3QWNA

Crystal structure of a nigd-like immunity protein (baccac_03262) from bacteroides caccae atcc 43185 at 2.42 a resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
206
structure length
206
Chain Sequence
YPSVKLEFVTVKAGTDGSIQTLIPDNGEALTVSKDRTGSAISPNTSRRVMSNYETLSNGHTATAVIYSLQSLVTPTPKPADDPTYRDGLKHDPVDVVSIWLGRGYLNMILNLKVNGGKQHVFGIVEDLSEFETNGTVNMLLYHDANGDEEYYNRRAYLSVPLDKYADAENPGQKITIKFKYYTYDKDGTAIESGKYCNPGFEYVPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical nigD-like protein
publication title Crystal structure of a Hypothetical nigD-like protein (BACCAC_03262) from Bacteroides caccae at 2.42 A resolution
rcsb
source organism Bacteroides caccae
molecule tags Antitoxin
total genus 41
structure length 206
sequence length 206
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3qwnA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qwnA02
3K6OA 3K0YA 3QWNA 4PQXA 4J8QA 3NQIA
chains in the Genus database with same CATH superfamily
2BE5C 5FO9B 3INUH 1T3FB 5F9WB 4XOBA 5F3BB 2D3JA 3RIKA 3H15A 1VQKA 4JY6A 1G7IB 3VJ6A 3W5NA 1U4EA 4PJHB 2Z8WC 4GUQA 3IRZA 5B38B 2NMSA 3E80A 4KKPA 4WNQA 3L08A 2A9NH 3T0BA 1XPRA 1BJ8A 1QOKA 4OCLC 4OJAA 1DLFL 5FYJL 2WXRA 5IIEB 3CC4A 1Z6JT 3TCXA 3LHPH 4LHJB 4FQ2H 4YLQT 3HC3L 3HG1B 2R15A 1R17A 2Y0SA 1FA4A 3DYOA 4DAPA 5E24E 1BDOA 2UU9Q 2XNAA 4AYDC 5DO8A 4Z3JA 1A0QH 1RPQA 4OD3L 1FNSL 1A7PL 2QFRA 3A23A 2XFXA 3PP4L 1MXGA 2WJ5A 3VXSA 5LXGL 1EZ6A 3FS9A 3M6DA 3S4SA 4UF7C 5C2UB 2ZWKA 4X5QA 4UM8A 1IGTB 3TVMA 4I4WA 1IBZA 1L3NA 2IH3A 2Z7WA 5KANG 1Q9WA 5DZLA 2DJGC 3PQIA 4A68A 4JW3A 1RVFH 5CKGA 3F85A 2XVLA 1J10A 2YPVH 1NCBH 4JHBA 4KDTC 5GS1B 4XH2A 3EJCA 1CLYL 3EHBB 2HVJA 2L11A 4Q74A 1LACA 4IKIA 5K1VA 5I19H 5HXMA 4JE0A 4KTEH 3FB7B 4WRLA 2GAZA 3G08A 2M2DA 3BVUA 3C1EA 4Z3FA 1AO7D 3CCVA 2W80C 5DK2B 4LSRL 3WJLC 2BOLA 1G94A 1TQCC 3GI8H 4I48B 4XVUD 4HJ1A 5DHYB 5EDSA 2NB0A 1ZGLB 1P4IH 1PJ9A 5JYLA 1Z0MA 4LFCQ 1BQUA 4LSTL 4NO3A 1JPGA 1MAJA 2QGBA 3PAZA 1CF8H 4WUUA 5D2NB 4YWKA 5C4XH 2WLIB 3HI5L 3KYMB 3HE6A 3M1CA 4MNGA 2VB3X 1W91A 3BHBA 5I30L 1MFBL 3RY6A 2XYCA 2WBJD 2J12B 1OEZW 3R0MA 5HHVH 5J89A 4JRYE 4R0LC 3WKNA 2MPMA 1FE8H 1HEZA 4C3JH 5JHDA 1DJWA 2Q5BA 4TTDD 4YBQD 4HWUA 3WDIA 4OV5B 4PMFA 2VXVH 4PJCA 1I9JH 1JNHB 1CL7H 3RIAK 3ZO0A 5F1IB 3BQUC 5FDWA 1Q0EA 2Z31B 1YO4A 5D3IB 2XV6B 4ONOA 4X0NA 1QVOA 2WMPB 4QJ5B 1RIHH 5G55A 4KXCA 1KCUH 1NFDB 2EVGA 1AGBB 1TSRA 3UGXA 1NMBH 1OHZA 2IHFA 3IGAA 3ELQA 1MFCH 5IYDH 1WTPA 2G5UA 4AVKA 4G7VL 4KK6D 1MWAA 3S14H 3ALPA 4NKMA 4RFOL 4DR6L 3PWLA 4K71C 5DJ0A 2Y24A 5C0CB 1BZQK 1RP9A 4OCYL 4G8FB 1HCVA 2CWRA 1ETA1 4JRXA 4PWJA 4JI2Q 3U2JA 1NCVA 1UE5A 1OOWA 2FATH 2JQMA 4JQXC 1M71A 5E23A 1HL5A 5AJ3L 2XN9E 5EULV 4WLCA 1A7NL 1BWWA 5DEZA 4QRPD 2ZXAA 4XXDB 1GJWA 3HFMH 4MNQB 4XNZC 2JTDA 5HSFA 4NI6A 1PZJD 3KNBA 4DGVH 1KABA 3NQIA 3Q23A 1O9WA 3LKSA 4NZJA 3B2DC 1OAUH 4LRIA 1A9BB 3GZQA 4XPFL 1YNND 3T51B 1HHHA 1BZ8A 1VQLA 4EJ1C 2H32B 5EU6E 1YVLA 5C4JB 3G04A 4S1SL 5DUPL 1J9SA 4A55A 4JHAH 5I2YA 2AJYH 4A39A 2EH8H 1IBGL 2D7TH 4NRZB 1FL5B 5CF3A 2Y22A 4ANXA 1FC2D 5A16A 4IEFB 3H3PH 3B5TA 1G2SA 2NTSA 1UWEH 3KGSA 3VD4A 1WIUA 3Q3GA 5L2KB 1BM3L 4NQDB 5L7XL 3H91A 4GQZA 4FFWC 2NY0B 2PLTA 2R7EA 3C46A 2QDBA 1SHMA 3HC2A 3A67L 5DJCA 5TQ0H 4P2CB 3X14A 5AOZA 1YEGH 1S5CD 1AE2A 3T0ED 5CSBA 5I5RA 3SJVE 4O02H 5ICXA 1KCRH 1FH2A 1D5ZB 1I85C 3B7UX 1LD9B 5DZOA 3UTTB 3EKCA 3K6FA 5SWZB 1WFUA 4KKQA 4NNPL 4E68A 1IIIA 2A6HD 2FQGA 2TRHA 2X09A 4FCHA 1J0YA 4WFHD 5DMKA 3X1GA 5FFLA 3KYKH 2B1HH 1OCOB 1G7PA 4GO9A 3IJEB 3WNNA 1FGNH 3VGDA 4URTB 1XB6A 1AY1H 4YIQB 4MS8D 1RODA 1OPOA 2VDRH 1C5BH 2WJ7A 3MLUH 3LPWA 2TSSA 5A6LA 1L6XA 3B2PA 2EYTB 4GIOA 2MQGA 4WEBL 5C0EB 2J1YA 2H2SD 1VFBA 4HCEA 1UD4A 4MMZB 4DVBB 2OTWA 5BS0A 4D9LL 3BSHA 3O3BB 2VITB 4KUZL 5ALBH 3KPLB 2AQTA 1BEYH 2ZWZA 3I6LE 5KVMC 1W72L 4A6YA 4XP1L 2Y6TE 3V4VL 5F7DB 3X1NA 5HBBA 1XSIA 3B2VH 2OZNA 1DQQA 3NIDF 3PE9A 3TPKA 2XSKA 4HUXA 3WLBB 1OT4A 1GGBL 4KJWC 2C3HA 3D69B 3OW7A 3HOVB 3SQOH 4K5VA 4XPTH 1HKFA 5G4OA 2QKIC 1U8MB 2E9GA 2H3KA 1ILUA 4E0RA 2JJTC 3BAIA 3ARDC 3H6MA 1YY8B 2E56A 3GHEL 3GV3A 4MAUL 5TE7L 1KNOA 3LIZH 5T33H 3BX7C 4N1EA 1KFGA 1CXFA 3BAWA 2XN9C 5FYLL 1EO8H 3V05A 3ZW3A 4HHAA 5HGTA 2FCBA 3HZXA 3LRKA 1GVPA 1JVOA 2BJMH 2F0OA 4KRMB 2W07A 3V0JA 5JOEA 3IJ9A 4OWWB 1MI5A 2WLZA 1SSOA 3ZE0F 3GJEB 1M2VA 4X64L 3QULB 4TNEA 5CORA 1A6AB 1KTKE 1USQA 2K8MA 3L5WB 4Y1AB 1V3MA 2C9AA 4KTAA 3P4MA 4KDTA 3I4NB 5D5MB 5E4EC 2NTFB 1PH5A 2N3SA 4MAYC 2ZKMX 4HD9A 3KCWA 4BH7A 4AIEA 5H2BB 5AVXB 2PF6A 2WTRB 4MA7L 4IJHA 4JFTA 3JV6A 3HOYG 3QB7C 2I32A 3SDYH 4KPHL 1IL2A 1C7YA 1E30A 3M86A 4L48A 3AMUA 1KJ2B 3WJLA 1KELL 2X53A 3D25B 4NQEA 1DBJH 4ZSOE 3BCDA 5K36G 1T04A 3VXTA 4HKZA 3WN5B 4Q9QL 4A3FB 1N12A 1S46A 1CQFA 3SGDI 4BQ9A 3HKZB 1YEFL 1NJIC 2XTSA 3MCLL 2O5ZL 1AE6L 3BP4A 1YEDA 2G30A 2VE6B 3HAEA 3PS6A 4UUJA 3T3PB 3G6AB 3WEXB 2TSBA 4FTVD 1DE4A 3KHOA 4R0LA 5ALCH 5ILTL 4PS8A 2E27L 3QIWA 1DBBH 2QVIA 4HOMA 1GGIH 4NXNL 4JMXA 3UPCA 1PV4A 4NO2B 5GRWA 1DGSA 3BQUA 3GGWB 3C6LB 5L8KB 3ZMNA 1LE9B 2W8CA 3NCYS 3LEYH 2PTUA 3N40F 4KKBC 1YIJA 3BP5B 2ZZUT 4NO5B 3BUTA 4LF3B 1Z47A 5ELDA 4OCRH 5ERWB 5SX4H 1UA7A 2NZOA 2HVBA 4X7TA 1IAOB 1P7QA 4YBLC 4L8SB 3TS8A 1CGSL 1VFOA 4YHOH 3HBGA 3FQ2A 3OMGA 3RI5K 3T4AB 4EBQL 3ECUA 1NBYA 1UT9A 1X5XA 4GRLB 5GZNC 4K7FA 1II3A 2P7TA 2GSGA 3O8XC 4I77L 5DD3L 3FB5A 1XSOA 4APQB 4KI5D 2WY3B 4A3IH 1NA8A 3JTTA 4JG9A 2C3WA 1CKNB 3GLDA 4KVCH 4ORGB 4PRAB 1UUPA 4JQXA 3FP9A 3RDTB 2X1QA 3SDAB 5HYJA 1I7TA 5DGRA 4C56E 1OAJA 4ODWB 1OP5K 4KFMA 1CDYA 1OK8A 2ZCHH 4JEGB 5HHNB 5C0BE 2DI8A 4LL1A 5I16B 3HZ3A 1NCDH 4MDRA 43CAA 5E2WL 4LVNB 4L4JA 2WNWA 4UTAH 3F05A 5J56B 2R3ZA 5IG7A 3SB3A 2WB1G 4F27A 2F0SA 4ZRZA 3LIUA 3WEAA 3IMSA 1OP5H 3SPIA 1D8LA 2XIWA 4YH6A 2VNCA 4JCWA 3F12A 4GG8B 4M7LH 4RAVA 1LJMA 5LMNW 3NQTA 1CDBA 4P71A 1I1AC 2V1CC 1Z9OA 5DJZA 1TU2A 5KOMC 3Q6SA 4FG6C 4PP1D 4IPGA 1DQLL 2OMWB 3L3HA 3NYKA 1BXAA 3TFKD 1A2TA 1G2TA 2AUKA 2RHSB 3DIFA 1B70B 4NRYB 2A68D 1BVKB 1F4YH 1X4XA 5DR5L 5HHOB 4QMGA 4QT5B 5IJCC 2VC2L 2OEOA 2EJMA 4OWTB 5C4HA 3G6EA 5GPRA 4AYGA 1M2OA 5GIRA 3MRMA 4RNRB 5AAWC 3LKRB 3U4BL 4IBSA 1FUNA 4IFDH 4E5XG 2BWDA 2IXQB 1VQFA 3L3GB 2B39A 3SKJH 5I5IA 3AREB 3WG7B 4K3JH 4JY4A 4W70A 3SYAA 2APXA 2PTTB 3WIAA 4JKWA 2APFA 2R39A 3EJQA 1IQDA 1NAKH 4GW4B 2B5IB 4QHKJ 5FPIA 2AQNA 1YSOA 4WI2A 3CSGA 4HJ9A 4L5FE 4XGZA 2LFNA 4MZRA 5C6TH 3TP6A 1RULH 4F8PA 3DM3A 2IPUK 1HIML 5I6YA 2K9UA 3SZ6A 3FMGL 3WTTA 3J80E 4NZDA 4XE5B 1NLDL 4AYEC 4TPRL 3AQQA 5DQJB 1KEMH 2AQPA 5GGSY 1IC4L 2D31B 3E8UH 4Y5XC 1FNGB 3Q9QA 4BKTC 3QRFM 3TEYA 3VXSD 1H0DA 1WAAF 4FOMA 2V8MA 4CJ2C 2ESVB 4XXWC 3WY2A 1LTGD 3VRJB 5BV7H 3TVMD 1N5AB 3MFGB 5BO1H 4PB0H 1MNNA 1A62A 2A6IA 5IB5B 4F7EA 4C3HB 3FN0L 4I9WD 4HWBH 4JN1L 4NQCE 3ARDA 3MSPA 3AWEA 4N2MA 3ZVVA 3BPOB 2G5BA 4P5KB 1LTTD 4XCYA 2AHIA 3B9AA 1A1MA 2XDHA 4JI4L 4FQLH 1RTNA 3L4YA 5F9OL 1VIWA 4P9MH 3WNOA 5EQ0A 1QNIA 1U8CB 1YNTB 2VWEC 3OG4B 1F02I 2YAOA 4O5LH 4X5LA 5IEHA 2AJSH 2ZXWB 4JDTH 3DK2A 1N18A 3EYOB 1PNCA 2DIEA 3U1QA 1NNXA 3ARQA 4PJBB 1IYUA 1J1XL 1LWRA 1ZKAA 1T4KB 1J05A 3HG5A 1MJ7L 5CJOL 4WUUD 2G60L 4FLRA 2BX5A 3HE6D 1GKEA 4Y4KB 5LNGA 3FFDB 3ZZQA 1PDKB 4IYKA 4H26B 3K91A 4MAYA 4OTXH 3MRBA 2Z6BA 1HYSC 2XPGB 1JHTB 4BFRA 1R3JB 3BG3A 3QO1B 4JBMA 3JYBA 5D4JA 4NC2B 5I6XB 2GIYA 3DXAB 1FSKC 3QRBA 5D70H 1MLBA 1N26A 1IKLA 3PU7A 1MFNA 3U79A 1D5XB 1FIGL 1A6WL 4LIQE 5GGUB 2LFGA 5IYBG 1K5NA 4E36A 5GGQL 2B2TA 5IT9E 4NDMB 4DW2H 3ECVA 4HVBA 4QRFA 1L0WA 3FBKA 4PP2B 2OQ0A 1P84J 4HJ5A 4A3LG 3TT3H 4OONA 4QTHB 2MPAL 4GJTB 4DR6Q 1RU9L 2QJDA 5GJTH 1QZ1A 3UJJH 3ZDZE 4PJ5E 1JWSB 4L5FH 1BFSA 5HHQA 4JRXD 2B63B 2Q8AL 3D9AH 2XV3A 1I4XA 2XKNA 4K5LA 1OL0A 5E2TL 1ILPA 4IURA 1FL0A 2X9ZA 3GPEA 4OJFL 2OI9B 4ZNCD 3KPQA 5FECB 4GKZB 5DJAB 1OANA 3MV9E 2KDYA 1OCZB 5AYUH 3RTQA 1I5FA 3E1ZA 1X3GA 3UO1L 4ZMQA 4R7DB 1JGDB 1NDMA 1NMFA 1VAHA 5D6CB 5GZNA 2VDNB 3MJ7B 4R2GB 4IM8A 3O8XA 2VXSH 4FKHA 1TS2A 5ISZB 2ID0A 1T5KA 2R69A 5KSUA 1Q8IA 1F2LA 1MEXL 3KHQA 2F6AA 3MRIB 1HDMA 5GSRB 4DUVA 5E1QA 4OM1H 1EJ6A 4L8BB 5LVEA 4AYMC 2OZ4L 3GBNL 4YLCA 1SXCA 2ROYA 3CMOH 1W0VA 2WB7A 3VVVA 3KLDA 5HDQH 1A3ZA 4P4RB 3O3DA 5H35A 4XP6L 1Q82C 2Z6KC 1UB5B 3N9GH 2DQFB 1DQIA 3OJMB 3QC6X 4GO6B 4U31A 3D30A 5B8CC 4BY1B 1G7LA 4OD2A 4PNYA 3LS5H 5HPOA 4HIEB 35C8L 1Q9OA 2D03H 3BWSA 2YK1H 1HSAB 3BZ4B 1E42A 3QEGL 2BWIA 4U3HA 3V5DB 3IL8A 1NBVL 5DURD 1AMXA 2W0PA 3ECBB 4LMQI 3U30B 4GUPA 1HWHB 3QIAA 5KVDE 4WGKA 3PWPB 4JVPA 3MCG1 2PP7A 3MRRB 2MCAA 1BBWA 2ED9A 4GRWE 4CMMA 2FLMA 2OSYA 2VN7A 1SYCA 4V11A 5F89A 1CFVH 5DNFA 4LIQH 3RX5A 1RJZB 3FCGA 4GINA 2BP5M 3UOAB 5BS0D 3G5YB 4F7CA 3UZQB 4PJXE 2MCPL 1C5DB 2NNAA 5AAWA 1Z9PA 2BE5D 4YE4L 3WMQA 4OZHB 4MZ2A 5A35A 4PGDA 3S1QB 5IQ7L 1E4XI 2NXZC 3GI9L 1YNLH 1NPUA 1ROWA 5JO5B 4PJGA 4YX2H 2FE0A 2B77A 1P4LA 3C5SB 1C9OA 3UBXI 5A2IH 5KZCB 1WWAX 2WAQE 1LQSR 5JLZB 3MRQB 5GADC 4ZPVA 3VCLB 3TNNA 2NUPB 1SM3H 3OXSA 2K5WA 3Q0AA 2BWQA 3MLXH 1OALA 1AQHA 4RISL 2AEPL 2EYJA 2KS0A 5GGSA 4NUGL 1YUHB 4D9RE 2Z7ZA 3CH1B 3WOEA 4OCSL 5KYLA 2PI2A 2WOYA 3H9ZA 4Y5XA 1V10A 2YPKB 3CFKA 2Q8RE 1JPFA 1W15A 1JNLL 1QRNE 4XXWA 2ZJRA 1MI5D 5L9DH 1JYWA 4X64Q 4MXVE 4M62L 3ZDXB 3HHSA 4HK3J 3ZKND 1MSPA 3OKDA 1OZUA 1NUDA 4OCWH 1A7OH 2H0FA 4LFAL 1K8IB 4R3SB 1BZ7B 5T1MB 4BK4A 5ACZA 5J57B 5IWAL 2P48B 5L0QB 1LEIB 3SE0A 2FT8A 1E9OB 3F58H 4AG4L 1BQSA 3TN0B 5J5EA 1JGVH 1DUZA 2CO6B 3R1GH 1S7TB 5ELCA 5D7LE 3IDXH 1PYWA 5H37H 4N28A 3QFJB 4B9GA 2KC0A 2WV3A 4YWGL 4NCC1 3K1DA 5IVXB 2APVA 3P3RA 4NQED 4TQEH 5ELFA 1FYHB 3M8OL 4M5ZH 1CLOH 1XAUA 4Q0XL 3LDBC 2VT0A 2EIFA 4QXUH 1CXIA 4KD3A 3SK8A 1KIQA 2F3VA 3EO1A 2V3EA 4RGNB 1U3HC 3U48A 4KY1H 4NRXB 1JF1B 4U1IA 4ENEC 2DQTH 2EY2A 4JFPB 1ZVSA 4QY8B 1BBJA 3KLRA 3GTGH 3QIWD 4NXNQ 1JV5B 2LLGA 1JE6A 3V10A 3BQUD 4QWWD 5ECGA 1SJHA 3V4UH 4M1UB 3EXJA 2MQCA 1WWWX 2RDGA 5B1JC 4TUJB 5G2NA 2VJ0A 4G3YH 3V52L 3WFHA 1S8DB 3EFDH 5C0RL 2FNBA 1GS6X 1P7QD 5JVH3 4LOUD 4MBOA 5EFIB 4FQHA 2Y5EA 5I8KH 5LWYH 4P72A 1SJEB 3CZSA 3HA0A 1FGVL 4M61A 1BVLB 2F58H 5FLXE 5C4XB 2E7CA 2XTJB 2P4AB 3D48R 3GTTA 1CUKA 1ODAA 1WFQA 1V5JA 1AGEA 2MQ0A 3NTCH 4TULH 4G1MB 1FFPB 2BXZA 1QA9A 2AMGA 4WHYH 5DHEA 2DJMA 1NR4A 4C3JB 4LSQH 1O75A 3Q2CA 2K01A 1NQBA 2SODB 4XZUB 2B29A 2XIIA 2F5AL 3D0VA 4UT6A 2DY7A 2J88H 5AVRB 2V9UA 1V1PB 4JPKL 2H2PC 4UT9L 2XTIA 1KYAA 2VLKB 5J11C 1N0XL 1VRSA 3KM2A 1VEPA 4HALA 4MYWB 1NMCC 3B4NA 3BKML 2OSWA 4FXGB 1D7DA 1EIBA 3R19A 1BIHA 4WGWB 2FQDA 3GSXA 1BPVA 3VE0B 4HT1L 5T8IA 2ZOLA 3JWDH 5HURA 3S14B 3ONAB 6FABH 4GI9A 5KJ7E 2HDMA 2M2LA 3RZWA 5EEXA 1X9LA 1OD9A 2DBJA 1G6VK 3CSFA 2PZUA 4FFWD 3RGVC 4X7DC 2Z6KA 4DN4M 1E90A 2HRGA 3S3BB 4K6LA 3PF5A 4BY7G 2Q86A 4ZD3L 4KO7A 4OZIF 5B8CA 3T1WA 5T1GA 3EGSB 2K5HA 3FTVA 3OR7B 1TO4A 3JVGC 2ZONA 5ADPL 3S15H 3LZNA 1NGZA 4E41B 4LLVB 2CXGA 3IFOA 3CVHL 2FTAA 1XPOA 2WC7A 1QKZL 2W1NA 1FN4A 4KJQC 5I71C 4UQCA 1KAWA 3NFNB 1G9ML 3VXRE 3IPBA 2R0LL 4AIZA 1KYOJ 1SN2A 1PLAA 1EEZA 3T6WA 3TJEL 5ES4B 1T5WA 4M8QA 2B16A 2PWFA 3HN3A 4X6FA 1NCAH 1AQDB 1LO3H 1WIOA 1J6QA 2K78A 1DBKL 3E6FB 1NEZA 3LH9A 3QHTC 4GLXA 1MW2A 4AYBE 2WLMA 3CLEH 2R0ZH 3VG0H 1DANT 5BRPA 5CGMA 4NN6B 2OK0H 3W0WE 5FA3B 4HIHA 4O02B 4Q9BA 2PTVA 3LPOA 5T3XE 2RTTA 3MXWL 1AVAA 3EJYC 5EZJB 5DD5L 3F6IA 5M3MH 1CM9A 1B4JH 2GT9B 2YMXH 2D0PA 3AMLA 5GISL 4HA1A 2ADGA 3IJHB 3MACH 2B3IA 4GQ9L 3ARDD 3PWVB 1KG0B 3S3JA 1FNWA 3TBWA 1NBQA 4JRYB 2QF7A 4PUBH 4JI4Q 1OB1B 1GZPA 3GZOA 1IBBA 5EO9A 3UAAA 2JA7H 4X3UA 3O4LA 4WWKB 4JB9L 5D72H 2FT6A 1LP9E 2X70A 3C2AL 3EUUA 2JWYA 3G9AB 4FNSA 4JFZL 4MFHA 3BH8A 4G72B 3VRLF 5F88B 1QFWI 5J0BA 2HRPH 4IRSB 3RU8L 3I74A 5HGDB 1N6QL 4GP5B 5EUOF 1VGEL 3OZ9L 5JQ6L 1CICC 1A47A 2V5TA 4OUOA 4XWOD 4AVHA 1ZS8A 4TVPL 1WV7T 2JH2A 4NN5C 1I3QH 1WZLA 5EC2A 4GMTH 4MAYD 1X4YA 2NWGA 4XQJA 4I8DA 3OWFA 3CFNA 5GGRB 4F2MA 3MEHA 3P20A 4L5RC 2OYMA 3EYFA 2RVLA 4QYOA 4M5TA 4A7GA 4S0SD 3MUGA 2VL6A 3QDMA 3ZHDA 1A1OA 3GS0A 3KDFA 2NUTB 2FZ3A 1HHKB 1IGML 2VZTA 4DAYA 4JGMA 2FGWH 2GEEA 1GUNA 2XY2A 5FGCE 4NQVB 4DEUA 1KULA 5K5PA 2G2NA 3FU7B 4MB5A 3MZ5A 3WE6B 5KBKA 4LESA 4JHVA 4IOIB 4A7UA 3Q5YA 4N2GA 4NQQA 1U3HA 3H3VI 1MVUA 1MCCA 3ARGB 1CD1B 3IMWA 2AQQA 1HHJB 3V0AC 4GLRH 2WCPA 2K9FB 3QIUC 2KVMA 4DPRA 3F7YB 4LLYA 4C1NK 1J8IA 4JREC 4TQ8A 4TM9A 3MREB 1V9PA 5F7NC 4X6AH 4KKBD 3VA2C 3VXQB 5B1JA 2F15A 3BUDA 3S5LB 5JIMA 1K2DA 3BFOA 3ME0B 4XMPL 1DQKA 4N0UA 3SJVB 3GTKH 2JA6G 5T3XH 3KJ6H 3DX7B 3M17A 2YLHA 2NY2C 3C09B 3RTQD 2BHZA 3CFIC 1SUHA 3EZJB 4P2RB 5GZND 2VDOH 5FYKL 4GH7B 3O8XD 5F21B 4JZNA 4L9LC 4G6JL 5AYUL 3VFGH 2BRRL 1P7BA 1SNRA 3PCOB 4TSAH 1C9SA 3O0RL 1KCWA 3DGGA 3HR5B 1CFQA 3LEVL 4ZTPL 2K5NA 1XPUA 5I75B 3F2BA 3G5VB 3MRLA 4C3IG 2WQ8A 1NTGA 1D6VH 4EN3C 1DEEB 2O6CA 4EI5B 1XH3B 4MSWA 4ZOAA 1FV1B 5DTFB 4H88L 3FTWA 1DJZA 4YHIB 3BGFB 1XIWB 4LLUB 1TZOA 1YHAA 2YSSA 3SK6A 4A04A 2HWZL 1GMIA 3VI3E 2E76C 4HCRL 3T2OA 4A63A 3L95B 2VXQA 4M4PA 1PKQE 3REVA 3WGVB 2VDQH 3SDZA 2FHFA 1L6ZA 4ZXBC 3AC0A 3CQPA 3SE9H 1BJ1H 5KYUB 5FO9A 3O45B 2CLRA 4A3IB 2Y5QA 4HJSA 4JE4B 4OF5A 1KRSA 4BUQA 3QG6A 3RGVA 2F0VA 4O4YH 3MOAH 1FZOA 1K3RA 1A8JH 3BD3A 3OMIB 2JB6B 4LVOB 2GVAA 1LM0A 1E7VA 3LSOB 1BQRA 7PAZA 5DFTA 1NC4B 3S2AA 3JVGA 4NHCL 4M6ML 4JI5L 5GRJH 4Z78A 1HKLL 1ED3A 4G9DB 1QFUL 2UZPA 4D0DA 3HUJA 5B1CA 2IQAA 5IK3B 4ZFOA 4NJ9H 3RGHA 5CN2A 3B6SA 3B34A 4KKAC 2BVPB 5BMFL 4X8XA 1REIA 4DXFA 2BS71 1PZ5A 4YCVA 3HHRB 2BIPA 4QHPA 4AJWA 1BBUA 3TESA 4MMXC 4YUEL 4YY3L 4WDIA 1CU4H 4AXWB 3OMCA 4YHHL 5TDPA 5IMMB 4MNHA 3WTYA 1WQVT 1JI1A 5I0XA 1PH7A 1KFAL 1U8HA 2YWYA 4I3SH 5D1ZI 3KWUA 4HCIA 4JQIA 3GIZH 2C9XA 2V8LA 3IMTA 4MZ9A 1BYPA 3A4FA 4JG1H 1NSNH 1PYBA 2NNXA 3GRWA 3SKNA 2DD8H 4WZ9A 4LFAQ 2C9QA 3STBC 2LLNA 4IMLA 1O7DE 4NT6A 5JW4N 1WTWA 5DLLA 5C08E 2Y36H 5DHYA 5KVEE 5IWAQ 3H0TB 4LCVA 3W3BA 1ZGLA 4F8LA 3W2DL 3U50C 4Z7QF 1M7UA 5FA4A 5TDOA 3SYQA 4FNUA 3P9WB 5HPMA 4A3KG 4AYFB 4KKRA 4ZT1A 4U6YA 1PYWD 2DMHA 5DS1A 3L3OB 1T20B 3AT0A 4C2MH 4Z5RB 3MUY1 3W1ZA 3DARA 2ZPKH 2BS8A 3HNTL 1CLZL 5AOLA 1TYEB 1KC8C 2CO7A 5T1LB 2F1MA 2OSXA 4MB1A 3KLSA 3J80c 2XKSA 4WRDA 3MDJA 5AVYB 3TJHC 4I2XA 4EQNA 3RHWK 3SYCA 4LSUH 4EZMA 1ACYH 5BV7B 4ECNA 4Z0BL 1NFDA 1ZD6A 2G4EA 5GRUH 1HYSD 3VXOA 3PHAA 1BWMA 4UDUC 4I3RL 5E1AB 1JPST 3GUTB 1QMUA 3FTZA 5IP7H 4C56B 1GYWA 3L2MA 3IFNL 3EG9B 1ZXQA 1UB6A 4CKBA 1SJHD 1BLIA 1O7ZA 2EO1A 2VQ1A 4PJGF 2Z64C 1STNA 4Q14A 1K9TA 5IW3A 3NESA 3O6FC 4RDQF 4LLDB 4PZ7A 1IV8A 3JUZA 5C7ZA 3V7AG 3ULVE 1IIKA 1M1XA 3RDJA 2CFMA 1SUJA 5GS1C 2BFVH 4U1GC 1MCOH 3UBXA 3B2UC 3TF4A 5IUCA 3GT6A 2I5YH 3Q1SL 1TFHA 3WUWG 4CVWA 2V37A 2AWOA 1OSPH 3GLAA 4TSBH 1JXKA 1KWKA 1A5FL 2OMTB 3VW3H 3UG3A 3LZRA 1NANH 2H32A 1WBYB 4ALPA 1EZLA 4AGLA 4B95C 4ZG1A 1DQJB 3IJSA 4OM0L 5I9QC 2K1MA 3U82B 2B20A 4BYHA 4NRZA 4FL4B 4HKBA 3MLYL 3R93A 1PRTB 2OMUB 4FA7B 3WJJC 4JZOA 5JTWA 3K8KA 2F19H 4IEFA 2I9TB 1E3XA 2I60L 3BT2L 1LTRD 4TNVK 1H9MA 1WTQA 4NQDA 2XRQD 1BF5A 5CGYC 4L9LA 4N9GB 1ESOA 1LLRD 4AJYV 4BEIA 3SPGA 4RGOS 2GIXA 2GJ6E 1T0MB 3C5ZB 5KVEH 2PXYB 1JGEB 1D1IA 4J8QA 1QATA 1U0LA 3C75A 1TJHH 4FF3A 1T7XA 3C9NB 4R26L 3ESMA 1DSYA 4NXKA 1KXVC 3PO2H 4IMKC 3ATAA 4EN3A 1RZQA 4MJ6B 1P84K 4LCCC 3MA2B 3GMOA 4I18C 5JIQA 4GXUM 3SO5A 3GTMH 2Q3AA 2VMCA 3CXDH 4GKNA 4JBSA 3ILQC 1HOEA 4NC1E 4YIQA 4D3CH 2W5PA 4JCLA 1HFNA 4JCVE 2B9BA 3O6MH 3GHBH 4P06A 1KTRL 4JG0H 4B0MB 3PHOA 4LCUA 3RNKB 4BXVA 4Z6AT 3BDCA 5C0EA 3DJ9A 3H3VC 3A5VA 2ZD0A 1N9PA 3REWB 4KRLB 4ZXBA 4XNYL 1U36A 3C8DA 3KEDA 3R06A 4UMSA 5HJDA 4ZFFB 4XOEA 2NNCA 1U33A 4N20A 1AXSA 4NQCB 4P5TC 5D4IA 4YMPA 2E2IH 3QRLA 3JWNE 4M9OA 2B1OA 3ZYOA 4JRLA 2XWEA 2F8OA 2HXAA 2FYYB 3D69A 4ONHA 1EMTH 5CM1A 3VFWB 1HJCA 1T0PB 3BC9A 1O6SB 1X3QA 4G80B 4N22A 5IV2B 4AL8C 1B2WL 1IAIL 4JO1L 2J71A 4QHUB 1T2QH 1KGXA 1BZ9B 2NXZD 3CC7A 2HJLB 5E6RB 1JPSL 1H15B 3IGUA 5LO7A 3GMMB 1WTVA 1I7RB 1S5IL 3BKJL 3ULVC 2CHNA 2WUCH 3K4AA 3GXNA 5DC9B 1F3JB 1LO2L 3ARWA 1JMCA 1OP3H 5GGTL 1U58B 3QJUB 4FF1A 4JO2L 2EZVA 3GJEA 3EDDA 4MMXA 1ET7A 3MRPB 3O4OC 4FQQB 3R4RA 3ZKSD 1JYXA 4HC1H 1QG7A 3O4LD 1QOHA 1QNUA 1BF2A 2OJZH 1BUVT 2PPAA 1RHPA 3QHZL 2RACA 4XN4A 4P2OC 4LPYA 5DRWA 5H2BA 1BQHG 5CLZA 3K80C 4I5BB 1N7MH 3V95A 1FAKT 3QE5A 4U2YA 4N26A 3H8NA 5CCKL 2PO4A 2Y5TB 4AZ8B 3STBA 3O3EB 1T89A 3PJSA 5E0FA 3BSZA 3LRSB 4KK9D 5B7FA 1HH9B 5B39B 1UGNA 5A2JH 2FIRT 3DUHA 3ZDZB 4K23H 2Z4TA 4B60A 2MNUA 1T6BX 2W0LA 3I4OA 1E1TA 3IDNB 4M3HA 1G6RH 3WN5A 2CDFA 1K72A 5EUKA 3TNMA 2IGTA 3HKZA 4F8MA 1EIFA 3PG2A 2JKLA 3QDMD 5BN5A 3QEQA 3VFVA 2QGDA 3NGBB 1NTDA 3TL5A 2YS4A 4QD2E 3MV9B 3PIQB 4E42B 3VFPB 1KLFB 2RCNA 3MCYA 3GGWA 1MKHA 4EEEA 3OJDB 3OX8A 4PD4J 1LE9A 5AB2A 4WU7B 3SGEH 4TRPH 1U3HD 1FVCA 2NY3C 2WXLA 2HJKA 3NSFA 4LKXA 4OIBA 5ERWA 5FV1L 4ENED 3RX7A 2K75A 3K2UH 3JWNH 1KJ2L 1I7UA 5M9OA 4KZEL 2NXYB 3WIHL 4PJEE 4WU5A 4CC1A 3I4MH 4GSUA 2EYFA 1VQEA 4Q56A 3NIFE 4OW6A 2CJSA 1TQBC 5DZAA 3BCFA 4JFDA 3QQXA 1D5RA 5IHWA 5E2UH 4APQA 2JB5H 1F3RB 1TQUA 5JW3L 1CKNA 2A1WH 4ZJ9A 1E27B 4PJ7B 4PMCA 1KDIA 3MV8E 2ZTDA 3O6FA 1KGIA 3C5JA 5D1ZC 4GKJL 3LHAA 3DJZA 2Z0SA 2F53E 2X1OA 3OWEA 4GS7C 4OLWL 4WFGE 1XCQA 5GS1A 5INCB 2L0DA 4MLIA 5AD0A 4YDIL 3JV4A 3M1OA 1RD6A 3VD0A 1FO0H 1UEYA 3MYJB 4DP8X 3GINA 3T2LA 4U3XA 1V54B 5F7YC 1TWFH 2ZKWA 2F4VQ 4N8VA 2M1KA 1C1EL 1QYGH 4QUOA 1PVOA 1T03L 3THML 5HY9A 5T5NF 3M85A 3JQOB 3OKMB 3HMXA 3W37A 3RNQB 3GTGB 2YPLA 5KS9A 3RA7H 3T71A 4IRZL 1GXEA 1WJJA 1KCKA 2A0LC 3QEHB 3WJJA 4IRJB 3KR3H 3MJ9L 1NAMA 1UOLA 2FO4B 2H2PD 4PJXB 5CZXC 4RMBA 4JUTA 1QR1A 3MQIA 4CDCC 4UY8C 1TS4A 4PV9A 1BVKA 4K94L 3I3BA 5ESAB 4DGIH 4QT5A 3URYA 2MMXA 4NHUB 3GJFK 1PQZB 4KFZC 4PS3A 1WWCA 4JZJC 1TJGH 2WAQB 2ASBA 1EUUA 4A7GF 4RG1A 2EYLA 5C0XI 2ED6A 1KXVA 2F0PA 4RWSC 2HVKB 3LKRA 4MB3A 1XX9C 3E3QC 2F52A 1FL3A 1P5UC 2FD6L 3QUZB 4IMKA 5HJGA 3UL4A 4UOZA 5E8OB 4LCCA 3RGVD 3BSGA 1FF5A 4LCIL 4I18A 1B8AA 3GKZA 4O51A 1I50B 2WV6D 5EWIH 3BLPX 3GJFH 1TITA 1XO8A 1PS3A 4FGMA 4U1LB 4FDBA 2ADFH 2J6EL 2KHAA 4JI5Q 1U8PB 4MXWH 4LVHB 4OLVH 2YXFA 1QRNB 2YLKA 4LAQH 1MZZA 1EJOH 4X5RA 4UM9B 4LCWE 2ICES 3HG4A 3CBRA 3PNRB 2PYFB 1UUNA 3QI9B 1ADQA 5ISRA 4FLSA 5D71L 4AM0A 4ZUSB 4MBRA 1A8ZA 4P5TA 5DQJA 4GRWF 5F7LB 5IFHL 4D9QE 4HUNB 1K83H 1H6UA 4N90E 4XTRC 4Z7NF 1FNGA 1RIPA 3KJ4B 3PWNB 3I9IA 3T1FA 5I1LA 3E6HB 3S37L 4YDVB 4CGTA 4KQ4L 2YYZA 3MFGA 4EQOA 4O2EA 1AD9B 3S8WA 1FVEB 3NTIA 3B1TA 5D7LB 4X80H 5IB5A 3MOBH 1XF1A 2EDHA 3BVZA 3N1QC 2J7ZA 5DJ8A 5GGVH 1W2BA 4OO1G 3L5IA 5I1KL 4AYID 2ZXDA 3EJYD 4DP2X 1OY3B 2GYSA 5F0LB 4L1TA 2C4XA 3S15B 5CJQL 1R3KA 3L9BA 3Q2WA 4C4KT 2E2HB 4GAFB 2IBZY 1N2RA 3KPPB 1BJMA 4Y4HC 1XXFC 2X2IA 2VKWA 4YXLL 4ONGH 4Q2ZA 1T4KA 5LBVA 6PAZA 4P05A 3O2DH 5SX4I 1SYBA 2FVNA 3NA9H 5DMIH 4NP4H 1Z9LA 2NSQA 1PDKA 3RMHA 4H26A 4Y5VB 1O0VA 4NUQA 5CBAA 2ZOOA 3GSOA 1DEDA 2ZNWA 1H9RA 3QWOB 4P2OA 1INDL 2ZYRA 3K80A 2VIRB 1DVTA 2XWBB 1OCWH 1KYOK 2BA0A 4G6FB 3CFBA 4Z7UE 5ADOH 1EQQA 4DP4X 3IMBA 4LMQD 1U5KA 4NQTA 2Z4QB 4XO5A 4Y1SA 4ZFZA 5T5FA 4A2GA 4CKQA 2EUZA 5M3MB 2WNGA 5DUBA 4KZDH 1J5IA 1DJGA 2QTEA 5C3XA 1MIUA 3GXUB 4O1NA 1FORL 3W38A 1TR5A 4M48H 2EDFA 1JGLL 1MFEH 3EH3B 3LB6C 4QTHA 1NJ9B 3TN2A 2EIDA 2P8LA 2ZX9A 3HUJF 2JA7B 1JWSA 4PVNA 4UYPA 1N59A 2OCJA 3HOXH 2H1PL 2VN4A 2BNRE 4K7PX 5D8JL 4X4MA 5KGUA 3VFOA 2E6QA 4BZ2A 1M6OB 1HJPA 4FADA 5JEAG 4I0PB 1QSFB 2L7JA 1MSHA 4QHMB 4DGYH 5FGBC 4GKZA 3MWYW 1BQLL 2DYPA 4JFVA 5E6ZA 1ESFA 3K71A 4L29A 1UM6L 1UEMA 1J0JA 3RFRA 3B43A 3AMKA 2D2CC 3V0WH 1RK0A 4HFWB 2UXBL 3BZFB 1U2HA 3MJ7A 4GSRA 5BZDA 3SPHA 4HPYL 2W9DH 1PX3A 1ZHBB 3NA4A 5JXAH 4MD4A 4W9CC 3MX0B 4XVJH 1ONQA 2X6MA 5D1ZA 4IFDI 3MLTB 5GSRA 5KSAB 3P40A 1AANA 1Q90A 4U6VH 1HJBC 5ID0B 4JK1C 4MHEA 1EV2E 3ZUCA 5BRZE 4M1GL 3ZHFA 2BZ7A 3R3OA 2VLLB 1KB5A 5FEBA 4NQDD 2AXFA 2EXYC 2KT6A 4DHLA 4AQOA 4YK4C 3AGWA 4WFFE 1FL6B 2NY0D 1UWGL 3T8VA 3W1GA 3QYCA 4EI0A 3WIFA 1KGCD 4UB0L 1S9VA 5AW2B 2DQFA 2XQYA 5KANI 5GQBA 4W4NA 5HDBE 32C2B 4QTIH 3UTZB 1TG8A 2R51A 4WI5A 2XC8A 2PPCA 4J3OG 4FG0A 4BFNA 3V7MA 4EN3D 1HSAA 1N0LB 3O11B 1SDAB 1J11A 3BZ4A 4P07A 3VGEA 2YQGA 1DVQA 5B3NA 2VDNL 3SD2A 4L5TA 3TTYA 4FFYH 4M8UA 4AYBB 1R24A 5F96H 1NCHA 2C4FU 1HA5A 4M4RA 3AG1B 1S78D 2DWEB 4IO9A 4PU2A 3MRRA 3QA3B 4LL9A 1DN0B 3SGJC 3SOTA 3VD3A 4HH9A 1RUKH 1UADC 4X6DB 3T4YB 2FR4B 1XR8A 3QCVL 3GTKB 4YSCA 1UWXK 4CU8A 1MDAA 3VSVA 4ZXBD 3UZQA 4C4UA 2BVQB 1ICFB 5IVZA 2VDOB 3U4KA 1KGYE 3LMJL 4OZHA 3D3VB 4HAKA 1BPLB 1ESRA 3BH4A 3FOLA 5IWLA 4IUUA 1GS7A 3OSOA 1BVZA 1CB4A 2D8KA 3D52A 3RP1A 1A4AA 4N8FA 1UWXH 1A2YB 4JL1A 1XDTT 5KYXA 5AVUB 1LTSD 5JLZA 4HK3N 2ZF9A 5EIIB 1VMPA 1OGAB 1XGRB 2BC4B 2BSRA 1UD5A 2L3BA 3N6YA 4Z7OF 1F13A 5C09E 5C2BL 2DLTA 1JK8A 5LMUQ 2EXDA 2XIBA 2K0RA 3EJUA 4KU1A 2F0TA 2YRZA 1KXLA 4G9FE 3AG2B 4KKAD 3T08A 2Z7YA 1MGSA 3VRIB 1O6TA 4KTYA 2VDQB 1UC6A 5GHWL 3UZEC 3C60C 4XBGB 1U3NA 3NMEA 5E99L 2X6VA 1MG3C 1C12A 2EYRA 4BZ1L 2CCZA 3LKNB 1XXGA 4NPYB 5F71A 4LLAA 1JN6A 5KJRH 5I1IH 1MRFH 3WKYA 5CP3H 1K4CA 1N64L 1JAEA 4KV6A 1BZ7A 1FFQA 1K8IA 1WEJL 2V17H 3BUBA 3N3EA 4UZUA 4JVZA 5J3BA 3CCMA 3DUSB 2OSLA 4PLNC 1MJEA 2A9DA 4DK0A 2X6CA 4PJFA 7CGTA 3E1F1 2DIAA 4N8CH 5FGCB 3MLZH 3TN0A 4EKJA 2R1YB 4UTBL 3WHE1 5HD8D 1S7TA 4QNPE 2FIKB 4WI3A 3STBD 3RN5A 1Q12A 1MIEH 3ERSX 3QFJA 4LEOB 1X5GA 5SWQB 3PSIA 2H6OA 1M8AA 3NDYE 4M93C 4QRSB 4Y4HA 3ILEA 5DD0H 4YVNA 2E7BA 2AJZA 1LP9F 4FS0A 1AHKA 2Z91B 1ZCRA 1NBCA 2BSSB 3JUYA 2IFFL 4JO5A 4L1SA 4PCKA 1TZHB 2AF2A 3QEQD 1OTUC 1JF1A 1UOVA 2X4UB 4JFPA 4K3DH 2DV6A 3ZE2F 4QY8A 3ZYYX 5FUOH 2W81C 3T0WA 1CT1D 3EIFA 1ZEAH 4JAMA 2NY1B 4OELB 4MCNA 1FR3A 2A9NL 3TJHD 3P11H 5IMOA 2P8PB 2GK0A 5CGBA 4YXHH 3SN6N 4FRWA 5JZ7C 1T5EA 4JJ5B 4V0BA 3ZUNC 1ETZB 3PDOB 3NEMA 4FQ2L 3V6ZA 2CKBL 3ZE1F 4JUSA 1JWUB 4CGYB 1KENH 1A0QL 5C0IB 3EO9H 2MPVA 3L7EA 3T2NH 3DV6A 4GRLD 2CH4W 4JFDD 2XWTB 2EIEA 4WI0B 2GKIA 4APQD 4JO4H 4AJVA 3L0OA 2A73B 2DLEA 1NE3A 5F6IB 3O6FD 4JW0A 1PF3A 4BM7A 3VI3B 2A74C 1J8HB 4C2MB 1RVFL 3GZKA 3JV5A 3WFBH 4XZUA 5MERA 1BVNT 2YBRB 2YPVL 4KROB 5FGBA 1SMYC 2EQSA 3UDGA 4EI5C 1G43A 1PKQB 3U7AA 4YDKH 4FQIH 5GZOA 2PPBC 4MD0B 5I19L 3B9EA 4WNSA 3BLBA 4KTEL 5DI8B 4E9XA 4XMVA 2EQDA 4O2CB 3ARUA 4AE0A 5C6PB 5ITFB 3ZDYE 1COBA 4KKLD 4HLEA 2J1XA 2EYPA 4G6KL 3ISWA 3PRZA 4N3TA 5LHDA 2YPLD 3B2MA 4AEFA 2IANE 1P4IL 1ZDQA 5J7CC 1GHFH 1H9VA 4APVA 3ARPA 4XB8A 1XSKA 3T6VA 5C0JA 3H2WA 1Q0XH 4E9SA 1BD2A 3FB8B 1YDPB 5E51A 4Z3HA 2NVTH 1GOGA 4DP7X 4AQ8C 5CGYD 5CMAB 3QDGE 3TIEA 1JF6A 1GZQA 2B1AH 3VG9C 2J73A 2Z0UA 2WYIA 1M9SA 4NZFA 2BOSA 4W9GC 1CXKA 5EO1B 3VXPB 4PRBB 3MJ8B 2EEDA 2R29H 4HK0B 4YOKA 2VXVL 5EUOE 4F15C 1I9JL 1CL7L 5ANHA 2OMXB 5AW0B 2IADA 4E41A 2Y1VA 2YA2A 1H9SB 3T1YL 3VMOA 1I75A 1RIHL 3AM8C 1KCUL 4K7PH 4OZ4B 5HGBA 1BX2A 1NMBL 1RZJH 1AR1B 2OMYA 3ILQD 4BS9A 1MFCL 1OXTA 4ME3A 3SGJA 4EVNA 4MZ3A 2UV3A 2Q10A 2JCCE 2JI1A 2OXHA 5AW6B 2CQAA 1XTLA 1RHHB 2WLJA 3P4LA 4FLQA 3ARVA 2WGXA 3RWFB 3VNYA 2WQAA 3N2JA 3UJTH 4DPGA 3DUZA 1YRKA 4JFEE 2YGOA 1N34L 5DD1H 1AQDA 4PGBB 3IF1B 3QO2A 3E6FA 3LOWA 4ZS6C 2FATL 2OFQA 3S2DH 1KEGH 5AW9B 1Z9NA 5C08B 1DOKA 4J8RB 5FA3A 3PGCA 2EYHA 3RZOH 1IARB 1XWVA 2DQJH 3RWIB 5FF6B 4ZKCB 4PGZA 3RHWF 1TZIA 2J1ZA 3N42B 5CZKA 3NJFA 5CEZE 2AJ3B 1OAUL 3PO2B 2DQEH 2Q2HA 4NSKB 4A3CH 4ULLA 2RB8A 3MVSA 3WU1A 5CP7A 3AROA 2MOGA 2JIXA 1KG0A 3IDJB 1SHXA 3WKPA 4FYQA 2AJYL 3GTMB 4MRBA 2EH8L 1OB1A 2D7TL 2F7RA 5DC0A 1JCKA 4MJ5B 3WI9A 4F9LC 4FF2A 5CINH 1NIDA 3ZTNL 4LWCA 4Y2NA 1Q9KA 3P9LB 3QJVB 3UMNA 3H3PL 1UWEL 1KXQA 1XH1A 2EADA 1XZ0B 1M53A 3BEVA 3DTXB 4M6OH 3UZEA 4F8TA 5KS9F 3C60A 3RWEA 5DEFA 2KLTA 4IRSA 5C0AB 5ITBH 5HGDA 2L7UA 5TQ0L 2H26B 1RJYB 4FERA 1YEGL 2B9AA 3T04D 4RSVA 4O02L 2E2IB 1KCRL 3EFFA 1T7WA 1MUJB 5IJVB 1S5DD 4OKVB 1S9KC 2EINB 1VS0A 5BRQA 1Y18B 4BA1I 5FO8B 1YUKB 2R83A 4P2OD 1EHNA 5HTSA 1UCTA 4Z7WE 3HZVB 3CVBA 3HIZA 3LZFH 4KVNH 2XICA 3SCMB 2B1HL 3SO3C 4KD4A 2HZHA 5KWYC 4DF7A 2CIIA 1FGNL 3S36H 3S5YA 2VDRL 1C5BL 3ULPA 3MLUL 2H5XA 2KMWA 4WY7H 5GQOA 4Y16C 1F4WH 1A63A 4AQEA 4DN3H 1QLEL 1LK3H 2XVBA 1SPDA 4KXAA 1S7WB 4JHWH 1AAJA 1QD0A 4IOIA 4LL4A 4Q6YA 5ALBL 4ZO9A 1BEYL 3OC8A 4OJEH 4DP9X 1XMEB 3ARGA 1VB9A 2HYMA 2P5EE 4WJ5B 1I1FA 2H8PB 1HHJA 4XVOA 2FB4L 3LV3B 4QF1B 4JFQA 4BH8B 1JWSD 1VQAA 3B2VL 2AK1H 3FH7A 1CDUA 1QFHA 4AH6A 3NP8A 2FK9A 1MCDA 1QJOA 1N33L 5DS8A 1VQGA 3SQOL 3MC0B 4R7LA 3MREA 4HAGA 4R97B 1KLGB 5IJBC 2OTUB 1MNUH 2LOEA 3CC1A 4JVWA 3ND9A 3ULUD 3A6OA 2GJ6B 4NYLB 4YEEA 1OXXK 1AG6A 3ME0A 4L1BA 3S48A 1OXYA 2DYPD 3LIZL 5T33L 2C3XA 3QXWA 1CT8B 4N2DA 5KYIA 4M7LT 4DR5L 1N6VA 2J3SA 1EO8L 2VAAB 3CHQA 3GBEA 2UXBQ 3HBPA 1MPAH 1PZUB 4P2RA 4G1EB 5EZLB 1S7SA 2XPYA 1DJHA 2VDLH 2BJML 2PO6B 3ARBB 1G6RB 4DWHA 5I5MA 5MEOB 1QTYT 3AITA 1GUTA 1S5BD 1KZQA 4HIIA 3ULVF 5D1ZD 5FYJH 1D5MB 4PVBA 3AGVA 1IL1A 1QLRA 2KZ1B 4NOBA 1ASZA 5FW7A 2A74A 2NZ9C 3Q8AA 4ORZC 2JJQA 3G5VA 3A56A 1DEEA 4L3EE 4EI5A 3CFJB 4X99A 4OD3H 3FTUA 4Z7VE 1LLAA 3B5HA 2M26A 3CN3A 4G9FA 3TT1H 1I9RH 4QO1A 4IKLA 3B7RL 4LLUA 4QJ4B 1T9HA 2VO8A 3I75A 5FO2A 4RFNB 3KWWB 3SDYL 3KPOB 3EN2A 4PYHA 3PIPA 3L95A 5E4OA 2G75A 4OY9A 1KV3A 5LG6A 5BUAA 3F84A 1EGJH 1OAYH 4PD4K 4MIUA 2A0LD 3FSOA 5EB9A 1DBJL 3NCWA 2NY4C 2BVOB 4BFGA 1A1NB 4GO8A 4EGVA 5CZXD 3H7LA 1CLYH 1A7BA 5T1KB 2UUAQ 4LDCA 3TEWA 4AQ8A 2LSSA 3PABB 3QQ4A 4MWFA 3ZN6A 3D39E 4NUJB 4OZGE 1FBIH 5MHSE 5ALCL 1AYRA 1YY9C 5D93B 1KTBA 1P9MC 5E8PB 4LSRH 1DBBL 4X4XB 1TTBA 1GGIL 2ZJSL 4JKNA 1YVCA 4Q52A 2HT2C 3BAXA 5PAZA 2I25N 1FO0B 5M94B 4KJYB 1IGYB 4FMVA 2PYEA 4LSTH 1EU4A 2QR0B 1TWFB 4B9WA 3LH2H 2O30A 4UTAA 1V27A 3F01A 3HB3B 5IK3A 1UZGA 3NHHA 3OR6B 3D6CA 4TLTA 3RVWC 2XQ0A 4OCRL 1SEBB 2WZ0A 1J8SA 4FF9A 4PBVC 5F6HJ 2FEDC 4AWJC 5BQ7B 4WTWA 4YHOL 3MNWB 1MW0A 5C9JA 4POGA 3J7A5 1ACCA 3IFLH 4XBEH 4PGJA 4WK0B 3US0A 3PV7A 2R56H 3GSVB 5ICZB 3PV6A 2HJFB 4HUUB 3DPBB 1EY4A 1T7YA 4BBRG 5AUMB 4GKLA 2ED7A 5IW1B 4KVCL 3N04A 2O1AA 4AXWA 4LSDA 1ZWIB 5IMMA 1GUWA 4OI9A 1TTRA 4XTRD 4X2UA 4PJAA 3OKNB 1DLHB 3DKHA 2GSMB 1MF2H 4Y8DC 2IJ0C 3CAFA 2RBLA 4PJIA 4PJDE 1AC6A 4G7VH 4QHLB 2DQCH 1RD9D 2WXHA 1NCDL 1JV2B 2FEEL 2JA8H 3SDDB 4S10A 3T3MF 3H9SE 2BNQE 1FIEA 3RY5A 2FX9H 2Y06H 3LX0A 3H0TA 3ERQA 4JJOA 3UAEA 1HL4A 4X7SL 3E5SA 3GJFB 5IHLB 2WB1E 3D6GA 1A3LH 4QB4A 4X7EC 5E8NA 4DJMA 3TN0D 1ZKOA 4F9LA 4K8RC 4AYFA 4GLRI 2JJWA 1Q9LA 3QFJD 1T20A 3AFPA 4JBWA 4QRUB 4Y4HD 4H8WC 2Z9HA 5CEXA 2HFEA 1TT6A 5HVGB 1FCCA 3GRGA 2CHWA 3RGBA 4EAEA 4PJEB 5DUPH 3ZZSA 5H4YA 4CJ0A 1K83B 1WOCA 2A8VA 4LPVA 1BIIB 5FM5O 2UWEE 3TONA 5C70A 4BDVA 1NCWL 1QHQA 1WISA 4Y2LA 2N0KA 3ML8A 2WUBH 5AL8A 3WKML 4CJ1A 3Q1EA 5JPMB 1BM3H 2YD7A 3CAMA 1DVFC 2AV1A 3LVEA 4K3JL 4LQ1A 5EBCA 3EG9A 4A66A 4Z95H 3A67H 5IFJB 2ZX7A 3NBHA 1NAKL 3QJQB 4PTTA 3J8F7 4N68A 1I53A 1HXYB 4Y16A 4F7PA 4TLSA 2F0LA 3RPIB 3EBHA 1FDLH 1RULL 3NN8B 4OWXB 2XN1A 4LLDA 1DDTA 5JR1H 1I9IH 1SLJA 3RVUC 1URLA 4R9WA 4JYAL 1IGFH 2HT3C 4JV5L 1FVDB 4JRWA 4WI8A 1SLXA 2WZAA 5I8EB 5CUSH 3E8UL 4JX0A 3R8BB 2O61A 1T1XA 5CV9A 1BLNB 2XZAH 5EPMB 2UXFA 3KMDA 5F1NA 3VU2A 5F2DA 3S3SA 1AGFB 4LAJH 2OMTA 3RG1C 3H4FA 3M45A 1WBYA 4PB0L 2IWGA 3MMEB 1DQJA 1EDHA 1X5KA 3TJPA 4HWBL 2IDCA 1PLFA 1PG7X 1P4UA 4F1ZA 4AIOA 2OMUA 3JAMi 5GZOD 4Y9BA 3HW7A 3NIFF 4Q9CA 2N59A 4FQLL 5T3ZE 4CBVA 3V4VH 1MHPH 4HIOA 4W93A 4FP8H 4PV8B 5A40E 5JHDD 3QZWG 2AXHA 4O5LL 3RWDA 5JW5B 2AJSL 2WWKO 2XOTA 3F5WA 4IJ3C 4PJFF 3T8MA 1T0MA 2H4EA 1JGEA 4BKLB 1YEJL 4JQVC 1AACA 4RBPK 4IBLT 2LXKA 4DV4L 2CRMA 3I6SA 4MAUH 1O9VA 3GK8H 4RVBA 2F74B 1BD2D 3BZKA 2R7DA 2EXYD 2QELA 5KYYB 3HKFA 3HOXB 1LGVA 2XJKA 3HJEA 5CV8A 4OTXL 1NCNA 2SEBB 4LCWB 4P46C 3Q5TA 3HE7B 2OS7A 5D70L 4RBPH 1EQTA 4P23B 2VDPH 3JC66 1BG9A 1B44D 2G9KA 2JQZA 3WO4C 1YNXA 1BA9A 1NC2B 3MTSA 2F8IA 4B7LA 4OZFG 4E41D 3T1YQ 1U21A 4PZ6A 1LT4D 4KQ3H 4WFN3 4WI6A 4QOKA 2IF7A 3LKOA 3QAZB 4N2KA 2P46B 3PIOA 4DW2L 5B3SB 3QI9C 4A3MH 1HAUA 3D0LB 5FUZH 4EUPH 4HMEA 3TT3L 3HZYA 5EBMB 1IBML 1Z3GH 3CCHB 3PIP3 4W9IC 2BP8A 4LKCB 5GJTL 1KTLB 3PDDA 2ZYSA 1N34Q 5T1JA 1IKMA 2PMZA 4L5FL 2FO8A 1O6SA 3N1PC 4L1LA 5BN3A 3CFQA 3D9AL 1F6AB 4N2OA 2ALAA 1Q0YH 5I6NA 2CA3A 4B50A 2VXWA 3J80L 1IILE 1FCGA 2PR9A 3SEPA 1HNWL 1SDFA 2YSTA 1UNSA 5LGYA 1YEFH 4N0YH 1EUJA 1H15A 3GXMA 2X89A 4GMSL 3GMMA 2E75C 2YRLA 3IJ7A 4R90H 4Y0GA 4P48A 4ILDA 2ALWA 1ORSB 3AAZB 5I26A 2YQ3A 3L2PA 4OQTA 4QUFA 4PCTA 2CQVA 1U3JA 1P4BH 4QXVA 4FFZL 4QRQB 4UZGA 2L4OA 1JRHL 1KPUA 1G9NC 4UOQA 3TMEA 4ZUUA 1A6TA 2JIXD 1XCXA 4JKMA 4E6IA 3RBSA 5JA8B 2SOBA 3NJLA 1M7DB 2ZG1A 1MJJB 1Y0LB 3MRPA 1D2OA 2G3XA 3I8ZA 1IBDA 3FL7A 5DQ9B 4Z7UB 1R47A 3OQRA 5ESAA 3CFTA 2YTVA 1PLGL 1WFTA 1CG9B 1JWMB 1EXGA 1IAIM 5T3ZH 4L8DB 4HS3B 1DBAH 4GKOA 2IJ0A 1JDDA 1GSKA 3C60D 3CMOL 3T8XA 2WHVA 4IRSD 4KRPC 4CDHA 1LO5B 3LZOA 3N9GL 2YV5A 4KHTH 1BHGA 1A3UA 2YBGA 2C9PA 2X4QB 2ZWSA 3T9WA 1EAQA 5FW8A 3VA6A 1IQWH 3LS5L 1XEDA 2RFXA 1LK2B 2D03L 2YK1L 2O5IC 2BNRB 3WNMA 2PABA 5K9QG 5DJDB 3OKKA 4GIPD 2AK4E 5IYCH 2KERA 1Y1WH 3D0AA 2WACA 3GMQA 4L4VE 5LL6X 1L9OA 3EVQA 3QWNA 3SODB 2DY8A 1MOEA 1NIAA 5F1OB 4ZMXA 1RK1A 1OO2A 2VR5A 1CFVL 3PIQA 4LIQL 4ZAKB 4M7ZB 3T5WA 3CCEA 5IT9L 3OJDA 1E2WA 1PTOH 3KLAA 1GUOA 4RA0C 4YHKL 2A6JB 1ZLVK 3IT8D 3ARGD 4JOIC 4OBRA 2F54E 4LGSB 2BS9A 1YNLL 1E1OA 1EJFA 1KCVH 5CNHA 3K58A 3GTPH 4YX2L 4UU9A 2FJFB 5BRZB 3LPPA 5JQIB 1N33Q 2ATPA 3FQTB 5FW6A 4CSSA 4FEMA 3CDGB 3U1PA 3US9A 3RX8A 3V4VA 2KJXA 2XZZA 1G1KA 2AEOA 2NVQH 1SM3L 2K1BA 2HN7B 4HMCA 3EQLC 1ZLVH 1E27A 4PJ7A 5J1SC 4OLYH 4LK4A 4DR5Q 3CV5A 3D4YA 1U2CA 3WD5H 1AP2B 3HBZA 5INCA 4OIJA 4LLQB 2A6DB 3RL2B 5CFHA 2W60B 2Y9RT 5IW6A 4P2RD 2NY5C 1WBZB 3TH2T 3APFA 2NDGA 2O5JC 3NIGB 3UCRA 4P3CH 5L9DL 2VB2X 4ABUA 3BMWA 4DV1L 4WUKL 5DSCB 2QADB 4OCWL 5M3FG 1ANUA 4MJIB 1GC1H 1YAIA 3NBNA 1F90H 1K4DB 2HHHL 4O00A 3RNQA 1T2JA 1SMYD 4RKBA 2DI7A 4XNMA 4AKPA 4EI5D 4F9PC 3F58L 1IC4H 3PQYE 3OMZA 4UIMB 1QWYA 1KLUA 1XIWD 5DVOA 1XMOQ 1HH6B 3LQMA 3R1GL 1KIRB 4QL5A 3QO0A 3ABKB 3IDXL 4OI8A 4L8CB 3FUJA 3SK5A 4IUPA 4NHUA 5CMDA 1AOHA 1PQZA 2RJMA 2J4XA 1MY5A 1TF4A 2ADJA 3OZKA 2JA5G 4JN1H 3FHQA 4A3DG 1CLOL 4M5ZL 5HYJD 4DXGA 1I31A 4QXUL 5C0GB 1WBXA 1UXSA 3QQ9C 4IKNA 5DZNA 3B56A 3QUZA 3CN2A 4FXTA 5C09B 5F9OH 2YAHA 3DROB 5E8OA 2WKOF 1DZ1A 3QZOA 4KY1L 4P46A 5KVDL 2CUMA 2FMCA 5HDBF 1VEOA 4BHUI 2DQTL 2F7OA 2P5WA 4JPIB 4P9HH 4W9EC 3W9DA 4I1NB 5IVNA 1O78A 4UCFA 1IEAB 2XETA 4G8AC 4RMWA 2N1KA 4EDXB 4QPEA 2EYOA 1KIUB 4RZCA 2V0AA 3MXVL 2PYED 2CGRL 3AXIA 3V4UL 4UM9A 2GUOB 1NKOA 3MNZA 4G3YL 4MA3A 1NGQL 3EFDL 3L48A 2YARA 4GQQA 3TO2A 3QI9A 4WO4C 4M6NH 4P74A 1V3KA 3IAPA 5I8KL 4ZUSA 1CQYA 1PG7H 2BP0B 2PW1A 3EGXA 3QXDB 5DDHB 3PWNA 5AB1A 3JWOC 2VDKH 3CXFA 3QDJB 4U49A 1SOKA 2HLFC 4KHZA 5LGKA 2F58L 2YMOA 3GMRB 4B9YA 4E5XA 5K9KA 3MGOB 3MAQA 1AD9A 1IM3A 1FIGH 1FVEA 3TPUA 4ZS6D 1U8IB 4AENA 1B9NA 4DPBX 2NVTB 5K59F 3PIO3 2MP1A 5GGQH 5LN4A 4YE0A 1DXMA 3NTCL 1X5JA 4TULL 5IHUL 5I2IB 1MCFA 4GEJA 3IU4H 3QR8A 4OFQA 4XVSH 4ZUTB 4F5CE 1UEBA 3UTPD 1IGCH 5CSZB 1HHIA 4CSZA 2J88L 1F2QA 2EZ0D 4XX1G 3TIDB 4G8EB 2OF1A 4EOWH 1UOWA 1J0KA 3NACH 1P5VA 4A3EH 3V9CA 2H0EA 3BP6A 1FNVA 3IFPA 2EC9T 5EU7E 3KPPA 4DV0L 2N3JA 2X6BA 5AZEL 2CUAA 3SGEI 3E0JA 4MX7B 3G4SA 4GAAA 1GGYA 2OQJB 2Y2WA 1SVCP 2EDMA 3MYZA 3JWDL 3CFUA 2PW2B 4Y5VA 6FABL 1EXHA 1FNLA 2BCKA 2CDGB 2EDKA 2FBRA 4L4TB 4UT7H 1GUGA 4GNXB 2UZIH 2D4FA 2K70A 2VIRA 3S2DB 3B7SA 2ETWA 2XWJA 1XF3A 2AXWA 3VR4A 1ZVNA 2DPKA 2UXDL 4IS6B 2RHEA 3BZEA 3RZOB 4PGEA 1ZHLB 2CR0A 3EUDA 1NPNA 1STHA 4BRJA 2HMIC 1PDQA 4XNBA 2PUQT 2D9UA 1CS6A 1WFNA 2VL4A 3DWAA 4PY8J 4QYAA 3N1MC 5D7IA 5IMKA 5C0FA 3VXUE 5KVGE 2K8QA 5IQLA 3D5OF 4FHBD 4GXVH 2HLAA 2YGVA 3GNMH 1SN8A 4MYPA 1EXUB 3R8QA 3NRQA 4Y16D 2VM4A 2FECL 5D2LE 4K9EH 3WEOA 1NCAL 1LO3L 4GW5A 4JYAQ 3ZDYB 1SNCA 1YJWA 4JV5Q 3RVVD 5JOPD 2YZ8A 3CLEL 2R0ZL 2X7LB 1QSFA 4HZLB 3VG0L 4QHMA 4BIKA 5KIXA 4ZLTF 1A22B 1NBVH 3WLWC 2OK0L 1QILA 3J27A 1Y8OB 4N8PA 2IANB 3GRWL 3OLGA 5HDWA 4KTGA 4YQXL 4GN4B 2ATAA 5FLXL 3FW6A 3LX9A 4IDJH 1B4JL 2YMXL 3JT0A 2FJSA 4AJ0A 3KL5A 2X6LA 3CFDB 2YD5A 4PJAF 1QVCA 2K52A 3MACL 3QDGB 4PJIF 3BPLC 3RYMA 1Q46A 1WPCA 5DD6B 3QXAB 1PRTD 3STZB 2E6PA 1ZSDB 3SPVB 5KSAA 1EYGA 3IRPX 3M07A 4PUBL 4EPSA 5I6MA 3CUPA 1AHWB 4NPKA 5EUOB 3ULAB 2XG4B 1MLCB 3GI9H 4APXB 5D72L 2COQA 2K5QA 4YVUA 1PIGA 3CPWA 4J15A 3NCYP 1FL6A 2YEZB 3U2SA 2HRPL 4A3BH 1HNYA 1YMME 4CDGC 2NLJB 1KY7A 1L0YB 2XJLA 2JYOA 3T16A 4BSVB 4X4YA 1NUGA 32C2A 3UTZA 3ZSTA 3BKYL 3KYOA 2OTLA 4DV4Q 4KK5D 4RISH 2UYLB 2NZ9D 1WG3A 3RPKA 1H3GA 1T22A 2MKLC 1VZIA 3P3YA 4NUGH 4OSUH 4ZK8A 1G1YA 4MQXD 1N0LA 1N9WA 1TOXA 4JFEB 3RWJB 3CLWA 4F9PA 2XN2A 4PLJC 1DJYA 1SBBA 1Y1VH 1IEBB 1UAPA 3GTLH 1JNLH 2ARWA 2DWEA 5FKAB 1BCPB 4KZ0A 2PKDA 3FCTA 1K9MC 5ANME 3T4YA 5A1AA 4CL7A 1LTBD 3ARYA 4QOKD 5E94B 2CH4A 2F0KA 2NY4D 4QRAA 3ER0A 1U91A 5DZ9A 4PZ8A 2VDLB 4AVJA 3VI4E 3D3VA 3B7TA 1HZKA 5B38G 2OT2A 4U1JB 2K05A 3MBEC 1IBMQ 5KVGH 3R7RA 3QIBB 3LKPA 2YC1B 4FHJA 1B7YB 4TNGA 4XAKE 1YY9D 4ABWA 1KYUA 2LU3A 3N44F 4N2EA 1JL8A 4YWGH 4R8IA 2A83B 4HCFA 3BT0A 4IBYA 3RWCB 3GEFA 4JFYA 3VWKC 3WHXB 1OGAA 1S3RA 2BC4A 1ZLWK 3EOTH 2A6KB 2J5LB 4NKDA 1O7VA 4Q0XH 3F2UA 1HNWQ 3GTVA 5F7EH 4R8WH 3RUZA 4Q97A 4Z76A 1PNDA 3L81A 3UTPE 4DZ8B 2GIMA 2FEDD 3QSKB 5GS0H 5HYSB 2JCCF 3DHPA 3IK2A 5T3XL 3KJ6L 3K0YA 1SQ2N 1PD6A 5DF0A 5A43C 2OW7A 1ZLWH 4LHQB 3L3JA 3KLLA 5E9DB 2VDOL 4XBGA 4XAWH 2FL5B 2Z65C 4Z7WB 3NFPB 3VFGL 4RHSA 3BPCB 3GTNA 3LKNA 2DIBA 2WWOA 3K4ZA 3MA9H 4R83A 3IWVA 1K28A 4TSAL 4PPTA 4ZO6A 1HTYA 3X1FA 2ZIDA 5CV5A 3LKQA 1B4RA 3QP3A 1PBYA 1XGPB 1YJDC 1D6VL 3RURA 1F9RA 4WW1B 4NUPA 3V2AR 3K2IA 2R1YA 4JFHD 3GIVB 1RL1A 1MH5A 1CGWA 1XAKA 3DJTA 3FU3A 4QAWA 2EDQA 5E7FA 2OTJA 3WTWA 2XQBH 4JM2B 5GXBB 2X40A 2N4IA 5DXWA 4XX5A 2AJXH 2OCFD 1XGUB 5F72S 3BYTB 1LYQA 2Z91A 2VDQL 2VW9A 5JDJA 1CIDA 2LR4A 4WW2B 4XZ4A 4G11A 3FTGA 3U9WA 3UTSB 2F5AH 4NQSB 3SE9L 5J1TC 3LCYA 1G6PA 5AB0A 2D0GA 2C7UB 2X4UA 4JPKH 2A2QT 4Y2DC 3TYFB 3KPMB 1A25A 3QDAA 3GSWB 3TREA 4QGYA 4UQ3A 4YBHA 4YC2B 2MH4A 3UG5A 1HXMB 3MOAL 3ESVF 1O5PA 2FBOJ 3O3UN 5JDSB 1GGCH 2RQ8A 5LGHH 2YKKA 4FA8A 1BZDA 3BQVA 1CYWA 3VYTA 4JJ5A 4HT1H 1PH8A 2JA8B 2NX5A 3MR9A 1BOYA 5ENWB 1AH9A 2WN2A 12E8H 1X6LA 2G0KA 3CQFA 4NJ9L 5IFHH 1Q3LA 2WVVA 2R1WB 4CHTB 5G3LD 1GCFA 4P5MA 1HI6B 4L3EB 1H8OA 4ZD3H 2L04A 4HJGA 4I9XA 1PXUA 2VZAA 1PPIA 4HZAA 3RUGE 1D5MC 4DV6L 3LN5B 3RVUD 3OKEB 4N1CA 4LF7L 2F0FA 1CR9H 2HT3D 2IBBA 1J8HA 3BVTA 3K74B 3RPBA 4N0FB 4NIKB 1E67A 2YBRA 1X44A 2FQEA 1FNEB 4WGVB 4I3SL 3NP3A 1TWAB 2KL6A 1S7QA 3GIZL 1MCJA 2P3YA 1SMOA 3BSZL 5KSBB 5FYKU 1HWWA 4JG1L 1NSNL 3K46A 2DD8L 5J22A 2HHHQ 4Q89A 1DBKH 2Y36L 3D39B 4OZGB 1DANU 1FYTA 3FTXA 4M56A 1ZA6A 4ZS7L 4ATWA 3PXHA 5D1QC 2EDBA 3MU3A 3T0DA 3M4OH 2LABA 2WM0A 4P2CG 1KLUD 4C3IH 3UE1A 2XV0A 4HKJB 5TE6H 1JXJA 4DU9A 3LWUA 1G1OA 3QFGA 4HXAH 1WAPA 3T6XA 4PR5B 1EZVX 3KJPA 5DEGB 3TBVA 3CFEA 1QNZL 2CNZA 2VISB 4RIRA 5GISH 1XCWA 2ZPKL 4R7VA 4HK0A 3MV7E 4X6CE 2CLVB 2OLDA 3ZL1A 4IUVA 5I8CB 3V0GA 2CBOA 3Q22A 5J1ZA 3QUZD 1D9KB 4LSUL 4Z7VF 1H9SA 3DX4A 4P46D 3T65A 2OYPA 4IW4C 1CDGA 4U05A 4N3UA 2EUXA 2AXJA 4HOXA 5HYIA 2P5WD 1HILB 1QABA 4C83A 4DUXA 1JERA 4LGRB 2BDOA 1CGUA 3RU8H 1N6QH 3ATEA 4G7QB 4P2QA 3RWFA 3SQBB 2Y3AA 1E5BA 4HLJA 4FNLH 2VLRE 2IALB 3MRNA 4UM9D 3D2UA 5CEYB 3V4VB 4JI8Q 4L0PB 3IF1A 3VM7A 1TSHA 2BOCB 3QI9D 5KSVB 2K7VA 1FFOA 2NQCA 5G3LF 2BNQB 1C8CA 4JDZA 3ZRFC 4J8RA 3HOVG 2ZKHL 1QHOA 2BFVL 1MCOL 3FU6A 3MBEA 3HI1B 3OB0K 5I82A 3UBFA 1QW8A 2I5YL 1TIID 3FULA 1AKJB 3SE4C 5ICYA 4OLUH 2W59A 4V1DA 3ZTDC 3QHFH 2AJ3A 4Z3EA 1IM3D 1OKEA 3IDUA 1L9RA 2JEBI 1OSPL 1S2EA 4KX7A 4TSBL 3KOJA 1RUMH 5E8EB 2Q6WB 4UDTB 3VWKA 3EW3B 3VW3L 4ICXA 5KEEA 2YU9H 2ZOTA 4KY7A 4J6RH 3BAKA 4CBPA 4PTUB 3V0VB 3OB0H 5D2LA 3KCPB 2MKWA 3P73B 5E00A 1SMDA 5BJTB 1A7QH 2ARJB 2VDPB 4MJ5A 3I85A 5IQNA 4S1QH 1E6JH 1ICTA 3N5AA 3T2PA 4FNPA 2B08A 5C7XL 2UWEB 2F19L 3CU1A 5CWSB 5IOPB 5KAQG 2M83A 5L88H 3S9DB 1DDHB 1TS5A 5I15H 3BOVA 4Z8FH 1Y8NB 5C0AA 1FNAA 1HQRB 3I4NG 3OIQA 3TZUA 3SDCB 5J6HB 4A3MB 3K2MC 4ODTH 3CLFH 5KVEL 4KI0A 4LAAA 3CXCA 1DP0A 1NCUA 4X9BA 4EUPB 3VXME 5F8QC 3U9UA 1MUJA 3WNJA 3LZLA 5IJVA 1BZOA 5LBSH 1CFTB 5JHLH 4PJDF 2VQ4A 2ZXEB 2WK2A 2DTMH 4DO6A 4ERSH 1ZOXA 3FO0H 3AZUA 3QUKB 3U0TB 4FA6A 3K6SB 4M3KB 3L4CA 4K3EH 1AIZA 3J81i 3MRJA 4QMEA 1D3CA 5JW4Q 4B3EA 2PWGA 3A5UA 5FS5A 1TPXC 5GROA 1A4BA 1X9RA 3TFBA 3CXDL 3D85B 3TF7C 1IFRA 2R9HD 4ALAH 1T1ZB 1A4CA 2BRRH 4A3FG 3HKZG 2BSBA 3RRQA 4JG0L 1J0IA 5JOBA 3O0RH 3T0XA 3I7FA 3LEVH 2AJVH 3L2LA 3DV4A 3E9IA 2EXWD 3ATFA 1E5YA 1VGKB 3SVMA 2Q7NA 2QSCH 3BZDA 3O9WB 4RA3A 5F0JB 3ZR5A 3CPUA 4BHUA 2W38A 1NMGA 2ZP9A 4EI6A 1UEAB 3FT4A 1JNNH 4W6YB 5TE4L 3VDCA 5H1SE 4FD0A 1TZ8A 1FJ1B 2H8PA 4WJ5A 4Y2DA 3LV3A 4BH8A 4HSPA 1MDTA 1HR0W 4KLKA 4AL8L 3H54A 1T80A 1Y6KR 3GTOH 1I8KA 4HCRH 1NGWA 1R5WB 4RWYH 1EMTL 2UZYA 1B2YA 2FMMA 3PL6B 4GKSA 2NT1A 5JAVA 1KLGA 2AQSA 3I50H 4RGMB 1KCSH 1AS7A 3PPEA 3V4LA 1EAPA 1QSFD 3ULVL 2HG5B 4NYLA 4YHNB 1T2QL 1HXKA 4Z3IA 1MFDH 15C8H 4LF5L 1AXTL 2P24B 2VAAA 4MKMA 1IL8A 2VM3A 3L7FA 2WUCL 2KI6A 3CH8A 5AW1B 2XA3A 5EZLA 2GTWA 2ATKB 2PO6A 1C0AA 3PV0A 1Q94B 2DWDA 1STYA 4JCMA 3VYPA 2WVUA 5EGTA 1AZQA 1D5MA 3FQUB 4RMFA 5KSAD 1Y1WB 3K5SA 2PW7A 2PNDA 1X7SA 1RCYA 1RZPA 4NB7A 4AIXA 1A3RL 4HC1L 2AERT 2RR3A 3ULSA 2OJZL 4Q6IC 1E8WA 2J8UA 2W65B 2Z8VC 3BLKA 5D1XC 3CVDA 4NMZA 2MNWA 1PTOB 2NY6C 3D18B 5BVPH 1NGXB 4YSDA 2B8FA 4UILH 5FAAA 1N7ML 2IPTH 3LQZB 3OC5A 1AO7E 3KPRB 3KWWA 1NINA 4K5WA 1AGCA 1JUFB 4U1KB 4P4KC 2WINB 1IFGA 4K23L 4P2YA 3IDYB 5D1QA 1H8NA 3NZSA 2MFIA 5FLMG 1T1WB 2OW6A 1G6RL 4LFHG 3FRPB 2V9QA 5T1KA 2PCYA 1EY5A 2NVQB 3UP6A 4AITA 4ZODA 4F7KA 1QQDB 4DNRB 3JZ7A 3K6IA 1J9CT 4LPUA 3MBXH 1L3WA 3KE0A 1BBDH 4OD1L 3VFTB 3CCLA 4OB5L 3UX9B 5INDB 1DO5A 2AQ3A 1VQ7A 4X4XA 1G7QA 1T1YB 5D7IF 1KY6A 4YDLB 3P3TA 5BXFB 2B7DT 5IHZA 1M7IB 2EDRA 3F04A 3D3VD 1KBWA 5IP9H 2FWSA 4X50A 1YG9A 5E2JA 5HYQB 2GY5A 3UGUA 2EYMA 3FT3A 4ZOBA 2X0WA 4TRPL 3CDFA 3ZDWA 4YFEA 2XI9A 1H3VA 1SEBA 3LQAC 3K2UL 1WTGT 4K0KL 4R96B 5GJSH 3I02A 5LKNA 1IC7L 3CZGA 1KXHA 4DSYA 5TJWK 1OGAD 4ZW7A 3G6JE 3M46A 1VQPA 2JV6A 3ZU8A 3K72B 2ZP8A 5E2UL 1A3TA 2JB5L 2CA4A 4X8CA 1H5BB 3NIDE 5DJ2B 2A1WL 5FB8B 5HVHB 1SE8A 4RGOH 1TY0A 3K6NA 2V4LA 2AITA 4QRPE 5TDNA 3UPAA 4NXSA 1G7HB 3OKNA 1DLHA 1X5FA 4W4OA 4C3HG 3KLHD 3SE4A 2B2VC 5CYUA 1IE4A 1O9ZA 1FO0L 3BH9A 3QUMA 2ZUUA 1X6OA 3IS1X 2G3ZA 3EH2A 5C0FB 1RZ7L 4I1PA 1BGXH 1QYGL 4L4VB 4IBTA 5FHAH 1SLUA 3RKPA 5CBEE 3EOBB 3RL1A 3VXNB 1RAMA 1ZT4B 1HC1A 3NTKA 3A24A 2D3VA 3ZE0E 1YPZB 5MI0C 3UEQA 3KR3L 4HSQA 3Q8DA 1VQMA 4BSJA 4K55A 4QRTA 3MA7B 1A6VL 3IKCA 2NY7H 2F54B 3P54A 3T0EE 2ERJC 2MO1A 1OCCB 3D34A 4G6ML 1EHKB 1NOFA 1DCLA 1BIIA 2VDKB 1TJGL 2DWSA 2EDNA 1K3IA 1XR9B 3EYSH 1E5ZA 4WFHE 1LO4L 3S37X 3RE0A 1DO6A 1C5CH 3OLIA 1EERB 3GSNA 3N41F 4N2HA 1KGJA 3KLKA 4GOPC 3QZBA 4OKDA 1TJMA 4NLAA 4LSSH 4GG6E 3HZKA 4HIDA 2NY1D 4GBXC 1TLMA 4JI0L 1A6XA 3BYYB 2ADFL 3V4PA 3X3FL 1U4LA 1HXYA 4P73A 2ZYHA 3E8VA 2Y7MA 1GOHA 3MGTB 4FN0A 4MXWL 4OLVL 3RPIA 4R26H 4LAQL 3TBCA 1EJOL 1LNUA 2NX5D 3NN8A 2GBVA 4A3EB 4IU3A 5TF0A 4Y7NH 1TQSA 4ZZKA 3KPSB 2QBWA 2B63G 3UYPB 1MHEA 4KXZH 3GMPB 4XNQA 1Z0NA 1ZE3H 3R8BA 2FO1A 1XGQA 4R4CA 4KMQA 1BLNA 4WFED 2L5TA 1L0XA 1AS6A 4E9WA 4DV6Q 1AGFA 3H94A 4JFWA 1EZSA 1I1YA 4E9TA 2BDNA 5L6YH 4LF7Q 1EY9A 4RRPM 1RQ5A 2F61A 2WCGA 4X80L 4YEFA 1C16A 1J8HD 3HJ0A 4JPQA 3FQWB 2AI0H 5KTEL 3LNFA 5GGVL 1STEA 3H9YA 4L8JA 4MNOA 2IW3A 5I76B 3Q48A 3I6KB 1I4QA 1XNRQ 1JP5A 2C1PA 3K2KA 5IB1B 1FFNB 1OXSC 2HKFL 3G5ZB 5CD3A 2E7DA 1EAJA 1O6VA 5DUJA 1HL9A 5EBGA 5HVWA 1FYTD 1YNNC 2A5UA 3H85A 1B2WH 1LE5A 3DYMA 2X4SB 1XH2A 4M5YH 3D7PA 4ONGL 2DWTA 4PIBA 3WUWA 5I74C 4ABQA 2B4CH 3O2DL 3TOPA 3DI3B 4Q6IA 3NA9L 5DMIL 4K8JA 4NP4L 1UJ3B 1VF5C 1JS4A 1QG3A 3BKJH 3BP7B 4BY1G 5D1XA 4YO0A 2SEBA 1T4WA 2G5RA 2VABB 4UZSA 1BFTA 1OVZA 4KJOA 3ARSA 4RMSA 3NPSB 3UERA 3A6BH 4JO2H 5DO2C 5IP4A 1NC2A 2N88A 5ADOL 3HCVA 3G5WA 1F86A 4P4KA 5C97A 1U8OA 3T0EC 4PREA 5FK9B 2A9BA 1WJ3A 5CHNA 4NCC2 3WNPA 1B2TA 2A69C 4KZDL 2ZQKA 5EPKA 3I56A 2Z1PA 4PLJD 1AR1D 3QHZH 4A2MA 5KYWA 5ECJE 3D0LA 4NKOB 1PG7W 4FYSA 3ND8A 1MFEL 4FTVE 4P2QD 3QRGH 4LKCA 4KK8C 5IESH 2DMKA 5FGSA 5IQ9A 2AV7B 3C6SB 3D2UD 4MS8C 4MTKA 1UXWA 5IKCA 3UTOA 5EPLA 4HETA 4EIBA 1F6AA 3MLPA 4WWPA 3WDHA 4NO0B 1H3TA 3U7YH 4A3BB 4DGWC 3MBED 2DNCA 2GJZA 1SY6A 2A77L 2GFBA 2AC0A 4DGYL 2YJQA 2HTKC 3N43B 3BGMB 4YLBA 4YR6A 3TBSA 2EH7H 4CDFC 3IB4A 4V1DD 5FM5M 3AAZA 1CFNA 1OF2A 4BELD 3IJYB 1QSEB 3VWKD 1XF2A 1NBWA 2BMKB 1G1CA 4A93H 2BOBB 3VD7A 4KI5E 5LAXB 1NCJA 3FUMA 5JMOC 4ODBD 1M7DA 1WAAE 5JXAL 1Y1VB 4KY5A 3GTLB 4ISVB 4K7PY 3RN2A 4J1UB 4K9JA 5DQ9A 4WKZA 3PWJA 4U6VL 1JWMA 4L8DA 1SVZA 1F2XK 3ROLA 2LTQB 3TXAA 4LJZC 1YNKH 4KZEH 1JB7A 5DJ6B 2B2VA 1N8ZB 5C0AD 3VR5A 4GRMB 1S40A 1OTCA 1GHKA 4B0MM 3MGAA 3PMFA 2VRKA 3VXUB 1M56B 3UI2A 2R4SH 4PS7A 4TN9A 2L7QA 3LN4A 1PFNA 3CCRA 3FQXB 4ZPTB 5E4AA 1LK2A 2WD0A 2SNMA 4WV1B 4AI7A 1JOOA 1HZCA 3G7LA 1EK3A 4OJCA 3NWSA 5DJDA 2PCPB 4H1LH 1GPOH 2ZX5A 4FFYL 3PNWB 2NUCA 5F96L 5E7NA 1CK0L 3ML9A 4PRHA 2Z8RA 4YPGB 3DVGA 1WTRA 3QFDA 5DJXB 3DRTB 1TZAA 4MJHA 3NSJA 4UQ2B 4I0KA 1BECA 1RUKL 5C92A 1XGYL 1F41A 1MSGA 4JLRA 5CIPH 2ICEC 5JJZA 1O7LA 3PAUA 4YHMH 3EXLA 1BQHA 4KN7C 4PRIB 4ZQ3A 5CGKA 2HUEA 2NTTA 3EH4B 5JIDA 1N32L 5HJ3A 2H0PA 5PCYA 3U7WH 4X8JB 5E08L 3CSTA 4XCEB 3QW9A 1BBXC 4YPJA 4HCGA 4TXVB 4GOPA 1MFMA 4GBXA 4K94H 3WS6C 2P9RA 5IB3B 2G2RB 5EAYA 3VFNB 1WFMA 1KLGD 1GS8A 1ZLUH 3FQRA 2LMCB 1SYSB 3FRUA 4G2AA 1X7QB 2YOCA 3ZT6A 1F9QA 5DZVA 4DP6X 1TTCA 2Y0SE 5MEPB 1MELA 4OGXL 4LF5Q 2FD6H 5C4XG 5IM7B 4NXML 4KHPL 2A6DA 4LCIH 4U3SB 3VXSE 1WD8A 2ODIA 2PO6D 5D2LF