3QWNA

Crystal structure of a nigd-like immunity protein (baccac_03262) from bacteroides caccae atcc 43185 at 2.42 a resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
206
structure length
206
Chain Sequence
YPSVKLEFVTVKAGTDGSIQTLIPDNGEALTVSKDRTGSAISPNTSRRVMSNYETLSNGHTATAVIYSLQSLVTPTPKPADDPTYRDGLKHDPVDVVSIWLGRGYLNMILNLKVNGGKQHVFGIVEDLSEFETNGTVNMLLYHDANGDEEYYNRRAYLSVPLDKYADAENPGQKITIKFKYYTYDKDGTAIESGKYCNPGFEYVPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical nigD-like protein
publication title Crystal structure of a Hypothetical nigD-like protein (BACCAC_03262) from Bacteroides caccae at 2.42 A resolution
rcsb
source organism Bacteroides caccae
molecule tags Antitoxin
total genus 41
structure length 206
sequence length 206
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3qwnA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qwnA02
3NQIA 3K6OA 3QWNA 4J8QA 3K0YA 4PQXA
chains in the Genus database with same CATH superfamily
3RILA 2QZQA 3W5OA 1Y69U 2XQ0A 3HRZB 4DR3Q 2UUCL 3QORC 4K7PL 5JPMA 3REWA 3OKEA 5HGBA 5GS1A 3U7YL 4AYGA 4RWSC 5EU7C 4DGVL 1SEQL 1SN0A 3FT0A 3SJVD 2XQYG 2EJFC 1SFOH 2VLLA 2YBGA 4TUOA 5T5FH 3ZZ1A 1IVTA 5DRZA 4TRDA 2NXYB 4JFVA 3GLAA 1SLXA 2YRLA 3RDTC 4BFRA 4JY6A 1AE6L 3GJEB 1OP3K 3ECBA 3RTLA 1OEZW 4MFHA 5EA0L 1BQ5A 3TS0A 4BCYA 2E2DC 3N52A 1RP8A 3TU6A 1AS7A 1DBKH 2NUTB 3OX8B 2WSDA 2W8CA 3HRZA 2BRRL 2FJ2A 4FQ2H 1I8KA 4HP5A 2G2RA 1BFOB 1IBML 2EH7H 3ECQA 3LS5H 3Q43A 4IALA 5C3EB 4IS6B 2TSSA 2NY0B 4PMWA 3ABLB 3HC0B 3K2KA 3TRZA 1UADC 5J1AB 3E8UH 3NIGE 4A38A 4FEMA 4L5TA 3GJEA 5J1SC 1C9OA 3CZNA 3K80A 2EH8L 5C4XH 2BC4B 2NUTA 3OX8A 2X4RA 3BPNB 4AGMA 3I2ZA 1E7VA 3ABGA 3IBEA 1BEYL 1RZKL 2RDHA 3ARGD 5AW7B 3SJVB 5C6PB 4MDRA 1BFOA 1KB5H 5JPNC 1PDKB 3F7KA 4N9GB 2ICEB 4Z0XB 5ISZD 1CBVL 2N55A 4NNYB 4NT6A 2GY7B 1VFMA 1UNSA 3GSNL 3FU0A 3D4CA 1WH0A 4X66Q 3HC0A 4A3MG 1I7RA 1IKFH 1EPFA 1XXDC 3BC9A 3L7FB 4PJFE 5IROA 3PWJB 2D7TH 5B1JC 4ZFQA 3STBA 2R4RL 4JGMA 2YGOA 3GB7B 1YMHB 5T3XD 2K70A 2V33A 1X9RA 3C60C 4IPDA 2BC4A 1T04B 1VADB 4JDZA 5FDYA 3RKPA 2RMNA 3LNIA 4P2OC 3ZYJA 1OB0A 1CBJA 4G7OC 2X9ZA 4K9EC 1B4JH 1JP5A 3BP4B 1A6PA 2A9DA 4ZUWB 4Z0XA 2ZUTA 1CDCA 5F21B 4NNYA 5IB3B 3TA3C 1ZLDA 4DNRB 1CSQA 3CGTA 4PRPE 1DBAL 2HUHA 3JAML 2NSQA 1BFSA 3L7FA 4K5OA 5FGCE 1RZPA 5D2LA 3WFBH 1XF2A 3PWJA 2AW2A 3WN6A 1VQ6A 4YXLH 3SPVB 1QFHA 1SYSB 5DHYA 2APBA 2XDHA 1MCWM 1U4MA 2Y7SA 4HU2A 4CL7A 3GB7A 1YMHA 2J8UB 1PLGH 2VOTA 3OR6B 1E2VA 3FQ2A 1NDMA 3FB6B 1VADA 3ARGB 3QUYC 2AGJH 4CC4C 5ISZB 3BWZA 2UZYB 4C3HB 4HXAL 4AQOA 3BP4A 3KLHC 3T1YQ 4XNDA 1XAKA 3SE8L 1MCDA 4K8RL 4ZUWA 4PJBE 3WD5H 3RVUD 3RZDH 2UXVA 5DEGB 1QNKA 1JV5B 1PZJD 3MYZA 2AJUL 4A3EG 3SPVA 1SYSA 2DQJL 2QVIA 3O6FC 4XWOC 5JHLA 4P4KC 5IHBA 1DJGA 1TWCH 3I4MG 3BVMA 2HLFC 4OX9Q 2J8UA 3I85A 2NNAB 3OR6A 4GW1B 4ONGH 1JE5A 4KMQA 4X9FA 2IADB 3FB6A 3ARGA 4QTFA 3EIVA 1J88A 2ADFL 4RVBA 2VDOL 5ISZA 2UZYA 4DTGH 2D62A 4LSTL 1GZQB 4UBDC 1HJCA 5I1EL 3I6KA 1H19A 2K8QA 2Z4IA 4NN5C 4Q6IB 5DEGA 1J5IA 3I55A 2R1XB 3I4NB 2F4VQ 2YOCA 1JV5A 5C2BH 3MTSA 2QSCH 3B3IB 1WZKA 3V4PL 4XHQA 3L5JA 3EF7A 3DX7B 3BZCA 4OQ1A 4P3WA 4OTXH 3PQYD 5I6OA 2C8NA 5AVUB 5ABZA 3RFRA 3HOZG 4GW1A 3U36B 2NNAA 5AJ3L 3ZIMA 2IADA 2Y7QB 5L8JB 5B38G 4XVSL 5MEPB 3NAAL 1TVXA 1DCZA 1TWFB 2GVAA 3A8KE 4OZHF 3QO0B 4TTGA 3FH5A 3IN2A 4Y9EA 4OCWH 1GZQA 2AEQL 2CR3A 4OCLC 1I1AD 4QRQA 4PS8A 3V0VA 1BQLH 5KJ7E 4LVOC 1QABA 3VR2A 1PMYA 1ADQL 1VAHA 4IOCA 2R1XA 5DVNA 4XXEA 5J56B 4KKAC 3B3IA 2IH3A 2XV3A 2PCFA 1S40A 3DX7A 4GAAA 3Q9PA 2UVEA 1DJZA 4DR6L 3AMKA 4GRLA 4K8JA 2KT6A 5D8JL 4OZIA 2F19L 3M1CA 5LQBL 3DVFA 2PKDA 2X05A 2R2BA 3U0WH 1NCBH 4GXUM 3SZKC 2B1AL 1SNCA 2Y7QA 3FW6A 3FDWA 3TZVD 1Y0LB 5JQHC 5MEPA 3QWOB 1NINA 4CMHB 3QO0A 2A74A 3GSQB 2WIMA 1IEAA 4UU9B 1P69B 4Q97A 3WHXA 2VR8A 1X4ZA 1I6HB 2ESVE 4M7ZC 4MMXA 4B97A 3BESR 2ZSWB 3PQYB 2BVQA 1FVEB 4GO8A 1OXXK 2QT6A 4L0PB 3APNA 1DQMH 5FJ8G 1MJJB 3B6SB 3WHE1 4PRNA 2YPVL 4MX7A 1LO5D 2QVMA 2ADYA 2L0CA 1PFBA 1D2OA 1HKFA 1HXKA 1Y0LA 4JBSA 4PRBB 2Q8IB 1I1AB 4AV0A 4GB9A 3GSQA 1A4JB 1FIGL 4UNUA 2OZ4A 1MFBL 4HF5L 5DGQA 4EQNA 2BSTB 2ZKHH 4UU9A 4XMZA 1AGBB 3BKJL 2D4DA 4B9XA 3BAIA 3PIQB 4GKNA 4IURA 1PZDA 4JI1L 3P40A 3OVUB 2ZSWA 3SKJL 4HOXA 5AAWA 2J56A 3PQYA 2PPCA 5BO0D 3H6MA 1FVEA 4TSSA 2JQMA 2C4FT 2QQLL 3G5ZB 4OLZH 4Q2ZB 4XMVA 1MJJA 3B6SA 1LK2B 5KNBA 2WTRB 2XG5B 3NIFF 4V11A 4LK4A 4X80L 3TZVB 3WN5B 2Q8TA 4DVRH 1KIUA 1PLCA 2H41A 4LARL 4GUPB 4PRBA 2R92H 3BN9C 3D52A 3X3NA 1ZSDB 1DEDA 3QJXA 2DM3A 4S1DC 1F4XH 4UTAH 1UEBA 2BSTA 1CKMA 1GYCA 3B43A 4F7TB 1QLEB 1UWVA 4JY5L 1AGBA 1INEL 1RH8A 3T2NH 4IJLA 3PIQA 2RACA 4FERA 4QJFA 2OW6A 1VEOA 4MLSA 2VERN 2VN7A 3G5ZA 4Q2ZA 3RWGB 3CXCA 1YZZA 1JJUA 2N56A 2W0KA 5IGEA 4M48H 4FFZA 3TZVA 4DR3L 2WTRA 2XG5A 3WN5A 2VIRB 3U2SA 1F4AA 3UJIL 1XSKA 4LMQD 3SK5A 4WFGD 4WEBH 5HHNA 2D8KA 1A5FH 1UWEH 3HG9A 1WEJL 1ZSDA 5EBMB 3QDHA 4DUYQ 4DR1Q 4DN3L 2EVBA 1JORA 4JDTL 3GFUA 5I8CB 2UVFA 3RVWD 4Z18A 4JI3Q 5EU5B 1I4XA 4JI7L 1YAIA 2LLLA 1XR9A 3BRDA 2Q8RE 5A3IC 4HK0B 2YD9A 3NZHH 1QJOA 1S46A 2YKLL 4XMXA 5BRZA 1H3PH 2P5EA 2WP3O 1JGVH 1LO5A 4N2NA 3CFCH 1Z3RA 4HEME 4JFYB 2E6QA 1IBYA 3DV4B 2VIRA 3EW3B 1XH3A 1C12B 1MCBA 4MXVE 3VD5A 3RWDB 5T3ZE 3I2CL 1I4HA 4UNTA 2AJZB 2F7OA 5BJTB 1F18A 1U41A 4UM9D 3H0GB 4EVNB 5EBMA 2JK5B 4X7SL 4JE4B 5LAPA 1YNNC 5GRUH 5GRVL 4N2AA 2XOTA 4XBGB 3HR6A 2WVVB 3MV01 3WEAA 1RSYA 5I8CA 4J5VA 1Q4NX 2EINB 1K4DB 4FQQB 5EU5A 2F0LA 4OB5L 4HK0A 4DAMA 2D2CC 4PUBH 2V5SA 3FFCE 3ULUE 2YD3A 2ZYHA 4JFYA 5CJQH 1HUNA 3DV4A 4TQEH 4N2FA 2BWDA 1C12A 4YNYB 1E4KA 5B3NA 3S15H 2D4FA 2FWUA 5EF0A 2AJZA 3QI9D 3S1NH 4GRMB 2VNCA 3DSFL 1X9UA 4EVNA 5BJTA 1KFGA 2JK5A 1TUPA 5ES4B 3T16A 4X66L 2F52A 5J06A 3OTOQ 2WVVA 4WHYH 3IU4H 4FQQA 1E2WA 1K4DA 2KDYA 2IWFA 4UAHA 4ZYKB 3NSFA 4A68A 5JUEH 3K91A 4PRHA 4GNXA 3U4VA 3BSZL 1PH8A 2EYMA 2Z64C 4N2IA 3CLFH 4X6DE 3NBNA 5C7ZA 4W6WB 1NJIC 4MQXC 5DQDL 4ZLTF 5HGQA 3TONA 3VXME 4EVOA 4UM9B 4PV9B 1NFDF 2ZXOA 3BQUC 4X6CB 4X9HA 4X8XA 1SGKA 1NPNA 1J5OL 3FUMA 5CF3A 2I07B 1U6AL 3VYOA 1H3WM 2Q7NA 1CLOL 2VDNH 2YV5A 2Y7LA 1SYGA 2UUAQ 3CJJA 3ZT7A 4K94C 4ZYKA 3D12B 2L7EA 5E3FA 3T0WA 4ME5A 4JOIA 1XDTT 4AIOA 1RMFH 1I4PA 2KCCA 3E6FB 4KTYA 2HH0H 2DEWX 5DR5H 4F1SA 4I5BA 3LQZB 4GRWF 4XGZB 5JDSB 1WYJA 3H6JA 3QI9B 4N0YL 4WJ3M 4X6AH 2ZIDA 3T1YL 4LCWE 3ZYIA 4JREB 3SVMA 4NN6B 1J18A 1MRDL 2NTSA 4M5ZH 4PHXA 4AI7A 3WJJC 2O6EA 2I07A 4CKCA 3UZQB 1OE2A 3UIYA 4JB9H 1G7IB 5JW4R 4Q0XH 2PMZE 5E7BA 1IBZA 4UUJB 3UBXB 2Y6SD 2LHAA 2GJRA 4MWFB 3PCYA 5J6GB 4NXMQ 5E4IA 2A9CA 4RFBA 4UTBH 2E2HH 1INDL 3FB5B 3LQZA 4XGZA 5JDSA 5C07E 1IQDA 2MNUA 3JVGC 3QI9A 3CCUA 1LXMA 3DROB 1RTOA 3UJJL 3V6ZA 4EUPB 4N0UE 5FR3A 4FFYA 4XQJA 2B77A 3P4OA 5CWSB 4AJVA 3J81c 5AYUH 1OAJA 2OR9H 2OXPA 2Z3FA 4D8PA 2F4VL 2CUAA 4DGWC 2HVJB 5F93C 5JO5B 1S9WB 4U6VH 3VJ6A 1G7IA 2JELL 5E6SB 2G9HD 2X3CA 3F7QA 3NABL 5C5MA 4OF6A 4UUJA 4G9FA 3UBXA 4MWFA 4FOMA 4LRIC 3M17B 4N8VB 3DVIA 1EGJH 4K9EL 3MJ9H 2E27H 5J6GA 1I85A 2IALB 3C6LC 1IBKQ 5HI3C 2EADA 4BK5C 1JPST 1OSPH 2R0ZL 3L0OA 4NQQA 3FB5A 2QKIB 1A0IA 3UPCA 5E6IC 2FD6H 1HEJC 4JAMB 4V1DD 3FOMB 1UASA 3FRUB 1OAQL 3K8KA 4DGUA 3WFDL 3TEYA 1PNDA 3ZKMC 3I74A 1IL2A 3MRLB 3ULVC 4PJIA 3KLWA 4JMNA 1IKOP 4TSCL 2K5NA 3SGJC 5IP4A 5JO5A 1FAIH 1ZT1B 4FTVE 4U1JB 3RKDC 5I24A 4I18C 4DP8X 5TE7H 2ZOKB 3M17A 3FK3A 4N8VA 5F7NC 2DWTA 3RWFB 1S7UB 4KI5E 1IBDA 1M4VA 4KKSA 3QPXH 1MVYA 4XO5A 3TBVB 3BIKB 4KHPQ 4TQPA 4JAMA 3FOMA 4X5RA 4YY3Q 3FRUA 3GTMB 1FLRL 4WVRA 3S4SG 4NKLA 2DEYX 2YWZA 2NZ9C 2G9HB 1MHHB 1LDPH 3LJ3A 1IFHH 4YHPB 5HYJE 4UOW1 5CEZH 4ALAH 4U1JA 5F9WC 3I72A 1OAZH 5LMNW 3FUDA 1UXMA 2ZOKA 1EJ8A 3LQAL 2R8SH 3GDEA 1ETB1 2Z35B 3LZPA 4C4UA 4U1KB 4YE4H 4NPSA 2B2WA 4N2BA 3RWFA 1S7UA 5B22A 4V1DB 3WDNA 1HT6A 2Z92B 3VXPB 2FSEB 4K55A 1RK1A 3GI8H 4ELME 2WLIB 2Y4SA 3FKIG 4CKEA 1TEFA 1ZHNB 4NWUH 1A8ZA 1IC5H 2WLKA 1LEIB 5F3FA 2FIRT 4OJCA 4JGUA 1X5GA 5C3TA 5CBAA 3DUUB 2G9HA 3BAJA 4IUVA 1LP9B 4YHPA 4AQZA 4X50A 3ILPB 5D3DA 1P5VB 4ZPTB 4D7PA 1BLIA 3K81C 3E38A 1QUQB 3L3OC 1OW0A 2DMKA 3BHBB 4OO1H 4RGND 5JJIA 2WAQE 2W0PA 3I4OA 3W11D 4JFHD 3RA7H 5ADPH 1OALA 5GRWA 1QR1B 3GV6A 4TVPH 2IBZY 2Z92A 2FSEA 3VXPA 3WTTA 2AABL 2KS0A 3OWRA 2WLIA 3GTPB 4BUGA 5JMOC 4QF4A 4Y4KD 1KACB 1LEIA 3MV11 3KLKA 3KYKL 1LO4L 3DUUA 3MBED 4B9CA 1Q9WA 2QQNL 1RZ7L 2BJML 3T6QC 3ILPA 1KCWA 1XMEB 3HMWL 1Z9PA 5B3JF 2PI2E 4ZPTA 3TBIB 2Y36H 3BHBA 4TXVB 2XNAC 4TLTA 2CKBL 1OTTD 5L0QB 4I9WE 1M8AA 5CGKA 1SNMA 4R90H 3ZTNH 5I66B 1QR1A 3PNWA 3J81j 2V5RA 2XICA 1E3ZA 4DUYL 3QW9A 3UJTH 1BX2B 4DR1L 4K5LA 4JVPA 5CCGE 2VMCA 1XVSA 1WCMH 2IF7A 4JI3L 4HS3B 5TDPA 4L05A 5I1LA 3NCXA 4RGNB 2F0NA 4NGHH 4WI6A 4KTGA 1BG9A 3H53A 4AYBG 4AQ1C 1R0AH 2G30A 3S17B 2NUPB 2XRSD 1GOZA 4M8VA 3EJZC 5KVGL 4ZOAA 5I66A 4H4NA 5BUPA 2H6PA 2LOEA 4Y4KB 3F83A 4LRNH 1G9EA 4NCDA 2YFNA 1HTYA 3B9AA 3GBMH 3VTMA 3MBEB 4OVUA 5D4HA 1AXSA 1JPSH 2Z9TA 1YBYA 4HS3A 5DF0A 1TJIL 4RGNA 1KPRB 4OIBA 1GSKA 1X7SA 1WBZB 1QD0A 3V0DA 4EXPX 1ZLSH 5KVEL 2BVPB 1GUWA 1UB5B 2NUPA 4O0AA 3B7UX 3VXTA 2SNMA 3CQZH 1YEDB 1NEPA 3TEUA 3X12B 1LO3H 5I9QB 2KQNA 2DLFH 3F7YB 4Y4KA 5E00B 5E8PA 1UFUA 2WB1G 4XBEH 2AEPL 2E46A 4I9XA 3MBEA 4RFOH 3OTOL 5IHUH 2FQEA 4NN7C 3WNLA 4BRJA 3C5JB 1P84K 4XT1C 2NNXA 3ZO0A 1KPRA 2EZ0D 1YC8A 4AMXA 1V8QA 1KNEA 3DYMA 4JHWH 1WBZA 2EYPA 4ZFOL 3UROR 5GISL 1E0BA 2D31B 4HSQA 4N20A 2BVPA 1UB5A 4R8WL 1J0YA 3TESA 2XWZA 5E2TH 2VDQL 3WNKA 4TYUA 3MLVH 4TNVK 3VFGL 5C0AD 5E00A 5BV7H 4XMPH 2H4OA 1N8ZB 4OSUH 3D9AH 1TCRB 3GIZL 3L3GB 3P73B 3SJVE 43C9A 2UUAL 1CR9H 1DZ0A 2PPBC 1U8OB 1QEWB 3C5JA 3KDPB 4XWGL 2AEOA 4F9PA 3A6CL 2W9DL 4DT2A 2ZNWA 2D31A 2BMKB 4C2MB 3QZLA 3CN1A 2FBJH 1WF5A 2GSIB 2X53A 4EX5A 2WVSA 2YAOA 1JXDA 3JV4B 1GJUA 4QCLA 4MMZA 2WTPA 3N5AA 2RQ8A 1PMRA 3CN2A 1T7WA 2LFGA 1YECH 3INUH 2RSNA 1N8ZA 1TCRA 3P73A 4M3KB 3L3JB 1S5DD 1QEWA 3FUJA 1QFOA 3BMVA 4KK8D 5HI5C 4JV5Q 4LF7Q 1DQQB 3DGCR 4HWNA 2F0JA 1C8QA 4NXML 2A77L 3D8GA 3AY2A 3DHQA 4IKLA 5KBNC 1G1YA 1C0AA 5DD1L 5EU6A 2GSIA 2P45B 3UTTD 4PG9A 5C0AB 4PG2C 3SIKA 2J8UE 5EEYA 1D7CA 4XPFH 3ZRFC 4LLUB 2D0GA 4NC1E 3NPZB 3ULVF 4FQIL 5C0ND 3DIDA 5ISZE 1MIEL 2HTLD 2AVGA 1CKNB 5IYDG 2X9WA 4GIPD 4OGYH 2EUWA 2YA1A 3L3JA 4B9FA 3QJTB 5AZUA 1Y6MR 4EKXA 1MEXH 4U6HB 4EEEA 1FJ1B 4NP5A 2IPTL 1BPLB 2F9BT 2X2UA 4FNFA 4NHCL 1E22A 3II1A 2B0SH 3JV0A 4LIQE 1KPVB 1FDLL 5JJLA 1TZIB 5T3XE 5EG6C 4JM2D 4QRTA 4XXCA 4L1TA 3T0ED 4LLUA 1OOAA 5ALBH 1IGIH 2Q5BA 4KK9D 4FNLH 1XMWA 2YARA 1CKNA 3NJXA 2PCXA 3EYUH 2VMDA 4XTRD 4J8QA 4KHZA 3OAYK 3VQMA 3C2AL 3KXFD 2NZHA 1AO7D 5D72H 1PZ2A 4U6HA 1FJ1A 1VLXA 1XD1A 1LTLA 3B2UD 3LB6D 2VJXA 4PJ5B 4GS3A 1KTJA 3EGSB 4KY6A 3OKKB 5FC9A 1B90A 1PJWA 1MSHA 1EO8H 3UTTB 1KPVA 5C3EG 3V6OC 1S78C 2ZJSH 3U7WL 1TZIA 3ECWA 3UG3A 2IDTA 3KBFA 5KVDE 3P30H 4KHPL 1CC3A 3QUMB 1T22B 3Q7JA 2K5WA 4U68A 1NCWH 3ROLA 1TQBC 5I6WA 5IB2B 4KKZA 3O8XD 2HQEA 2HFTA 1T1XB 1TQTA 5I6KA 2MEJB 3I90A 2YA2A 3EGDA 4DNIA 3MLTA 3KEHA 3IDIB 2BZDA 2EJGC 3QG1A 1YEJL 3EGSA 3OKKA 4R0LA 3VDYA 1ORQB 1QBLH 1Y1VG 3CCMA 1ASYA 4A3LH 2VO5A 3EJYD 3IJ9A 4JM2B 3UTTA 1ETJA 4AH6A 4XOBA 4A3IG 3CK0H 1M42A 4OD2B 3T0EB 2X1OA 2JJVA 3QUMA 4YO0B 1T22A 4E9YA 1OCWL 3GTJB 4AL8C 5IHLB 1XGPB 1H9KA 1E5UI 2BVYA 2UX6A 5CJ8A 4AENB 2P43B 4R5TA 3L1GA 3WL9B 3CDFA 1T1XA 1TLKA 2X09A 3F05A 3MLZL 2Y5TA 1HIMH 4TULH 1AO7B 2ZX6A 2R56L 3PXHA 2CVRA 4PS7A 1N9PA 3IDIA 2K45A 2I24N 1ORQA 2YRBA 3PQYE 4I77L 4KQ4H 5EKKA 4KV5E 2GTQA 3RDJA 4HTHA 4WHTB 2CQAA 2BNQD 2YD4A 2J55A 3HNSL 4OD2A 5I5MA 3T0EA 3ULVL 4YO0A 3A67L 3AW5A 5DZ9A 3HFFA 3GTGH 4P5MB 4NM4H 2ORBL 4AENA 4X0KA 1XCTB 1A6XA 5C08D 2DQGL 1LYLA 1L1OB 2GW5A 3KXFA 2H2PC 2WWKO 2NY4C 1ML0D 4YDVB 4MCZA 3GS4A 1MCCA 5E2VH 5I0VA 4POFA 1KRSA 4PRIA 4WHTA 1ZLEA 3MRHA 3HOVG 2A9AA 1CJYA 4LMQI 4ONFL 2EICA 2AV1B 4BM7A 2HTKC 4BH7A 4F8QA 3O8XA 3U7AA 2VH5L 2V0AA 4LGPB 3QIUC 1V3LA 4P5MA 4XPBL 4YSDA 1W6KA 3F85A 3VI4B 3TP8A 2RAMA 4HVBA 3KNBB 2GJZA 2JB6B 2NY1D 1JYVA 2DQHH 3TJEH 4GP5B 2ZP9A 1FNLA 4YDVA 2V5MA 4FLOA 3ZE2B 5IBLD 1KCUH 4GIAA 5EKIA 2BNQB 4EDWL 1HWGB 1KYFA 4GKOA 2YK1L 1VQDA 4WF7A 2WLZA 3I4NG 1VDGA 2AV1A 1EFQA 1T7YA 2HT3C 5ELDA 2YBRB 1WTLA 1A7QL 3DTDA 5C08B 1VQNA 3KBEA 3X17A 1AW7A 4MZ9A 1U93B 4JI8L 3BUPA 1PRTC 3A4EA 1LK3L 3WJLA 5E9AA 1NGYB 2VZSA 3KNBA 4AYDC 2JB6A 3QZBA 2YUZA 4OHJA 1EO7A 5I8KL 1RKRA 2DLTA 3CSFA 1D5BB 4DF9A 2UZIL 3JWNC 3TEHB 1C4QA 1TWHB 4IUNA 1FBIL 3N42F 2BNQA 4TNGA 1MJCA 4YCVA 3LHAA 5EUKB 2N3JA 4ZFGL 2DOCA 2G3NA 2B2UC 3GSXB 3RY6A 5GZOD 2XXGA 2DIBA 4R4IA 2YBRA 4H8UA 4TPRH 5C08A 5ICUA 4L0YA 1TU2B 1U93A 5HHXL 1SLVA 2NY1B 5DM73 2FJUB 1I94Q 3TO4C 2AQ2A 4YXHL 1U8HB 4LKXA 2PP7A 3TTSA 1GRWA 1ML0A 4I4WB 1JDCA 3AUVA 4JHBA 1UACL 1UM4L 5FX3A 1G7PA 4ABNA 3BGAA 1YNLH 1FGNH 2C1OB 5CSZB 1R9TB 1D5BA 2G5BB 1JZFA 3UBXI 3CIAA 5CR1A 4CDDC 1FGUA 1TQCB 3HI1B 4MA8L 1QWHA 5J39A 3G7TA 3RAJL 1IGTB 1PW3A 2QADC 5EUKA 3P9LB 3HPJB 3PAVA 4HA1A 3MNWB 4HIJB 5DUML 5G55A 4HPHA 3GSXA 5LL6S 5KW9H 2DH3A 2X89D 4A39A 4LMQE 4WFGE 5TE4H 2VJ8A 1EQVA 1M56B 1TU2A 4XZUA 5D6CA 3UX9B 2YRPA 4MS8D 5B8CB 2AHOB 3SO3C 1U8HA 2Q2TA 1KZYA 1JV2A 3FULA 3GUFA 2XLLA 2C1OA 2YSSA 5CSZA 2G5BA 1X4XA 5C0EB 1NGPL 3HI1A 4RISL 4XO8A 5F9OH 4FA8A 4MNOA 4KKCD 1I8LC 2UUBQ 1IGTA 2PN5A 1QBAA 1YNJD 1U8KA 3FCGA 2CIKB 4DV2Q 2Z8SA 3CDZB 12E8H 3HPJA 4HIJA 4PTTB 3LWEA 1RKNA 2X4QB 3BG3A 4MCMA 4XP9L 2NDGA 4R4BB 2JCCB 1IGJB 3QCUL 4IRZH 1NBWA 4X6CE 5FCUH 5SWSA 1D7QA 1SPDA 1TKWB 2OI9B 5AVYB 1JERA 4MXWL 4Z7WB 2X6VA 4ZX4A 4JV5L 1FFQA 4LF7L 3ARBC 3L4WA 3BVUA 5I9OA 5FUOL 2CA4A 4ZNCD 4IRJD 4XNYH 5C0EA 2VL5B 3OTTA 5GZOA 4M3HA 5JIKA 3UC2A 5LKNA 4XCCL 3CHOA 4PTTA 5DK0B 2E7LC 3VGHA 1H6FA 1JT8A 4WKXA 4F37F 1QUNB 2JCCA 4TN9A 5HDQH 4ADGA 3ROOB 3WO4B 1FFTB 3CG8A 3DOHA 4F7MB 4Z7WA 4B9GA 3DX1A 4JG2A 2HFEB 2NMSA 2R51A 5IB5A 4QKTA 3ZTJH 1FZOB 4OCYL 5ERWB 1F3RB 4A67A 2XN9C 4I3RL 5JAVA 1E43A 2J5LB 2O4XA 3TEWA 3G4SA 4JBKA 1A6WL 2VXUL 3KEDA 1VKXB 2ENJA 1VF7A 1G9NC 3IMUA 5IGFA 5DK0A 3GTKH 4JHVA 4QHNA 3UAJC 3C46A 1QTSA 5A2FA 5ABAA 3SBQA 1W72B 1D6EA 1E27B 3RBSA 1QUPA 2C3HA 1QUNA 5BR8Q 1V5JA 2X41A 3KYAA 5FYJD 3ROOA 4HUMB 1WO2A 1MPAH 2WK2A 3ZRCC 4LSVL 4F7MA 4FF4A 1IV8A 3QUXC 3FS9A 2OLDA 3AWEA 3IKKA 4IRJB 2AQ1B 2NSXA 1G6ZA 1FZOA 2DQIH 4I0PD 5ERWA 5HYSA 4CN4A 3H0GG 5EMYA 1E9OA 4ZT1A 4WRDA 1SNOA 4ZODA 3O2VH 3TX4A 1B7YB 3FQUB 4UZUA 5FW7A 4F8MA 1RLBA 1VKXA 4TTDD 5AOZA 1P4UA 1IVLA 2KPNA 2WQAA 1W72A 1E27A 1NOFA 3WFZA 4ETYA 1CXHA 4JKPL 1T5XD 2J20A 2RHEA 1DUZA 1MHCA 4GLAC 2WCGA 3GMPB 2Q3XA 3MV8D 4WK0B 2YAFA 4AGOA 4G7YL 2DD8H 4MZ3A 4QOKD 5FF6A 3E3QE 4UT9A 2UWEF 4BD4A 1HZKA 5A35A 2Z7WA 5IR1B 5IT2L 1CZ8H 4MYWB 5MEQA 4JGJA 4IFDI 4EIGB 5GZNC 5FGRA 5H8DA 1VPOL 1I7TB 3BVZA 5B39B 1ASZA 4I0PB 2XZAH 1AQDB 1RZIB 2EQDA 4N68A 2QPFA 4IPGA 1SDAB 2HLAB 4LLVA 4H8VA 3M7GA 1NEZB 3D30A 4JHAL 4IOSA 2W94A 2BSDA 4DPCX 2NVXH 1G6RA 3VFUA 2EEBA 4JQVC 5IR1A 4DR2Q 4V1DE 2I5LX 4QHPA 4IBUA 1T5XB 4YMPA 1MJEA 1HRJA 1JF5A 3MCKB 3VU2A 1BQQT 5FK9C 5EIIB 2AKWB 5E1GA 2ZUSA 1I7TA 1QW8A 3HMXA 5B39A 3GTLB 1MDAA 2V5YA 1KN2H 4I0PA 4YK4C 3MV8B 1AQDA 1RZIA 4X4YA 3QRFM 4KY1H 2MIZA 4QOKB 1ZOXA 1BLNB 1KCBA 1NCHA 1HOEA 1NEZA 3EN2A 4H8WC 1EEZA 2VMFA 2XA8H 1Y8OB 4F3FB 1PRTF 4J6RH 3VFPA 2NR6C 3MROA 3VQ2C 4APQD 2E3VA 2VERA 1OXUA 3UBXG 1T5XA 4X4KA 3K6SB 4LAQL 3MCKA 5CN3A 1AHWA 4LLDB 1IEBB 2VDML 5CFAA 4K8RD 1MFUA 3GSNB 2OX5A 3FZUC 4CU6A 1YY8A 5SWZD 1UE6A 4E41D 3A21A 1WBXB 5D1ZC 3H9YA 3MV8A 4Y1AA 2JJUA 2DI8A 1CFNA 2QHRL 3VB8A 5C9KA 5IMLB 3RVXC 1IC1A 4QOKA 4BKTC 2KJXA 4MJ2A 5CEXB 3ARVA 4IBLT 4AL8L 1DBJH 5I82A 2KERA 1O78A 3SDCD 2WIIB 3WXVL 4GLRH 3PAZA 4XN4A 2QPEB 2EE0A 2VZ1A 4F3FA 1T4KB 2CW0C 4ENZA 4F9LC 3K6SA 5JORB 1M1XA 4H8PA 2RFXB 3WTUA 2BDNA 3QIAA 4N25A 4LLDA 1IEBA 2QHLA 1CDYA 3IFNH 3NCCB 1OL0A 2JA5G 1KZQA 1SDDA 3QJFB 3DM1A 3GSNA 4L5FE 3G9VA 3UOAB 1MHEB 4X8JB 4DVBB 1Q72L 1WBXA 2WAHA 4RGNE 2ZCKL 5IMLA 4UAIA 3WNJA 5CEXA 1RERA 3NCYP 4G1EB 2F54D 4XOEA 4APQB 4JFHE 4TUKH 5E4XA 4S1QH 4PJ8A 1QB5D 4OV6F 2WNWA 5F96L 1T4KA 4NZUL 4GSUA 2EIBA 4CILA 1A2YB 2VDPH 5KYXA 1I94L 5JORA 2A68C 4A93H 3CRLC 2RFXA 5IGDA 5SWZB 4E41B 3AWFA 1KXQA 5G2NA 4YSSA 1ETA1 2R0WL 3QJFA 4NZFA 2GVBA 2AMCB 1A63A 1LDSA 4X8JA 3E0JA 4CA4A 5F0LB 1II4E 3QCVL 4OIFA 5DNFA 1OWWA 2Z1PA 3SDCB 4L3ED 4G1EA 3T08A 5HHVL 5GS0H 1SMOA 1OM9A 1LHZA 4FQ1L 3UCRA 3VFRB 2DY7A 4G8IB 4YEEA 5ID1A 4WRLA 4GH7B 2YXVA 4QRPD 3UERA 1UWYA 4BXXG 1A2YA 3LY6A 1HXYD 4KC3B 3J7ZC 2ERJC 5C0BD 3S1NB 1XSIA 3WXWL 2GFBB 3ILQD 5SWZA 4E41A 4K2KA 1XSJA 1VMCA 5HURA 5KBLA 2BDOA 2PNRC 4HQQL 1VQ4A 3V4PB 1BG1A 3DLLA 4HH8A 4DKTA 2UUBL 4A66A 2J6WA 3SDCA 3WEBA 4TVSa 1JGUL 4B9KC 4DV2L 2A6HC 3FH8A 3HFMH 1NKOA 2ZUYA 3VFRA 4G8IA 1XX9C 5HTSA 1CQFA 1BSIA 1CK0H 2CAKA 4OLEA 2A6IB 5BW7C 3CFDA 2PNHA 1P4IL 4YJZL 5I8OH 2VZAA 2GFBA 2JYOA 5DHXB 3W81A 4XBPB 3L3HB 3BAKA 4PYHA 1G0YR 3HBZA 3G5YB 4PP1C 4YBQC 3Q48A 2OFQA 3IDGB 2C3XA 4KGJA 4DEPC 4U6XB 3V4PA 4BFFA 4FA7B 4H26B 2F54A 1FG9C 1VFBB 3QRGH 3HZVA 5ETUB 1BIIB 3RL1B 2KZKA 1G84A 4OD1H 2IIJA 2JNZA 2X0VA 4QRPB 1JUFA 1HXYB 5C0BB 4LF8Q 1WZ1H 2V37A 2DPKA 2ZWKA 3GHPA 3M86A 4JM4H 1P7HL 3CVHL 4JO4H 4K5PA 4YSUA 4XBPA 1TZHB 1SLJA 3KLRA 3L3HA 4JG1H 2XQYK 1HAUA 3G5YA 1ADQA 2OTPA 1RVFL 3IDGA 4XH2B 5IEKB 4U6XA 3P2BA 3MO1A 1MDTA 4H26A 4L3EA 3S6CA 5EBDA 1WCBB 3SQOL 1RUKH 1VFBA 4XNXH 3A7AB 2K14A 2K5HA 2P8LB 1CGSL 5ETUA 3RL1A 5F6IC 3EOAB 4QXWA 3O2WH 2LXKA 4RFEB 5K9JH 4QRPA 3EH5B 1NC2D 2F2HA 2OMWB 1HXYA 1X3EA 2KECA 5C0AE 5BR8L 3F8UB 5AYTA 5GS3A 4D3CL 5IHHA 4G59C 4R96B 3RWJB 1QZGA 3R4RA 2WUBH 1DQTA 1JDDA 3TFBA 7FABH 2JKSA 2VT0A 1TZHA 4P5TB 2R93G 1NPJA 5DXWA 5I1KL 3IMRA 4PLNC 1UA3A 4GSQA 4XH2A 5IEKA 5D7IB 3GRWH 5KSAD 1L5GB 2WW8A 3VXUD 4FABH 4PJ9C 1HL9A 2FAUA 4JFED 5I28A 2P8LA 4XMLH 1MFDL 5I74C 3QC5X 3UDXA 3GSRB 2HXAA 2OMWA 1CGVA 3IAQA 1DBBH 1JWMA 5LGHH 1RPUA 1FL5B 3TMEA 1HHIA 1CYGA 3CXHK 2HFFB 5HYFA 1SAPA 4R96A 3RWJA 4YFEA 3D4DA 1KXTB 1QYGH 4XNBA 2HVKB 1OARH 1SY6A 2N1KA 1NWPA 1A0QL 5JW3H 2EDJA 1AOZA 3KBPA 1LWRA 5D7IA 2IGFL 1L5GA 3RGVD 1MNNA 2BW5A 3HHMA 4D0DB 1NC2B 1KB9J 3WMQA 3UTTE 2E8GA 2YAEA 4NUPA 5JOPD 1Y1WH 1EMTH 2VLMD 3HC3H 3V2AR 1MELA 5SX5H 4N5ED 1FL5A 4XCNB 1A14H 4WNQB 3L5WB 1AI1L 3QQ4A 5LBGA 4LB8A 1PEWA 1B9MA 2MCPL 1TJXA 1KXTA 3TT3L 2HVKA 3PDOA 1ZTXH 5KSAB 3VXUB 2RGSA 2QR0B 3BP5B 1G9NL 1EIBA 2IV9A 4GQQA 4JFDD 4OGXH 4G71B 2ID0A 15C8L 3EFDL 4FDWA 4BWGB 2PO6C 4POUB 4D0DA 2CQOA 3GZKA 1NC2A 5CP3A 3D39A 2VC2H 3ZLQC 2XACC 3BRGC 1PU0A 4DR2L 1AZCA 3NA9H 4NKDB 5AAPA 3OJDB 3BP6B 2Y1AA 2L5TA 3FNKA 3CZLA 3E0GA 3T0EE 1CICD 3VM5A 5EUOB 1B0WA 2XY1A 3L5WA 4HUWB 4WNQA 4YC2B 5ALCH 3IRBA 1OCRB 1JHLL 4XXWA 4RAUB 1UD3A 5TF0A 1WWCA 5ELOA 1BM7A 4Q4EA 4KJYB 2P3YA 2O4EA 3EDFA 3GBNL 5KSAA 1AO7E 5FHBL 3RGVB 2QR0A 3K5MA 3RJDA 1V1QA 1KXVC 2Z6BA 1QILA 2IDFA 3BP5A 4JFEA 4MXQD 4P23D 5I1DB 3PGDB 2W07B 2WVTA 3V0GA 1UHVA 4XO3A 4BGLA 3MQIA 4KFZC 1V3JA 1SHSA 5IYCG 5IREA 4NKDA 3OJDA 3BP6A 2OJ1A 2R29L 4J4PC 1K3RA 5EHFA 5EUOA 4HUWA 5I1JL 2OR7A 1QO3B 5B1AB 4CGUB 4DP0X 4GT0A 3O0LA 4MNHA 3CVDA 4FQLL 3LDBC 4JFDB 1L9NA 4KJYA 4PI0A 4R8NA 3SBWC 4YEFA 5I16B 3RGVA 1Q8MA 1YVLA 4F8LA 4Z7NF 3MACL 1CFBA 5I1DA 3IDMB 3PGDA 5GRJH 2CM5A 4W68A 3GRBA 5TK2A 4L1LA 2FEDC 3ER0A 3LRLA 1CICB 5IYBH 2VXVH 5F8RC 2FT7A 4WQOA 5FPIA 4OI7A 1HCFX 5C0JB 4P9HH 2MOVA 3FQWB 5IJCC 1QO3A 1Z9MA 1WCMB 1HNYA 1I9JH 4NP4L 3VI4E 1QBMH 2G9DA 3AQQA 4H8QA 4JFDA 3TFKC 1ROWA 4P23B 4PFEA 5I16A 4NZRL 4QD2E 3RJQB 4QAWA 5GGTL 3VR6A 2DJ4A 3IDMA 2CMRH 1KDBA 4YFLI 2CNZA 3QO2A 1HZHL 2BNQE 3TP7A 5KBKA 2ZCHH 3RU8L 3K5NA 1EDYA 2V9RA 2F7RA 3LMJL 3K7UA 3V6BR 4KD4A 5C0JA 2HIXA 1IT9L 1IJ9A 2CDEB 4B3MQ 3FQWA 3TNMB 5C08E 1MI5D 1KCVH 5AQ0A 4BWTA 4XE5B 2VLKD 2BHYA 4P23A 2VE6B 4H8WL 4P4RB 2ASBA 1ULVA 4HT1L 2WXPA 3ECUA 2Z31D 1D2PA 1HSAB 3N1PC 2HJFB 2IDUA 2MH4A 2WQXA 3BZKA 4OZGB 1WJJA 2ATWA 4RZCB 2F0TA 4XODA 1A6UH 2E56A 3L4TA 4L1DA 3B1TA 2P9RA 4A7UA 1FD7D 1KRTA 5EC2B 1UKQA 3NIDB 3UDGA 1AANA 1GC1C 1DR9A 2I5YL 4BBSH 1OK8A 3I3BA 4MAYD 4OLYH 3S3BB 4FLSA 5EO1B 2ZTCA 5J11B 2EE9A 3PRZA 1O6VA 2MMXA 3PAUA 1A7PL 2Y2WA 4PWIA 4QXTB 3W37A 3GRGA 2I0QA 2KBGA 3BWSA 1B0GB 3CUPA 1KDIA 4P4RA 3SHSA 4LSDA 1UCBH 3NJFA 3ALPA 1HSAA 2OJEB 2HJFA 1LEKA 1Y1DA 1LM0A 1AJ7L 3QWNA 3PY9A 4OZGA 1DEEA 1MVUB 4RZCA 4F7PB 3NH7L 3UTQB 4EE2A 3T77B 3D31A 5ILTL 4HKJA 3RUGA 1GOHA 1MFMA 3BVGA 3KGRA 4YSPA 3QQ9D 2BE5D 3RL2B 4MJHA 3HEIB 4BFIB 5J8OA 5DD0L 3F58H 5BPPA 2L0DA 3S3PA 2VLKB 5EO1A 4KVPA 4IDJL 3S37H 3LNGA 2HG0A 3L5IA 1YEHL 3CF5A 1QAWA 4S11A 1E42A 2FEEI 4HUUB 2Z31B 4OD3L 4C57C 2ZT9C 2JKJA 3L45A 5EEUA 1HTLD 1BBJB 5E9NA 1MNUH 2ED7A 3L9BA 4JRYA 2XN2A 2ADIB 3MRMA 2WXOA 2OJEA 1I8UA 2HT2D 2VDKH 1MBYA 4G6AC 1MVUA 4I87A 4Q74A 3ZKXC 3CX5K 4H1LB 5EWIL 2NW2B 4ACTA 4LF8L 1WFNA 3KYNB 4HZLA 2G9KA 2K8MA 4MAYB 2LFNA 1MI5A 4GNKB 5C8JB 4NQUA 5M7QA 2B8FA 3E5SA 2NY3D 2Y3NA 3MXWL 2JCCE 2DJMA 2VLKA 1NSNL 2VQFQ 3QNFA 3NCJL 4IKJA 4QO1B 2ZKXA 2DJUA 5AG8A 5CLYA 1F2YA 4Z7WE 4HJ9A 2Z31A 4HUUA 5AUMB 3PMFA 1TT2A 1DVYA 4HPYH 4WJWA 1EFWA 4N0CC 1BBJA 2JJSC 4PJGB 5ELIA 4EI6B 1E90A 4K3EL 1TWAH 3T0BA 3L9RB 4XVUD 4H1LA 1NFDA 1YYLH 1LTSD 3QR0A 1WD9A 4MAYA 4PY8J 3S2CA 3ZJAA 5CD5C 1J5CA 3HC4H 5T1JA 2P1YA 1UWXH 4LFBQ 1CDBA 5C7XH 4ZS7H 4S10A 5K9KA 2O93L 3O6FA 4QO1A 1DXMA 1U3HD 4QXVA 5D7JC 4ZTOH 1B50A 3A74A 5EOCH 1VQPA 2F5AL 4BY1H 4PJGA 1CQYA 3MUJA 2QFRA 3BUYB 1G43A 3B5HA 3DSNB 4K7PH 4NQXB 4RFNB 4EI6A 3JZYA 1NGXB 1X9LA 3L9RA 5C6TH 2Y23A 3BEVB 3U7YH 5KTEH 5IKCB 4ODXB 5IFHL 4EKJA 2QVTA 3NQKA 2NY3B 4K7PY 2A1WH 5FYLH 3RD4A 1F0LA 1PCSA 4LP5A 4AJ0A 2EKJA 2H32B 2D3NA 4K7FB 3P4NB 4R4NC 4N0FB 4BZ2H 1U36A 1AE6H 3SQRA 4CJ0B 5B7MA 5J13B 3FTGA 3GK8L 3NJHA 5CV6A 1UZ6E 4FS0A 4JO1H 4EMZA 1ASPA 1GHJA 3T13A 3BUYA 1MHPL 1P2CB 3DSNA 3BWAB 3S1QH 3IF1B 4J2QA 4NQXA 4BFNA 1NGXA 1CS6A 3T3PB 3WG7B 4H25B 5JXAH 5JA9A 1JZIA 3BEVA 3VRIA 1MLCB 5IKCA 2CBQA 4ODXA 4CDGC 4Y9BA 1F3DJ 1NL0L 5ANMB 1V7NL 4QTIL 4NXNQ 4KJPD 4U33A 1ZANL 2V17H 3O9WD 4QYAA 1U3HB 1X65A 3BZDA 2H32A 4KVNL 1R4QB 3MBXH 2PQAA 2EE6A 3OL2A 1C5BH 3PDDA 4XN2A 3FONB 1MQKL 4UOZA 2EXWD 1J5HA 4P2QD 1CSPA 3QCTH 1EHAA 1P2CA 1NKGA 3L54A 3BWAA 5JIQA 3IF1A 5DUPH 1N3NB 2D3VA 4H25A 5H4ZA 4DR7Q 1O7LA 3CC1A 4RGMC 1MLCA 2B5IC 4QIWB 1D7DA 1MIMH 2GYSA 3H9SA 5C92A 5HYIA 2HMID 3ZR5A 4D0BB 4ZQKB 5IQ7L 3RNQB 1EJFA 4KK7A 5FYJE 4MA3B 1S3RA 3PP3H 5IP9G 4FHJA 1JZ4A 5AVRB 3O3BA 2R4RH 3T53B 3DK0A 1Q0EA 1ZV5A 4JZJC 1Z32X 4AZ8B 2YA0A 2APXA 2M26A 1R3IL 4KRLB 5CIPH 4XO4A 3ZL4L 2K04A 2JKIS 3AS2A 2DMGA 4JW0A 1M7DB 2F6AA 5HGDA 4M5TA 1N0LB 1EJOL 1KDAA 2YHGA 3QYMA 3CAMA 1ENAA 3O9WB 4Z76B 4XC1H 1RHHB 2E8YA 4O02H 3QXUA 4YPJA 4ENEC 2NQCA 2G3ZA 3N2JA 1GGIL 3K3QA 2E9WA 4KAQL 1AD0B 1AXTH 3D69B 2XKUA 1MY5A 4AZ8A 2B4CC 2W80C 2AJSL 3D2TA 4DK5A 1FFNB 4DKFL 5TPWH 3MV8E 2ZXRA 3TWYA 1IO4C 3MCLL 2QEJC 1M7DA 4DV1Q 3QEHB 2K5VA 2KH2B 3BVTA 4QOKE 3RBGA 4HXAH 5EN2B 4ZS6D 1U8IB 1VZIA 1EUUA 3SE8H 1N0LA 3QDJA 2VDQB 1Q1BA 3OWEB 4I85A 4H2CA 1B4TA 5HYSG 1F58H 2FX7L 3O9WA 4RGOS 4HWBL 4E9SA 1RHHA 3HG2A 4KJWC 3V7MA 2IOOA 2IEPA 4ATTA 1AFVL 2AJUH 4RMFA 4JRXD 2DQJH 4Y19D 1AD0A 3D69A 4UT7L 4EXKA 5FM4A 3PSIA 3WMSA 1VQBA 2NNFA 1FFNA 4G4KA 4P2QA 2V2TA 5C0GA 1FH5H 1IM3D 2E5EA 4LASL 4XHJC 4GS7C 1H8NA 3R0NA 1EZLA 4Z7OF 4A3JH 2DI7A 2O5YH 1TO5A 1STEA 2VDOH 3QEHA 4FJYA 4OCRL 4F8NA 5IESL 3F2BA 2OCFD 1E4HA 3K2UH 3WS6C 5H1SE 2XWBB 1IQWL 4B3ML 4N8CL 4B9IA 3FPUB 3S2HH 1LEGB 1NPUA 1HK6A 4K3JH 3C8HA 2DUDA 1JF1B 3BJ91 1O7SA 4OZ4B 4KPHL 5AZ2L 4DP1X 4NUGH 4PJEB 5KUMA 5E2WH 4FXGC 3BS1A 1OP9A 1W15A 4UF7C 5DLML 3SDXF 2CPCA 3ZDXB 4A6YH 3DX0A 1KIPA 4G43B 4YX2L 3NAAH 3EVQA 3OF6D 3C09B 1TNMA 1RJLB 3NGBC 5DZOA 4JNXA 1EAPB 1KBBA 1UH4A 2ENQA 1RK0A 2MPVA 4ODVH 3U6XS 2ENPA 2B1HL 1LEGA 5LJYH 2WO4A 4JRXB 4Y19B 1J8HA 4KZEH 3WEXB 3AY4C 1WVZA 2Z4QA 3OHXA 1PG7X 1I7UB 4HFUH 4UDUC 4PJEA 5C1MB 5SWZE 4E41E 1EAJA 1JGEA 1YUKB 1IM3B 3HNTL 3R7QA 1EY8A 2V8MA 4P9MH 1N59B 2H0EA 1DCLA 4N2KA 3S3SA 1CL7H 3V52L 5DVMA 1T3FB 1AIZA 4N2MA 5B39G 3O41B 3S35L 2IDSA 1G7JB 4ZFFB 1Q8IA 3CQFA 5LWYL 4IQZA 1EAPA 2CRYA 2MFNA 5DJYB 1STGA 1X5IA 3IFPB 4U3SB 1W0VA 2A0LD 1D1KA 4CMMB 4JRXA 1NEZG 4Y19A 4UANA 2CR0A 4ZUVB 5E6RB 3MGOA 3WEXA 3ZL2A 1YEEL 4W70A 4X62Q 1GW0A 1G6PA 3O3DB 3NBHB 4HSPA 2YPVH 3B7SA 4N2EA 1STAA 4X0NA 5ESAA 1K83H 1T4WA 2PCPA 1XEDA 3L1OL 3PO3B 1N8OE 1PVOA 1T3FA 2F54E 4H20H 2CKZB 4GBXD 3TJHD 1LD9A 3O41A 3NIGF 1FIGH 1G7JA 5F2DA 4HGWB 3PUXA 4MZ2A 4ZFFA 1UCTA 5DJYA 3OMGA 1BVOA 4U3SA 1A66A 1ZVNA 3UYOD 4CMMA 2VQFL 3OMZA 4LSPH 4ZUVA 3R7RA 4DGYH 5F8QC 4EF3A 5E6ZA 2VDLL 3GS7A 4DK6A 1AKPA 1FL3A 1WG3A 3GM0A 2YLHA 3O3DA 2J7LA 1N9WA 4X5WB 3U30B 4X80H 5F7YC 4HOZA 3E7JA 1GC1L 3EO0B 3EG9B 2OMNA 4PJFF 1YN7A 1AGEB 5FHAL 3KLQA 1DP0A 2FVNA 4QRPE 4IHOB 3QG7L 4NCC1 4FXKB 4ZFZB 4LFBL 5C0BE 3RGBA 3HOGA 1U3JA 5HYQB 3ULUC 1GYAA 1COBA 1HHJA 2AJXH 2DICA 5ICYA 4N5UA 3QB3A 1F8TL 2XZZA 2F68X 5KNDA 4IYKA 2LKVA 4AIZB 5I1HL 4AEIL 5AKSA 1N4XH 4X5WA 1LTTD 1NGWB 4GOSA 4CKVX 1I8IB 4GBXB 3EO0A 2AWOA 3EG9A 3EH4B 5HBBA 3U6RB 2WNGA 4XIGS 1AGEA 1PLAA 3SDDC 5CGYC 4F57H 3GTKB 3X1FA 1RUPH 3IJ7A 4IHOA 1ZYRC 1F86A 4FXKA 3HNVL 4J2XA 4DZBA 2FK9A 1NOAA 3FO9B 2X0UA 2DLEA 1S7VB 2ZOLB 4YSOA 1JHTB 1I1CA 1QWUA 2X4UA 4BKLB 3TV8A 1EEYB 5IWAQ 1RULL 1Z9OA 3HI6L 4PJBF 1EU3A 4EN3A 4OIKA 4GUOA 4OO1I 1NGWA 1P5UB 4OFYD 5D7IE 1I8IA 4GBXA 3OPZH 1YSOA 4BBRB 3U6RA 2B14A 4YWMA 3MJGX 3OAZK 4D2NA 4NXNL 3M4OH 2JJTA 4GSRA 4OI9A 1UZ8A 4M43L 1K9TA 4FQCL 2W9LA 5I18L 3FO9A 1XF5B 2PW1B 1OP4A 2ZTEA 1S7VA 2ZOLA 4M62L 1JHTA 1O0VA 3VI3A 4F93B 1KAWA 2ATPA 5E2UL 3SPHA 3Q6GL 4MRCA 1XAUA 5CJXC 3T6VA 5J22A 1WZMA 2FHTA 4EI5D 4IIQA 2EXYC 1JR0D 3VXNA 4HETA 1LTID 1WGVA 3FUNA 4A3GH 2H7WA 1U4PA 1NGQH 4DR7L 4L8CB 2YEVB 4FKHA 2FO8A 3FHEA 1TZGH 2J12B 4I8DA 4ZKBB 2N0MA 4GXVL 4Y52H 3MKGA 4OLVH 1K0SA 3SPIA 2AXFA 1C8PA 3PS6A 4Z7UA 5DO2C 4M8QB 5CJBA 3T65B 2PW1A 2B08A 1EDHA 3B8SA 4K3GA 3BSZH 1UD8A 1CGWA 3ICEA 4WO0A 5LG6A 4FG6D 4XPHL 4FYSA 3LH9A 3VXUE 1N64H 5B1BB 4B53A 4C54A 1MCOL 4B9JA 4JM0A 3C87A 3VRLF 3HVNA 3LXBA 5EORL 5F88A 3BEWB 2EDXA 4H7VA 1CK1A 2O5ZH 1L9TA 4Q56A 5AWNL 4CSTA 5ICXB 4JPSA 2MCMA 1BMGA 2K4AA 1MRFL 1U6AH 1UD6A 4DGIL 2K9UA 1KN4L 3AM8C 1CG9B 4M6MH 1NDTA 4P2RD 1L9OA 2IPKD 3S2DB 4M8QA 1TZ8A 4M93B 5DRXB 5EUOE 1TPXB 2IWEA 3J2PA 4PIBA 1KENH 3T65A 3WS3B 4H13C 3KLAB 5DD5L 4EI5B 1DVSA 2AQTA 3KPOB 2GIMA 2QDLA 4JPKL 4OFYA 4ES9A 4A7SA 3I02B 4DV1L 3LIUA 1GS6X 1ZRUA 4QJ4B 1ZXTA 2RQEA 4N0YH 4A3DG 3MNZB 3X3MA 5DRNA 3BEWA 1KC5L 3WKPA 2XRQD 4HR7B 1OAYL 5CLZA 1QHOA 5ICXA 3RP1A 3FTWA 2VLME 5JOPE 3FTXA 4MTMA 5TE6H 3BU2A 2A6DB 1M2VB 4YSAA 1SXZA 2WBJB 3NK9A 4Q6KA 4X5XB 2IDCA 5DRXA 3WSQH 2PXYA 4Q4IA 3WS3A 3HC2A 5LN8A 2VR6A 3PGCA 1NCAL 4EI5A 3TNNB 4Z0BH 3KPOA 3S14B 1AIFB 2HT1A 4JFDE 4NLHA 3WE6B 3I02A 1QG7A 1JJCB 4GKZB 1HZ9A 4OQTH 4FKEA 3RZCD 2VLRD 4K5MA 2DLIA 4POZC 3EFOB 5KSBB 5EKLA 4WO4C 1HAWA 1NCJA 2CCLA 3QS2A 5B1KA 4LPYA 3AT8A 1RJZB 4KDVA 3KJPA 2UZXB 4WHCA 4P2RB 3V4LA 2A6DA 1EHXA 2IPKB 1M2VA 1EY0A 4NPJA 3QJHB 4F58L 5L88L 4KX9A 4X5XA 1TQWA 5MP6H 3KCWA 1E6JL 3U4EA 2PPFA 1VESA 5IBUB 3NCMA 3BAYA 4K9EH 1EY4A 2OYLA 4RMBA 3TNNA 2J25A 1AIFA 3E6HB 3MJWA 3WE6A 1D5RA 4ZOBA 4I0KA 1PLFA 1W8NA 4XCYB 3HZMB 2EYOA 3QJRB 3K2IA 4U0RB 3SGDH 1SOXA 3ISYA 3PO2H 4Y5YB 5DJCA 5I75B 1M2OA 3OPOA 3A56A 2VQEL 1RJZA 3WCYA 2UZXA 3HUJF 4JO2H 1A65A 4P2RA 2IPKA 2PWEA 3QULB 2B4CL 3QJHA 4N8PA 1T03L 3BZEB 4LPTA 5M5YH 2WLHA 5FYKU 4PM1A 4A93B 4KZ0A 3GUTA 3TPKA 2VXTL 3OKYA 5KSVB 4WKZB 1MH5B 2P52A 3BSHA 2YD0A 4HPOL 1U8PA 4S0SD 3E6HA 3WTVA 5DMGD 3U2SB 4P59L 3RZCB 2VLRB 2IX1A 1KBVA 2WXNA 3ARDC 3HZMA 4IUTA 5I23A 1AD9B 4Z77B 1XV8A 4OZGE 4U3CA 4TNEA 3N43F 4Y5YA 1FLRH 4PJXB 4X5LA 5DYOB 5DMKB 1TIID 1AZPA 2R2HB 3LKNB 3NIDE 3SK6A 1HL5A 1FNEB 2Y3AA 3IJHB 5EBLB 4WY7L 4MJ5B 4MXVF 2EDWA 4LSUL 1LWHA 1RZ8B 2A83A 2BIHA 5TH2B 1K6QL 3VD4A 4KK6D 1PTOD 1WFOA 5KSVA 4X62L 4WKZA 1PSKH 4GRWH 2VSDA 5E23A 1OAKH 4AGLA 4EI0A 3QZWB 5JPMC 1SYDA 3TZUA 3ARPA 3QEGH 5HJ3B 3RZCA 5GS1C 2MHAB 1E1TA 1CDIA 2F53D 1AD9A 4Z77A 1JPTL 2XVKA 3L7ZC 1MJ7L 4IGBD 2FQFA 4PJXA 1F2ZA 1AGFB 5DYOA 4ZNEA 3ULUF 1UH3A 3IGAA 5DMKA 3INOA 1R34A 4B3SL 2MRYA 2R2HA 3LKNA 3LKPB 1P53A 3U82B 5BOPA 3IJHA 1MI5E 3KG5A 5EBLA 5GS2H 2R1YA 3UGUA 4IOFC 3U9OA 2D7MA 2Z1KA 4MJ5A 1RZ8A 2QJDA 1NANH 2WWMD 3GDBA 4OFVA 2VLKE 4G6KH 2LLNA 5TH2A 3WIHA 1BJMA 2APWA 3QUKB 2O1AA 4N2DA 4KY2A 4X5QA 1L7TL 3QZWA 3HRZC 4QJ5B 4B50A 1CVRA 3VG0L 1WS7A 1MI2A 4BRVA 2DB8A 1PFCA 2MHAA 1HOCB 2O26U 4P2CG 3VX1A 1HH6B 3N0PB 1A7OH 3G6EA 4KXBA 4MZIA 5E5UB 7TAAA 4X6DF 4B9PA 4OEMB 1RZ7H 1I4RA 3BWUC 3LKPA 3WY1A 4MDIB 1FV1B 1PTOB 4U7SA 3K80C 2BOBB 1HQ4A 1W2KT 2CKBH 1BBDL 4UV4H 3VFVB 4N9PA 1KBWA 4WSKA 4YUEH 2CJTA 3QQDB 3MJ7A 5IGXH 1G6VK 4MBRA 3ZQWA 3CD4A 4PJGE 5EV7A 2F53B 2L11A 1CFSB 4K8IA 4IGBB 5A2QE 3LAFA 2RHSB 3KH3A 4X65Q 1CE6B 5GGRY 1HH6A 3P1VA 2KDGA 2NY0C 5AVQB 5M5XB 4NXSA 1O7IA 1DO5A 2WBKA 1E8XA 4KO7A 3SQBB 4MDIA 3STBC 5L7XH 1ZVHA 5I30H 3CPLB 1YITA 5IWAL 4C4KO 3CCEA 3OM3B 3Q9QA 1T1YB 2WYZA 1IC4H 2H8PB 3QG6B 2KI6A 4TSBH 1KEMH 3QQDA 3FQ4A 5KGUA 5ELNA 1CFSA 2BINA 5T1KA 4IGBA 2L9HA 3U9PH 3WTWA 5HY9A 3V5KB 5I0XA 2RSOA 1XD0A 4KTDH 4P99A 5LNEA 3DX8B 3R93A 4PGDA 2A9NH 1TXYA 4CVZB 3U4BH 4LQFL 5DT1L 3GMOB 4OONA 1QSED 3SQBA 3N44F 2BFVH 2XQBL 4U2YA 1XZWA 3CPLA 1NCUA 1TEYA 4XYQA 2VDMB 3UACA 2FX9H 5I1AB 1IZ6A 5EPLA 1NJ9B 1T1YA 1BVZA 2H8PA 3QG6A 5KVFE 4GUQA 4IBQA 3RYMA 4PJ7B 5M5WH 4Z3TA 3IU3B 3IMWA 1J9SA 4UV7H 3OZKA 4IO9A 4XPAL 4QTHB 3EOTH 2ZXCA 2XT1B 3T3PE 3GT6A 4XP6L 4C56A 5C9JB 3DX8A 4BWUA 4UINL 1IAIH 4HD5A 4DO5A 3ASOB 1Q46A 4CVZA 4LSSL 3T2LA 3GMOA 5ANME 4X4ZA 2GKIA 4Z95L 4OJFL 4U1MA 3EIFA 3K71B 3RVVC 2XZQH 1NJ9A 4RLDA 2ETWA 3QYNA 4NC1C 1VFOA 3ARGC 2GAZA 4R8WH 2ZF8A 3VH8B 4DESA 3AT9A 1FRGH 4N2GA 4PB9L 4PJ7A 3IU3A 4DWHA 2C3VB 4FZ8H 4A3KB 3UFIA 3DJ9A 4QTHA 5C09D 2NCEA 3KM1A 3I84A 3PHQB 3TYFB 1XXFC 4BXSV 1PDQA 1DQKA 5KVGE 3L4XA 5C9JA 4NUMA 2GUOA 3QGVA 4QIWE 2HG5B 1VQGA 2KKQA 1ORSB 2HYMA 3CMOL 3TM6A 1MJUL 1Z7TA 4XWGH 5DZJA 4XX1E 1QLRA 4MDJB 2EC9T 2XY2A 3S36L 3A6CH 4H1LG 2CA3A 2OMBA 4FNSA 3K71A 2GA4B 3V8OA 3QUZD 3DUSB 4LPUA 1W8EA 3VH8A 2IANA 4IJTA 4NUJB 2XXFA 3J07A 4JX0A 2UWEA 4MTNA 3QC6X 2C3VA 2BS71 4BKSC 3PV6B 3CLEH 2WZ0A 3PHQA 2B3GA 3TYFA 3D06A 4LUVA 1QSEA 2HG5A 2X4OB 4WK2B 2LABA 3C5ZD 2EDOA 2F8XC 4MDJA 3VM7A 4ELMF 1JHKH 2QGQA 1YYMH 2CH4A 1NMBH 3FQTA 4J8RB 3OZ9H 2GTWB 1EIYB 1N6UA 2ZPKH 2DWXA 3DUSA 1JTTA 3FUKA 4O00A 1BXXA 4P2QE 1OGSA 4QR7A 2Q2LA 5C09B 5T33H 3VI3B 3HOXB 4JHUA 3RVUC 3SPJA 3OXRB 5C0FB 1PZ3A 4FQIH 3CH8A 5H37H 1MFEL 1MY7A 1L0YB 1SUHA 2MJWA 2OSLB 2VTFA 4MMXC 4KUCD 5KIXA 4WWNA 3HB3B 5JOFB 5K39B 1PQZB 3MMEB 5D96B 5DAUA 2X4OA 4AM0B 1YPZB 2IPTH 1ERNA 3GHBH 4ONOA 4JI0Q 3QUZB 5FLVA 4NHCH 1CF8L 1DL7L 4J8RA 4JJ5B 4EQ3A 4LHUD 4KWUA 2VRAA 5KAQG 4XDXA 1AACA 2O6FA 3MBWB 1KJ2L 2R7FA 3U9UB 4WDIB 4CMHC 5C09A 3MXNB 2ADGB 3DO4A 3MRDB 3U4AA 5C0FA 4K94H 2UUDK 1KBPA 5A2IH 3L5HA 4EDXB 1L0YA 1QNIA 2OSLA 3RN2A 1J5EQ 2JKWA 5LGJB 3GC3A 4QHKI 3HTLX 5JOFA 3D2UD 1PQZA 1BD2D 3C5ZB 1RIUH 4L8JA 3MMEA 4G8EA 4PD4J 5DJ6B 5AAWC 4AM0A 1L0WA 1YPZA 4E5XB 3ARYA 2F0OA 3CVHB 3FCTB 1F2QA 4JANB 3U25A 3BD4A 3LEVL 2IC2A 1A3QA 4PJEE 2ICWB 1Q9OA 2GTZB 4GQ9L 4DP5X 4KJNA 5EBCA 1BQUA 3ZL1A 1I1AC 4FYQA 3U9UA 4AUYA 4WDIA 2JA7H 4LLYB 3ZDXE 3MRDA 3TBYA 3A6OA 3F6IA 1X5MA 2BW4A 4EDXA 5F97E 4OLXL 2DIAA 3DTUB 4FVMA 5LGJA 2CHBD 3MLYL 2F3IA 3C5ZA 4HMEA 1AR1D 2PR4H 2Z7UA 1QTYT 1FAKT 4LL1A 4M7LL 3EDEA 3CVHA 3FCTA 4JANA 1SE3A 4JRXE 3T3MB 4Y19E 4X3SA 3GQFA 3UGXA 1QOKA 2WTOA 4LHUB 5LUMA 4OCSH 3TZVC 4DU9A 5JQ6L 1MCKA 3DX9B 2ICWA 3WN5C 3LRGA 4LPCA 1KELL 1DZ1A 3HCVB 3OKNA 3PUCA 4O4YH 3SE0A 2ZM6Q 1S7RB 4LLYA 4MD0B 2K52A 2VW6A 2NVTH 3JWOL 1STBA 3KYHC 5GJSL 3QEQD 3BWUF 3D2UB 4HKBB 2OYKA 3RG1C 2BXYA 3R06B 1JVLA 1ZK9A 1VIWA 1UFGA 2BERA 1A3ZA 2MQ3A 1IBHA 1AYOA 4HJ5A 3QOLA 1I8AA 3IL8A 2HWZH 5IT9L 1A1MB 2HLEB 1KLFB 1UA6L 2IBBA 3MUGA 3QXWA 3K7AH 4LHUA 3KF8B 4LLQB 3A8IE 1PH6A 1ZA6B 3HCVA 3N41B 3HNSH 3U46A 2Y0SB 4JI4Q 2UXDQ 5E24E 3ULVH 1S7RA 4NPYB 1LL1A 4MD0A 3VFSA 1D5IH 3UMNA 2EDKA 2GN5A 1SNDA 2QGEA 4IMLB 1BD2A 3OMNB 4HKBA 1AR1B 2DQUL 1ZS8B 2F74B 4UDTB 3AFLA 3CC2A 3MV9D 5CMAB 3CCSA 2VQTA 1VQ5A 1HFUA 1MRCH 5DVLA 3C5SB 4YXKH 2HJLB 3VD9A 2QA4A 1A1MA 1KLFA 3LZOA 1BA9A 3F6JA 3P2DA 3KF8A 4LLQA 4RAHA 2WNKA 3A22A 1E4KC 4H5SA 3K5LA 5E4OA 5FO7B 4NPYA 3QEQB 4HGMA 4X65L 5LNGA 2NZ1D 1RIHL 4M7KL 1TWAB 2H3NB 1IGCL 3EZJB 2BCMA 3VWJD 3N06B 3Q13A 1UD5A 2UY7B 4XP4L 1DQDH 4IMLA 1AKJD 5J3HD 1ZS8A 1DE4B 2F74A 4UDTA 4HCGA 2ZUWA 4GNXC 5DZNA 4O42A 1QNZH 2B9AA 5E1FA 5CMAA 5FDWA 2V4DA 4ICWA 2XN9A 1UE1A 4DP4X 3C5SA 3J7HA 2HJLA 3MOBL 5CZVH 4POYA 1XR8A 1B2YA 5IUSA 4BY1B 3EJSA 2E76C 5I73B 3NFNA 5FO7A 4X98A 4HJ1A 3SKOB 3QEQA 4B5ZA 1VQJA 3CU1A 5FWRA 3RIAK 3RVWC 4AC2A 1LK3H 1WISA 1FFOB 2UY7A 4D9LL 1SNPA 2EABA 4NENB 5KEEA 3MV9B 2G5UA 4GAFB 3SE9L 5L6YL 1DE4A 1ODUA 1OKEA 2EDFA 3BISA 2J8UF 3GHEL 1WFIA 5CINL 4BQ6A 2VLJD 5I8KH 2EIFA 1LTGD 4JOIC 2WKGA 4PY7A 4YAQB 2VZUA 5KANG 4YDKH 2CRMA 1FBIH 1LO2L 4RCAA 3CHSA 4J28A 4I65A 2FT6A 1GR7A 1XTLA 2F0EA 1X5YA 4IEFA 4L23A 2HUGA 4YBHA 3VWJB 3IKCB 3S1QB 3P4MB 4HBCH 4NJ9L 1RV6X 4UQ3B 1AKJB 2H1PH 4WCYL 5F7LB 1EV2E 1UD2A 4G9DA 1FFOA 5JW4Q 4NENA 3MV9A 1BGXH 2OMZB 1NBZA 4MCYB 4ANVA 4NQVA 3PDGA 4BZ1H 3CVIL 4ABVA 4LFAQ 4EOWL 3LEYL 4QIRA 4YAQA 1PHJA 4KX8A 4MB1A 3RAJH 2DQEH 4EIUA 3OIPA 4I88A 2ZUQB 3GMMB 2EJ1A 3QI9C 1FG2A 2NZ1A 2R61A 4NN6C 2WQSA 4PVNA 4CGTA 3IKCA 3P4MA 5IY0A 4UQ3A 2N01B 2R69L 1AKJA 3FO0H 4XN7A 5GGSY 1GM5A 3DMMD 1X9QA 3IFLL 4M1DL 4OZIF 2OMZA 2VLJB 4MCYA 5GHWL 2KCTA 3PO3G 2C9AA 2F7IA 4EZMA 4R4FH 1NDGB 3VR4A 4NWTH 5DFVD 1I85C 2W65B 4RISH 4HMJA 2EECA 4H88H 3ENEA 4K71C 2A6ED 5IQ9B 5AOIA 3K5OA 3GMMA 5F1IB 5CUSH 3KS0H 2F08A 2FWOB 1UKTA 1VQIA 2RCFA 4WV1B 3PUYA 1Q9KB 3I3DA 3QCUH 3MRFA 1AOHA 1YJDC 1DVZA 3P11H 5DJDB 4HC1H 3V7AE 4M8AA 2VLJA 1OGTA 1UM6L 5BMFL 3BGMA 4O02B 1PH7A 1GUTA 2EKSB 2FL5A 4BHUA 2Y06L 3KBXA 4C47A 3VFOA 1NDGA 1GL4B 3CV5A 1MWAH 4KXAA 5F7WC 5T5NG 2ZXPA 1WWAX 2W65A 4V0BA 1IBFA 4YIQB 3J7AF 1HU8A 3LNEA 5IW1A 1FO0L 2QKIC 4FQJL 2A99A 3OMCA 4YGVB 5I26A 1QEXA 5IQ9A 3I8ZA 1EY9A 5F1IA 4HMDA 4DQOL 2FWOA 2O5XH 2NR6A 5FYKH 2ZOTA 5KJRL 4M6AA 3CC7A 1SHMA 4DV0L 1MCJA 1Q9KA 5JW5B 3DMMB 5KBPA 4A3BB 1R3LB 4KKPA 4P05A 3SYCA 5FW8A 1S7XA 3UTSD 2IJ0A 5C0XJ 4IDLA 4KV5F 3IDYB 5BZWA 5C0IB 4LQ1A 4OXPA 2ZXBA 1TETL 3BVWA 5DJDA 2Y6SC 1I9RH 4TRPL 4XPTL 4O02A 5E0FA 4JI0L 2EKSA 3VDCA 3UTPD 3CN4A 4GMSH 2X6BA 2B2WC 4YIQA 4YGVA 5J6HB 3PIO3 3ZMEA 2DY8A 3A4AA 4NHUA 4NBXB 1A4BA 4A3JB 5B4MD 2GK2A 3V96A 4LIQL 1GOFA 2OJZL 3DMMA 1J5EL 5T3XL 2GI0A 4GAYB 5C0IA 5KSBE 5IY5B 5E8OB 2DIJA 1CM9A 2VN5A 3A5VA 5TQ0H 1ACZA 3PPEA 1MKHA 1OXYA 4P2RE 1OW0C 1PG7W 2FH6A 3Q22A 3FQ1A 4ODSH 4BBRG 2YMXL 3SGIA 1PAMA 3IMTA 5C6WH 1LT6D 3UCQA 3CFMA 4K23L 2NX5D 1CA6A 5IB1B 3D33A 1BWWA 2AP2A 2Y2YA 3TCLB 3UTSB 4UP8A 3ESOA 3PUUA 3L3KA 1NFIB 5E5MB 5K36H 1XL4A 1JK9B 4ZUIA 5SV4A 4GAYA 5KVDL 3SYAA 5E8OA 1DVQA 1EHKB 5GSVB 2RBMA 1BM3H 1F6LL 3OQRA 3B5GA 4N2HA 1JTPA 3LIZH 4AIEA 2YQ2A 3X3FH 2ZKMX 3CC4A 3ZKND 1U5KA 2ZM6L 2J6EL 4GW4B 3HZXA 2FLBT 2ZWYA 5IB1A 1AMXA 1ROCA 2YTXA 1HS6A 3TCLA 1FZJB 5IK3B 2FO1A 4YHNB 4GSDL 1OXSC 2VLRE 2LMCB 4M7JL 2EY5A 4YDMA 1ICWA 1A6VL 2DMBA 1OT2A 1NFIA 3IPEA 5E5MA 5I6PA 1JK9A 2N7SA 1N18A 2XPYA 1VPOH 1Q0YL 4PJXE 1VQOA 2AKRA 4M9OA 4PV8A 2YIHA 3RI5K 3MREB 5DWUL 3RR5A 5L0QC 4CN1A 2SOBA 3HOYB 2X40A 2NX5B 1KG0B 5EEZA 2UXDL 4JI4L 3KYOA 4QMEA 4GW4A 1YQVH 1KC8C 3B4NA 4R7NB 1PGRB 4KD3A 1FZJA 5IK3A 1YJWA 2HD3A 4TSAL 4Y9CA 3TREA 3I9GL 3QZNA 1Q8KA 2EDHA 4M5YH 5EZIL 4HSCX 2IH8A 1BZ9A 1FLTX 1QQDA 3LRHA 3PABB 4RAVB 4RGNC 2XN1A 2BVOA 2FTAA 1BREA 5KRUA 3MREA 2NY6D 3W11C 3ZRSA 1RZFH 4JRWA 5BVPL 4YVUA 4JQIH 1S3OA 1CHQD 1ADWA 32C2B 2NX5A 3T51B 1JXFA 1KEGL 2PTTA 2CHXA 1BMWA 4AIMA 1FR3A 2D3LA 2P8MA 2P44B 4Y4KC 5K9OB 5DA0B 2FXQA 4R7NA 1GMEA 2ZG1A 2BP8B 2VISA 3AABA 2V7HB 3MBEC 5FFLA 2WQRA 3A47A 2EYSB 2MSPA 5D1XB 4ANWA 5TK4A 2GSGB 3BH8B 3PABA 2V4LA 4FFZL 2E2JH 4GI6A 5CLWA 4LLWB 5AZEL 4FQPA 1OTTC 4QJ3B 5I0YA 1GS7A 3P9MB 3T0DA 2QHRH 3QT2A 1RUQL 2OQKA 1VHPA 3CHBD 3NCYS 2GBAA 1NMFA 2F0UA 3HOWH 5FW6A 4LF3B 4X6CF 4AL8H 3B9VA 32C2A 4B7IA 1U8QB 3EHBB 2CUIA 1QLEL 2AAVA 2X2IA 1OIOA 2XVBA 3P69A 5I9QC 1F45A 5K9OA 3BJUA 2KYIA 1RF2D 1TS3A 2ZOWA 4DGZA 5IBUG 2F53E 2BP8A 3QQ3B 2YXWA 1QFUL 4PJDB 2EYSA 1W6LA 5CCHE 3O2DH 5D65A 2OP4H 4CGYB 2GSGA 3BH8A 2NY6B 2ZCZA 4N2CA 4F9PC 4YN3A 3O0RH 4QRSB 4YL9A 1ESOA 1T5KA 3P9MA 4R7XA 4LSQH 5CJOH 4F20A 5HHPA 2NXZD 5JTWA 5M3FH 2WM0A 2X4PB 4LF3A 1CDGA 4HZ1A 1U8QA 2E0PA 2ZOOA 4MMZC 4XX5A 5AEAA 3OIQA 1GVPA 1BIHA 4XAWL 4HCIA 1NCNA 3D7PA 4QWWD 2ZSVB 1X5XA 2Q3AA 4NZUH 1N5YH 3GMQA 4ZMZA 3H3VI 1T21B 3QQ3A 2BPBA 4JL2A 4FXTA 5L8LB 2I9TB 2J4WH 2RB8A 4PZ8A 3AXHA 2CLRB 4LFAL 1H8SA 1KIXA 1AG6A 1M7IB 3H8NA 3EYFB 4OJDH 3W57A 43CAB 1T1ZB 4QRSA 1RZJC 4NP9A 4C3IH 3MODL 3QCVH 1H9RA 2X4PA 2GEEA 3V6FB 2W91A 2WANA 3O6LL 5HHVH 3FO2A 3BE1L 1TSRA 1YHBA 2X69A 5L9DL 2ZSVA 1Z5LB 5LBSH 4PJ7E 1XTCD 2GSMB 2QV4A 1N34Q 2OMXB 4JKLA 3WXWH 2G2PA 1N0XL 1F9PA 1X6NA 3ONAB 1SNRA 4HWBA 1M7IA 3EYFA 2NXZB 4Y9FA 4HQQH 43CAA 1T1ZA 2BCKB 2Y1ZA 1Q81C 2EQSA 3T04D 2RCSL 3C1EA 3ET9F 3UYPB 4EQOA 4IU3B 3TBSB 1FFPB 3E2HB 3V6FA 3PHOB 4XXCC 1IRAY 5LXGH 1KULA 1IW7D 2K9FB 1Z5LA 3OAYH 2Q7YB 4WAFA 4PAZA 1DOMA 2WXIA 4DFHA 4XNUH 1VJSA 1PKQB 3JWNH 1AQHA 4YCUA 4NI3A 1RFDL 1K3ZA 1EEQA 4WIQA 3NCFB 4OKDA 1HHGB 3TN0D 1KCSH 1HNXQ 2G4EA 3FDTA 1P4BL 5JEAH 1OCZB 2BCKA 3TXAA 3DX4A 5I15H 1X56A 1FPTL 2NW3B 2KHIA 2QF7A 4I3SL 1J1XL 3C60D 4LEBA 1T5EA 3UYPA 2ICWI 4IU3A 4HUVB 1BUVT 1WD1A 1FFPA 4G1MB 3ETBJ 3PHOA 4YWKA 2PW7A 1ONQA 3TBSA 5I6LA 1QATA 5BS0D 3VVVA 3VFNB 2ZKWA 1ACYH 3RIAF 1ZKOA 2ZYRA 3NRPA 3OSKA 4JPVH 1FVCB 3EDKA 1WTXA 2Q7YA 3T4YB 1SE4A 3MNVA 4KK8C 3S5ZA 4F7CA 3G3LA 1PKQA 1ZWIB 4OH2A 2PCYA 2NNCA 3B1UA 4UHVA 1PY0A 1SSOA 1KLUD 1DSYA 1JE4A 1RVFH 1N70A 2L4OA 5DU7A 1J5DA 1OD9A 1V7MH 1EYDA 4UOJA 2OTWB 1CFVL 5D70H 3CH1A 1CKOA 3HHSB 1NLDL 1PY4A 4FFYL 3SQOH 4DP9X 4UZSA 2OW7A 4CUCA 1CGSH 3CBJB 5C2UB 5C0XI 1J9QA 1PZUB 4X7CC 1UATA 4AIXA 4HUVA 3RZOH 2P5PA 5JPNB 4H2AA 4KJOA 5C0NC 2HTLC 3VFNA 1T2JA 1WIPA 5E94B 4QYOB 3UI2A 4G6JL 1FVCA 3LRKA 2RD0A 4M1GH 5C09E 3T4YA 2MCG1 4UT6A 1ZWIA 3S88L 3TN0B 1U91A 1ACCA 2D0HA 4WEEA 1A7NL 1VFAA 3CN0A 4NQDD 2DDQL 3C60B 1NIDA 2R2CA 2CU9A 2OTWA 1YPZE 1TWGB 3HHSA 2P24B 2VDLB 1JL8A 5IMOB 3S1RH 5BS0B 4ILWA 3T0EC 3CSGA 4CKBA 1YJDL 5E8DL 2Q8AH 1TMCB 2A9BA 4NC2B 4KK9C 2JWYA 3FU8A 1JCVA 1MFCL 3CQQA 3F00A 3L3IB 5E94A 3LSOA 4XTRC 1TVHB 4LE8A 4LGSB 2NUCA 4UILH 2CO4A 3PO2B 2H6OA 3DARA 3K46A 4BH8B 3LB6C 1KLUB 2PWDA 3B2UC 3TN0A 3KJ6H 1S9YB 4QHUA 2B2YA 3JYBA 3LS4L 3ZE0E 1YG9A 4N26A 1UM5L 1NMCB 3TTYA 5AOLA 3D4WA 4L4JA 4Y5XA 6TAAA 3HAEH 3VD3A 1VZHA 2P24A 3X3GL 2AJ3B 2XTSA 5IMOA 5BS0A 3QR8A 1JOQA 1UTDA 2UXCQ 3O8XC 1FNVA 3UTOA 1YZ6A 4L1BA 1SRDA 4WU5B 1GGBL 4P04A 4U3XA 4M4RB 1L1OC 4ZX5A 3TSSA 5DZLA 2OSWA 4BH8A 1HN1A 3VYSA 3H3PL 1KLUA 1K8DB 4Z78B 5BVJB 1VQ9A 4NQDB 1CO1A 3VH8G 1S9YA 4GO9A 2QEXA 3EJYC 4G7SB 1G9NH 2HKHH 3Q1EA 4ODTH 4A3KG 1DQLL 1U3ZA 4NKMA 2D9QB 3SYQA 4LEOB 3WOEA 3MLSL 3QK0A 3T3ME 3ZW3A 3D48R 4FKKA 1B4LA 1R47A 3GKWH 3IK2A 4M56A 1OK0A 3B9EA 4NKIL 2L7QA 5AOMA 4IBVA 3CC5A 2OF1A 3MRIB 4LOUC 2M8XA 2PYED 4WHDA 1DJWA 2W38A 4JFXB 5F7EH 3WJLC 2XX0A 1DVTA 1OWRM 2DM2A 4M4RA 4UM8A 5INCB 2CO7A 3OAUL 4TQUS 4Z78A 5BVJA 2F8OA 1DFBH 4J3VA 1OTUD 1HTPA 1CYWA 4F92B 4YLCA 2APTA 3K8AA 1T9HA 4LEOA 2IFFL 3LCYA 4YDZA 3O45A 2VW4A 1MCNA 1Q1JL 3RY6C 1NCDL 2LLGA 3B5TA 3TWCL 4PS4L 3MRIA 2QDWA 3W9EB 2Y0SE 2I25N 2R29H 3KE0A 4LVOB 4NO2B 4P46D 1FORH 4JFXA 4LCYB 2FEJA 5D93C 5INCA 4WW2B 3KGUA 3UGEA 3FUIA 5IE8A 4BBWA 3ARSA 2WYTA 5M94B 2BA0A 3HOXG 4KXZH 1C7YA 4HIPA 4IUUA 4HZAA 1G5GA 4A63A 3I50L 2W5PA 1WP6A 3WKML 1N5AB 1GZHA 2IG2H 5GGRB 3R8BB 4RGOH 1PEZA 1KUMA 4BWWA 2PYEB 3LHPH 4DK3A 4ZMWA 5JW4N 1WWWX 3U83A 4BJLA 5DZPA 3W9EA 3D4RA 3AROA 2NY1C 1CMOA 4KUZH 3QEQE 4NJAH 4LCYA 4NO5A 4W9IC 4WW2A 5CN2A 3FF7A 1WHPA 5IBLC 4IBWA 1JJGA 4KVCL 4BHUI 4MQTB 3UZEA 1TQCC 2DQ6A 5GGTH 4HWEH 2EIZB 3RLOA 4AQ8A 4IJ3B 2MO0A 1HKLH 4XOCA 4L5FL 1N5AA 5AL0A 3R8BA 5ITFB 3TA4D 1MW0A 2PYEA 3VD1A 4YGAB 2OYMA 4P46B 5JLZB 2ITCA 2P8PB 4E5XG 3LMJH 1IT9H 3RWHB 1LILA 2JA8H 3RI5F 1BDOA 4J3OD 3ZHLA 5JXEA 3MV9E 4G7HC 4H8WH 2XIIA 3EADA 4BY7G 5BXFA 2EIZA 3COOA 2VUMH 1G9MC 5GZOC 3DGDA 2Q1EA 3BI9X 5DQ9B 5ITFA 4PRPA 3R1GH 3SDAD 1ASQA 4P46A 5JLZA 2ARJB 3KJ4B 2NN6G 2P8PA 1N34L 3DURB 3SR1A 4KRNA 2EE2A 3TV3L 4LHUG 1CD8A 3RWHA 3MR9B 2MCAA 5C0DB 5C0XG 4LCIL 2EYLA 1JFHA 5DQJA 4UB0L 4ZD3H 3Q8EA 3DETD 2GIXA 2BZ7A 1AJ7H 5D4JA 1NMAL 3NH7H 5DEFA 5DQ9A 5ILTH 4KITB 1CLVA 1E9QB 1D6EC 2ENYA 4MS8C 2ARJA 2ATAA 2EE1A 3WO4C 3SSGA 2ATKB 2WUCL 2Y22A 3QB7C 4B08A 3CMAA 5DD0H 1KB9K 3MR9A 1L3WA 1XIWA 3VW3L 3MLXL 3D08A 3KF6A 3BFWA 1HNXL 3BMWA 4NNPL 5EOQL 4KKCC 4OD3H 3TURA 2P5WD 2VLJE 2ZP8A 2VNUD 2E5LQ 1UD4A 1YNJC 3LPPA 2QELA 4KOBA 1GY1A 1TR5A 5FB8A 4TQ8A 3SDAB 1ND0B 3L7EA 3L4VA 5J4MA 5EWIH 3SDYL 4PMCA 4Y1SA 1E9QA 2A5UA 4LF5Q 4AMKL 1NCOA 1STNA 2OMTB 2Z8VC 3FQRA 3VB9A 2ATKA 1A2UA 4BA1I 1WUZA 2XRAL 4LCVA 5D9SB 4AK2A 2EVFA 2CHZA 4C1NI 1TVBB 3O6ML 4JFQB 5LCVH 1CPUA 1D5ZB 2AJYL 3UZVB 3M7NA 4HMIA 2ZZUT 4Q0FA 2Q2HA 2NOYA 3GJFH 5GGUA 1SFHA 4DK0A 2ZCLL 3TT1H 4EGVA 3LH2H 3ZO9A 4PRAB 1YY9D 1I8MA 4J6IA 4XNQA 3SDAA 1JI2A 1ND0A 1AGCB 3ALXA 2R0LH 3M7OA 1JFQL 3DKHA 4NZTL 1EUTA 2OQJB 3FQNB 3K72B 3GI9H 3NFSH 3IMBA 2AUKA 1VCBC 5IFAL 3QOJA 2P5WB 1SN8A 4ZAKD 1JZ5A 1MW1A 1TVBA 1UGNA 1HWHB 2PTVA 3JXAA 1D5ZA 4JFQA 4F80A 1JGIA