3QWNA

Crystal structure of a nigd-like immunity protein (baccac_03262) from bacteroides caccae atcc 43185 at 2.42 a resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
206
structure length
206
Chain Sequence
YPSVKLEFVTVKAGTDGSIQTLIPDNGEALTVSKDRTGSAISPNTSRRVMSNYETLSNGHTATAVIYSLQSLVTPTPKPADDPTYRDGLKHDPVDVVSIWLGRGYLNMILNLKVNGGKQHVFGIVEDLSEFETNGTVNMLLYHDANGDEEYYNRRAYLSVPLDKYADAENPGQKITIKFKYYTYDKDGTAIESGKYCNPGFEYVPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Hypothetical nigD-like protein (BACCAC_03262) from Bacteroides caccae at 2.42 A resolution
rcsb
source organism Bacteroides caccae
molecule tags Antitoxin
molecule keywords Hypothetical nigD-like protein
total genus 41
structure length 206
sequence length 206
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3qwnA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qwnA02
4J8QA 3K0YA 4PQXA 3QWNA 3NQIA 3K6OA
chains in the Genus database with same CATH superfamily
4LF6L 1S5ED 1DBKH 3Q5YA 4BHUI 4J3UA 3GV3A 1G91A 1XL4A 5CEZE 4FQHA 1R9TH 3JV4A 2G0KA 4JCMA 4RAHA 4WK4B 4MAYA 3DJZA 4HULB 2WXKA 1FE8H 1PTZA 3ME0B 3VDCA 4KDTA 2A77H 3SHLA 1UKTA 1RERA 3BPCA 3LMJL 2HCIA 2N3SA 3GSWB 4FULA 3DMUA 2B20A 5MEOB 4L37B 4OT1H 5C0IA 4LSTL 4NWUL 4J1UA 3DWPA 4PM1A 1A0QL 3HOUB 3M1BA 3AYHB 3A0OA 3FUNA 2AJSH 3UTSA 4YQXH 4L2YA 1Q1JL 4LBEB 4CADA 5J0BA 4J1MA 5L2JA 2XQBL 3A4EA 3OC8A 2PCFB 3QUYA 15C8L 1JK9A 2Z8WC 1STEA 1N4XL 4LHJB 1AXTL 2WXIA 4ICWA 1B50A 5CILH 4F2MA 3REWA 1O6SA 5CEYB 3T77B 2EABA 2XRAL 3QQNA 4CDGC 1D2BA 1ZEAL 3NSDA 1TNMA 1KXVA 1OCWL 1WCBB 2B2WC 1FNHA 1M8AA 4OGQC 2E8ZA 3JWNG 3L7ZC 4J3TA 5JHDE 1K28A 5F7EL 4LSPH 5KBNC 1L2FA 1AH9A 2G5BB 4AYGA 1F6AB 2NRDA 2ZE0A 5D7IB 3CVBA 2R1WA 1KEML 1CPUA 3OKMA 2F7OA 4P4RA 5HY9A 1QNUA 2OL3B 4HMDA 3CXHJ 3DHUA 1NC2D 5J22A 4NXMQ 2NY5H 4Y9FA 2QADB 5FM8A 2ZTBA 2PNDA 4UANA 1RUKH 1U58B 1AR1B 2V7HB 1D5BA 1XHHA 3D6GA 3M7FB 3WUWG 3KG5A 2WLIA 3AB0C 3VH8B 2JKWA 1G4MA 4Q0FA 2RACA 4KJWD 1WWCA 2PKDA 3RWDB 2DW5A 4HKZB 1H8NA 4IPDA 3W0WA 5C92A 3MRKB 4XZUA 5BJTB 5JA8B 1GOHA 1UHVA 3FB6B 1RH8A 2FTAA 3U0PB 3AQDA 3UXFA 2XBTA 4MWFB 4XNXL 1OP5H 4WNJA 1WYDA 4A76A 3B2DC 2A6DA 4DP0X 4FRWA 4KITB 1M2VB 1UD8A 2K1MA 3AS2A 5I4DA 5I82A 3ULVL 3ILPA 3ZL2A 4MQ7A 5E1HB 3NJFA 2X6GA 3W5OA 1VQ9A 3QUML 4C56B 3VD2A 4XP4L 1CK0H 4G43A 4JI8L 5DRNA 2Y7QA 2D0GA 2EDOA 2JJSA 2EC9T 2IJ0C 3K46A 2FWOA 4YC2B 1VMPA 4HHAB 1NJIC 2YD2A 5LGHH 2W8CA 1B0RB 1MSGA 1RURH 3CPWA 2CHWA 3GRWH 4GUPA 1IE5A 2EO1A 1XF3B 2CKNA 2AK1L 3ALWA 4X4MA 1ETB1 4U3XA 3S88H 1SXCA 4UQAA 5E8PA 5GRJH 2ZYHA 5M5WB 5K9OB 1T7ZA 1IC7H 1TCRB 3D0AA 5JHAA 4FG0A 4NQDE 3FFOA 3H7LA 4N0CC 4XCYA 1B4RA 5C4XG 1TG8A 4YH6A 3HKZA 4UT9L 3ZJYC 3FP9A 3TBCA 3ZGIA 1KLGA 3L3OC 5HHOD 5EPLA 3T16A 2BVPB 1NDGB 4FQ2L 3EDDA 4G8GA 3S96B 3Q2CA 4S1SL 3S97C 5C5LA 3PO2G 4Y7MA 4AIXA 5JXEA 2JXMA 2JNZA 3MA7B 2VJXA 4JKMA 3OW2A 1F45A 3LEXA 4PJ5A 3KH4A 1WBXB 1OE3A 2XACC 5JYLA 2MUYA 3DSFH 1BBWA 1PYWD 2E6QA 1Z0MA 4IRJD 3F7RA 4H4NA 5T1LD 3BO8B 2GC7C 5MERB 1WFTA 1DBJL 3GMQA 3EKCA 3GTMB 3FCUB 5BUPA 2KL6A 1C1EL 4WORA 2CDFA 2ENSA 2BMKA 2EKJA 3N0AA 4UDUC 3BMVA 4I9WE 4HFWB 4MB4A 4ZMZA 2FBRA 3J07A 3BEVA 5I9QB 4AQ1C 4WWOA 2Z6BA 3GHBH 3WFHB 4P2OC 4DO4A 3S24A 3S1RB 1STGA 2YD3A 2NN6I 4RBPH 5KVDL 1LEIB 4JZJC 4DKAA 4TTDD 2Y6TE 5B7EA 3IU4L 3R8BA 2YXMA 5I76B 5C0CE 3T1YL 3QIWC 2E9IA 5KVEH 2F0VA 4OCRH 2JJVA 4P3DB 2PO6C 1EDQA 4G8EA 2R51A 3F12A 1E0BA 2Z31A 4G8AC 4M8AA 5LNEA 2JLLA 1RULL 4DR1L 4FNRA 2ADFL 3HOYH 1CQFA 1E42A 2R39A 3SDAC 4B3TL 2OPCA 3ZDXE 3EJZC 3R06A 2DLGA 1MY5A 3OVUB 4FN0A 1D5XB 3TA3D 4AZUA 1JYWA 4K71C 4Q5VA 1SGKA 3CSFA 1CYWA 3LKSB 2J1XA 1B3IA 3T09A 3NJXA 4UI2A 2J4XA 3HMWH 3VB8A 4R7XA 4XCFL 2VL6A 4U1LB 1J18A 2R4SH 2XZCL 2QHLA 3HE6B 4OD3H 3OR7A 2NY0B 4NN6B 4ADGA 4UAOC 4ZQ3A 3WTYA 4ZMVA 3RL2A 3X11B 3F7VB 1A8VA 5PCYA 3GMRA 5DO8A 4YHHL 1JZGA 5FUZH 2NXZC 4W93A 3C60D 3SDYH 4GIAA 1SYGA 1QVOA 3VD3A 4F8MA 4NQVA 5I8EB 4DKFH 5CNHA 3ABZA 5F6HI 4HQQH 2DICA 4MX7B 1ODAA 3VXUA 2ZYIA 3D4ZA 4DNIA 4NAMA 3EO0A 4DFHA 4WI6A 5AOLA 4PJ7A 2CIIA 3C9NB 3FB6A 4I85A 4YHYB 5EA0H 2F3WA 4XN8A 1IVTA 3T0ED 3GSXB 3AAZA 3V6FB 4NXNQ 2CHXA 4FQHB 2X4QB 5HHPB 5ELOA 4TQUS 2HUGA 4LRNL 1P5VA 4K6LA 3IXTB 3DOSA 3TO2B 4PPTA 1YNXA 2VABA 2YUWA 1A2YB 2BO0A 4ZW3A 2EYSB 1SM3L 3FSOA 2FATL 4NCC1 1ZTXL 1F97A 3MLTB 3J2PA 4QRSA 5DQ9A 5EU3A 4HC1L 3EG9B 1E8WA 3EOBB 2NYZD 3AROA 1JC7A 1I3GH 1FG2A 2BH0A 4IRSB 4NZRH 2V5SA 4DOHE 5KNDA 3KWXA 2PPCA 1IGYA 4DAYA 2ZOTA 4DKEL 3UBXI 5DTFA 5GRZA 3MXWH 5DWUH 3U36A 4KFZC 4U6XA 1H3GA 1YYLH 1I1FA 3DEPA 3S4SA 1TEYA 2OT2A 1HNGA 3IRPX 3TIDB 4UU9A 5E9DB 4NKDA 4CC0A 4KRPC 4AYBB 4TOYL 1M3IA 3B4NA 1JN6A 3REWB 2G3XA 3MGOA 5KEZA 1KCKA 2XIIA 3SYPA 1QWUA 1I9JL 4JQXA 1GPOL 3INUL 2YPKB 1U95A 4PRIA 4U1NA 4GSQA 4NO0A 2C9VA 5TE4H 3RPBA 4YDNA 5ISZB 1L9OA 1PEWA 3Q8BA 2IPUK 5IQLA 1UA7A 3C8KA 3D87B 5CORA 2DYPA 3EF7A 4XPBL 1HZHL 4P9MH 4NT6B 4PJCB 3DC0A 4LRIC 4ORGB 3S37L 1BQHB 2HD3A 1OTTD 2KERA 3KM1A 3C5SA 1CG9B 3FCSA 1DJYA 2OA9A 4EEEA 4G1MA 1NMCC 3M8OL 1TT6A 4ICXA 4NRZB 3ARPA 5GGTA 4Y4KD 2O5XH 4K5LA 2B8FA 5E4AA 4X99B 5HYJB 1UOVA 2HKFL 2UX7A 1SDFA 1KPVA 2RDFA 2HJFB 3SCMB 5D70L 1K83B 1NDTA 4AE0A 1AKJB 3L5JA 4N9TA 5B4MC 1TFHA 1B4TA 4Z3FA 3POHA 4RKBA 4NPYB 4P3CH 2PWFA 3CU7A 3L3JB 2EIEA 4P59L 5I18L 3QUXC 2EEDA 4QRTA 2XV6B 5T1KD 5AFAA 3LY6A 4GN4B 1EGJH 1JPST 1EJ8A 1XF4B 1KJMA 1E40A 3BPNB 4QHNA 3KYNB 5GRYA 2WQ8A 1YNTB 3GMNB 1Z2KA 2DWDA 3SQRA 3S98A 4JDTH 4G9DA 5SX5K 1E67A 1BV8A 2K5VA 2JFCA 3F01A 4YXKL 5DVNA 4DGYL 1THAA 1J8SA 4UDTB 5DDHB 3Q2LA 2AEOA 3SE9H 5C3EG 5L9DL 4HD9A 5FUOH 5IYDG 1SN2A 3MCYA 4HA1A 2X89A 5DU7A 2H0JA 4YDVB 4PJAA 1QFWL 2CJSA 2R23A 4LVHC 5A6LA 2HWZL 3VR3A 4WHCA 4AYFB 3NSJA 5M3FG 1IGJA 2A9MH 2MQ3A 2VN7A 4J6IA 1FLRL 3SPGA 2XJLA 1O9VA 5EU5A 3IJHA 3RWIA 5GGSA 1B53A 1LHZA 4A3FB 2PQAA 3ETSA 2YD1A 3K2UH 1Q9KA 2PMZA 5DT1L 1YN6B 1OT2A 4MNGA 4KKTA 1E9PA 3VXMA 2IX3A 3X1BA 1W0WB 4ILWA 1Q72H 4KN7C 3N06B 1Z32X 3OLGA 4L4VB 2AJSL 2IG2L 4P4KA 4JFHE 1X6LA 4N25A 1L0XA 4R7NA 3SDAB 2GI7A 4F24A 4UT7H 3VI4E 1PNDA 3HOWG 2YJLA 4PLKD 5C8JB 2I46A 1QABA 1UM6H 3WNJA 2IAND 4GLRI 1VCBC 1SXSA 1GGIH 2AV1B 4JE0A 3ZYZA 4FDBA 5DMKA 5BZWB 5B4MD 4ELMF 1CDHA 1PFOA 1VPOL 1QA9A 3UROR 1HN1A 3SCMC 5D2NE 2NZOA 2CNYA 3AVEA 5KS9F 2R29H 2FHFA 3AT0A 3MX0A 2EUZA 1TR5A 2JJTC 3GK8L 3A56A 3IS1X 3QORC 2OWOA 4NZUH 4XOEA 3HNTL 2R2HA 4N2OA 5FFGA 2KCMA 2F8OA 2VR5A 1SSOA 3LPOA 1HNYA 4UP9A 4ZUVA 2I85A 3ZPDA 1MH5A 4MJ6B 5JUEL 3U0TA 1J5DA 4HKZA 1YY9C 2WY3B 3JWDH 4HV8B 1JS4A 2CK0L 4PJGF 4ENEC 5FGBC 3F2CA 1PZJD 5I6MA 3S1QB 1EK3A 3V0VB 4A1RA 3QIBC 3CX5J 3QPKA 2NCMA 4FNTA 3TEYA 3WY4A 4HXBL 4DW2L 3G5YA 4LMQE 4YQXL 5GADC 2QVMA 2CBMA 4IMLA 3GV6A 2LXJA 4PJFB 5CLYA 4WUKL 1OL0A 2R1YA 3TTSA 1D7CA 3HOZG 3T51B 4YLBA 2QV2A 1W3SA 2Y0SE 1R24B 4JFDB 4EUPH 1ZE3C 2EICA 3IMVA 1T5EA 1MCWM 4F15C 4HETA 5IODA 1V7NH 3TREA 2WIIB 4X4KA 2AXWA 3ZIMA 2BWDA 1K8DA 3UTSE 3A55A 4KKQA 5I1IH 3QDJD 1KNOA 4R8NA 3KLAB 4BFIB 5C70A 4HIKA 3IEAA 4KRNA 3ALPA 1E5ZA 2OF1A 1TCRA 1VQFA 1GUTA 3BSZA 1G7MA 5BRPA 4EI6A 3K6SA 1LEGB 4H8PA 1EWHA 1J05B 3ROOA 2CQAA 3H3VH 2XJKA 4N6RA 2EDQA 1L3NA 4AJ0A 4H0HB 1YHAA 3I8ZA 2X4OA 3LHAA 3JXAA 1AHWC 4CN6A 5IWLC 1C16A 1IAOB 1JGLH 5F0PB 1YECH 5CJQL 5C08B 1EO8L 5EEYA 1IFHL 2BOSA 2MNUA 5DQDL 4ABVA 4H8WL 4M7JL 4MB1A 4OO1H 4DV6L 1HX0A 1I4RA 4HBCL 1PZ2A 1OCCB 3NCCB 2MSPA 3U30C 4YJZL 4A3GH 3PGCB 3BKMH 4KHTL 4BRVA 4RGMB 1ZLWH 1EO8H 3MJ8A 1VEMA 3VXTA 3PFQA 4LCUA 4ZNCD 1H15A 3X17A 7CGTA 2H26A 5D2LB 1MCQA 2LU7A 5F96H 2EY1A 5J1ZA 4BUGA 4L63B 4M7ZC 2G5DA 2SNSA 1G2SA 5A2FA 4LNRA 3LN9A 1LTTD 1ICWA 3KYHC 2JYOA 5ILTL 4L0YA 4G8GE 5E95B 4L5SA 4Z76A 4F7CB 3HR6A 5EIQA 5LXGH 3D4YA 3LPFA 4JPBW 4HJ0D 4JRYE 4PGBB 4WNSA 1DQDH 4F7EA 2J1YA 2PXYD 3SDCA 4LXFA 3V4VA 3CMOH 3NCYP 3MRBB 1CDCA 4K5VA 2D7OA 1B3AA 2UWEA 4GP5B 2PTUA 4N0YH 3TPKA 3SJVE 4PS8A 2ZUSA 4OF8A 5J12B 3GZQA 2NQCA 1MI5B 1MD2D 2KECA 3DUUB 4DAGH 2VT0A 3H0GH 3DO7A 1KFAL 3GT6A 3ZT6A 4FKEA 4NI3A 1D1IA 4M5ZL 4FNQA 3BGMB 4HW6A 3VCLB 2WSKA 1E43A 3EH1A 5JA9A 1PYBA 4LJZC 1CHPD 5F2FA 1YMHB 1RZJL 3ATAA 1PDKB 3QULB 4XCEA 4XMLH 1FH2A 4EQ3A 3G7TA 4R90H 4B3RL 2NZIA 1SN5A 2VZ1A 3EGXA 4AEHL 1TTAA 2VDNB 3E6FA 4AX3A 5J1TC 3BDLA 4A4IA 4GG6B 5CBEB 2M2LA 4Z1PA 4U3CA 2IADA 4LO9A 1MFEH 1L0YB 4D0DA 4MBOA 4ODVH 3RLOA 3R2IA 3HN3A 3NDZE 3P02A 5CD3B 5L8JB 4HV8A 1CDUA 1YVLA 2B3IA 2WBJB 3WIHA 3NCBB 3TN0C 3QQ4B 1BOSA 2F0OA 3UZEA 4LT7A 1NGPH 1MF2L 2A6ED 5JOBA 2GCYA 5DCCA 5DUJA 2PCYA 2AZAA 2X0UA 3IRCA 3QP3A 2R0ZL 2HKHL 3IXTA 2GY5A 4LP5A 3TO2A 4M43H 1A2YA 1AE6L 2NY5L 1R3KA 1XNQL 2HG5B 3C09C 1AZRA 4O2CA 3OX8B 4M8RA 4MNQB 4NOFA 2FATH 3RJOA 2NY4B 3F85A 4L4TD 2RQ8A 4U7MA 3RB5A 3NBNA 1U8NB 5HYIA 4QIRA 5GSRA 1KB5H 3NIGE 1S9VB 4LVEA 4H25A 2BY0A 1BQHG 2VZ3A 1QBLH 3QC6X 4LF3B 5IW1B 5IQ7H 2EUWA 3LVTA 4QKXB 3CN2A 1NCDL 1Z5LB 3S16H 4NO2A 5ITBL 1NFDA 3IDNA 2FHCA 3QS3A 1KIPA 1X4YA 3EFFB 3N50A 3KLDA 4CW1A 1FGNL 4PIBA 3KS0H 1BJMA 2WB1G 1G7MB 1S7WA 1F5WA 4IRJC 4JPSA 4HF5H 5D5MA 4JFOB 3TX4A 2MOVA 4RGOS 2K7QA 2N55A 3NCEB 1KRTA 3VI3E 2RBLA 1R5VA 5D2NA 5D6CB 2P1YA 4FHKA 2CUAA 3GBML 2YSSB 4HK0A 3FTZA 4ZW5A 4JI3Q 2BDNH 2QT6A 4A66A 3VXNB 2DQUH 2IGTA 4B7IA 1GZQB 1BLNB 2A6HC 4DGIL 2MMXA 3ULSA 1VQ4A 3HC3L 1EQWA 4LLQB 1IZ6A 1JAEA 1PMYA 2IBGA 3QEQB 4FGMA 4NZDA 5E51A 1N5AB 5CINL 4ZKBB 5KBKA 3C5SB 3NHHA 3VSTA 5D71H 1SYVB 3BVGA 4QF1B 3ITPA 5DZLA 3ZKSD 4DESA 4X4ZA 1N9PA 1QOKA 3B7SA 4XP5L 1EHKB 3WJLA 3HOWH 1KTDB 3HB3D 2QW7A 1FRGL 2C3XA 1SUHA 3VMNA 2F19H 1E6OH 1EU4A 2ICWB 3OB8A 2VQEL 4PJEE 5TDNB 2DWEA 2M00A 3L9AX 3JAME 4AT6B 5A43C 1AR2A 2E7MA 4M5SA 4OZ4A 4A3FG 2R4RH 5H94B 5KUMA 3TA3C 1T20B 5KRUA 4BQCA 1QYGL 3HLKA 3FULA 5I1EL 3CIQA 4LF6Q 5CC4A 4FZ8L 4PGBA 3OJMB 2LVCA 4JPWL 4P05A 4QRSB 3S2AA 1NGXA 1UXWA 3BVDB 2OP4H 5M5XH 1ITBB 1D9KA 3EYFA 1DQJA 4ZQTA 4RWYL 2B4CH 2NXZD 1K0SA 2VZOA 3WIFB 1JE5A 2ITDA 3B7YA 3QJHA 1SMYC 1LYLA 1NE3A 1KBPA 1YPZF 5FCSH 1FZKA 4L0ZA 5KW9H 1BZ7A 4WEBL 3LOWA 5A2BA 2WQAA 3MN8A 1XBRA 4HFUL 3QFGA 2DQHL 3KPSD 2HWZH 4XC1H 4XPTL 4A3BH 1TZGH 3B9KB 3IDMA 3C08H 1FL0A 1AFVH 3E8UH 1U8QB 1KB5B 2ZXPA 3MYJA 1BZOA 4O2FA 1CC3A 4MNGB 3ZJAA 4DTGH 2WANA 1SROA 3FL7A 2K14A 3CRKC 4FHBD 4ISVA 1S7QA 1JMZA 3MBEA 5GHWH 1P4LA 4PJXB 3E38A 3CCLA 4XZ4A 5IM7B 2EXSA 3ARGC 4NKQB 1JNNH 1IW7C 1QHPA 5L88H 2IOMA 2P5WE 1M56B 2VDOB 3NTCL 2Q87A 3DX8B 4HKJA 4MTMA 2VMDA 2HPTA 2JA7B 4OUUA 1B0GA 1RU9H 3HFFA 5I18H 4TUKL 5J6HB 2R9HD 3ZYJA 1QUQA 1JD7A 4OR1A 3V6OE 2WNGA 4D9QE 2EDJA 1PKQA 3WSQH 2HG5A 3WDJA 3A7AB 1DQIA 3J7ZC 4XCCL 1BZQK 1SYEA 2Z4IA 2NQDA 3IGLA 1TZHB 4QRQB 1AGEB 1FYHB 5L8LB 2B15A 3KLQA 1D7DA 1SYSB 3GO5A 2X40A 4XGZA 4EF3A 1TEFA 2EVFA 2OV0A 1NUGA 2EH8H 2E59A 4KHVA 5CMDA 4G1EA 2JI3A 3FUDA 1C5CL 2DQTL 4Y19E 5JOFB 3GDEA 1A0QH 4X8GA 3I9AA 1A7RH 2Q7AA 2UY7A 2Z6KA 4LFHG 3I50H 2P5WB 4L3ED 3UBXG 1JGEA 3TMEA 5FYJU 1FDLH 1L9TA 5JIKA 3RVUD 3I9PA 1A3ZA 5FW8A 4X5WB 3RLFA 3QI9B 2F0GA 2ADIA 3O3EB 4F8NA 3V0JA 3DX6B 4FJYA 2O1AA 1FO0L 3RJQB 5IIEA 4N0CD 2Q3ZA 1VFBA 4WUUD 1WHOA 4HUMB 5K5PA 4KO7A 3MFGA 3TO4D 1KAAA 4BGLA 5F71A 3DX0A 4HWZB 2O5ZL 4JVUA 4M1UB 4A3IG 3OLIA 5GRVK 1O7DC 2VISB 4ODVL 3KD4A 3KPNA 4Z7UA 5HPOA 3DWQA 1SXTA 1IEBA 2HAZA 3PWLB 4E9LA 1XGPB 4JY5L 2B16A 3H94A 4I48A 5BMFL 2WZ6A 1K4DB 3KWVA 1ZSHA 2CZNA 2LABA 3PABB 3QBTB 3QUYC 2OYPA 3UJTH 2LOEA 3VI3B 3CXDH 2EIFA 4HXAH 1NEZB 3P7JA 3R4RA 5D1ZD 1EJOL 1AZUA 3TP6A 2A83A 1T1YA 3UP6A 4U1JA 3FU8A 5B3JF 4OCYH 2J5LC 1F2YA 3CZKA 5HVWA 4LSPL 1UOKA 1UURA 1TYJA 1YMME 3NA9L 5HGDB 4IUNA 4XN1A 4ZPVA 2IJ0A 1OPOA 3TVMA 4P5TB 3ULVH 2XG4B 3TO4B 1XXDC 1B70B 3HHMA 2Y5TB 4N0UE 5C0EA 4DKTA 3QUXB 2YRPA 2O4XA 3PQYA 4QJ5B 4Y5VC 3CE1A 1PIFA 2DQJH 2GAZA 1ES0A 1EZUA 1YUKB 3F7QA 1DM0B 4G5AA 4U1KA 4L29B 2EPBA 1MFNA 5KSUA 1F4AA 1HE7A 1W6WA 3WXVL 4FP8H 2ZOLA 1OXUA 3FT2A 3CDCA 1WQVT 2LLGA 3BSZH 5BZXA 3VJ6A 5J9PA 1I7UB 4RZCB 4IBSA 1M4VA 2JP1A 2HTKD 3VFTA 2I07A 2AHOB 2DQJL 3HAEH 4MSWA 3I7FA 3PCYA 5ETUB 1MCEA 1Y6MR 5I6WA 3B9KA 2VDLB 3IDMB 1JGVL 1UM4H 4DUZQ 1CBJA 3MR9B 4N28A 3WIAA 8FABB 3W3BA 4X66Q 4X8JB 4EUPA 2UUBQ 2M2DA 2YR3A 5BOZG 2EXZA 1TSHA 2F7QA 2OL3A 4YHIA 4NP9A 2VW4A 3KEDA 3IAGC 2IOOA 1IBLQ 5BRZE 1JPGA 3HFML 5DJCB 1E5BA 3AFLA 2H32H 1MHPH 1RK0A 4KY7A 2VDLH 1UEYA 2X3CA 2KDYA 4OGYH 5MEPB 1T7XA 3DSFL 3SKMA 3I85A 3ZTJH 3WKQA 4BBSH 3V0WL 3QXVA 5FV1L 3TA4D 2VNUD 1D2OA 1CXKA 4MASA 1ENFA 4X66L 5B38A 4JHBA 4Y1AD 3GNML 2FX8H 1EZSA 1I8KA 1IJNA 2IEPA 3CN4A 3R4DA 4F8QA 5I75C 2AXHA 2D9QB 1A7NH 4L2LA 3N85L 2KEDA 5C0JA 1V1QA 4EI5A 3I4NB 3PIQA 1HSBA 5IREA 5HDRA 1ORQA 2PPDA 2UY6B 5DJDA 5I1GH 1AIZA 1XNRL 2OQJA 1NPNA 3OF6D 3DX3A 3GMPB 4HZAA 4RGNE 4UNTA 4UQ3A 5K1VA 3GSNL 5IVXE 2E4FA 1BXXA 3FHQA 4MAYC 4R97C 3CFBA 4UQEA 3DHQA 2AMCB 4NUMA 3H54A 4XC1L 4XPTH 3PNWA 3QFDB 3CXHK 1U8OA 4LPWA 3L1FA 3P11L 2CIKA 4YE0A 1TKWB 4F80A 5JPMB 3MACH 2RTTA 4N8VB 2VL5B 2VUKA 4CN4A 1U8LA 1BAFL 3ARXA 1PLFA 5M5YB 4I88A 4JG1L 3VGEA 4JKPL 4LNRB 2AMUA 1J1OL 3NIDF 4AENA 3RDTB 3KEHA 4RZKA 1RY7B 1CICC 4LF5Q 4Z7WA 5ABDE 4WWKA 5JUEH 3BRGC 4EN3D 1NMBH 1G0DA 3HC4H 5K1JA 4HSPA 1X54A 4PV8A 5KJ7E 4F5CE 1IKOP 1ZYRC 1P4LB 4PJXA 4NNYB 4RA0C 1D5IH 4XB8A 2JIXB 2C3WA 3ROOB 1G6PA 4LIQH 3H6MA 3FT3A 3TT3H 4ZUWA 4I2XE 4XB3A 2HFFA 2R7EB 1B0GB 1DL7L 3T0VA 1LMKA 2ZOKB 3M07A 5CHNB 4YDKL 1CF8L 2CNZA 2AJ3B 4YXHH 1EAPB 4AZ8B 5FCUH 2ENYA 3BUTA 1AGCA 3ZZSA 4IGBB 4DV7Q 1PAMA 2IO5A 2VDPH 4UQIM 3GD7A 5IE8A 2W07B 2X2IA 2EIBA 4S1QH 5EBWB 4MZ3A 5AYUL 4JBJA 2ZT9C 4HSQA 2BC4B 2V2TB 1U3YA 1XD1A 4LSVL 2NDFA 4H8VA 1SRUA 4YXHL 4A3MH 1S7SB 1EUTA 1XCQB 3QUMA 4KAQH 2X6BA 1C8QA 3P1VA 4WO0A 1HZKA 4X3KA 3F12B 3RZWA 3G9VA 3RWHA 3ZZ1A 3GTKB 4KKUA 4FYQA 5GGTH 1RFDL 1X7TA 3MV11 2D0OA 4F9LA 2XV2A 1ESFA 3HLAA 2XTJD 3VB9A 4IK7A 5E99L 1TT2A 3QEGL 4E9SA 4YMPA 1VQPA 5IQNA 2MH4A 2X0WA 5GZND 1LO5B 2PR4L 2WTOA 2KBNA 1UB5B 2V5RA 3GSUA 2EXWD 2XRAH 3PWUB 2YTYA 1KBGH 1OXYA 1I4PA 3DA0A 4U1LA 4WV1B 3RX8A 4LFAL 1MFMA 3O6FC 1FYCA 4JFXB 2WXFA 1JV5A 5LCVH 4GRLB 5MHSE 3PUYA 1SR3A 1KB9K 3DRTB 3NZ8A 5JQHC 3CCEA 1DR9A 4L8DA 4P2YA 4YC2C 4A3EH 5T3ZE 1ZV9A 2XQYG 4MCYB 5JJLA 3BN3B 3T0BA 2KEEA 1SUJA 2EDKA 4QXTA 4A3KG 3PP4H 5KGUA 5AYQA 4ZMTA 2EXWC 3SO5A 3VCLA 1PVOA 1H3XA 2WKOA 2YRBA 2IPKD 3GK8H 3Q7JA 2WW8A 1XGQA 1T1YB 2VKWA 2NTFB 2UVEA 2Z7YA 4RA8A 1KENL 2O30A 2VDRB 3GC3A 3BFQG 4ZXBA 2ZJPA 3FO1A 5A2QE 5CFAA 4NXNL 1BM7A 4OCNC 2ZKWA 3A67L 3ZKXC 3LD8B 5D7IA 5SWZA 3PO3H 4YUEH 1YEEH 2O72A 1QI5A 3FFCE 3QQ3B 1HQRA 2IH3B 1PFCA 1U8CB 5IP4A 4C56C 3S2DB 1SF3A 3E5SA 2CGZA 4N1HB 3MOBL 4RFNB 3ULSB 2FGWL 5DEGA 4PD4K 3PQYE 2H7WA 1PSKL 1HT6A 1N34L 2R7FA 4HIHB 3T2NH 3TLRA 1QCBD 1AQKH 1CLVA 2HRPL 3C8HA 2EDDA 3VFOB 4AUUA 5KYNA 1G9EA 4B9WA 3LZOA 5C3XA 4DV0Q 3LKPA 5F3HA 3IAQA 1SYFA 4J3BA 1ZV5A 3MOQA 1X5LA 1U3JA 3DX7B 1MCDA 2ZPKL 4YL9A 4MNQA 4YSDA 4XMLL 1FI8C 3SYQA 1IFRA 3FJTA 2FLRT 4MJ5A 2WC7A 1EOTA 1BYOA 5EEXA 4P71A 5F3FA 3TV8A 4JHVA 1NSNS 5LDUA 4HG4J 4EZJA 4IBZA 4JHZA 1W72A 3SDZA 3MJGX 1QACA 4M9OA 5HGQA 3U4AA 1TIID 1E5UI 3HI6H 3K8AA 3IN0A 2PUQT 3AG4B 2AGJH 2J72A 3D18A 1IQWL 5F1NB 2XYBA 1UYWH 4IDJH 5IHZB 1R75A 4LARL 1J1PL 3SK8A 1YRKA 3SE4C 2WJ7A 3CZJA 1DLHB 2J71A 5I6XC 3ZKNC 3HZKB 2MPAH 3GSVA 4G9FD 2CUHA 4J23A 1I8IB 2H0FA 3SBRA 5CEZH 5C07B 1T89C 2WGNB 3U58A 1TTGA 5K9OA 2EDXA 1OCRB 5FO8A 1QX1A 2N0MA 2ODHA 3JV5A 2P44B 4MDRA 1Z6JT 2R2EB 4U3HA 4W68A 3QSKB 2HJFA 2VM4A 5B21A 3S2CA 3MRLB 1GKHA 3IJEB 4GW4A 4Y5XA 2WIMA 3TWCH 3FN9A 3T2PA 3U82B 3Q8AA 2ZNWA 4R3SA 2X44D 1YNLL 2A9DA 3VD7A 5I66A 3CTTA 3Q23A 1QRNA 2J57A 4J3VA 4XZUB 3IFPB 3ASOB 2PYFA 3PAVA 4P0DA 3SE3A 4G83A 1W15A 5BMFH 3T0DA 4JFZH 4PG3A 2GFBA 4C58B 4PRHA 1ACYL 4F2FA 4PV9B 4KUCF 1XXGA 2UUAL 1HXYB 2IAMB 3DRQA 3NIDB 4R8IA 5L0QC 3FCTB 3QZMA 2Y25A 1UUPA 1F18A 1TWCB 4X9BA 2CJUL 4WFFD 1JXDA 5LJYH 5E6ID 2G0LA 4BBSB 2EEXA 5ELCA 3K8KA 4J12A 4IRZA 4UBDC 2X69A 3ZDYF 1VZGA 5I5RA 4IOIA 3RMHA 3HG3A 3ULUF 1KG0B 4HUVA 2LQRA 2J6EH 4NUJB 3KVDD 1CGTA 1FDLL 2H2PC 3KJOA 4YLCA 2HT1A 3F7YA 1J0IA 3L3OB 1SMOA 2FO4B 1HWGB 2GUOB 4XMWA 3MLSH 4MMXA 3IU3A 4XTRC 4Y2OB 4R2GB 5D71L 2UVFA 2P5ZX 2V8LA 3PJNA 2VXSL 2F54A 2VC2H 1OAQH 1ZXKA 1OALA 3FFCB 3QORA 4I2XB 3U4EA 3OMAB 5E1QA 2D7MA 2ZJQA 1KN4H 1K8IB 1TJGL 2Z93A 3WOVA 4L05A 5JOPD 4NENB 2KZ1B 4GQRA 3ZKMC 2R92H 1XT5A 5EN2B 3UCQA 3TGXA 3M4PA 4GOPC 2NTFA 4K8RH 1G7JA 1SNMA 4H7BA 4HXBH 4DW2H 2XN2A 1T83A 3OG6B 4A7GA 2BVPA 4HJJL 1TVHB 5I1EH 1LT4D 1F4WL 3TPUA 4DJMA 2FECL 3NCWA 4ISVB 3MX0B 1CD8A 5B22A 4OF5A 5I6OA 1DTUA 2CPCA 4ZDHA 2AV7B 1LMIA 3X11A 1J0ZA 1B0IA 4PQXA 2ZUQC 1QKZH 4Z0XA 3T8XA 1SOKA 3QJFA 5E7FA 3DX8A 4RMBA 4BE5A 1AKPA 2NY2B 4Q4IA 3KPSE 1LO4L 3QIUB 2V4DA 1NUDA 4AMXA 4UNVA 3GS7A 5EBCA 1ZK5A 2DQDL 3VGAC 5KBMA 1MVUB 3KGTA 3STLB 5ELDA 1MWAH 5E94A 2EIZA 3ZDXB 4N90E 4Y9GA 3VG9C 3VG9B 3HR5B 4LLMB 4LFBQ 2ZCKH 1HILA 3T04D 4ZMXA 1CUKA 1E6JL 2GJZA 1U8PB 2O4EA 2P26A 2C9SA 3TJEL 4ERSH 1CFVH 3CD4A 4TRPH 1ZS2A 2Z8LA 1LV9A 4Q9QH 2VDQL 1TTUA 5C0EB 1E24A 3VWJA 3QUXA 3LX0A 1MW3A 1LILA 5HDBB 5IVXB 1T3FB 3P30L 1KLGD 5C4JB 4KQ4H 4GW5B 4AV0A 4N2DA 4RGNB 2DTSA 3MV7E 5BN5A 4HH8A 3ARGA 5I1AA 2W88A 2WIIA 4TNEA 1KYFA 4FEMA 4OGXH 2W65A 3FQNB 3NACH 2HFEB 4DV3L 1NLDH 1KXHA 1CSQA 2CFMA 2OXPA 2OTJA 1YNKL 4EDXA 2GC4C 5ICYB 4EI6B 3K6SB 2HVJB 3ESOA 1DLFH 2GTQA 3BDYH 4KKNA 3ZKXB 3KL3A 5E56A 2A69D 3ESNA 4A6YH 3FO1B 1NBZB 5L4FA 3VXSD 5I5JA 2D2OA 1L0WA 4PMWA 2VW6A 3SE8L 1G9NL 1QNZL 4MHHI 3K6OA 4KH9A 5CGTA 1HNWL 3ARSA 4FF1A 4K23L 4LK1C 1DDTA 4IJ3B 4W9CC 3QNYA 1G7LB 3TBVA 3I9GH 4WFN3 2HPOA 4GB9A 1Z9FA 1DZBA 2ITCA 3RR5A 1S9WB 3FHAA 1SHWA 1RKRA 3LQMA 5GJSH 1N68A 1S3KH 1W8OA 1E1TA 1YJ9A 1CGUA 5IBLD 4DR4L 1VLXA 3UBHA 2OSYA 5ELFA 1BG9A 1GMIA 2WLHA 4X9GA 4YSSA 3FKIH 1OARL 1LL1A 5HYSG 3N42B 3UAAA 1EV2E 1XL6A 1JI2A 3MBXL 4KJQD 4XRCB 2YAOA 1H5BC 3M4QA 4RGND 1D5MB 2BPBA 3V52H 3TA3A 2FMCA 4DR5Q 3ATEA 1DVYA 3PIPA 1J8RA 1R46A 2WTRB 4JZNA 3CVDA 3EBHA 1HHGB 4DAYB 4R90L 5D72L 1CICB 3HZMB 2XI9A 4BZ1L 4DPRA 3B7UX 6TAAA 5BV7H 3J8F7 4LOUD 3PIQB 1MNUH 1EJFA 2GW5A 4K4KA 4KAQL 4NKDB 1CLYL 4PB9L 3FO9B 1JNHB 3BEWB 3WJJC 4EQ5A 3G5WA 3CN0A 5EU4A 3VFPA 4OCYL 3QUHA 3IDXL 1U8HB 1YY8B 5GGVH 4A55A 4BQ9A 2ENJA 4OIJA 4M00A 4PJXE 5JO5A 5INDA 2YKLH 4BA1I 5K9KA 1LP9A 3B9AA 4JAMB 1I1AB 4MXVF 3PWNB 4I4WA 4F9PC 3ULVD 3WFDH 2J5WA 1ZVHA 2A6HD 1FYTA 3R0MA 1M6OB 1BFSA 4IUPA 3N3EA 5JEAH 4NPKA 1NTDA 3QDMD 1NL0L 2J4WL 3LNGA 3COOA 4DVBB 3VU2A 4PRPA 4JFZL 2F3IA 4Z0XB 3T8XB 3WEXA 5JXAL 3S36X 4WWKB 3DV6B 3S5LA 5IY5B 1ZHLA 2MNJB 4BBSG 5C44H 1DSWA 4MA1C 3ZW3A 5EEVA 1TO4A 4BKLB 1RD9D 1NCWH 2KHJA 5K39B 3FFCD 2OKMA 1BEYH 5DFWH 2ZUYA 3RVXD 3SPVA 1NNXA 4ZUJA 4OFIA 1SNDA 5FHAL 1IBYA 3B6SB 1SNQA 2FUTA 2GSGB 3B2UC 4JN1H 1OGAB 1NFKA 2RA4A 1CA5A 1RZGA 1UH2A 2WYIA 3BP7B 3DO4A 3G5XB 2DJMA 3B2MA 3QZNA 4IM8A 4IFDJ 3N55A 3CSYA 4NQEA 4DK5A 3KL5A 2AQQA 4FP5D 5BS0A 2BFGA 5I1CL 3U79A 2KOLA 4OFKA 4M1GH 1FD7D 1EEYA 3KXFA 3O11A 4LRNH 3DPBA 2PO6D 3BT2L 4TVAB 3PQIA 4POYA 1MCWW 2N1TE 2UY6A 5DJDB 2R92G 1UXSB 2Z31C 3IDGB 3WYRA 5L2KA 4DAPA 3IDYB 5KSAB 1A8JH 4QTFA 1XDTT 3QO0A 3ORJA 4ETQA 2R2HB 2X87A 3BWUF 2H2SC 4MMXB 2APWA 5DRXB 3F5WA 3GSNB 2KJXA 4M5YL 1ZT4A 1IBZA 4XT3B 2HCZX 3ESVF 1O5DT 4JM2F 1A4CA 4A7GF 3KBHE 3WELA 1PG7X 4R83A 4ZPTB 3RHWF 5I6NA 1NLBL 2RA1A 1UB6A 1V7NL 2KLSA 3MO1A 3M7GA 1FFTB 3IJ7A 1MHHB 5E4EC 3MAQA 1Z47A 3E6HA 1HOCB 5B8CB 5HGHA 2BZDA 4BYHA 4PRDB 1NJ9A 2X1XR 5FW6A 3PWUA 4OZGB 3B3IA 1LLAA 4LDCA 2R1WB 4IU2B 2OMUA 2DQCH 3MNMA 4O02A 4S0SD 1NANI 1S7UA 3TP5A 4GLXA 3V0VA 1S72A 4JN2B 4JRFA 4BK4A 1E2ZA 2MTPA 4K3JH 3PPSA 1BBDH 1BF4A 4JFXA 4LLQA 1EZVX 3NIGF 1A7QH 4RWYH 2L04A 4MLSA 1M4KA 2AV1A 3STZB 3VH8G 1JDDA 4G7RB 4YGVB 2NY4D 4Y89A 1KC8C 3EVQA 4KXZI 5ACMA 4W9JC 1NDMA 3F7PC 4L8CB 3D09A 5JIQA 2ZOKA 3FPXA 4M7JH 5TK4A 1VF5C 5IWAQ 4YHYC 3REVA 2F0EA 3DEOA 1WC7A 2XWEA 3MROA 1PD0A 4X3SA 4PAZA 1UT1A 5DURB 4ANXA 1DJRD 4BK5A 1MJUL 3MU3A 1NM4A 4JG1H 4W9IC 3VM7A 4L4TA 3QZBA 4NP4L 1EEID 3BZKA 5EBWA 1H9SB 4OKVA 1JFQL 2VDQH 2EC9U 3TN0D 3I4LA 4MNQE 2GBUA 4G71B 1PZBA 2CE6A 2HX9A 3VXUD 1EOVA 4GZYC 4FQXB 4J3OF 5CP3A 3ZHDA 1TUPA 4FQCH 2XGTA 2JJSC 1A65A 1O5PA 4YFDB 5MP6H 2C35B 1JHKL 1IT9H 2FJFB 4XVTH 1K9TA 5D1QC 5FF6B 2Y7NA 2XNAA 4FMFA 5C08D 2Q6WB 4DP4X 4DKDC 1TS2A 3LDBB 4NC1C 3KNBB 1NMFA 3HOXG 1E4KA 2VQ4A 4U33A 3O13A 3GTMH 5HHNA 3VXMD 4D0BB 3CJJA 4ANUA 2BE5C 1NGWB 3S5YA 2WKCA 4DFIA 3D6WA 4ELME 1ESOA 3OKOA 3SE8H 5AAWC 1Q4NX 3LN4A 3ZQWA 4AH2A 4KI0A 3Q2NA 4UOW0 4NJAH 1ZA6B 4YWMA 3GQBA 2ATWA 4Z7QE 5T8IA 1BIIB 3GXIA 5ITFA 1A9VA 4CDEC 1NUFA 3OX8A 3QO1B 1Y8OB 4BH8B 1LD9A 4KKLC 4XMPH 5ELBA 2MHVA 4D9RE 5K9JL 1L1OB 4NQUA 3CMAA 1D7QA 2Z4QA 3UAJD 3ZL4L 2AQ1B 2YEVB 2CD0A 2Q20A 3L3GA 2BIPA 5IWAL 5I6LA 2QKIC 4HISA 4OCXL 2VC2L 3MLZL 4QYOB 4MIUA 4QPEA 2CJTA 5CJBA 4U1SB 4A04A 1OANA 5M3MH 4A93H 1IARB 1KN4L 4KXDA 1CF1A 2RF4A 3P77B 4HIPA 4XI5D 1NCCL 3PO3G 4G8IB 5ALBL 4RKLA 4P5MA 3JTSB 3NFPA 5GSVA 2A4ZA 5DHVB 3MNDA 3QQ3A 4X5PA 3NPSB 1YZ6A 1IKLA 1IC5H 3O9WD 2DUDA 4X3UA 2CH4W 1SY6A 1HZCA 2WQSA 1OM9A 4RWSC 2FRGP 3GKZA 3S36H 5EOTB 5KSBB 1E2WA 1ZLWK 3I4MB 3TQYA 3E1ZA 4NX0A 4PP1C 4EI5D 1JR0D 1MFBH 2IWKA 2QLVB 5CXPA 4B5ZA 4XVUC 2EYOA 2Y6SD 4EZKA 1GXEA 4WW2B 4YWLA 1IBML 1HA6A 4GP4B 2Q7NA 2IOIA 2VWEE 5I76A 3GJEB 2BRQA 4AITA 4ZFOA 3TEUA 3CDZA 3H0TA 3W0WE 2GJPA 5LNGA 2YKLL 2R61A 1B1ZA 2GFBB 2WO3B 4ODTL 2P5WA 4HXAL 2GPZA 4WU7A 4Z7VB 1UXMA 1BLIA 3S14B 5BOPA 1BAFH 2X6UA 3M4OH 4YK4B 3PY9A 5TDNA 3WO4C 5C4XB 4FC3E 3ZE2F 1DONA 3FB5A 5GRXG 4PB0L 2A6DB 2B14A 5HGBA 1SYCA 2XVLA 4HIJA 3TN2A 1F2ZA 1TJGH 3VGDA 1FVDA 1HTYA 3V6ZA 5F7NC 4QHMB 5DZVA 4LFCL 3Q3GA 3UTTD 3ZSSA 2ASBA 4R4FL 4G43B 5IROC 4GUQA 2QQQA 1GYWA 3ETBF 1YIJA 4JFED 1NBWA 2P5PA 4I77H 3LHPH 5EBMB 4YDJA 5KZCD 4L1LA 4N8CH 1HU8A 2E7DA 2Y7LA 3SGDH 4Y5XC 1NDMB 3AREA 4TNWK 1XF3A 4YXLH 1D1KA 5FUZL 4X3TA 1VMCA 1SBSH 4A2DA 2VR9A 1Q94B 4HU2A 2KUMA 3CFTA 2NBFA 1CLZL 1QPPA 1OTCA 2VDPL 4L4TB 4NENA 5BXFB 1NAMB 5DS2A 4N8CL 1GH7A 1FG9C 5IVZB 3OHXA 1ED3A 3DROB 4GT7A 4UAHA 2FBJL 5IEHA 2ATKB 3FFDA 3JWNH 3U6RB 1E6OL 1O7DE 3L6FB 1DBML 2OJZL 3D6CA 5JDSB 4EN3C 2QHRL 5M5XB 5MENB 2ARWA 2LFNA 3UZVA 3DX9B 2H2PD 3TJHD 3H4HA 4HS6A 5CSZB 3NYKA 1T1XA 2B1OA 1CFTA 2FIKB 5JPNB 3QQ4A 1U0LA 4OJDH 1LEKA 2FJSA 3SJVB 1EEZA 3BCDA 1LWHA 2CRZA 4KHTH 4WU5A 2MWCA 2Z7ZA 1UATA 1WLHA 1DUYB 3U7WH 3S35X 1JVKA 1N36L 2L0CA 3DBSA 4L3EE 1PH4A 1HS6A 1ZSDA 1WT5C 4FQ1L 2PP8A 3F7YB 3WEOA 2WAQA 4DK1A 3QO1A 3EYQC 4TOYH 1JORA 1HR0Q 4ZTOH 3KBFA 2ED9A 5C08E 5AD0B 3BWSA 3VVWA 5C9KA 1TQBB 1VJSA 1GS8A 4U1IB 3PHOA 1AD0A 4FE9A 3O0RH 3NJIA 3ZYYX 1NEPA 2MJWA 3QIAA 3TP7A 1UOLA 2YQ3A 1T6BX 3F04A 3MCLL 3UO1H 3IMSA 1ACCA 1I3VA 3V10A 1MPAH 4PZ8A 1MFAH 3PWPD 2ENPA 4QD2E 2FYYA 5ID1B 2KBGA 4JV5L 3RLSA 3CZEA 3GF8A 1G5AA 3W5MA 3UTSB 1DJGA 1JZDC 5LG6A 2GJ6E 2WNKA 1DDHB 1N19A 1OWWA 3QZWG 1N70A 4JO1L 4DK3C 3QEHA 4KNUA 4A2HA 5EZLB 5GSVB 2J6EL 5E9DD 3NSXA 5D4HA 2WLNA 1I7ZB 1BLNA 4OQ1A 3QJYA 5CEYA 2R27A 3T77A 4K15A 1GAFH 3BE1L 3QXUA 4OLYL 5AUMA 3RNKB 3KPQB 4UTAH 5IQ9B 1PX4A 1ZMYA 3TESA 2UUDK 2KCNA 2EACA 2WXOA 4KKRA 3MXNB 3NBHB 5HD8D 2MQGA 2AQPA 3ZTDC 3ZUCA 3WSQL 4WKXA 2NY2D 3DWTA 4EPSA 1EVUA 3G5VB 4ZG1A 3I70A 4I0KA 4PU2A 1ZANL 2C4FU 4GO6B 2VO5A 4KROD 3H2WA 5EN3A 1WUZA 3BAWA 4IBUA 3KPPA 1HHJB 3VXUB 2EH8L 3B6SA 3NP4A 4LGSB 1NFDE 1J6QA 4R9HA 2JA7G 4HIEB 1TS4A 3X1GA 2BOLA 3QO2A 3U48A 4BZ1H 4F37F 5BO1L 4UDTA 2QMJA 4XMPL 5DDHA 2DD8L 2ZTCA 3ILPB 5EU6E 1LLRD 2G9HD 3RY6A 1VGEH 3HAEG 4J8RA 5FM4A 3JUYA 3WXWL 3FB7A 4AYFA 5FOBA 2L4NA 3WOFA 1U93B 3IFLH 5IHLB 1F8TL 5D1ZB 2CO6B 3PQYB 4Y16D 2O26U 2HG0A 3ZK0A 4E9XA 5BW7C 1K72A 1DFBL 2AKRA 4YSPA 3W9DB 2F0FA 3NIFB 5D1XA 1U3NA 1KXLA 1NCCH 4JANA 1HKLH 4JV5Q 2V2XB 4DCQB 4P5TD 1GR7A 2B2XL 2GJ6A 2VRAA 4Z7QF 5E08L 2ESVA 4OM0H 4KJOA 2E9WA 3I3CA 2LV4A 3DDFA 4TSBH 5LMUQ 1R5IB 1IZKA 1FO0B 5AW6B 5KVFL 4GUOA 2P8PB 4HBCH 2X1QA 3SBWA 3WMQA 2ICCA 5FKPA 1DJSA 5FV2A 1I4GA 1S9XB 3BH9A 5GRVL 4MGXA 1F4HA 3UTSD 5HP5A 2FGZA 3TBWB 4L3AA 3NH7L 4GS7C 4NO0B 4BZYA 3C2AH 3S34H 4JI0Q 1N18A 3MFGB 2YD8A 4WUUB 4BY1B 4GINA 3GGWB 4G7VH 2DQCL 3T3PE 2O61B 2BHUA 1WTVA 3OF6A 4OGAD 3D39E 5L6YL 3F65A 2BP0A 2YWYA 3FOLA 4MCNA 4LU5L 4NT6A 5E7NA 1P4UA 2VISA 1JT8A 2JA8H 2WQRA 3EDJA 4TUOB 4Z7UB 1OE2A 2B8OT 4OGXL 4WGVB 1Q0YH 1NEUA 1QSFD 2D8KA 5HI5C 4QB4A 1KJ2B 3QJTB 4AYBG 2HTLC 2FSDA 3EYSH 1F58H 4FDWA 5AW0B 3KWUA 3V0GA 4C55A 3II2A 4I89A 2YKKA 3OJ2C 4PJ5B 2NLJB 1D6VH 2IWGA 2PCPB 4PJDA 4QRPA 4JJHA 5F89A 1IILE 2JA9A 5AEAA 1QO3A 1KGJA 3MRIA 5TDPB 2R2BB 3MC0B 1JOQA 2IBZY 3L2MA 4APXA 4M7KH 1SYSA 2EEBA 3ZE0E 5KUKA 1F6LL 4WHTB 2WXJA 5DC0A 1ASOA 2NVXB 3O3BB 5F93C 3H9HA 4TTDC 4K23H 1AY1H 1D7BA 4P2OA 1WZ1H 2XTJB 1XXFC 2VUYA 4UT9A 4JR9L 2C8NA 3IGKA 1ICTA 1NLBH 3I4MH 1NMGA 3C5ZD 4YHNA 2IANB 1SBSL 1FNVA 1NCVA 1XSJA 3C3LA 5F7KC 5FYKD 3RDJA 1YNTA 5D3IB 2YD6A 2GAZB 5F0JB 4DFAA 1FL6A 4X2UA 3RAJL 4WFGD 1YEGH 4AEHH 3O9WC 3PU7A 2WB7A 1AYRA 1FLRH 5SWSE 2MO0A 2K04A 4U673 3D0LB 3D2UB 3RN2A 3GHEL 4XWGH 1KPRB 1KB9J 3K2UL 3OKOB 1NIAA 5EHFA 1IGIL 5F97E 4UWQB 1NC4D 3EZJB 4JHAL 5I8OL 3KHQA 4C3HH 3ZDXF 3EJZD 1QILA 1UVQB 4FL4B 3EXJA 5JAVA 3VSVA 1TZAA 3E1F1 3UMTA 1QVOB 5HHXH 3NABL 3U50C 1CZWA 2V3DA 4A3FH 4NQVB 5F0MB 1X5ZA 4O9HL 5K39A 2X70A 4OBSA 3WI9A 4GO9A 4L4VA 4DR6L 3DUZA 3UTTB 4IQZA 3J7A5 1HTPA 1AI1L 1JPTL 1KV7A 5MI0B 4HCEA 3NMEA 3TM6A 3F7VA 2PPFA 3C9NA 1H95A 1I9RH 3FQ1A 5AVRB 5GHWL 3HOVH 1FBIL 3TCTA 1N10A 3UYPA 4H88H 1QNIA 4X0KB 1N5YL 2C9UA 4PJCE 5HHOA 3VTAA 2YMXL 2K3HA 7FABH 2H4EA 1GIGL 5JW5A 4X83A 3SGKA 1T0PB 4NBYB 2E5LL 4PN6A 3PIP3 3I02B 1JWSD 2HFGL 4FX5A 1THCA 3OJVC 2IF7A 3HS0C 3HKZE 3FQYA 3KYOA 4XBEL 3IETA 5TJWK 4P73A 4JM0A 5LGYA 4U3SA 2HYMA 4RAUA 2C1OB 1RZFL 4TV3A 3WENA 1CMOA 4NNPH 4GKKL 4ZK8A 2JB6B 1T0NB 1EIBA 3LXBA 3CHBD 2OX5B 3X2QB 3JVGC 4ZFGH 1Q8KA 3G7LA 3AACA 3RZOB 4NM8L 4X7SH 5IK3B 2JQZA 1UB6B 4LW1A 3MO1B 4DCQA 1N7ML 1KLFA 4TL5A 4ZZKA 1ULVA 3T2QA 3PO3B 3O9WB 3K0YA 4C3JG 1J8HD 1NMBL 1WZLA 2VXVH 3HC4L 4EKJA 5JHLA 3CFDA 4B9JA 2WQXA 1QE6A 4XXEA 4M8QB 1HHIA 4PBWD 2J8HA 2ZG1A 3BGAA 3VWKC 4OV5A 2WXNA 4PUBH 1JOIA 3LRLA 5FECB 5DK0A 1V10A 1K4CB 4R9WA 2FD6L 2FSEB 4LP8A 3OXSA 5JPMC 2BVQA 2N7AA 3SGDI 4NXML 1S40A 2YEZB 2IALA 4HEPA 4X7CC 3VYNA 2CA4A 1YEIL 3RGVC 2FL5A 5ICXB 5IKCA 3VA2C 4OJAA 3WUWA 2MKLC 3SKUD 5CBAB 1JXFA 3ASWA 4KJYA 1EWIA 4PJ8D 4CC4A 4HOZA 1YJDH 1EEQA 2YAHA 2KLTA 3DGGA 4M5YH 3WN5C 3ZU8A 2VB5A 5DHDA 2FD6H 2GBVA 1ZOXA 1JWSB 3FRPA 3SKMB 2DTMH 1CGSH 4AKQA 1IAIM 3OWEB 4P2CB 5TQ0L 2N7SA 3B7RL 1ZLVH 2W81C 5E6IB 3ARRA 4APQB 4L6TB 4JLRB 4YSQA 2V6HA 1SBBA 2X9XA 1CTOA 4HJGA 5E2TL 1A1NA 5JVH3 1XGRB 2I60L 4KFMA 3QUZC 1OAXL 4ODSH 1JHTB 5FAAA 1UAPA 3PV6B 1PIGA 1M1XA 3BSGA 1YSOA 4HJJH 2GBTA 2OI9C 1DJXA 2WKOF 3G9AB 4MFHA 5EPMB 5F1IB 2BSDA 3GUTB 1DVQA 2GJRA 1QATA 2EIKB 4OAWB 3TJEH 1UXLA 2DPKA 2I60H 4QTHB 3AG3B 5LBSL 2XTIA 4JDEB 3LNEA 2X09A 4LPCA 3KLSA 1RZKL 3QNXA 4KK8C 3GXUB 4H25B 2IDSA 5TE6H 1BPLB 3TH4T 4N0UB 1PJWA 4GAYB 4F15B 8PAZA 1N32Q 3CVHH 4RH4A 4PZ6A 1JP5A 3H0TB 3VTTA 1MRDL 1JWUD 3A0JA 4DV0L 2B3RA 4QHNB 4RDQF 5FLUA 4P2QD 4XPGH 3PAUA 3DX7A 3WFDL 4E5XA 3NJHA 3OQRA 3G6AA 4R8WL 2CCWA 3L7FA 1NL0H 1JNNL 2J4WH 2Z92B 3BJ91 3WD5L 4YNYA 3CSPA 1J8IA 2DDQH 2ZCKL 4AQYL 4G6MH 4CJ1B 4JK0D 4LU5H 5BNXD 2P5EB 2CDGB 2SODB 5MP6L 2FEDC 1K6QL 2VXWA 4DV4L 3E3QE 1UWGL 4QAMB 1K2DA 4GEJA 1RUAH 4L5TA 3GTOH 4OZFA 3T0WA 1U8IB 2YBRA 2DS4A 5EF2A 3BD4A 4LF4Q 3D33A 2PYEE 2I5LX 1VQ6A 3RX9A 3KFUA 1MCOH 1XTCD 2G75A 2DH3A 1EEUA 3DI2B 4PRHE 1GS7A 4D3CL 4JGNA 1KJ2A 1FJGL 3DURB 1BKBA 2Q2UA 1MI2A 1HKFA 4BA0A 4KTDH 2AUJD 1K8DB 2BY1A 3V8CA 4JI6L 3L48A 3VGBA 4HUXA 1BCPF 4LF5L 3AM8C 3NQKA 4Y5YC 1QFWI 3RVUC 3X14B 1AQKL 2HRPH 4PJHE 5AWNH 1TWCH 1GC1H 4LQ1A 1HFUA 5D7SH 5E5LA 3MV8A 4PHZA 4Y1SA 5AKTA 4WK2B 4Y9BA 3UPRA 3L95A 1IAKB 1QUNA 1MWOA 2F19L 2QVKA 1MWAB 3MLRL 2E86A 3OAUL 4J6RH 4PJ8C 3UTZB 3VFWB 3W11C 3GBEA 1CTNA 1I8LA 4PSPA 4O0AA 2VSCA 1XBDA 5FLMG 1J5EL 1I6HH 1C08B 1NCJA 5F88B 4P74A 2NVQH 3UDGA 1YEHL 4Y19B 4KY6A 3ZTEA 3US1A 2IV9A 4G6AD 4LGRB 2Y69B 4POZC 3EYVB 4PV9A 5J13C 4XH2B 3D4CA 3VWKD 2HN7A 4GW5A 2Y07L 2QEJA 3C6LC 3QRLA 2V1CC 2FB4H 1O7IA 2GHWB 4Z78B 4ES9A 4WSGA 1OO9B 1JV2A 1IC5L 2FT6A 4YK4C 5C0AA 3T3ME 4NFCA 4WNQA 5E8PB 1OGAD 2HKAA 2WO2B 5CAYB 2NW2B 3U4BH 1TJXA 4LLUB 5L2KE 4XT1C 1GOFA 4N22A 3QR0A 4RX4A 4N2CA 4H20H 3FB7B 4JMXA 1RZ7H 1QSEE 1D6EA 2P80A 5EH1A 4LCCA 5IGXL 1U0QA 4WF7A 4GLAC 3E9TA 3I75A 4Z77B 5FO7B 4MBRA 1VQGA 3ISYA 2QBWA 3WO3B 5A6MA 1TIUA 3NA9H 2ROYA 3GHPA 3BIBX 1CLYH 4PB9H 3HZ3A 3O2VH 4MS8C 4GKOA 3LXUX 1DEEB 1G7PB 3J7AF 4QRRE 1OP9A 4NZJA 2Y22A 5CZVH 3OTOQ 3FDWA 4JN1L 2V9TA 5I6XB 2H5UA 2D9UA 3GI8H 4QHUA 3T6WA 5IQ7L 4HPYL 4A3IH 3SDDD 4B50A 1EHLL 3KLAA 3U7YH 4BFIA 3K74B 4MAUH 2K1BA 5IQOA 2VZVA 2CLVB 3HBQA 3O3AB 2Q2TA 1T1WB 3D25A 1EFXA 5EKKA 2FLMA 3LB6D 5AUMB 1PJ9A 4JRXE 2XWJA 2X4OB 4JFDD 4XN7A 4BE6A 3HOYG 1PRTF 4N8UA 3ARGD 1VFUA 2CLRB 1UWFA 2YS4A 1J9CT 3NGBC 3TV3H 5HXMA 1EA9C 1AGFB 4F7XA 1IQDA 3BAXA 5IT9L 1QFOA 1V27A 1PRTC 5KSVB 3DWAA 2GIMA 1A7BA 2X4SB 2ZXBA 4M4RA 2VLRD 2YD4A 4OWTB 2DEXX 1WTGT 3V05A 1CN4A 1U6AL 1JGIA 4PWKA 4D9LL 1EAOA 2DQUL 4HIIA 5C71A 3QDME 1E8YA 4YVNA 5I73C 4K3EL 4WFED 4TQ8A 5B8CC 4UT6H 4OGYL 3LKSA 4YVUA 5FECA 2OTLA 2EZ0D 1J8HB 3C8DA 4DPGA 2P5EA 3FTWA 2IPKA 4N2HA 4KKPA 2QGDA 2YRLA 4HJTA 3WY3A 4N68A 1D7FA 1T20A 1OXVA 2MHAB 1Y8PB 4CMHB 5DMYA 5CKGA 3IVKB 1KG0A 3CC2A 4N2KA 1FGBD 4OM0L 5DRZB 3MRBA 3ULVF 5FKAA 3IYLW 1GYCA 1SMXA 2EJ1A 2DQ6A 2LU5A 5BZDA 5KVFH 4I8DA 1AN8A 3V8OA 5C44G 5G4OA 2OCCB 2RMNA 4V1DE 4IOFD 2OZ4H 1GPOH 2XV3A 3CNKA 1K3BC 2O5IC 4X6CE 2N1KA 5AW7B 5BOJA 4TQPA 1GW0A 4L3EB 4QQBX 2KMWA 5GRUL 4IJLA 2CIIB 2JLPA 1HNXQ 2F53E 1SVBA 4NQEB 5I0XA 1JRHI 2HT2D 3UACA 4EGVA 3DMMD 2A1WL 3DO7B 3N1MC 4CSZA 3N9GH 3SO3B 4XNMB 2P43B 2IDFA 2Y2WA 1SOQA 1V3MA 4EMZA 4FF2A 4XBPA 2DI7A 1SNRA 3CVHL 5E8DH 1KACB 2JXMB 4MQSB 4ZDHB 2VSMB 3EOBA 2TRHA 4G6KL 2VXTL 3WHXA 2B1HH 4PY7A 3BVZA 1X5GA 2K8MA 2YGNA 4H1LA 4X4ME 3TYGL 3ZDZE 3DIVA 2DL2A 5CCJA 5CEXA 3HG1D 4BQ6A 5E6IC 3GZPA 4WNQB 1PFBA 1QUQB 4Y4FC 1WBYA 3VXPB 2EXYD 4YR6A 5C8JA 1LP9F 5CZXC 1YQVL 4LCYA 4RZCA 1E27B 2BIMA 2HFGH 1U8NA 4AQAB 1E30A 1SYBA 3I3DA 1XSKA 2J8OA 1OLZA 3PRZA 5DJ0A 4LCCB 6FABL 4XVUD 3QZLA 1X5AA 4GKZB 4WI7A 3BFOA 1Z5LA 4DGYH 3X3GL 4N0YL 3T71A 2W60B 3KK7A 1C5BL 2I24N 4YY3L 2MFNA 3LAFA 3P3YA 4GAJH 4V0BA 2IANA 4JN2A 2BOCA 4LAQL 5JW4R 5EZJA 1JDCA 3LYRA 1X9RA 2OJEA 2AANA 2V33A 4LSVH 1KIRB 4Y19D 5DUML 4UIKL 5FC9A 2F5BH 1SF5A 3RWFB 1FJGQ 5BPPA 3UYRH 4XYQA 4ZMWA 4OZGF 4ALAC 1WT5A 3GSOB 4HWEL 3WHE1 3A22A 4JCWA 4X6DE 2KHAA 3S9DB 4J6RL 4NAJA 1AI1H 1JPTH 1P4BL 4Y4HB 2O61A 1S5HB 1N12A 1VQCA 2M26A 1P84J 4Y1AB 1FNGB 1VEPA 4FABH 2ZXGA 1E3FA 3WCYA 1HOEA 1ASYA 4F58L 3TEHB 3OZ9H 4Q6YA 1HSAA 4Z7UF 1WA1X 4UF7C 1NDGA 5HI5D 3PWLA 3P20A 5ISZD 5EF0A 1K8GA 3CSGA 3VXNA 4BUQA 1LTSD 4G80A 4QRPB 2KENA 2NSMA 4C83B 4JFTA 1CD9B 2F0WA 2J8UF 1NGZA 3RUZA 1DVFD 2E8GA 3M45A 2NR6D 4D8PA 1YEDB 1NQBA 2ZM6L 4NZUL 3JV4B 1RUPH 3Q01A 1UA6L 3MV9A 1PW3A 3GHBL 4JO4L 4NO0D 4PD4J 4D94A 4XPFH 5JW4M 2ED6A 1NGWA 5CMAA 1JPFB 3HS8A 4FFZH 1ZLUK 5IMLB 4QMGA 1FH5L 3ZZLA 1HYSC 3KF8A 3MV01 3DOSB 1Y14B 1RVFL 4LP4A 4KHXL 1CZ8H 5EPKA 4YDVA 2VLKD 4LCWA 2B29A 5EUKB 5ANME 1MJ8L 1TVDA 4KTYA 4E9VA 2FYVA 3EJJX 4IHBA 3F8TA 1QLEH 2E9GA 1FG2B 3N40F 5M3MB 4TULL 4XN4A 4AT6A 1K9MC 3I75B 5HDBF 1ZPUA 2RVLA 2PMZB 3C5JA 1T4WA 4G1EB 4B3SQ 4CUCA 4NQXA 1FH5H 4IPCA 1OQXA 4JCLA 1U8MA 2HFEA 4R0LA 4YDIH 1T2JA 4HJ0C 3TYFA 1HFGA 4BFBD 4FFYL 1UZ6E 5D93C 1XMWA 2GEEA 4UOJA 3UAJC 1MCFA 1MIEL 2BRRL 4HS3B 3V6OA 1T7YA 2VN5A 4HLJA 4KKLD 1PZAA 2AEQL 4Y2DB 1OP3K 3AS1A 4PCKA 4KXAA 3V6BR 2WBWB 3GTGB 1JNLL 3VYSA 3VFSA 4C54A 1GMEA 1E7VA 2WCSA 3MRGB 5F7BA 4MAYD 3RPIB 4PGJA 3BRFA 4QNPF 1OXTA 1R3IH 3M17B 3KW7A 1UWGH 2BRRH 2BNRB 3I2ZA 1YEZA 3KCPB 3GSQA 3DGGB 1JPGB 5DJ6A 1MCJA 1N64L 3HC0A 5AZUA 5HTSA 2NY0D 4P07A 3KPTA 1ILSA 3RWDA 3W0WB 1GJXA 1A21A 4M9PA 2QPDB 3ERSX 3V7AE 3W9EA 1V1PB 1X9NA 3PO2B 3QC5X 4QRRB 4EDWH 3NELA 5CZXD 5DI8B 1UKSA 3T0EC 5JQ6L 3FPYA 5DMIL 2PNHA 1Q0XL 4OVUA 3ZRSA 4B97A 5KJ4A 4ZW6A 3H85A 4M6MH 1R4PB 1H6TA 5K33A 1INQA 3LQZA 1I3GL 1HNWQ 2Z9TA 3DTXA 1A6UL 4MMZA 2G4GA 5CLWA 2VQ1B 4P4KD 3SXHA 5FYKE 4L18A 3QIWD 3RGHA 1JZ2A 2Z31B 3PO2H 3EUDA 4IFDH 4JRLA 1WK0A 2F5AH 3FO9A 5AAMC 2DGYA 1BBJB 4P57A 4WI8A 1KJMB 5DAUA 1AYOA 3AB0B 1SJHA 3H3KA 3QR1A 4NM4H 5EU7E 1COBA 3CFBB 4FYTA 1E4XL 3MNVB 4CDCC 4XNUL 4C4UA 1IL8A 2WACA 3VG0L 3S3BB 4ES8A 3HBPA 3I90A 2WZAA 5AAWA 4PJ7F 3NP8A 4UZSA 1SLXA 3HIZA 2HFTA 2VN4A 4YHPA 1Z9LA 1DJZA 3BQUB 4X5XB 1VHPA 3P0YH 2X4NA 5D5ME 2F0SA 1HESA 4ZYKA 4N20A 4Z7QB 5IR1B 2A1AA 2Y4SA 3HOYB 4XHJC 4AQEA 4ENED 1QAWA 1BXTA 3FYIB 1QLFB 1CQKA 3BWZA 4I18B 3UOAB 4IO9A 3L54A 2OMVA 4JI3L 4J4PC 1AJ7H 4ZFFB 3UZVB 1U8IA 4HS6B 1WBZA 5L4MA 4CGTA 2PP7A 3P4OB 3KPNB 2YBGA 4GOSA 4N2LA 4XAKD 3UBFA 2VXUL 2B2YA 4FF9A 4PUBL 4JBKA 5D2LF 1RK0B 3STBA 5MEND 4ULLA 5GXBB 1O7ZA 2NY3D 5L7XL 4WIQA 3DURA 1YEWA 2X4QA 3X1FA 2JQAA 5IEKA 3OW7A 4JFPA 3MROB 1QA9B 2KQMA 6FABH 1BM3L 5B1JC 3RTQB 4RRPA 3PPEA 1JWMA 4PJ7B 2QDLA 3QG6B 2WAHA 3BP5B 2ZUWA 4EE2A 1NOFA 2DQFB 1WS8A 2MTAA 2ZPKH 3JV6B 4U49A 4W9KC 4BXVA 5DJ0B 5CGKA 4ZMQA 2XWCA 4GAYA 1B2YA 3FTYA 1L7TL 4A2GA 5FYLL 4B9CA 2AF2A 4PWHA 3I84A 2E7LA 3WUZA 4P5TA 2YPVL 2WD0A 2KQ3A 3WEAA 3WTUA 1GVPA 2X88A 2H1XA 3CZNA 3G04B 5A3ID 3EF4A 3K7AB 1JWMD 3QW9A 4DNRB 1I3RA 3GMNA 4GBXC 2D3NA 2MCPH 1ZLSH 3UL4A 5CN3A 1E4HA 5J5EA 1L7TH 3HI1B 4U1KB 3GRGA 2R1XB 3QA3A 2F8XC 1J9RA 4IBVA 5G3LD 1AKJD 2AVGA 2XQBH 3RX7A 2BSSB 1OP5K 4OIKA 3NEOA 4OZGE 1GKEA 1OTTC 2VUOA 3CFCL 4P49A 1S7UB 5IB1A 2Z0SA 5E00A 3FUEA 1JPSL 2MHAA 1NTGA 4B5EA 3MRQB 2C9OA 3I6LE 4JRXA 5T3ZH 3BUPA 4Y9CA 4YO0A 3RNKA 1ASQA 3STZA 4JI5Q 4PMBA 2OTUB 3KDMB 5IY0A 3BIKB 4HT1L 4KVPA 1WICA 1L9RA 2VL4A 1S6NA 1BZDA 1N8ZA 5J1SC 2OTPA 3PJSB 4S11A 3VXOB 4FTDA 3EGXB 2VUMG 1MRDH 2PR9A 4A3JH 2IHFA 1JXKA 4MAUL 5INCA 1Q0YL 3GTVA 3IDUA 4TVPH 4X65Q 4WO4D 1F1GA 4ZS6D 3T2LA 4L48A 4XPFL 4K8IA 4U1SA 5AW8B 5KYWA 4FNLL 4DQOL 1CDGA 4LL1A 1HJCA 3MV8B 4IBLT 4AJVA 1Z7TA 4B9IA 1JZ8A 4X9HA 3UPRB 5M3FH 4OSUL 3V4UL 3EFOA 2F53A 2P45B 4KXCA 3SYOA 2PF6A 4CNIA 1IYJB 4YBLC 1N0LA 2JCCE 4G1MB 3ZDZF 4YSCA 3FRUB 4YFEA 1CTMA 3UBGA 2L0DA 2JA6B 3INOA 3SGEI 4I0PA 2A2QT 4KZ0A 4BSVB 3RDTD 5IFJB 1F02I 2UZYA 2ARJB 4IRSA 2KYIA 3VXSB 3WAJA 4A3MG 3FH5A 3IKJA 3TSSA 3KHOA 1M6UA 4GXFA 4DZ8A 2WQUA 2K7PA 4Z7OB 4MZ9A 3VYUA 3MXGA 2VXTH 3E2HB 4Y2OA 5HHNB 5GQBA 4OQTA 1JK8B 2WXMA 2H45A 2IVFC 4GXUM 4JANB 4LLYA 2ETWA 4M4RB 3ZMNA 4MLIA 1JF5A 2JCCF 3D06A 2VR6A 1MHEB 3S1MB 3GJFH 1R0AH 2K4AA 2OMXB 3SDAD 2ZKXA 1FAIH 4JVZA 1S5DD 1SXBA 2IAMD 3KGUA 3PDOA 2G2PA 2D0HA 2FJ2A 2LXKA 2DKMA 2X4PA 4GQ9H 4KJQC 2DMCA 1D6EC 2WXPA 3EYUL 1E2VA 1A7PL 4I1RA 2BY3A 3WLBB 1A3TA 2XXFA 4ZAKD 1CIUA 5EUOB 4P4KB 1M05B 3U2IA 1EZ8A 3OAWA 4WJKB 3AU7A 2VLJB 5GRUH 4IKKA 3SZ6A 5KAQF 1L5GA 1VQLA 4JPVL 1A3UA 3WFZA 2WMPB 1WP6A 4XBMA 1DJHA 1TDQA 2VDML 1WJJA 5K1NA 2OTWA 2A74A 1KYDA 1A62A 2W9EL 3BVTA 4U6HA 5FA4A 1A64A 1EAPA 1UEMA 3QUZD 3RRQA 4MD5B 5G2NA 3L5XL 5EZLA 5I1KH 4JQVA 1LK2B 3CKIB 4PJDB 3V0AC 5HYJD 1EBPA 3L4ZA 3S1MH 2EDGA 2Y7SA 3LNIA 1ZWIB 2YQBA 3PWJA 5K9QG 1HJBC 5K69A 4LSSH 1F13A 1AKJA 3CFNA 3I6GA 3I72A 1I7TA 2EC8A 1E8ZA 3F8UB 3N1PC 1ETJA 5L88L 2MPAL 2WBXA 2XCMC 4RSVA 4OX9L 2NY4C 5DHXB 1YMMA 4CDDC 2NNAA 5C3LD 3FTGA 5T1JA 4YHNB 4K5OA 1TETH 2FWLB 3UABA 5DURD 3C60C 4GIOA 4NNXB 1Q38A 2AK4E 4JFHD 2Z34A 2ZXQA 3MA2B 4LOVA 1WZMA 2CHNA 5AB0A 3WG7B 2BP3A 1H9KA 3O4OB 1FL6B 1NCGA 2QDBA 3G5YB 4PJDE 3TF7C 2VDQB 5L2KD 1K5WA 1CQYA 1TMQA 3W2DA 5CS7A 2DV6A 4YY3Q 2APSA 3H3VI 1VCIA 4A3DG 2PETA 1K73C 5I0VA 3BQVA 4A3EB 5BS0D 5FYLE 1DJIA 1LO5A 3DARA 2E56A 4NHUA 3PIO3 3MRPB 1JSYA 2AKWB 3FYEB 2CKBA 2X9ZA 2ZJRA 3QUGA 3O6LH 5CJXC 2G3NA 2R83A 3V0DA 4LIQL 4OCXH 2EDLA 4JO3H 2PO6B 1OT4A 3W2DL 1XMEB 1W6LA 2XUWA 1OSPH 2CO1A 4X7FC 3J80L 2WSPA 1RZIB 4PJ5E 4LMQI 3UYPB 5D7SL 2E9BA 3QARA 1UCTA 3WS6C 3SQOL 3SK4A 1JJ2A 1B3QA 3QZWB 3MRJA 3ZHKA 3N44F 3O6LL 5CILL 1GSMA 2GQHA 4P2OD 5FKPB 1IM3A 2JCCB 3GSVB 3WS3A 1KDJA 1ET7A 5JDSA 5BQ7B 3W2DH 4HUUB 1A6ZB 5IVXF 4MDIA 4LFCQ 2BNRE 2E2IH 5EIIG 5HGAA 1KTCA 2R2EA 4OD2A 4GRLD 3VFNA 1LEKB 3K57A 5DJ6B 3F84A 4G3YL 1X6NA 2BVUA 2G9HB 4HS8H 3C60B 5FOJA 4JJ5B 4DPBX 1CO1A 4LCUB 2EXTA 3BPNC 4NPJA 2Y1AA 3Q2VA 3I73A 4RFBA 2HJLB 2QZQA 3MRFB 1UA3A 1V1PA 4OIBA 5LN8A 2F61A 4MCMA 5IHUL 1DQLL 4Z3IA 4GW1A 2RSOA 4QY8B 1N59B 1EY4A 2AJYL 5DO2C 4NUGH 4PEEA 3AY4A 4R97B 1FIGH 5E94B 2AQ2A 1MIML 1VQNA 3ARED 2WCGA 5C0ND 3CFEB 3GM8A 2CH4A 2AI0H 4WUUE 2BSSA 2QSTA 4PJFA 1LM8V 4RX4D 1KXQA 1H15B 2BXYA 3LZNA 4P2OB 1HHHA 5D1ZI 4C57C 1JZ3A 1KYAA 2BHZA 3H0GB 1R3KB 4Z7AA 3HC2A 3PXHA 2NZ9C 4FQIH 4J8RB 3KVPA 4MJ5B 3QHZL 2EEFA 5LBSH 4B9YA 1SDDA 2EYHA 4KO5A 1X5FA 5CBAE 2NN6H 2WN2A 5TK2A 3T0XA 2J73A 1A6WH 4G6FD 3PYCA 3KF6B 5IW3A 3U4VA 2BP5M 4OSUH 3RVTC 1LT3D 3V4UH 2ADYA 3PFUA 1V05A 1FRGH 2XDHA 2XXMB 2XN9A 1N3NA 2MQ0A 4NYLA 1L4IA 5KVGE 2QQKH 5C0XJ 5C3EH 4G57A 2DI8A 4PWEA 3VXUE 4Q9QL 4L8SC 1J5IA 4DAGL 2K6YA 1YYMH 4R4BA 4RLDA 5H2BB 1A2TA 1BAWA 3A67H 5EN2A 2Q8IB 2GSIA 4JOIC 3DUUA 3N41F 4IBWA 2E9JA 3HNSH 3C6SA 1TXKA 3I9GL 4OFYA 1RLBA 1LO3L 1NBZA 2EOTA 3BGFC 1UZ6F 1DQML 2XYCA 3A4AA 3HC3H 3TV3L 1Y1WB 2G5BA 3MYJB 5A3IC 1GZHC 4MHEA 1RMFH 5C4ZA 2CM5A 3BGMA 3ZE0B 4TL4A 4E41D 1U36A 4D0DB 2V9QA 4CU7A 1GY1A 3APMA 5LQBH 2Z1CA 2XX1A 1U9RA 3POCA 3P3TA 1G7LA 3TBVB 3FOLB 4Y5XB 5AZEH 5DFVD 4BFKA 3DV4B 3KJPA 3RPKA 4AEEA 3FQUA 2H6UA 1GYAA 1RZPA 3PF2A 3LS5H 1YNJC 3OTOL 3VFVB 3S1RH 5T5FA 3ME0A 3D0VA 4YWKA 3D3VA 3EOTH 3MLUL 4QUOA 5LKNA 4OI7A 2V9UA 1HEZA 4O2EA 4E5XB 1HE8A 2BFVL 1TPXC 1FL5B 4KK7A 4L37A 4OIIH 2OR9H 5EOCJ 3K7UA 1M57B 1MW0A 4Q2ZB 2GUOA 2GUYA 3OV6A 4PWJA 3ECQA 4ATTA 5L9DH 3MQIA 3MRPA 4F92B 4LLWB 2CDGA 5AB2A 1TJIL 5D1XB 2GT9A 2K4KA 2Q76A 3OGCA 5FYJL 2YSTA 2AGJL 2J7LA 3GB7A 3SDCB 2BSTB 3V4VB 5KYIA 3QIWB 3MBXH 5L4IA 1IBKQ 4JDZA 4HIOA 1SYDA 1EIYB 1ASZA 3TZDA 2FAUA 3I6KA 3NOIA 1KOAA 1ID2A 3JVFC 3BEWA 5C0IB 3A21A 1GZPB 1A8ZA 2VDNL 4ONFL 2ZP9A 1B0RA 2WB1B 2OTWB 2GG1A 3MXVL 4PBVC 4ZAKB 1RPQA 3RPIA 5CP7B 3BH4A 4UAIA 3RL1B 1QRKA 5BS0E 5HYQA 32C2A 1NBCA 1Y1DA 2C9XA 2BVYA 1BHGA 5D7JD 1E9OA 3KCPA 5EO9B 4DTGL 5ANMB 1UASA 3TIEB 1QZHA 3TNMB 3OZKA 5HGAB 1F4YL 5LMNL 3S1QH 4XNZB 3RVTD 1QG7A 1OSZB 1UVQA 3ARFA 5GS1C 4PMEA 4KMUC 2H3XC 3O45A 4ME5A 3TT3L 3EN2A 2P24A 2VITB 3MZGB 2G9HA 1IYVA 1DVZA 3SHSA 5ADPH 1A9EB 4JYAL 1AR1D 5DZJA 3UTTA 4NWTH 4IBTA 5IHHA 1YNJD 4IS6A 3STLA 3PABA 3KLWA 2WBJA 4YBQC 3ULVE 3T1HL 2LHAA 4CKQA 3T1HQ 2AEQH 4GW1B 1NCHA 5D7JA 3F6LA 1DYZA 4Y16A 1U6AH 4NM8H 2ZOOA 3CFKB 4URTB 2WINA 2WAQG 2ZSVB 5ESAA 1SFDA 2P47B 3DMMC 1CL7L 1EERB 3PV6A 3C46A 1ET8A 3JWDL 5DK2B 4FS0A 5BJTA 4E36A 1YPZB 2X12A 3ZR6A 2IWHA 4IIQB 1NC2B 4QHPA 2QTVA 4I0PB 1A6TA 4X64Q 3IDIA 1SJMA 3FKUS 2R4RL 2FJUB 4J1UB 4JDVB 5IFHL 4QIWE 1FFNA 3B2VL 2F8VA 3L3DB 3QEQD 1CGVA 3LPGA 3OPOA 4DXFA 2XZQL 5FGCE 1WCMG 4OCSL 4WI0A 3VFGH 4QO1B 5D6DA 1OAYL 5AL8A 2A5HA 1S5IH 5JQ6H 1VQKA 1E1OA 5DVLA 5DVOA 1KLFB 3EBAA 5HGGS 4D9RD 3SPIA 1RZIA 4N5EC 4WEEA 5D6DC 4NLAA 5F0LB 4PRNA 2XRQD 3TVMD 2QV4A 3FU5A 2YLHA 4X6AH 1HOCA 5B8CA 3VRJA 3FTVA 3ZR5A 4F9LC 5DLLA 1IEHA 1EYDA 5I1LB 5CJOH 4GI9A 2E75C 2L11A 4GLVB 2XC8A 3TEXA 2XWTA 4DPCX 4DUXA 5KVMC 1XGTB 3U83A 2CLVA 4JRXB 1H3PL 3D2TA 1I9EA 1UUSA 3AMUA 1QPKA 3HCVB 4HG4K 2X4UA 5E6RB 1S5CD 4JFVA 1MCHA 2H3NA 2XSKA 3OKKA 2QADC 3P54A 4XI5C 4QMEA 3S96A 3GMQB 4IKIA 5TPWL 4U6HB 3I4NH 1NGQH 2YAFA 1RUQL 4S1RL 1H0DB 1A6VL 5D7JC 5FA4B 2N01B 5I8EA 5DQDH 3QDJA 2P52A 2AXFB 2FK9A 1SNOA 2BM3A 5IB4B 1M71A 3I6SA 1TY2A 4HIXH 4PCSA 1JIBA 3PHSA 1SBBB 4HJGB 3S3SA 2QQNL 1J0HA 4FXKA 2GJJA 2Z91A 2L55A 1NBYB 1IT9L 4M7KL 5IT2L 1WTOA 3OAYH 2C3GA 4JEGB 4A3GB 4X6DB 1ZDQA 4K8RC 3FHEA 2O6PA 5EB9A 1MZZA 4JE4B 3ND8A 1B7YB 1XR9A 4R8WH 2FCBA 2G60H 1PY9A 1QSEB 4EQNA 1BOYA 3MUY1 4DGVH 4BDVA 1ML0D 1GGCL 3BWUC 4P3CL 1C12A 4GG8A 4FP8L 1EAQA 2GKIA 3MV7D 5DQJA 5C0GB 4Q6IC 1EBAA 1RIHL 2WJ5A 3QJZA 1JCKB 3MLYH 3O6ML 1AR1C 3NCYS 3WIFA 4AKPA 1XO8A 2WKDA 1FPTL 1XIWC 3DBXB 4ZTPH 5A7EA 4I77L 1JK8A 4WTZA 1TEGA 1JE4A 4G9FA 1D8LA 4N90D 5EC2B 5A2AA 5KSUB 4XYOA 4ZW8A 2YXFA 3PNWB 1MAJA 2G2RA 3OMZA 4FFYA 1EFXD 2DWTA 4O58L 4RAVA 3ZL4H 1G6RL 1F4XL 2G3MA 2OMXA 1CE1H 1PLBA 3UBXB 2GK0B 3MCKB 5FUOL 4KJYB 1NWPA 1IAII 4PS3A 3WTWA 4J2XA 2K5WA 1U8QA 4OQTL 1NMAL 1YC8A 4BD4A 3HE7C 3H09A 4OB5L 1MCPH 3BH8A 4PP2A 2XBDA 5EKLA 4CSSA 4M1CC 1KC5L 4UOZA 3OZ9L 4HPHA 3RZOH 3C8KB 1W16A 4ZBJA 3LRHA 3VW3H 3CHSA 1EUUA 2P3YA 4NJAL 4HOWA 1NEZA 4N8VG 3B5HA 4KHPL 2A6KB 3GMRB 2EZVA 3LIZH 2AXGA 2IIJA 5DFAA 4B3VA 3CHQA 3QJUB 4EJ1C 4LPYA 1UM5L 2F5BL 3V5DB 2VW9A 2ERJB 3FRUA 3KLRA 2IAMC 2JJUA 3ZE2E 5KANI 4P5MB 1KJVA 3NPZB 5HPMB 5BQ7A 4Y5YA 2GSGA 5I6YA 2HHHQ 3HUJE 1HEZB 1Z3RA 4O2EB 3RU8H 4EN3A 2UXTA 1AP0A 3DSNA 4J3OD 1EFXB 5HHVL 3Q8CA 4A3LH 1RF2D 1RVFH 1A3QA 4XVSH 1I8KB 3C1FA 2WLLB 1X3DA 3UTZA 5J6GA 1KT2B 5E2VL 5E8NB 4FADA 2VQFQ 5CU9A 3FT0A 2Y72A 3MKKA 4GFTB 3F2LA 5GAGC 1TFPA 1WAAA 2Z8RA 5MENE 3HHSB 4V1DB 1KCRL 1X3PA 1KTRL 4GKLA 3A5VA 1J0KA 1MAMH 1P5UC 3MRRB 4L3CB 1PCSA 2EDTA 4FQPA 2HMIC 3KNBA 5BRZB 4F7TB 1DQVA 1X56A 1JOOA 3C6EA 4RGNC 1H8LA 3VE0B 4YCVA 3FUJA 4CJ1A 4G7QB 1ZLDA 4H44C 5B1BB 1PX8A 4Y4KC 4F8PA 4MXQD 1N0XH 1ZDSA 1LT6D 3K4AA 2YC1B 3D08A 3ZXAC 1XSIA 2EO7A 1KTKA 1XWVA 1JGUL 1W9XA 1F77A 1E9QB 2NY1B 4LLUA 2AXJA 3EA6A 2QR0B 2XWBB 2JTDA 1IM9D 1ZK9A 4WI3A 5ETUA 3ZYOA 4JW3A 2VB3X 4OEMB 5H35B 3V4PL 2WXHA 3WKNA 1BEYL 4F27A 1BD2A 2PYKA 1CT8A 2AEPH 1P84K 2WSDA 3QWRA 3MHZA 2W0FB 2KKQA