A 5IM4A 3I9LA 4MP6A 3AWIA 4KHZA 4EKNB 5DGXA 3TVTA 4YX9A 5BN1A 2G9QA 4QJBA 1COWA 3KKKA 4RVCA 5G2OA 2WU0A 1FZTA 3M6MD 1DGQA 1PT8A 2ZREA 3MAJA 3OA2A 2FW1A 4OP1A 1SHZA 3BK1A 3RGWS 3KUCA 3ZGVA 1JLLB 3CX3A 3V42A 2IOYA 5JU6A 1ZHHA 2FSSA 2CVHA 3FVTA 2ZBDA 3SIWA 1RE0A 2PNJA 3MYYA 1FF9A 4B3XA 4NCHA 4GRIA 2OCPA 3VKUA 1SBIA 1Z6ZA 2O7SA 3HM9A 4Q19A 3NT4A 2ZK7A 4EI8A 1YCGA 1DTEA 4WNAB 4OQXA 5FI5A 1M5UA 3JZMA 3KDAA 4MZXA 5KYGA 1GFWA 1GPAA 2QPAA 4RKQA 1KEPA 1GPMA 1U3FA 3V8NA 2RHCA 3AU9A 2OYRA 3ER8A 4MULA 4CDMA 3BHNA 2O7QA 1XMSA 2YRWA 3ELUA 3ETLA 4EM6A 3VISA 1NNLA 2E55A 1GM5A 2II6A 2VYND 2BCGY 4M7RA 1A95A 4K9SA 4PYOA 3OSZA 1QZUA 4FN5A 3VYTB 3BULA 3D6UA 3Q5GA 1NOJA 1MU0A 1CF4A 3B5IA 3D2BA 4J7CA 3DAYA 3QU7A 3BE4A 4MVJI 3I4CA 4D0SA 1H6CA 3I42A 1M8KA 3TLGB 3W1VA 1E79A 5KNCH 1OBHA 5MFZA 5GP1A 2KHZA 3ED5A 1S4QA 3SFVA 2P6MA 1KK2A 3WYNA 4EYOA 2O2EA 2PR7A 4NFLA 1JIXA 2PUBA 2NTNA 3ZBTA 1VYHA 4YMUA 4OHBA 1WP4A 1N8NA 3ELDA 4WBNF 1BJKA 2MR5A 3RVRA 3O7MA 4E12A 4EL5A 1RRMA 2I2DA 3A7DA 4PAGA 4RSHA 5T4FA 4DCOA 2DBRA 4WLOA 3VPSA 1UJ6A 4NATA 1R8YA 4LZWA 1JFFA 3WFJA 1H4TA 1IXRC 4BFLA 3OJ0A 4GL4A 3E5HA 4US0R 4YFVA 2QNIA 2I29A 1PLJA 5K7SA 3PFFA 3P97A 1OD6A 3ABZA 2IPMA 3IPXA 3BJMA 4HQLA 2ZULA 4R40A 4YRFA 5ER6A 5EWJA 4EY3A 3BVPA 4GDFA 3HRIA 1WNTA 2BFEB 3PFGA 1AGRA 4H18A 1ENZA 3WDSA 1FA9A 1NF9A 3X1YA 3D3QA 1TQDA 1N6KA 5EFZA 1HPLA 3I1FA 4PG7A 1ZL2A 5H16A 3WIBA 1FNDA 1GA4A 3B1YA 3PUXA 4RKFA 2NADA 2W22A 2X40A 4XPIB 3ZHBA 2PVCA 5IU6A 1ZUNB 3N8NA 4L9SA 1VKHA 4B2IA 4EHIA 1OH8A 2EHDA 3DZIA 2B4RO 1ZITA 4B84A 3A3KA 2BTQB 1GRNA 3AIMA 3IP6A 5AKXA 4BLWA 4RC9A 5I47A 1RPTA 3BMQA 1V9LA 3UA3A 3EC7A 2ROQA 4ESVA 3OPYA 4O5OA 5M5BA 5I4KA 1WZEA 3P2OA 1GPBA 2HFJA 4ML3A 4KGVA 3FYUA 1KYIA 3EPRA 4H3HB 4OLJA 4V1CA 2LXNA 1M1NB 2H51A 3KSBC 4I50B 1O7JA 1YMQA 3FLBA 4YPFA 2HZBA 2Y92A 1ZX1A 2SBTA 4K7JA 5IFKA 1C8LA 2VO1A 3I2JA 5K3AA 1N5DA 4BDTA 2Q0SA 3AFNA 1GPH1 3JRXA 3O9MA 4JP3A 3KSAC 2WWYA 2XQKA 5EPEA 4CVNA 2PL5A 3LP5A 4MUNA 3CX4A 3GJSA 3NX4A 4DRYA 2OTCA 5LQAA 3VGJA 2H1VA 2JGJA 3AIOA 4HDSB 1AV6A 1H8HD 1QFJA 4UC0A 2AV6A 3FDZB 2OPHA 3OM8A 4Q01A 4L8YA 5E9WA 5AVKA 2O23A 4BJ5A 3NU1A 1SKAA 5JY6A 1FC0A 2IF0A 2ZG6A 3ONEA 3ONFA 1S8NA 2ECFA 2X1VA 4RTMA 2XXAA 3VPGA 3OJFA 4NVRA 4OSEA 3RV4A 3X1KA 4UU1A 3A4IA 3PVSA 2ZJ6A 1X86B 4M22A 4ZT2A 3KZKA 3PDJA 5BV2P 3EIHA 5FI1B 2BGWA 2QVZX 4TTQA 4UM9B 2X4DA 1NOKA 4FKMA 1J2EA 3S55A 1XXHA 3WLJA 4CF3A 4ACAA 3DEIA 3FVRA 4A8JA 2B83A 2ZSHA 4QXRA 3W0LB 5F7OA 3JQ7A 1TEXA 1GDDA 5DLEA 1CFZA 1HQCA 2EP7A 1KTIA 2GAAA 2HRZA 4H27A 1G17A 2O8DA 3ICEA 4LYJA 1FFCA 1EJ2A 1Y98A 3MFQA 2W2QA 1W94A 2I66A 3LZ6A 2GN1A 3D2AA 1KQNA 3ZWKA 3LTNC 2Q4OA 1H05A 1YS2X 3KT8A 3E8MA 4G4IA 1K6JA 3UWKA 5AFSA 1I10A 4X8OA 3BE6A 3LX6A 4UU0A 3KKLA 3H5TA 2KPOA 2JI9A 2ZSIA 1F7VA 1NY5A 3Q11A 2GPTA 2ZBVA 2HF7A 5KDOA 1ZI9A 1G8GA 2A0WA 1VSBA 3FGZA 4Q02A 1M1YA 1PFWA 5AHKA 5EQTA 2OFFA 1BH2A 1QIHA 4X94A 2W2OA 3RSSA 2W93A 2V0CA 3AHHA 1LA2A 1N5KA 1UDAA 1ZAKA 4X1YB 1EZ4A 4I7EA 1KVQA 2XYPA 3CLVA 3RJTA 4O3MA 2VUHB 4BKOA 3MNFA 5KB3A 5E0OA 3DONA 1P1RA 5EZSA 2RE8A 1JAHA 1MT0A 5SZHB 4YR9A 2C29D 1Y4ZA 3E0XA 4A0QA 3IQGX 1XF9A 1JU4A 4EO4A 2QUAA 7MDHA 1JMYA 1IHDA 2YXPX 4TKUB 5L3RA 4LFBB 5M2QA 3P9YA 1ZMTA 1F4LA 2OB1A 3OP1A 4REMA 1FLVA 2YX1A 3I45A 5EXDA 1WCWA 2PLFA 2Q3JA 1R4NA 1E0SA 1RWKA 4Q4JB 4I6JA 3T06B 3M5WA 1O6FA 3P94A 4Z1MD 1M8GA 4R7GA 5A4KA 2XCSB 1GTVA 1E1MA 1EK5A 1QFXA 1YKSA 2GNPA 3QVXA 3O1HB 3AKCA 5FOUA 3NGMA 4B3IA 1K1EA 5BQPA 4YJGA 4EABA 5HQ3B 1LPOA 4OQMA 3IHWA 5EWMB 4Y1FA 2G08A 1OKKD 3SG0A 1GPYA 1M73E 4JC5A 4UXHA 4QYIA 1TYEB 3AI1A 1YTUA 1VOTA 4D96A 1U7OA 3WYDA 4EA6A 5BXQC 1TKAA 1NVUQ 4C89A 2OSVA 1SAYA 1PJ2A 5AVOA 2ZCVA 1QAQA 2NV6A 2VP6A 3JZFA 3K2IA 3WS7A 1JFLA 1TKCA 1KMQA 3AEXA 3H9UA 4I8IA 1NXTA 1VZ2A 1OYOA 3UTCA 3DW1X 1JEYB 4RADA 4TKMA 3GYGA 3MTDA 4IPTA 5AVSA 4BV3A 3NAGA 3CT6A 3NASA 1WVGA 4FCWA 1A96A 1Y8QA 2ZJ5A 4EEKA 2QRMA 3A58B 2EDCA 2RG7A 1CJKC 3ZVMA 2C57A 4XYBA 4R0NA 2CJYA 5CGZA 2VN8A 4FNGA 1RJGA 1NNUA 1ACLA 4FCTA 4G5YA 4R2KA 2P6OA 1BU5A 3C1UA 3S28A 3UMSA 3OQ1A 5MF6A 3KQLA 5CDFE 4ITUA 1QSGA 3ND5A 4RCVA 1Z4QA 2JAWA 3G9TA 5CGQB 4YEDA 2B8JA 3N86A 1YS1X 1YZLA 2Y05A 2RGBA 3G2LA 1LY1A 3JYLA 2C7OA 3PL5A 2B21A 5BVHB 2PWBA 3H5AA 2GK7A 4JHLA 4D99A 1FYDA 1JQKA 4TWIA 1WAMA 1K0FA 1NF3A 2GCOA 3MJTA 1EH5A 3JQBC 2FDXA 5LFAA 2I33A 4PV7A 4WBNB 1Y3AA 2XWQA 3OQIA 1E2JA 2Q1WA 3FNHA 3SYMA 4MYUA 4EVIA 5HNKA 1WBJB 4L4XA 5BWMA 4UBKA 1VDMA 4PX9A 5C8ZA 1FU7A 4GPIB 2ECKA 5SY9A 2E89A 4KITB 1KMHB 3OAAA 1ZVJA 2QX6A 3T5GA 5BSFA 5L7TA 4NULA 3V2HA 3J80A 2YWGA 2UYQA 1DC5A 1YQWA 2FMKA 4PYJA 5J5VA 4OBBA 5SY4A 4B7CA 3O82A 3A4VA 3A7EA 3U7FB 5KTMA 2X9NA 4UBOA 5HRAA 1LQTA 4OI1A 5BRNA 1EXWA 4QOIA 2FP4B 3HGTA 2DTXA 4ZEWA 4F6RA 3RU9A 3EW9A 2WSMA 5G0SA 4C4YA 3IAXA 2GBIA 1CW2B 5AM0A 2PL1A 3EVAA 1VYUA 4EB6B 1TCCA 1NVXQ 4RFSB 3KM0A 1L4EA 1MABA 3U31A 3MJCA 1TLTA 4UFNA 4CKBA 3UBTA 1OLSB 4C78A 1BC5A 3FWHA 5TDHA 5KI6A 1YUMA 1A50B 2MDTA 4X00A 1K0UA 3BGVA 4BLUA 4D8XA 1FTQA 2AOWA 2FCAA 3O75A 4ZV9A 1N57A 1ZUHA 1P9RA 2CNLA 2QZZA 4FTWA 4AJ4A 2I7CA 4BV2A 2G71A 2PSSA 1N6NA 1L8XA 5G3ZA 3BF7A 3SU8A 3ZU4A 1G8MA 1XCJA 4L85A 4H7HA 2QN3A 1ZN8A 1E6LA 4WK6A 4L8LA 2EOAA 2P3OA 3E1KA 3HJGA 1ZD1A 3J7AC 2WFLA 1U1EA 3C8DA 3ABOB 1V9CA 3K1YA 1VLLA 3OT4A 5BURA 5JYBA 3ZXUB 1A8UA 2WWGA 5DYYA 1VKJA 2FZ4A 4E5UA 3FRHA 4C4XA 3PC7A 4UVHA 1KJWA 1T9HA 1LK5A 1MO4A 1VIAA 3PE4A 1JI3A 1D1SA 1FX0A 1PK9A 1RWWA 4IXDA 3H2GA 2ZRFA 3HUDA 1D6SA 4GLLA 1PJSA 2X58A 2Y6VA 3P7MA 2AT1A 3ZS8A 5ICMA 3RAEC 1V8PA 3KXKA 1FYVA 1IMOA 3QE4A 1X0VA 3AETA 1Q7BA 1JHPA 2PT6A 1DI0A 2Y2UA 1NXOA 3BAFA 5EINA 4P4GA 5C8DA 3MQ2A 1IBMB 3E2MA 5CB4F 3I04A 4KBYA 4YQYA 1JR3E 3GAZA 4Z8XA 2ZE6A 5KU7A 5DF1A 1KK0A 3QKIA 1S7GA 3ESDA 3IOCA 2XSZD 4XIFA 2AF3C 1JJBA 1XKQA 3JVVA 3LIIA 2GR9A 4K1LA 2QD3A 2BH2A 2JI8A 3PJGA 4Y2UA 3SNHA 2R2GA 3ZHYA 2PG3A 1JPNA 2UVPB 1UJBA 4IXMA 3AM4A 1L5WA 1RZ3A 1VIYA 3MG9A 1O03A 3EEIA 3IDFA 4KWTA 5A71A 3WQHA 3DNMA 4B85A 4ER6A 1CUEA 5KWSA 5L4NA 1VG9B 3R5XA 4FQ5A 1L5GB 3A8TA 4KK3A 1D1PA 5L8VA 4FJ2A 2XQGA 2IOQA 4JVMA 1UZUA 4MS4A 4RVGA 1VE7A 4Y2VA 3FWZA 1U8AA 3T3GA 4YMSA 3HKBB 4J4BA 3ROPA 3N8HA 3GLIE 5CB0A 4EB0A 1NM5A 1O97C 1SG0A 2IITA 2WKSA 4CL3A 1FUIA 4LKOA 1ODKA 2P1RA 2H2AA 4HYQA 1W5AA 1M0WA 4M1WA 4NS1A 1L5HA 4LZOA 1J8VA 1ES9A 1JHOA 1Y8RB 2A9QA 1R6DA 2C9MA 3GVCA 3V55A 4BVFA 3UMCA 4BN4A 4UZFA 4LN1A 5CDSA 3T7CA 4RTSA 3WQSB 3U5ZB 5K2OA 2VRCA 3BIXA 4WSOA 1G9XA 2G4VA 3WK4A 4ALJA 4M7OA 1NY6A 4G4SO 4X65B 1LPNA 2IS4A 3GZTB 4XM2A 3WHIA 4FGLA 1DXHA 4ZJYA 5CU7A 2D1RA 4HZUA 1FW6A 4KR6A 4AW9A 3AY0A 5ISMA 1DUVG 3NVAA 5LN1A 4S2EA 1XU4A 1G7TA 1V6SA 1ZOPA 3EY4A 5T64A 4KREA 1CF2O 2DETA 3IAEA 4A0GA 1F6DA 2ET6A 2B94A 3M9XA 4MDYA 1W73A 4PQRA 3P0JA 1UJMA 3LVFO 2GEJA 4JLKA 5TEVA 3P0RA 4LZNA 1J0XO 2QQFA 1WSDA 3UK6A 2UYOA 4L07A 4FCCA 4EO7A 1YB2A 2PV7A 2HSDA 1EVLA 3RG2A 2R4TA 2FPIB 2YHIB 5LPNA 1IEXA 2Q5OA 3FPEA 2K5UA 2QJRA 3GW8A 3L0CA 2A7QA 3H1BA 3CSSA 1Q7TA 4ENQA 3GCWA 3VDRA 2ZWOA 2H8GA 2GMWA 2WP0A 5G4KB 3SZLA 3KTAB 3PITA 3H05A 1FNMA 2UUCB 4R8SA 1R4MA 4EUEA 4BNDA 3PT9A 2FZWA 1ENPA 2BFBA 3NIDB 3RRJA 3QG1A 3WIDA 5ENZA 4OYRA 3GJTA 2YJZA 4P22A 4AX8A 3KFVA 4RF3A 4AYXA 2GZ1A 4E7PA 4RV4A 2POCA 2A1UB 3AJEA 3CA8A 4GSLA 4DRZA 2J48A 4R54A 4B47A 3TECE 4MQEB 3JQ8B 1RRCA 5DHSA 4RPLA 3IOBA 1BFKA 4UMFA 4DIBA 3PGXA 5JEEA 2R8EA 1IJEA 2MYUA 5DI9A 4HHEA 1VXRA 4QHTA 1L8AA 2WW8A 3AYZB 2E48A 4NS4A 2X1LA 3PHJA 1N5MA 4YHBA 3E53A 2JW5A 3CQ9A 4EY7A 3L8MA 2P4UA 5H02A 4W5QA 4ND5A 1A9XA 4MUFA 3S8YA 1SIUA 1C0EA 1X1AA 4KO1S 2XB2A 3LLVA 3UENA 3K70D 4I2NA 5BW5A 4MINA 2DPGA 3I6ZA 4HBGA 2EJTA 4BPBA 3D7SA 4FLFA 2EQ5A 1ZG3A 4CQLA 1WP9A 3ENKA 3TM5A 1OGJA 5JOQA 1P80A 1A88A 1U0NA 1R5BA 4MUXA 2B6HA 1EX1A 4IMIB 1N2IA 2R9VA 3GAFA 3ZCTA 3RUAA 4FUQA 5EFOA 2K2QB 1FDRA 3RFUA 5CAEA 1GPUA 2K4MA 1DQPA 4TWZA 3ROKA 4CKWB 2HK6A 1F14A 1CIPA 1M0SA 1RSZA 2YDXA 1UH5A 4KNVA 3WK8A 4AJKA 3EC2A 4FOTA 5KX5F 5EZYF 3PNOA 1CT9A 1RIFA 2C96A 4LDAA 4JQCA 4N3GA 4ZP1A 1V1RA 5H5JA 5ALDA 4JMLA 4R2MA 2I4MA 3UY4A 4DW8A 4DRXA 3TF5A 2EVWX 2Q4DA 3GAAA 3GLHA 1MIOB 1S8FA 1VBNA 2Q4RA 1HDIA 3BMCB 4D43A 4D80A 10MHA 5KUTA 3EXAA 5EIAA 5EHZA 1YE3A 3CMCO 3EZFA 3PD7A 4B4WA 3K9GA 2R6JA 1X1SA 2RIPA 1CUAA 3K92A 3QKSA 4C0WA 5DNAA 4E2ZA 3LFHA 3UMYA 4TWAA 3O92A 4TM8A 1NUAA 1ZKDA 2ZVDA 4YAGA 1KEZA 4ARSA 1F0YA 1CUVA 1NRWA 2AFHE 3BXPA 3C85A 1RTTA 3DL2A 4HPJB 3T0IA 4Q7KA 4DZZA 1TZJA 4F4DA 4TTIA 4U7PB 2E82A 1FU4A 5H7XA 3L41A 2GVNA 2VZ0A 3QE2A 5FRDA 2JAPA 2PZJA 4Q9JA 1QQ6A 1Y7PA 4E4YA 3QMVA 5G1OA 4WA7A 2WY2D 5I7UA 3Q6NA 3H17A 2EJCA 4KOAA 1QX3A 3HTXA 2XGSA 1OBOA 5LYJF 3L5KA 3A6JA 1BEZA 1XBTA 3TQRA 4D9BA 4ZTUB 3KUDA 1S2IA 2BMFA 3WGTA 3CH5A 1ZPDA 2W6JD 1N1DA 2GFQA 5JXHA 3CN9A 3M4YA 1NP7A 3LT1A 3NXKA 4WVLA 4HDMB 3ZLTA 4EX7A 1DTWA 1Z5NA 1ZGJA 3D6FA 1CUCA 3MPUA 5I7AA 2P3LA 3TLCA 3CF4A 1DOAA 5JS8A 3ETEA 4WCVA 4B6GA 4DIDA 1TEVA 2PAAA 4YAOA 1G3QA 2DLNA 2Z3VA 2O2ZA 3IERA 5KU1A 5LQNA 2ERCA 1ETHA 2QYHA 1ZMRA 3COWA 4H7DA 2YJ3A 3FVVA 4Z7OB 5LIRA 3OCJA 4ZQCB 1VP3A 2PGJA 3GJ5A 3QUTA 1H9AA 2HC9A 2PS3A 4HLQB 3H5WA 3IE1A 3BT7A 1JDSA 1F0PA 1G21E 4FZ5A 5FCDA 1JDUA 3D8RA 2IY8A 3UF0A 3VBCA 3ZLVA 1DL5A 1ABFA 2VP5A 4UCFA 2W6PA 3OCUA 2XYGA 4LRXA 3U7JA 4EHDA 4R1TA 2C7RA 3A28A 1EE1A 5B64A 3CH4B 3AEUB 3SZMA 1VHJA 4RULA 4E5NA 4TPKA 1YVEI 2QTAA 4E07A 5EJ8A 4HB2A 3ZDQA 2NXNA 2NZYA 2Q50A 3CSUA 2QVGA 5TF4A 5KMGA 2BR3A 2XMGA 3HYCA 4MP8A 2H18A 3C8ZA 1VP9A 3DO6A 3WGJA 3CYFA 1QV6A 4EFNA 1SZCA 3GLVA 3PFBA 3TXYA 2VT3A 4REOA 2PAFA 1JDNA 5E3JA 1GUDA 3DHYA 2AW5A 2GN4A 2G3YA 2OV8A 5DTQA 4FDLA 2W11A 5FUBA 1GHTA 4UJ3A 4IJWA 1C7JA 2YFQA 4YCDA 3FMPB 3GFGA 4YMTA 1NTRA 1AY0A 2FFAA 5MGBA 1WXXA 2QL5A 3CO5A 5F5LA 3ZE6A 4EBBA 1FSPA 5FA5A 2OHHA 4YRNA 1EX9A 1T6BY 4L6IA 1GSIA 1ACJA 2R68A 4BNWA 5HUQA 1A77A 4UDNA 4YQFA 5I7RA 2EFJA 1AKYA 5EN4A 3RARA 4LVUA 3LCRA 2HTEA 2Q7DA 1L7DA 3I0NA 3JQ9A 5H81A 1HDEA 1LI7A 4BV8A 4G8CA 4H08A 2G8LA 4Y2PA 2EHJA 3KL4A 4L0DA 4POAA 3TKAA 3W06A 2O1XA 2J6IA 2VZLA 3KCNA 2YOFA 3WV5A 4OHUA 2IIQA 1CB0A 1XA3A 3GH1A 3RIEA 3TNFA 4KMMA 5DX8A 2G88A 4R71A 2N46A 2HCFA 1CY1A 2VF2A 1UFQA 3EF1A 4KH0A 2UXCB 1DAGA 1ZGCA 3WGZA 4ER0A 3HCCA 1H65A 4O3FA 4EZBA 2XD4A 1Z5ZA 3IHTA 3ZXYA 4Y6PA 2ETXA 2QG6A 3IMGA 4N54A 3HPQA 3RKSA 1GN9A 1LNZA 1MGPA 1MX9A 3M6XA 1YKFA 4QO8A 3LBYA 3JQEA 5E2IA 3WRYC 1TTQB 5HRCA 2RHGB 1Z8FA 2R6FA 1V6AA 3OLYA 1EHIA 1N5LA 1UKVY 3AR9A 3DCIA 4L3VA 4B48A 3PUKA 5HCIA 1N0UA 1RACA 4HMQA 3LS2A 4P2BA 3SZ3A 2IXDA 1KY2A 4B40A 4WLFA 4EFMA 3OLWA 4B8ZA 4J4HA 3WVNA 3JD2A 3PU6A 5E6UA 2OCDA 4Z0PA 5TB5A 4YXFA 4FFNA 3NTUA 4EPWA 4JSYA 4MI1A 2HHAA 3HJHA 4G97A 1K4MA 2VNHA 3HDJA 1KR5A 5I8ZA 3Q7TA 1TK3A 2DY0A 4TV9A 5IDYA 4ZJUA 5TJHA 4LI3X 3HU3A 4IJ5A 5D8DA 1YS6A 1Z18A 3ZVRA 3MCTA 5B5SA 3BILA 3TQTA 3HWSA 4KE6A 5BUSA 3OMXA 1ZLXA 1XNGA 3SBXA 3WMRA 1PU2A 4PWZA 1U4SA 3KR9A 2CCKA 5HS6A 4KPEC 5CLQA 1IWBB 2HSJA 2YASA 3NM5A 4W1RA 3Q88A 1C0LA 4MUYA 3ZY3A 2C92A 1CR4A 1GTG1 2QAIA 3L84A 3AV3A 3T3PB 5DN6D 1G5FA 1JSCA 1JU9A 1ZDMA 2V03A 3ZWMA 2VYNA 3P5SA 5FLEX 1YIDA 3T52A 3W6NA 3CZRA 3B82A 3MILA 3I37X 2GJSA 7ADHA 3B1JA 5GVRA 4B6SA 2O2DA 5LOVA 2J0SA 4U8HA 3ETJA 5C5DA 4BO1A 4EMSA 1GYRA 2FMXA 1KSJA 6ADHA 1N8KA 2IWHA 1F38A 1AGXA 1T29A 2A88A 2VHTA 5HQJA 1BWSA 4IVPA 1NMSA 1TYCA 4CPDA 5A3QA 5JZOA 1HNZB 3OIVA 1GQQA 2Y4OA 2H5LA 4MA0A 5I01A 2UU9B 2DBVO 1T5TA 2XMPA 2BLLA 4HGOA 1M7HA 4PAOA 1V11B 4NOJA 1TL7C 1NMZA 2VXBA 5ED4A 1IIBA 4HN2A 1V8BA 4Q03A 5AVQA 3OIDA 1TVKB 2PUHA 3BWEA 4LMBA 1LVGA 3OJOA 5DYNA 3TLMA 4U2BA 3VGPA 4WEOA 1OT5A 1E1CA 1LFDB 3AEKB 5EZYB 3ZY4A 4BBAA 4OQZA 4K9QA 3VH3A 5ADWA 2NQTA 2X42A 2HQSA 3I6IA 4IG9A 2RIRA 4P4TA 4CL8A 5MN4A 1KMCA 1QF7A 2KSQA 4HD8A 3EYAA 4MRVA 3QRWA 4GMFA 4E2XA 221PA 4L2IB 1WTCA 2FUG6 3QEMA 2W9XA 4O0LA 1H6DA 5KJ6A 5AIAA 1TMGE 3DZFA 3PIRA 1GLNA 3MUEA 3SN6A 4K1XA 3LHKA 1FUUA 4AZSA 4C29A 4DSUA 1UKAA 2I4NA 1X8KA 4B31A 2ZRNA 4QGAA 2A9PA 2CYCA 5CPFA 1UMBA 1WXGA 1Z2PX 2Q2NA 4G1MB 4UD2A 1CDDA 3D7RA 4KRGA 3U9SA 4DR5B 5EHGA 3QYJA 5EXTA 4ZOQI 2ZSAA 2D2IA 4JC4A 1S89A 1QP7A 2EX0A 3ISTA 3JYOA 5K0ZA 1MGOA 2RGYA 2VVTA 3HHPA 4H7PA 1UT8A 4KAAA 5A1JA 1C3JA 3SQLA 4B5KA 2TRSB 3TEFA 3O2SB 5BSHA 2Q5HA 3HJRA 2X3YA 4AN0A 2ZRAA 4X6YA 2O8EB 4DDTA 4RSGA 5DHPA 1DFGA 4BNZA 4TWJA 1I51A 1F1BA 1QC5A 5JQGF 3WMFA 1D04A 1GA6A 1KIMA 3J7TA 5DI3B 3HDGA 4RZ2A 1YV9A 4AWAA 4F8YA 5CIYA 4HFJA 1Q0UA 2H2HA 2G1PA 5IARA 3PA6A 5CHEA 1LD3A 5DBIA 4DARA 4I1PA 4IM7A 1H6BA 4MMXB 1YR7A 3AJRA 2YMLA 5JD5A 1XTBA 1J09A 4NPAA 1EA5A 5DNWA 2JHPA 1QZ3A 2ORED 3HA3A 1GL3A 4UM5A 4W82A 1EE2A 5LNK1 2NZVG 2D2XA 1NLFA 1T3TA 5H3CA 2ATXA 4IGEA 2ZITA 5JNRA 1H8HA 1PJ8A 1O5OA 1RJ9A 2X41A 2DTDA 4I4NA 4NECA 4Y1EA 3K30A 5JCOA 7AT1A 4EUFA 4J4TA 5K3SA 4JBLA 1GTRA 3WLQA 1CQXA 4YYZA 3H04A 1BVYF 4ZT6A 2VYFA 1OSNA 1U3VA 1UT5A 3BORA 2C5EA 2Y0DA 5P8WA 1MC1A 3KTOA 1TAHA 1K7SN 1IB0A 1WWKA 1DEKA 1E60A 5ITZA 1S3GA 4B3SB 2RONA 4HXFB 2XUJA 5CA0B 5TMPA 1IBCA 5K3EA 3K8QA 4O5AA 3T3NA 4L6AA 5TGZA 4BMSA 1P9OA 3D64A 4BNTA 5DNCA 4AXXA 2HAEA 1GZ5A 1VHLA 4KVGA 4N0PA 1KRWA 4F3YA 4MRMA 3UUFA 4FYXA 1E3EA 4OI4A 2XQFA 3HCWA 2GYYA 4NYJQ 3VRHA 3MT9A 1EDZA 1FP7A 4GNKA 2X7HA 2IXFA 3BC1A 1D03A 2ODPA 5M3BA 1QHYA 2BD0A 3VTKA 2Q4BA 2O3SA 3GLQA 1PR6A 2Y1WA 4TLDA 5IDWA 5DWVA 1PZFA 2COKA 4BDSA 5F52A 3U1BA 4LUCA 4OX9B 1T9AA 1Z63A 4WY5A 1MO5A 3TN7A 2UYCA 1H4QA 3Q1KA 2QI9F 2WJPA 2ZR9A 2NPFA 1LDGA 4DS3A 4EG8A 1EJBA 1RXYA 3DOJA 3GUUA 3L92A 4FFDA 3K9QO 3Q6IA 3OFND 3FOCA 4BQQA 1HR0B 4WX2B 4XLZA 4BNKA 6LDHA 1DKOA 2MSKA 1EINA 1PE0A 1NBEA 1WG8A 3GFPA 4GVLA 1LBEA 5HF5A 1T6XA 4QAJA 3QHPA 4LXYA 1RI3A 1KDZA 3PEUA 2AX4A 2GK3A 4K6KA 3U56A 2FX5A 4DQKA 2P68A 1PBNA 2EARA 1K9VF 3ROGA 4OQDA 1ATIA 1Q1ZA 5J4VA 2XDWA 4XJTA 1LV8A 3BHJA 4MKZA 4Z3KA 1L7PA 1WZNA 2WHEA 3LOPA 5ESWA 1KE1A 3ER6A 4QNRA 2HLNA 2J7PA 2GN0A 3Q3CA 3UKOA 2JJMA 4BFXA 5BWCA 8ATCA 4ARCA 1W25A 4LJ6A 1WM1A 3EAQA 2DU8A 3DQZA 4J0FA 3SY8A 4DYHA 1CEYA 3F4KA 3WB0A 5JC8A 3DEZA 4UHKA 2RK3A 3K94A 2Z5LA 4FBLA 2BEUB 3S27A 1OKKA 2ZJBA 3MINA 5BQ5A 3LPNA 3OIFA 5I9IA 2ZRDA 4BTEA 5CYFA 3SDZA 5AQ1A 4MQ4A 1QR2A 3AM1A 1GV1A 1M33A 3F47A 4FXOA 3PUJA 2B69A 1SOUA 1WMSA 3IIIA 5LQKA 3FG9A 3EXHB 1L4YA 2QMUA 3PV0A 5IKMA 1K2VN 1U2TA 4BO9A 3BS4A 4NP6A 4PPFA 4UTRA 4RA6A 3H11B 3WSTA 4BJ6A 2QPTA 5DGDA 2YJTD 1DZ3A 4MR8B 3R9KA 4C4TA 2FF5A 3G5TA 1AH2A 3BGWA 1FTSA 3A1NA 3NTQA 2WJYA 3QBEA 3ZOZA 3O1JC 3IR6A 2O3JA 4D8VA 5AIBA 1JS1X 1RAAA 3KVOA 1NVDA 1S7CA 1J07A 5BY2A 3AINA 2GPYA 4X24A 4BLSA 7REQA 1S8AA 2QTBA 4BQOA 2QAGB 4PANA 3PSAA 2QVYX 4GZ3A 4HWOA 4PQFA 3K0CA 4RPGA 1UAYA 3M8KA 4ZPJA 5LUBA 3RC7A 1OFUX 3C7TA 5DNUA 4GZLA 1DIAA 1H2BA 4DTCA 5CJJA 3CINA 4JL6A 3GV0A 4RU1A 5L3SA 1GPLA 2JI6A 4TLBA 1N8SA 1T8RA 1GT91 4OAQA 5E9JA 1KOJA 1Q3HA 3OU7A 4LKRA 4I9NA 4N49A 4PQYA 2HMAA 2YIVX 1ZIYA 1S8OA 4B34A 1VSUA 4QPCA 1E9EA 4U0JA 2Z8YM 3DV0A 4CI0B 3HJTA 4JXXA 4F4CA 1DKUA 2R7AA 5JTTA 4IXNA 1CWUA 2ID7A 2MOKA 2D2VA 3N1UA 4HDQB 1NZDA 4BHTA 2FEWB 1AQJA 4G0NA 3U61B 2DT8A 1FZQA 1M2NA 1ATZA 1SNYA 1U0JA 1JIUA 4QM6A 2XB8A 3CEPB 3AUTA 3EXHC 4AJEA 1OWLA 1XE3A 4YB8A 1C7ZA 2BGJA 4Q21A 2NW6A 2VDKB 4XFJA 1FW8A 4TRMA 4Y6GB 3UOAB 2GSWA 4UDXX 4YCMA 5IMBA 1ZQ9A 1TW3A 1DWUA 2X2PA 1LLUA 1N7GA 2YV1A 1M2VB 1WQ4A 3NH9A 4IR7A 2O2SA 3RAJA 3TCKA 3TR0A 4AO6A 1YQUA 4JB8A 2VHEA 4LOHA 2HU5A 2QLJA 3ANLA 3U9LA 2GA9A 3KZVA 1AU9A 2E4YA 1JA1A 2FN3A 3L8FA 2A59A 4IH4A 2JCGA 4MR9A 4P7BA 3U9TA 4B7XA 4ZIRA 4QVIA 2Z09A 4PFQA 2ZSJA 4DQUA 3RTDA 3QEJA 1G0OA 1L5LA 3MTEA 1JSRA 3KT3A 5ELLA 3S5UA 3TW8A 1DINA 4HDKB 2XW6A 5JW6A 3HUEA 2SNIE 1SQGA 1JSLA 3ITNA 4FSDA 4WCFA 1E3WB 9LDTA 1S2GA 5B12A 1W7AA 3WK6A 2I3GA 4D2IA 2ZQ5A 3RSHA 4AZVA 2GJKA 4L51A 4KQ6A 2W6ZA 5JNLA 4GXQA 4J0KA 3AUYA 4GUAA 2F1OA 2O7RA 3TZHA 3A6PC 2GZDA 2VRWA 2XNJA 3DT8A 2HWXA 2JLVA 1N32B 3INRA 2KX7A 1GNLA 4MDHA 2CFOA 2DSTA 3KIPA 1KC3A 2G4CA 3F6BX 3FIUA 2BGMA 3V97A 4OIFA 3ENQA 5DHUA 5AJTA 3D4BA 1W88A 3BFXA 4Z9BA 3TW4A 4JR2A 4OXRA 1EQAA 3TW0A 5EQDA 5DH9A 1UPTA 1KH2A 1ZM9A 1KJQA 1QVAA 2GAOA 2X8LA 3VNQA 4WVFA 5IF9A 4EFLA 1G66A 4QPJC 1ZK2A 2QT9A 1H22A 2V6BA 4KYVA 1B23P 2X1MA 3WNCA 5FI0B 4DWJA 4BIMA 4CM9A 3RODA 1Y9EA 2J30A 4JLUA 4GLBA 1Z5WA 5IBPA 3TBHA 1NMEA 3SC2A 5H4HA 4UBLA 2REQB 4I1RA 2CVFA 4RXMA 5JASA 4DQXA 3O38A 1N2BA 4OOFA 2CMHA 3OLVA 2W8BA 2WILA 2F6RA 3IQXA 1XPUA 1UFRA 1GZ3A 1S01A 1ZOLA 1T4DA 3SEQA 2PA0A 1VLVA 2Q0XA 1B42A 1AGPA 1V96A 2XNDD 2Z1DA 3AT1A 3ETCA 2XSZA 1Y7TA 3HP4A 3ONDA 1SU7A 5AKZA 4DCTA 3JX9A 2NOAA 3G9QA 2F55A 3OKAA 3IUSA 4F4UA 1BDHA 4RK1A 4INJA 1SHTX 1TO2E 2UZ3A 3KLMX 2H57A 4DYDA 4M4SA 3UMGA 4AWXA 4ED9A 3ZDBA 2P0AA 1M6VA 2Q62A 2R84A 4W1SA 4YCBA 2AN3A 3HC7A 3SJAA 4EJFA 5C1BA 2C03A 2OUIA 2ZANA 2CXNA 1OFVA 1HEUA 2ZT6A 4AY6A 2R5FA 3R76A 5JAQA 2X8JB 1XAJA 4W7IA 3OZFA 4IY1A 1ZHOA 2CV0A 4LBWA 3VH4A 3B1WA 3PTZA 4XGKA 4N01A 2JG3A 3VX3A 4K9LA 5AVRA 4HQKA 3WYFA 3I64A 3FUTA 5AVTA 2D5BA 3B6IA 1DAKA 1KJIA 3K32A 3UCEA 3DMTA 2W2XA 4GX1A 3W77A 4IW3B 3ZQ4A 1L7XA 2WDZA 3D1VA 1Q16A 3HUFA 1C1XA 1LCIA 2HK8A 2HQ1A 5LD2B 2FPPB 2JRLA 1P45A 3VKHA 3LC2O 5HHTA 3PXGA 3E2PA 3MT8A 5KSOA 3L8GA 3COVA 1CNFA 4N1AA 4WOJA 2VUTA 2VQSA 2AQHA 3O3CA 3AB3A 4JENA 2G06A 3EIWA 3DWFA 3ZKWB 1SZJG 4JJEA 4B6QA 1RI5A 3AW8A 5E2AA 1PEYA 4UNQA 3FR7A 4MWGA 2H08A 1KEEA 1GQYA 3LGXA 2WINI 2EYQA 1E5LA 2IEGA 1MAWA 2BMEA 3AOEA 2IYEA 3CU5A 1YAHA 2Q4TA 2QU7A 3KBBA 2HUPA 3ZLBA 1ZI8A 1THGA 4BBJA 4AWBA 3DLAA 5A4DA 2L82A 2J5KA 2G7ZA 4P0PB 2EW1A 3NEJA 3NBXX 5L45A 4PR0A 1WHTB 4Q1VA 3AIKA 2I22A 5J1TB 1TZBA 3BE8A 1OF1A 2C8JA 3EODA 3LP6A 1DX9A 5IRCD 2XUDA 5I7SA 3MJEA 2GHIA 2HBYA 3ZHSA 1NVKA 3CPEA 4BO4A 2G1KA 1NWCA 1A7KA 2VDWA 1GKUB 3F9RA 2C5SA 2QX8A 3FB1A 3N28A 3RUIA 1JHZA 2BONA 1XCPA 1Z5VA 4LDRA 5FB3A 4CM8A 5J59A 1R10A 2ZZKA 4LJ8A 4OB7A 4UARA 5D86A 2LDBA 4AP9A 1XVTA 1EA7A 1Z4LA 3NKFA 2PLAA 2I5PO 3GX1A 2GX6A 1QOZA 1JR6A 3WB1A 4A73A 1U3DA 4GE3A 1NLYA 1GQFA 1WMDA 1E32A 2LIPA 1P4HA 3TSYA 1LQ2A 2YJ5A 1XELA 1RQPA 3ZIAD 1FFBA 5AKIA 2F1RA 1T4GA 2D2FA 3C4QA 5C3UA 4AKSA 1L7MA 1IJBA 2RGUA 1KI1A 2HI0A 2V3VA 4M7PA 4NCXA 3U7QA 3UWPA 4ITRC 1ZGAA 5FPTA 3TH5A 2X5XA 1CVLA 4OYLA 4I5DA 4QJIA 2OD7A 4DSAA 1G18A 3QI2A 4PS0A 1XMXA 4MRRA 3JVIA 1H6AA 4DJAA 4ZDKA 3TMAA 4JLDA 1GUAA 4KQMA 3KU1A 2PGXA 1BFDA 4DR2B 1SY7A 3JXEA 3KYDA 4G5GA 1ODTC 2EQBA 2C2BA 4HQ0A 3RRYA 1T25A 3WWPA 4A6XA 2PXXA 3WGYA 2YC4C 4H0FA 4WW0A 3NANA 2ZAGA 3AFHA 4BYMA 1N9GB 3NONA 1QGUA 1G63A 5JG7A 1V71A 3S2YA 3RYCB 4S3MA 1AVTA 2ZB7A 2PUWA 4IF6A 3M9WA 4AJJA 3GJQA 2FZVA 4FDAA 4TXJA 3W5IA 3NV9A 3GDHA 3EGDA 3UJCA 4AAYA 1E6EA 1TEZA 1BAPA 4ZN6A 1EWVA 1SULA 5DULA 4Z2YA 4RPKA 5LM3A 4XLLA 2IRWA 5GAJA 1QU3A 2HLDD 5TMBA 2R79A 5TRTA 3CX7A 4OA8A 5MGNA 5KKCA 1DARA 1HZJA 3N2KA 3HJBA 3L7IA 2WI8A 3F6PA 4XVHA 1LUAA 2DHCA 2WF9A 4LNAA 1XCMA 3EWAA 1P9LA 1E5TA 1Z4PX 3FFWA 3ZHZA 3OTIA 1BRMA 1RXSA 1Q5PA 1VHDA 4HVTA 4MV8A 4RLSA 4M9SA 5I48A 4XDGA 2YW9A 4QUGA 4HBZA