3QWOA

Crystal structure of a motavizumab epitope-scaffold bound to motavizumab fab
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
220
structure length
220
Chain Sequence
QVTLRESGPALVKPTQTLTLTCTFSGFSLSTAGMSVGWIRQPPGKALEWLADIWWDDKKHYNPSLKDRLTISKDTSKNQVVLKVTNMDPADTATYYCARDMIFNFYFDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords motavizumab light chain
publication title Design and characterization of epitope-scaffold immunogens that present the motavizumab epitope from respiratory syncytial virus.
pubmed doi rcsb
source organism Mus musculus
total genus 38
structure length 220
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qwoA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qwoA01
2VDNH 1SYVA 3RHWF 4X80L 2QLVB 3HS0A 4I3RH 4X0KA 4OZGF 3WSQL 4EDXA 4ZXBC 1QQDB 3MV8E 3TA3B 1EERB 1WGOA 1ZLVH 3BP7B 3VXME 4JN2A 4L1DA 5DRZB 5H37H 3DGGA 3GBNL 5CKGA 1JMXA 3C5SB 5EC1A 2GK0B 1IM9D 1MFAL 2A74A 3O6KL 5HI3D 2NPLX 5ISZE 3STLA 3MODL 4GQPH 1A7NL 1F5WA 1F42A 3KWWB 3MRKB 5KN5A 2DQCL 1QBML 3I2CL 3QXAB 2PYED 1DUYB 4XVSL 5ADPH 4EVNA 4OJFL 5EIVA 1C16A 1CF8H 5KVDH 1UM5L 4IOFC 2XTLA 4M61B 1AGCA 3QAZB 5I1EH 4EOWH 1NGWA 4H1LB 1Z5LA 4WO4C 4OV5A 1OARH 1DSFH 1HIMH 2DBLH 1X5IA 4M7ZB 4NUGH 3T1WA 1FQ9C 1MEXH 2D9QB 4OUOA 5DA4A 2YPVH 3AB0B 2FRGP 1AI1H 5IBUG 3TO4D 3NIGF 5EU7E 1S7TA 4KQ3L 4N8VB 1AHWB 3DVNB 3VFUA 1MHEB 1J11A 1T2QH 1UKTA 1RY7B 3VXQB 4HULB 4GG6A 2OJEB 4K3DL 1QP1A 1I9JL 3SGKA 2WBJC 1NDMA 2WQ8A 2BXYA 4XCYB 1NGQL 3QIBD 4XTRD 4QO1A 4NRYA 3OB8A 2OK0L 5TFSH 3D3VD 3MNVB 4Y16B 5JR1H 1UVQA 1MJ7L 1KCRH 3GUTB 3C87A 2WLZA 5JW4M 4GRWE 1W72A 1DQLL 1JWUB 4HFWB 4K3JH 3UTSD 1A2YA 4K8RL 3O4LE 4CGTA 1QNZH 1VHPA 4L4VD 4OGAC 2CO7B 4ZOEA 3WUWB 4F7EA 3NCJL 3M1BB 5E4EC 4YDLB 1I8IA 3DUSA 1OQXA 1WBZB 4KAQL 2GJ6A 3IXAA 3T77A 5IB4A 4P46A 3U2SA 5T33L 1UT9A 2O93L 5DS8B 2AXHA 1XGRB 4EBQL 5DMKB 1CZ8H 4YPGA 3ULVF 4WUUD 3V5DB 1ZGLB 2N56A 3SDCB 4GKSB 2BZDA 4OF8A 3HE6B 1AFVH 2JKXA 4NHCL 4XBEL 5C0CA 5D9SA 1WCBB 4LSVL 2CIKB 1E4KC 4P2OD 3NGBB 5C0BD 4OM1L 4U1HA 5E00A 3MTRA 4IOIA 2IMMA 2FCBA 1CD1B 5HYFA 2Y23A 3WIFB 5EC2A 4OGXH 2HAZA 4PRBB 4JM4L 4GH7B 1B0RB 3BZFB 1U58B 2W07A 5JNYA 3WFDL 1YEGH 1II4E 3MRIA 4PJ7E 5FOBB 2ICEA 1LO4H 5TF0A 4LP5A 3FO0L 4NIKB 4RNRA 1ZVSA 1A7PH 3L7FA 3P4OA 5INCB 4LDLB 3G5YB 1YA5A 2XNAB 4C4KT 2JB5L 2UZXB 4XRCA 2AVGA 2G60L 2X4QA 1UA6L 4NKDA 4OZHF 1P6FA 1O7SA 1MLCB 1A4JA 3TO2B 4U1GC 4UINL 3BQUC 2ZOLA 1P7KB 1DBBH 3KDMB 4U2ZA 2EDQA 1KJ3L 1I1YA 4M7LT 2DKUA 3QRGH 1RZKH 1H5BB 4QRSA 2X4SB 2J8OA 4XNZC 3AAZB 4YE4H 1U95B 3MV7B 4WFFE 4OB5H 3ZDXF 1G7PB 3MRPB 3P0YL 1MUJA 1Q0XL 1U8OA 3LZFH 3VD9A 1DE4B 1J86A 5E5MB 3GKWL 3S97C 4C56D 5AYUL 1YDPB 5HYIA 4KTYA 3TN0C 4LNVA 3VFNB 2ED8A 4P5TC 1NCNA 1P69B 4OZGE 5DRNB 4HWEH 1U8LA 3ARQA 2UY6A 1BJ1J 1GAFH 4LGRB 1SY6H 5KW9L 2F54D 4KROD 5DQJA 3WS6C 5KS9A 5E0QA 1FFOB 3T0EE 4OKVA 4XNYL 3VFMB 1JWSA 2DTSA 4RZCB 4OM0L 1WUNT 3KPNB 8FABA 2VH5H 4AEIL 2YUXA 4MNQE 1F4WH 1XGUB 4U0RB 3OKMA 3S8WA 1RZIB 3HKFA 2YPLE 4JZOB 1J1XL 3BX7C 1GGCL 2FWOB 2VXVL 3ARFD 4CW1B 3FO1A 3TWCH 3HRZB 3EJZC 5CSZB 3ES6B 3T0EC 1W0VB 3KR3L 3U30C 1VPOL 4QTHA 1MI5A 3P11L 1VB9A 3QBTB 5T3ZL 1TZGL 2FECL 4K3GA 1U0QA 4WV1A 4LCWD 5GRUH 4MNHB 1VGKB 1V3LA 1TFHA 4PP2A 5GZND 3CCHB 4HK0B 4WWKC 4XT1C 5GGQH 4B7LA 1T7VA 3E3QE 4GBXC 2E8YA 2OTUB 2FX7L 1I7RB 3L5WA 3NIGE 2BVTA 4YHLH 3KJ6L 1T1XA 1EMTL 2I60H 1K3IA 3CU7A 5CEXA 4NQEE 1QSEE 2DQDH 1HQ4A 1CDGA 3D39D 3S7GA 2AJXH 2J5LB 3KYKH 4HG4J 2HJLA 3DARA 1NEZG 4JQXA 1UACL 2A38A 4F7MA 2Y07L 2OZ4L 3LKQA 1SQ2N 3RVTC 2YC1B 3N9GL 5INDA 2ED9A 1JN6B 3ULUC 1AH1A 4YQXH 4X4XA 2Y36L 5HGGS 5DDHB 4XNUL 4Y7MA 2A83B 4QF1B 2AXFA 3V8CA 4ZUTA 5HVGB 5IB5A 1A6AA 5DJ8A 2GTWB 2A6JB 2RQ8A 1GGBL 3IKCB 1CBVH 4DKFL 1NCWL 3MQIA 4DEPB 2YKLH 2HFFB 4A6YB 2NNAB 3AM8C 4U1IB 3ULVE 1JTPA 2ESVE 4X6CA 3MGTB 4KK8C 5D8JL 5DUBB 4EI6A 4HKZA 5MEQB 2ICCA 3BVNB 4HKJB 1NBYA 2NY0C 1L7TH 2B8OT 3OB0H 1ONQB 4GAGL 5DD0H 6CGTA 4M43H 2QSTA 4JRYD 3MRRB 4HIIB 5KSAC 1HXYA 2YD5A 3OZ9L 2IGFL 1S78C 1WK0A 1E28B 3IB4A 3GSNL 2KDGA 3W81A 1M71A 3PL6B 3VWJB 5F1IB 3ZYOA 3B9KD 3ARVA 2YEZA 4JDVB 2Q8BL 5ERWA 4TRPL 4MJ6B 3S3SA 1KB9J 3W39B 5J3HC 2ICES 3VRJA 3H42L 2NZ9C 2Q3AA 4K94C 3QI9B 3MCKA 5EOQH 4NKIL 1NAKL 3SGJA 1BOGB 3W0WB 1UJ3C 5FYLE 7CGTA 2R29H 4P2RB 3BH9B 4OZHE 4JM2B 4PJBA 2GCYB 3IFPB 5TDPA 2QADD 4NO0D 1FYTA 1J0HA 5I16A 1GGIH 4K3EL 4JDTL 2IBBA 4OV6F 4XMKH 1IZJA 1NLBL 5T1KA 1CFNA 3KYAA 3WXWL 4QEGA 3IXTB 3GIVB 1UWEL 3NFNB 5F72S 3DSFL 4FABL 4UV4L 5AZ2L 3QWOA 4R4ND 2VXQH 3Q2CA 4Q7DA 5SWSB 3ZDXE 4YXHH 2RAMA 1JYVA 1ZMYA 2OR9H 4Z7VF 2XN9E 4L4TA 3QFJD 3O45A 4OZIB 5DR5L 1K4CB 4BFGA 4TQEL 4PG2C 5DD6A 4GLRH 4GXVL 2KQNA 1BIIA 1IAII 1MFCL 4W4OA 3RUGF 1MPAH 1SYSA 4KVNH 1JWMB 5T1LB 1Y6NR 2VISA 4D0DB 3LQAH 1T4KB 3W2DH 1Q94A 1PZ5B 1CT8A 2EDFA 4PIRF 3FFCD 4NN5B 4ZUUB 2V5YA 4KJWC 2MQ0A 1IGJA 3DMMD 1CTOA 5DSCA 4Z9KB 1U8PA 3HG1B 5HDQH 4QNPF 4F7CA 1HZHL 3QCVH 3C5ZC 4PV8A 3TBYB 1KCUH 4N90E 4Z7NF 3IFLL 3QH3A 5GS1C 4K8RD 1ACYH 3TJEL 4X98B 2C4FU 4XVUD 1HILA 5M94B 5F96H 1CFQA 4HIXL 4PUBL 1RV6X 3CSPA 3QIUB 1X7QA 4NZRL 4XCNB 2GSGA 1CYGA 3ULVL 2R1XA 5ALBH 4ZXBD 2YMXH 5HI4C 1OAZH 4KY1L 3O2WL 2XZQH 2NXZB 1XH3A 1AQKL 1N2RB 4JRXE 1BZ7A 4H25B 3O8XA 3CSBA 3RY6A 3GSXB 4I77L 4HUKB 2BFVL 3SGEH 4K94L 5EH1A 5C0NC 5D7LE 4LGPB 1OM3H 5D2NE 4PJGA 1SBSL 5GGRY 3FB5A 2FIKA 5EUKB 1KIRA 4N0UA 2XG4A 4H5SA 3GMOA 1WIPA 3IS1X 4MGXA 5E6YA 2BVQB 1LDPH 4HH8A 1KT2A 4JY5H 1KEML 3CXHK 1G9NC 4NJ9L 3FB8B 3UTQB 2IQ9H 4IOFD 3RWHB 4L9LB 1JGUH 4OLWL 4HGWB 3AREC 3HC4H 3CUPB 2R1YA 4WO4D 3A6BL 5D2NC 2CUHA 3QJHB 1QR1B 2XI9A 2MPAL 2R39A 3HNVH 5KTEL 3NPZB 3LOWA 3D87B 4M6OH 1AR1C 1RD6A 1F4YL 5BS0E 4DK6A 4JFOA 4IRZH 4JGUA 5EWIL 1EVUA 4PRAB 3FT2A 4PJEF 3X11B 3E6FB 2EICA 4YHOH 2WBJD 4JO3H 5DJAA 1INDH 1N64H 3HS0B 5DURD 2P7TB 4I4WA 1U42A 4U3XA 4EDXB 3NABL 2YD8A 1NGYA 4OBSA 4PTUB 2FX8H 4JN2B 3DGGB 2A1WH 4OIIL 4OGAD 5EC1B 1JMZA 2BP3A 5ITBL 2A74B 3K74B 5MHSE 3C8HA 3OAUH 5IB2B 5KN5B 1S5HA 1T83C 1LEGB 9CGTA 2W1NA 4EVNB 2P47B 4DGVH 5IV2A 4FNLL 3PWLA 3QPQC 5F1KC 1C16B 5AYQA 5A3IC 3AMKA 3IDGA 4JJHA 5E7BA 1AGCB 4FQXA 4HBCL 1D5MA 1NGWB 2SEBB 1Z5LB 5SWZE 3BMWA 1T7WA 4OV5B 4OFKA 1TJGL 4HV8A 3BOVA 4K9EH 4CMHB 1BJMA 5C86A 1MCWW 1NQBA 2APFA 4WI2A 2FBOJ 5E6IC 1G9NL 4TSAH 3PWUA 4WCYL 1S7TB 3VFUB 5T3ZD 1CR9H 2NY3B 3FAWA 3N06B 4GG6B 1BWWA 1UYWL 3EFFB 1TIUA 1KYOJ 1NDMB 3QAZC 1I9RH 5JA9A 1ZV5A 1BQSA 3HNTH 4Y4FC 5IROA 4NRYB 1UVQB 3BKML 3OR7A 2FGWH 4PJDF 4OSUL 1NGPH 3GKZA 5HHMD 3PHSA 1W72B 5FA3A 3BQUD 5L2KE 4MJIE 2DQIH 1A2YB 4KKCC 2DJSA 4Z7QF 3ZTNL 5C7XL 1BM3L 3T2NH 5EBMA 1S7VA 4QNPE 4F7EB 4UOW0 3ULSA 1I8IB 4NQXA 3DUSB 1MCEA 4YGAB 2GJ6B 3IXAB 3FQNB 3SDXA 4P46B 3U2SB 4Q74A 4EXPX 2X4TA 4DVBA 3IDUA 5IR1A 4YPGB 5CUSL 2XQYK 3SE9H 2VMFA 3CSGA 1W0WA 3T2OA 1XGYH 3HUJA 5C0CB 3TN0D 4PJAF 5D9SB 4P5TD 4U1HB 5E00B 5IMOA 4ALAL 4X9HA 4OLZL 3VMOA 1EXUB 3RX7A 3AROA 5EC2B 2XFXA 5KVFH 5TQ2H 4N9OB 4GRWB 2VE6A 5JNYB 2WQRA 3O4LB 2NW3A 3MRIB 4XPGH 1FRGH 3HE6C 2ICEB 1OAXH 5C0AE 25C8H 5DJXA 4RNRB 1ZVSB 3L7FB 3P4OB 3VGHA 3NGBC 4XRCB 2B5IB 3MJ7A 1DBAH 2X4QB 2X41A 4NKDB 4YC2B 3T0ED 1BJ1H 1A4JB 4I0PA 1GPOH 2JJSC 4OFVA 1P84K 2VZSA 2BCKA 4XH2A 1HHIB 3FO2A 3DURA 1FZKA 4S1RL 1I1YB 2E27H 2YPLD 3KS0J 4WWKD 4QRSB 3WNMA 4PP1C 4OLYH 3E8UH 4FQHA 5F1NA 3CC5A 1C5BL 1MUJB 4PB9L 4PJEE 4U1SA 2WIMA 1U8OB 1IMHC 3U4BL 2D7OA 2P8MA 3Q6GH 1CLZL 5ICZA 1IJ9A 3OG6B 1JBJA 2W38A 4YXKH 3D9AH 3LSOA 2BVYA 5D7JA 3RVTD 4G8GA 4P9HH 3WIIL 1S5IL 1VFUA 1KBGL 1MH5A 1U8LB 1H5BC 3ULUD 1U9KA 4UQ3A 3T0VA 5ID1A 1GXEA 4OCSH 1Z0NA 5KSBA 4LHUG 4PTTB 5DQJB 2QSCL 5I0ZA 5KS9B 3WHE0 3EJJX 4NQED 4XC1L 4OKVB 5DEGB 3QCTL 1IAIL 2F58H 1JWSB 1LE5A 4UOW1 3MXWL 8FABB 3A67H 4AMKH 1A0QH 3RX5A 1WTGT 4FQIL 4PRIE 3OKMB 4JREC 4X6BA 4ETQA 1LILA 1LP9A 3ARBA 4L3EE 5DHVA 5DQ9A 3MLSH 4G9FA 1HCVA 5B39G 4KK8D 3FO1B 4QXTA 4P59H 4MAUH 2KPNA 4LAQL 5B38G 2NY0D 4QTHB 1I3GH 1MI5B 2D3VA 4ONGH 2D7NA 3DVFA 3BGMB 3UTTE 2FB4L 3LCYA 2J6EH 4JFFE 3UJTH 5IHLB 3SDAA 4CL7A 4HXAH 4XXCA 1BMGA 5KSAD 3TCLA 4NYLA 2GI7A 4U0RC 1M7XA 4PP2B 1Q9KA 4Y1AD 4PJFF 2ESVD 2OLDA 3L5WB 1T1XB 2P4AB 5CEXB 2AQ3A 1HQ4B 1FAKT 2VDKH 2HJLB 2NZ9D 4YBLB 3EYUL 4UOJA 3UTPD 4F7MB 2VIRB 2X44D 4ETYA 3LKQB 1NGXA 3UZVB 3JV4A 2HJFB 4WW2A 5EBWA 5INDB 4WY7H 3RVXD 1KJ2H 4F9LC 4X4XB 3PDDA 1ZVHA 1RURH 4QTIH 4JR9H 2AXFB 3HAEG 4HPYL 3EUUA 4X7DC 1BD2A 3DVGA 1RZJL 2J5LC 4AT6A 5KOMC 1A6AB 2Q76A 3D48R 3KPRE 5HYQA 3DI3B 3CMOH 1DLHB 3AS2A 2O5XL 5DJ8B 4LVHC 5GSRA 1OGAD 4N0YH 3PP3K 2E5EA 3MRLA 2BRQA 3L5HA 3RBGA 4H20H 4HKZB 5F6HJ 4EI6B 1D5ZA 5F1OB 1MWAL 5C2UB 1JZ3A 1NBYB 4IS6B 4PJAE 4QRPE 1T89C 4CNIA 1MCSA 2VDOL 4LIQE 4LPUA 4QHMA 3BKCL 2V5RA 2FZ3A 2X1OA 1CDYA 2J6EA 1PFCA 3RJQB 5C08E 3LS5L 4M7LH 1HXYB 3GDBA 4KJWD 3WHE1 2D03L 4OZFH 3FB7A 4DEPC 2XN9D 4HC1L 1M71B 1YMME 2J12B 1DQDH 3C5ZD 4Z0BL 3N50A 1NMAL 1YEJL 3KPSA 4MXQC 4R2GD 2YEZB 3BXNA 1X5YA 2EEBA 5ERWB 1MJUH 1K85A 4XNMA 4YZFF 3VRJB 4G8IA 3VDCA 1A47A 4G3YH 3MCKB 4BQBA 3KXFE 4V2BA 1H3PH 1C08A 1G0DA 3QFDA 1WEJH 3U36A 1OQOA 4PJBB 5HI4D 5TDPB 1IC7L 3DYPA 3EYFA 3LRGA 1FYTB 4CJ0A 3B2VH 1KJ2A 4UT7L 2YN3A 3F7QA 3VW3L 3MJ9H 3G9AB 5T1KB 1CFNB 2P5EA 4MJ5A 3QNYA 1LO3L 1S7QA 3H0TA 4QRRA 1J8HE 3G5XA 5C0ND 1WLHA 2I07A 3QWOB 4I5BA 1KOAA 4RAVA 2P46B 3QI9C 2JB6A 3U4EB 2OP4L 4HW6A 4L4TB 1UFUA 5MP6H 4OF0A 3RDTA 3SHSA 2FD6L 3O45B 1A3LL 1GVIA 1X44A 3RI5F 2BVEA 4G6FD 5DD6B 5E99H 4YIQB 1BIIB 2I9TA 1SYSB 4QXUL 3WYRA 4IDJL 3Q3GA 2EO9A 43CAA 2BNQE 3ARED 2ITCB 2XICA 4UV7L 3EIFA 3CFDA 1Q94B 5J6GA 2BNRE 4M5YL 4N0FA 4EDWH 2VDLL 5GSVA 1CT8B 1G7JA 3O9WA 3RHWK 5CKAA 5E24E 1U8PB 5TF1L 3IDXH 4HIEA 3QQ9C 4OZFA 1AR1D 4PV8B 5TE4L 1JGLH 3BGAA 3D69A 3BD5A 4MWFA 3TJHD 4XCCH 3QH3B 2W91A 4K7PH 2WZPD 2GYSA 4NSKB 5IMKA 3BDYH 2Z8RA 5CP7A 4X5LA 1S7UA 1HILB 1CFQB 3IFNH 3N1PC 4HJJL 2VKWA 1FVDB 1X7QB 4U1MA 3RPKA 4NN5C 4XCFL 1A6ZA 1EO5A 2GSGB 3MV9A 3UROR 3TVMA 2R1XB 4A6YL 5FYKU 3WLBA 3F58H 4B53A 5C0EA 6FABL 2VABA 1XH3B 1EPFA 3RGVC 4LIQL 3O8XB 1WWBX 2VC2L 2DQHL 2OBGA 3VGEA 4PJFE 4LCYA 4K07A 5ICYA 3F62A 4PJGB 3FB5B 2FIKB 1KIRB 3SQOL 4ERSH 1IEBA 4N0UB 4ZD3L 4E41A 4H5SB 3GMOB 2VDQL 2NYYC 2HKHL 4LVNB 5FKAA 1KT2B 4RRPG 2VJXA 1EO8H 3BPNB 4ZDHA 3VD3A 3QPQD 2AQ1A 4NN7B 3TA3D 2NXZC 4KJYA 4QRTB 5DUML 2EDEA 2FX9L 2BOCA 5A3ID 2XWJA 4Q6IC 3K2UL 4EN3A 4Q6YA 2R1YB 5MHSD 1Q38A 5F7DA 4M00A 4PBXA 4OZ4B 5TE7H 2ZCHL 3QEUA 3SKJH 5CJ8A 2E9WA 2PO6A 2NX5E 4DKAA 2Z9TA 2HRPL 3OKDA 1NFDA 2VDRL 4JVPA 4JFOB 5FCSH 3FT2B 3QUZA 3WD5L 1QHPA 3C8KA 5DVMA 4GKZA 1NDGA 5DJAB 1GIGH 4N1HB 4Y4FD 4D3CH 4MJ4A 1JPTL 1VSCA 5D1XA 1AR2A 4F57H 3TH2T 4I4WB 4P2QE 2VSCA 2BMKA 2DM2A 3FRUA 1L9MA 1HHGA 3LPWA 1O7VA 3EYQD 2NW2A 2DM3A 4KKCD 5I1KL 3I9GH 1UM4H 3VGAB 4YHMH 4OLUL 2X1WL 5D7SH 4UAOB 3MFFA 5CZXC 3EZ8A 1U3HB 4NN6B 2PN5A 5CIPH 3FL7A 2DQGL 1L4IA 1MVFA 4YZFE 4FOMA 5IV2B 3PWLB 4MJID 3IDGB 3MLXL 4LSQH 3OGCA 3KGRA 4FQXB 1G84A 1D5MB 5TDOA 3HA0A 2DLFH 3FZUC 4U7MA 4NKQB 5D2LF 1ZLSL 1BVLA 4PJXA 2OR8A 1NC4D 4HS6A 3IDIA 4Z8FL 3P9LA 1P7HL 4MS8C 1IARB 3PWUB 5K9OA 4FFYL 3WLWC 4JFDA 1UEMA 3BJ91 3MO1A 4MAYC 5TQ0L 5BW7A 5GS0C 2B20A 1JNHA 4ZFGL 5EZOL 3HE6D 4Z6AT 1H8OA 2YUVA 3U9PL 3PIQA 1J1OL 3V0AC 3S88L 4ZYKA 3IFOB 4NQUA 4FQLH 3SKUD 1JE6A 3OR7B 3L1OL 3RA7H 1D7FA 4NWTL 3CFCH 1ZHLA 2ARJA 4X7TA 5FA3B 3FHAA 4KV5F 2IFFL 1EUUA 2PUQT 1JRHH 1RK0A 4Y89A 3BD3A 5EBMB 1S7VB 3QA3A 5EDXA 2APWA 2PETA 5EO1A 5JZ7C 4NQXB 3FO9A 4ODSH 1K2DA 3T0XA 4Y4KA 1F4HA 3SDXB 1H3TA 2X4TB 4POYA 4DVBB 1EHNA 1VADA 5CBAA 4ZTPH 1IC4H 5IR1B 1T1WA 3PE9A 2CLRA 3CVIL 1EZVX 5CIPA 4MXWL 1W0WB 1RHFA 2NY7H 4X6CF 5I18H 2AJSH 3HUJB 5J1SC 5BQ7A 1ZEAH 3IF1B 1FO0A 4MQXD 2GAZA 5AG9A 3BAEH 2R56H 1NCAH 5IMOB 1E4XH 5I1LB 3PDOA 5C09E 4YO0A 1INEL 2XFXB 3PQYE 1S7SA 5CZVH 2VE6B 4JY4A 5FGSA 2NW3B 4JGMA 2EDTA 4LQFH 5FV2A 4U6HA 5DJXB 5I17A 5DC0A 4JQVA 3L95B 2FSEA 3PGFL 3MJ7B 4N1CA 3SPVA 1AE6L 1B88A 8CGTA 3EOBA 1FHGA 3MFGB 5ANMA 2Q87A 4DFHA 5E6ZA 4I0PB 2DQFA 3JV0A 5MENE 2YRPA 2D4FA 2BCKB 4XH2B 3FO2B 3MOAH 1TZHA 3DURB 4M1DL 1PQZA 4L3ED 4QHKJ 1Y0LB 3BJLA 4DVRH 4AG4H 4PPTA 4FQHB 1XZ0A 4XZUB 3PXHA 5F1NB 4L3AA 3AXLA 3GMQA 1IKFL 1DBKL 1F3DJ 4BYHA 4YC2C 5CLTA 2P8MB 4JFFD 5D7IF 5ICZB 1FNSL 4R7NA 3B6SA 5LCVH 2BJML 4FFVC 2MKWA 5J56B 3LSOB 4DCQA 5D7JB 1AXTH 4G8GB 1EZVY 1MH5B 1Q72L 5DMGD 1KXVC 4B7IA 2VDNL 4UQ3B 5ID1B 1KEGH 4NPYA 5KSBB 2EC9T 1H3XA 4RMTA 5IGXH 4BM7A 1G7IA 4LCUA 5AEAA 1REIA 2A73A 4I3RL 1LE5B 3H9SA 3D0VA 1T7XA 1CE1L 1T0PB 1UXSA 5H35A 3S4SG 3T08A 1BZ9A 4L8BA 5J13B 3T8XA 4X6BB 2JCCF 4ETQB 1LP9B 5DHVB 3ARBB 5DQ9B 5B3NA 1JPSH 4G9FB 3DX8A 4F37F 4KRNA 2RBLA 2CR3A 4PGCA 5DI8A 4FQ1H 3LKNB 4FP8H 3O2DH 1TQCC 4QXTB 3QQNA 2OMNA 4WHCA 4HKXA 3H3PH 3WFEH 2GEEA 4WFHE 1URLA 3SDAB 5FO8A 5D2LE 3IAPA 3HLAA 3LN4A 5ADPL 5D6DA 4S0TD 3TCLB 4D9LH 5DQDH 4XP5L 3BWUC 5KVDL 1Q9KB 1DR9A 2O5YH 4Y5XA 5I1EL 3MLYH 4EOWL 2HT3C 3U46A 4MXQD 1OARL 2C26A 1HIML 2Z4QB 5JQHC 1JGEA 2DBLL 1K8DA 2OR7A 4ESKA 1EGJH 4M6MH 2R15A 3QIWA 1MEXL 2IANA 1CVRA 2YPVL 3RWEA 4ENEC 4WGWB 5FK9A 2YD1A 4XP6H 2V5SA 1GGYA 4WV1C 4YPJA 4OLVL 3JV4B 2OXGA 5EBLA 1T2QL 4WW2B 5EBWB 2AEQL 2IEPA 2HG5A 1ZLUK 4KV5E 3G6DH 4DAGL 1RZKC 5DGRA 5TFSL 2W65A 3B83A 3THMH 3BKJH 4MD4A 1BD2B 1RUAH 3DVGB 1PX4A 4AT6B 2Q76B 5HYQB 1G9MH 3FMGH 3KXFD 4M4PA 3QI9D 5GSRB 4FQ2H 4I0KA 3QQ3A 3MRHB 2DWDA 1QNZL 3MRLB 1EX0A 3MRFA 1D5ZB 3ZYJA 1CDCA 5JORA 4I13B 4CNIB 3BO8A 3D25A 4ZPTA 4QHMB 4C54A 1J8HD 1U92A 3T0BA 5CILH 2FZ3B 3CFJA 3ZT6A 1CZ8L 2OYPA 1KENH 5H8DA 2UWEF 3KPTA 1AFVL 1MFDH 1J5OH 3SGEI 2D7TH 5GS2D 1FVEA 3KPSB 1RUQH 2X89A 3LS4H 3BXNB 1NCUA 4OF5A 3KG5A 2DMCA 3SE3A 2ZG1A 1KACB 5T1LD 5K9KA 4G8IB 3DUHA 2BNRD 1EGJA 3KPRB 32C2A 2GFBA 1I75A 3BN9C 4GSDH 4N9GB 1C08B 1YEGL 5JHLH 3QFDB 1XR9A 2EXYC 2AJYL 3VA6A 3U36B 1LO4L 2PYFA 3HG1D 3JV5A 4O2FA 2XA8H 3EYFB 1FL6A 5IFJB 1A7PL 3MNZA 3ZKSD 1KJ2B 1MCDA 1YUHA 3RGVD 1FIGH 1AKJA 2FJHA 3FQWA 1MAJA 2P5EB 4MJ5B 4NP4H 3QNYB 1S7QB 2JJTA 4QYOA 3H0TB 4QRRB 5E56A 1FAIH 3G5XB 2I07B 3JWNC 5FA4A 4I5BB 5DLML 2JK5A 3ARYA 4RAVB 5C08B 2J3SA 2JB6B 3WN5A 3EOAA 3SGJC 1DBBL 1JNJA 3RDTB 3QRGL 1RZKL 5D7IE 3KYMA 4ISVB 2NXZD 4YE4L 5C0FA 1MCHA 2GJZA 2I9TB 4OB5L 1JHLH 1UKQA 43CAB 1OWWA 3K46A 3ROOB 4TTGA 3CFDB 2VKXA 4N0FB 2J7LA 3LZFL 5GSVB 1G7JB 1MSPA 3B9EA 3O9WB 5IF0B 3HRPA 2CSPA 1KC5L 3CGTA 4AIXA 2YZ1A 1OAKH 3MOQA 3OKNA 4GJTB 1F97A 5KVMC 3DXAE 3L3IA 4OZFB 3AMLA 4HWEL 5A2FA 5F7HA 1LO2H 4LCCA 4HGMA 3D69B 1SY6L 2CK0H 4FTVE 2JTDA 4W4OC 2Z35A 1P4BH 2JCCE 5HI5C 4X9FA 5IMKB 1FZJA 5CP7B 1S7UB 4IRJA 3QISA 3VFPB 3VG0H 1DANT 3RWCA 1VKXA 4NNYA 4U1MB 1A6ZB 3MV9B 5C9JA 2F19H 3TVMB 1F4WL 2OXHA 1Q8MA 3H6JA 4X7FC 2LE9A 3WLBB 4F15B 4ZFOA 2NX5D 3O4OB 5BOPA 5L8KB 5D70H 4BQ6A 1DQMH 4OQTA 4IIQC 4WI8A 1GH7A 4LCYB 1TJIH 5I75C 4PJ5E 1YQVH 1S9XA 2RGSA 2V17H 2L7UA 5CZXD 3L3OA 4P4KC 4E41B 3RNQA 5JHDE 3EDJA 5FKAB 2ZUXA 1OT1A 3Q5YA 4JHBA 3VU2A 4PFEA 5GGQL 3CXDH 1XAUA 3X14A 2ARWA 1RUKH 4KJYB 2BOCB 2P8LB 1YZZA 4YHLL 2XWJB 3LAFA 4F2MB 1RULH 3O8XC 2ORBH 2DQDL 2O61B 3O0RH 4FA8A 3TZVA 3FZUD 5F7DB 2AJXL 3KYKL 5D6CA 3HCVA 1P4IL 3QEUB 1YECH 5C0RH 1I7UB 4MS8D 2PO6B 4LVNC 4Y4HA 1WICA 4NZUH 3OKDB 3WLWD 4MAYD 3G08A 5GS0D 4NQDA 4G5ZH 3QUZB 1I8KB 5GRZA 3PWPA 3C8KB 4V1DE 4KGLA 4GKZB 1NDGB 1K5NA 1MRFH 4OLXH 2OI9C 2VZ1A 3LQAC 1D9KC 4XI5C 1XGQA 1EJOH 3PNWA 5D1XB 1NFKA 1XF5A 2BMKB 2MSPA 3FRUB 4K55A 4X9IA 1HHGB 1GZPA 1GHFL 1B0GA 3H8NA 2NW2B 4PB0H 2P43B 4Z7UA 3ZDZF 2UWEE 4J4PA 1BX2A 5IESH 1JGVH 4ORGA 1WWAX 3UPCA 4AEEA 1L7TL 3AU1A 5JZ7D 1DN0A 5C8JA 5DD0L 3ZKNC 1EEYA 3MFFB 4TNVF 4F33B 4U3CA 5E1AA 5IVZA 4HUWA 3O3DA 4X4MA 4ZNCD 4KDTA 3VWKC 1WIUA 4W4NA 1V7MH 5I8CA 3OGCB 1YEEH 2YSSA 1JUFA 2CR6A 5TDOB 4WRLA 3S36H 5FAAA 2UUDH 3OKOA 1ACZA 4KPHH 4BELD 3KLDA 4R4BA 1BVLB 4KMLB 4PJXB 2GJ6D 4HS6B 3MLTA 3IDIB 2FHBA 4WTWA 3BPLC 5EOQL 4S1QH 1DEEA 3P9LB 1T0MA 3T3PF 2VXUH 4NN6C 3PWNA 1PJ9A 2BSED 2R29L 1IGTA 1QA9A 4FQCH 1KJMA 5K9OB 4JFDB 3MO1B 1IRAY 5IVOA 1JNHB 3B4NA 1BAFH 1N4XH 4XMKL 3QZWA 5EUOF 3PIQB 3IT8D 3GZKA 4NQCE 4ZYKB 3E1F1 4GAJL 1FGNL 5CJOH 2P44B 2Z92A 3JSSA 1OAYH 4YXHL 3I85A 4X6DA 1ZHLB 2OR9L 2ARJB 4X7TB 3QUMH 5A16A 3MOBH 1P9MA 1Q1JH 1RK0B 2DB8A 4N1EA 1QLFA 3QA3B 1MPAL 4KVNL 4WUKH 1UCTA 5EO1B 3FO9B 3LQAL 1OSPH 1LK2A 1K2DB 4Y4KB 1CWVA 4LP4A 3NACL 5FGCB 2V5MA 1VADB 4G6KH 5CBAB 1V5JA 4DN3H 1T1WB 1V8HA 2CLRB 4X9BA 1QO3A 1NCDH 5CIPB 3KPQA 4PLNC 4WIQA 5HDQL 1A1OA 3QCVL 4YHPA 5K93A 4RIRA 1KCUL 1MY7A 3I6LD 1WF5A 2Y1VA 4FFVD 1FO0B 2H26A 4BFBD 4Y0GA 2GAZB 1ACYL 4LQ1A 3Q0HA 4QWWC 4YDKH 3PDOB 1T3FB 4AIOA 4RGNB 3PP4H 5F96L 4I2XA 4YO0B 4PRPE 5IJKA 4ZO7A 4PV9B 4JJ5A 2CKBH 3MRQA 4JY4B 5ALBL 2YMXL 1OAZL 3M8OL 3O11A 2XZQL 4JG1H 1N59A 5I74B 1OCWH 1I7TA 2AJUH 2DQEH 4U6HB 3O3UN 1FFRA 5DJDA 5I17B 4KHXH 2BHZA 2V2TA 4KQ4H 1QR4A 2FSEB 3CAFA 1QZ1A 3I3EA 1RZ8A 2F53E 3SPVB 4ZOBA 4B0MM 5C1MB 1ODAA 3DYMA 3EOBB 1KIUA 5ANMB 4PRHE 4K9EC 2H1PL 3T4AB 1NCCH 3L3HA 2G5RA 4JY5L 4DOHB 4U1LA 2DI7A 3X13A 3QUMA 2ED7A 2EDKA 1OP5H 1JGUL 1OB1A 2HT3D 3WCYA 1XZ0B 1TCRA 3AXLB 5DK3A 3GMQB 1KCLA 1MI5D 1NBZA 3HNVL 2VOTA 4I0PC 5TDNA 3ARZA 4F8QA 4M6OL 4R7NB 3B6SB 4ENED 1FORH 3TBTB 5D96B 2CKNA 3DJ9A 4DCQB 5KSVA 5FHBH 4IRZL 3GB7A 2EDHA 4NPYB 3WHXA 4JO3L 5AD0A 3ZDZE 1G7IB 3GMPA 3RTQB 5FM8A 2A73B 5DRWB 3D0VB 3H9SB 1UXSB 5H35B 4OCRH 1BZ9B 1IVLA 3CFIC 1JFQH 4L8BB 2CKBA 1JGDA 5IUSA 1S7XA 1N7MH 4JPKH 4U1NB 3T8XB 1F4AA 2C1OA 3F12A 2A1WL 3DX8B 5IVXA 1K3ZA 4P0DA 3AC0A 1WVZA 4PGCB 3MUHL 5DI8B 4ZSOA 4NRXA 4BQ8A 1KGCE 2A6DA 3QDGE 4O2EA 3U0WL 4HKXB 4JY6A 2C9AA 2ITDA 5H94A 2RB8A 1R6VA 5FO8B 1F45A 3HLAB 3LN4B 4ZNEA 1AP2B 5FKPA 4X7SH 3T3PE 1WJ3A 4OCXH 4Y5XB 5D5MA 1TPXC 2DQJL 3U0TA 5ITFA 4UTBH 3FQTA 3U46B 3I6GA 1JGEB 4PLOB 4JFZL 1K8DB 4OT1H 5EOCJ 2WP3T 4HS3A 1X5GA 3QIWB 4DKEL 2IANB 5EUOE 3Q5TA 4JFEA 3VFTA 1QFHA 5KJRH 3RWEB 3BN9D 2Q8AH 1PAMA 2DD8H 5FK9B 3ZT7A 4JHAH 2C7UA 4TULH 5T5FH 4X7CC 1T03H 4FQJH 2EXYD 5EBLB 5IBLC 3ARDC 3HC0A 1UEYA 2HG5B 5JOPE 3U83A 5GRJH 5E03A 1U2HA 5GRWA 4G6JH 1LDSA 3LKRA 2RHEA 2W65B 1XF4A 3BH8A 4YHNA 5HHOA 4D0CA 2NLJA 3VXRA 1I8MA 4MD4B 2FGWL 1NGPL 2CXKA 3I50H 5FM5M 1JCKA 1NFDF 1UH4A 3QQ4B 5SV3A 3QQ3B 1GGTA 3MPCA 4HKBA 2DWDB 1K8IA 2LU3A 1Z2KA 3BT2H 1T21A 3MRFB 4WW2C 3T2NL 1ZLVK 4NOFA 4P9HC 1FYTD 5JORB 3BO8B 1IL1A 3D25B 4ZPTB 5T1KD 2WUCH 1U92B 3LMJH 3CFJB 5JTWA 1FBIH 3SE9L 4R8WH 2VLRA 3V0WH 4PGEA 1XGYL 2ATPA 2IPTH 1FVEB 4L4TD 2E6PA 1KIPA 3AY4C 3ALXA 5IJVA 3MCG1 2VO5A 3Q1SH 3DLQR 3BHBA 5K9KB 3VXSA 4JLRA 32C2B 2GFBB 4I3SH 3QEGL 3DX6A 1GGUA 4ELMA 1X5JA 3QULA 1SBBA 1XR9B 4XPGL 4N5UA 2PYFB 25C8L 4DTGH 1IKNC 4O2FB 2HLAA 1FL6B 5LAXA 1OW0C 3MXVL 1YUHB 1AKJB 2FJHB 4J7RA 3FQWB 1DBAL 4GG8A 2W0PA 3EYSH 4QYOB 1C1EL 2JK5B 5D71H 5DVLA 2VUOA 1GPOL 4KI1A 1UB6A 5FYJH 1J0YA 2OTPA 3WN5B 4P4KD 3EOAB 4A2LA 5M95B 1DVFA 4ONFH 3JWOH 2E27L 5JDJA 4QOKE 1D6EA 3KYMB 3FQXA 5C0FB 1WFOA 3E8UL 4IM8A 2R8SH 2GJZB 5B8CA 4I3GA 2VN7A 3O8XD 3N1GC 2Y5EA 1QSZA 2J1KA 2CRMA 5ACLA 5KZCB 4JPIA 3Q6GL 1A5FH 4IRSB 3NBNA 3OKNB 3WFCH 2CJUL 3D9AL 2Z8WC 3L3IB 3TH3T 3D2UD 4P9HL 3RDTC 3SY0A 5KANI 4LCCB 4R97B 2QQNH 4OCSL 3QDJA 2Z35B 2WIIA 4PJIA 1JF6A 1FZJB 4TPRH 4IRJB 3DHJA 4RBPH 1CLCA 2F58L 1TJHL 4P23A 3RWCB 3QRFM 1VKXB 1D9KD 4XPHL 1YEDA 3O9WC 3A67L 4AMKL 5C9JB 4GRLA 3DWTA 2XKSA 1T04A 3LEVH 2ZUTA 3BZEA 2YUWA 4HUXB 4ZFOB 2D7PA 1Y6MR 3B9VA 3RVWC 3GSOA 1H15A 2W9EH 3F5WA 1T7ZA 4P59L 1F2QA 3CXHJ 4MAUL 3WXVH 5JXAH 1CDBA 4ONGL 2C3HA 1QRNE 4MA1C 4XHJC 1PKQE 1S9XB 3B5GA 2YWZA 2J6EL 3KAAA 1RIVH 2QQLH 3ZKND 3C8DA 3L3OB 3GRWH 1RJYB 4HXAL 1NL0L 1JYWA 3BZ4A 2NY4B 3RNQB 2PW1A 5LQBL 1QKZH 3ZKMC 4OCYH 1WV7T 3MRDA 3VXUE 3O4OC 3X14B 3VWKD 1C5CH 4EKXA 2HJKA 2OX5A 5GISH 5IW3A 1YEFL 2OTWA 4TVPH 1HEZA 1U6AH 3QDME 3TZVB 1DDHA 1MQKH 1SEQH 3VFWA 5D6CB 2VUYA 2VDKL 3HCVB 4RX4A 1JRHI 2ZCKH 3GSVA 3O6LH 1ZT4A 3JTTB 3KPMA 5K59E 3OJ2C 4OGYH 3BKYL 4YHYB 4YFEA 4I9WE 3BPOC 3IKKA 3G08B 2G5BA 4NQDB 2C3XA 4O5LH 4HDIA 4KMTH 1R0AH 4AENA 4QTIL 4C83A 4ZTOL 1J1PH 3PWPB 4NGHH 5BJTA 1K5NB 4FQXD 3WUZA 4EN3C 4PJ5B 2AK4E 3DROA 1XGQB 5HPOA 2Z31C 1XF5B 3CMOL 1XR8A 1YC8A 1F4XH 3LRSA 3MZGB 4K71C 2H6PA 2EIDA 5D1ZA 1GZPB 4ZFZB 3QEQE 1B0GB 1E4XI 1QSVA 4GUPA 4GQ9L 3VI3F 4Z7UB 3WO4C 4H20L 1BX2B 4ORGB 3AU1B 3O41A 1E27A 1DN0B 5C8JB 1IGIH 3CSYA 1EEYB 2BSRA 4LF3A 2FATH 5D1XC 3ZYZA 1MAKA 3ARSA 4M7LL 3GRWA 4QKXB 5E1AB 5IVZB 3O3DB 3UBXA 1XFPA 4EIZC 1DQDL 1KTRL 3E2HB 5I8CB 5B21A 2OL3L 4IOSD 3DHMA 4LLMA 2YSSB 3IDMA 4DGYL 1JUFB 4V1DB 1MJUL 4GW5A 3OKOB 2DJUA 2N7AA 5EIIA 4CN6A 3PF2A 4QWWD 2NQCA 4R4BB 2APBA 4G3YL 1VCAA 1F58H 3MLTB 1H0DB 3O3BA 1KN2L 1DEEB 1T0MB 4PJHA 1H3PL 3PWNB 2AJ3A 1E6OL 2I27N 2R2HA 4Z77A 1ZHKA 1IGTB 1QA9B 5ICXA 1KJMB 1WEJL 4GS7C 4KKLC 4UIMB 1LNUA 5EA0H 4BA8A 4JKWA 2ICWJ 3EW3B 4KXZI 3RZWA 3MJ9L 3QZWB 5IB3B 1IC5H 3GO1H 4N8CL 5EZIH 2Z92B 3BYTA 2B4CC 4X6DB 1TVDA 5MP6L 3GI9H 3ARGB 4UT9L 5A16B 5BW7C 4NJAL 3DIFA 1KELH 4QCIB 3RGHA 3SO5A 5L7XH 4FG6D 1QLFB 4LOUC 4P3DA 1P53A 4Q58C 2CGRH 5F9WB 1LK2B 3OJVC 5D7KD 4MNGE 3LV3B 3NA9H 4QGYA 3OPZH 4AJ0A 1BGXH 4J8RA 4QHLA 3WKML 4PRHD 1J7VR 2ZSWA 1QO3B 2GY5A 4NFCA 4E0RA 3R1GL 3ILPA 1A1OB 4I0PD 1Q9OA 3IDXL 4KFZC 4W6XB 4YHPB 1RUPH 5JMOC 4RIRB 1ZLWH 1JNNL 3ALPA 4L3CA 1JGLL 4XP9L 4UZGA 2H26B 2W0FA 4XCCL 3TBSA 2DAVA 4K7PL 3CIQA 5HYSA 1TCMA 1ZSDA 3OAZH 1DJSA 5A2JH 2NXYC 2CDEA 5JPMA 2V9RA 4KRPB 5DEFA 4Y4KC 3IFNL 2YXFA 4I2XB 3UDWA 4JO1L 4RAHA 3X3GH 2VR4A 15C8L 5F7FA 3MRQB 5KANG 3CDGA 1A6WH 1A7RH 2P5WE 1AGBA 3F58L 1PEWA 3O11B 3FQUA 5I8KL 4MDIA 5T3XE 1I7TB 5CMAA 4JZJB 5CCKL 1P84J 3CZFA 5DJDB 4OTXH 3SCMA 2V2TB 1JHTA 2HWZH 5EIQA 1RZ8B 4XPAH 3DI2B 5J9PB 5B4MC 3DV4A 4LSSL 1RFDH 3P3YA 3EZJB 4KDVA 5GGTL 3L3HB 1EO8L 2NZIA 3X13B 3QUMB 1EO7A 4OF7A 2KZ1B 3V7MA 1NLDH 3SJVE 3LQMA 4RMRA 3X12A 3ARBD 1OB1B 1ED3A 4G9FD 1DBMH 4JQVC 5GGUA 1KCSH 1TCRB 4E42A 3QO1A 2B4CL 5HVHB 5TE7L 2W9DL 3MZTA 1NBZB 1CXHA 4X6EA 4YX2H 4DQOL 1CICC 5E9DE 5TDNB 2WWKT 4JE4B 4P57B 3RRQA 4POUB 1UZ6F 5EU6E 5KSVB 2ZKHH 5IBLD 3GB7B 4FMFA 3ARDD 4PY7A 5BMFH 5BV7H 3WHXB 2F53B 3FOLA 3VI3E 5AD0B 3BD4A 4D3CL 3GMPB 1CFTA 5EULV 4TUKL 1BREA 4F57L 4L5FH 1YYLL 2JIXD 5CD5C 4TSCL 1XGPA 2CKBB 4M93B 3JTSA 1JGDB 2C4FT 1UG9A 1TETL 4ZPVA 5D96C 4MQ7A 3WL9A 2C1OB 3N1QC 3F12B 1H3GA 3RWJA 1G6RA 5IVXB 2JJWA 1ADQA 4XPBH 3I9GL 5FHAH 1UM4L 1ZGLM 4ZSOB 4YHML 4NRXB 1AD9A 2A6DB 4O2EB 5A2IH 4JY6B 1FZOA 4QXGL 2R0WL 4UBDC 2ITDB 5H94B 4IDLA 1RJLB 5TE6H 3DRTA 3BP6A 4P3CH 5F3BA 2LV4A 2OJEA 5FKPB 3ZE0F 1ZVYA 4KHTH 3DOSA 4LSQL 3HR6A 5D5MB 1PLGH 4YK4C 3U0TB 5ITFB 3ZHLA 3FQTB 2DLFL 5HHPA 2PYEE 1I1CA 4HS3B 5GGRA 2R4RL 4GKNA 2GHWB 4JFEB 4UILH 3VFTB 2G75A 2AK1H 2DMKA 5T3XL 1C8PA 3T2QA 5FDWA 4Q2ZA 2VDML 2WMPA 4JB9H 4YUEL 3NCYP 2C7UB 4XMPH 5D6DC 3UYRH 3MLRL 1HKFA 2MCPH 1PG7H 3O3EA 2MOVA 1RVFL 4YXLH 1OY3B 3HC0B 3ETBF 4PJ9A 1HDMA 3KPSD 4N5EC 3SEPA 4NWUH 1KUMA 4XC3L 3LKRB 4YHNB 1XF4B 3BH8B 4FQLL 5HHOB 1JYNA 4D0CB 1AIFA 3VXRB 1I8MB 1CL7H 4GKSA 3HNSH 3IU3A 3CFCL 1HHJA 1F2XK 2HFEA 3ZZ1A 3RKPA 1A6UL 1JRHL 1PBYA 4HKBB 1K8IB 1V3MA 2YPKA 1T21B 1CD1A 3WIFA 4ODSL 1VACA 1JHKH 1IL1B 4V2CB 2PF6A 3KVQA 5DT1H 4ZTPL 1IC4L 2R1WA 3UTSE 4QRRD 3VJ6A 1FC2D 4AZ8A 5FOBA 4L4VE 1MELA 4OD1H 2NY7L 1Z9OA 2VLRB 3S37L 2AJSL 4PGEB 5I18L 3MSPA 1CG9A 2ATPB 3CH8A 1KIPB 3C08H 3RDTD 3BAEL 2R56L 4NC1E 1NCAL 1NBQA 1E4XL 5IJVB 3MACH 2M1KA 3P73A 3OGOE 4LU5H 1DLFH 3ZKXC 4JKPH 3BHBB 3VXSB 4JLRB 3GBMH 3NFSH 3IJHA 4CUCA 4ELMB 5CZVL 2Z0BA 3O9WD 4HWZA 3MJ6A 1NCTA 2NCMA 4M5ZH 1IE5A 4LSRH 3B3IB 4LQFL 5C0BE 1MJJA 2OMBA 3LDBC 5BVPH 3C2AH 2HLAB 3D3VA 3RVWD 5LAXB 2A77H 3FN9A 1A7OH 3OAYH 2FR4A 1QEWA 2LTQB 3L3GB 4GG8B 4G8EA 4LVEA 1I8LC 3SE3C 3KJ4C 3NOIA 1IQDA 1UB6B 2D4DA 4LSUH 2BHYA 3GHEL 5BVJA 1DVFB 2EDRA 2W60A 4P2OC 3MV9D 3LEYH 1AXSA 4F9PA 1HH9A 4BSWA 1EA9C 3ZKMD 4Y2DC 5F21B 1D6EB 3S5LA 4DVRL 4NFDA 3FQXB 4WHYH 3TIDA 3GFUA 1UZ6E 4WUUA 3IS0X 1NMCB 5SX4I 4WU5B 1FZMA 4YDIL 4X4YB 2KH2B 3QO0A 1QRND 3B5HA 2G2RA 1MREH 4JPIB 5A43C 1RZIA 5LCVL 2ZJSL 3HPLA 3RIFF 1CI5A 1G9MC 1V05A 4E41D 3FRPA 5J12C 4LLQB 4FFZH 1VEMA 1AXTL 4HMEA 3SY0B 1RU9H 1A3QA 3SE4C 4R7DA 1KEGL 1Z3GH 4U6VH 4BZ2L 3EOYG 2WIIB 4PJIB 2R0LH 4C56E 4WTXA 1NC2D 3QDMD 3W5NA 5HDLA 4EN3D 1D6VH 4K23L 5GHWH 2CUMA 4JHWH 1YEDB 4WNQA 3RAJH 1RZ7H 2Z31D 4GRLB 2K3TA 1N26A 1ZTXH 4S10A 4UQ2B 1T04B 4NO2A 2J8UF 3BZEB 1ZT1A 4I9WD 2F54E 3GSOB 3NH7H 1H3VA 3IAGC 1H15B 3F5WB 4BSVA 4FQ1L 1RJCA 3O2DL 4TUOA 3ZE0E 3KYOA 4D8PA 1IEAA 3H3PL 3RKDC 1H3UA 1CD9B 3WFEL 1WZ1L 1U3JA 1UQSA 4NCC2 5J4MA 1N3NA 5D1XD 1PY9A 3BZ4B 4D9LL 2PW1B 2AS5M 1QFWH 4FQPA 4HAFA 5DHXB 3MRDB 3UXFA 3ET9F 2O5YL 4LLVA 4AL8H 2E7BA 4J23A 2HJKB 4C57C 2OTWB 1DL7H 2JLLA 2PR4H 3BIKA 4G9DA 1HEZB 1BLNA 1DDHB 4M6ML 3VFWB 1WAAA 2XZAL 1HWGB 4LCWE 1JK8A 2IG2H 4MJ2A 1NAMH 4ZAKC 3GSVB 1ZT4B 3TT1H 3KPMB 4U1IA 3U4AA 1FNFA 43C9A 5L88L 7FABH 3EYVA 3BVNA 4HKJA 4KKLD 1OAQL 1IGCH 2G5BB 1WQVT 4HDIB 3G6DL 3D39E 1B6UA 4AENB 2FLBT 4ODVH 3SGDI 4C83B 2ZSVA 5BJTB 3RWGA 2IH1A 4ODBD 5L8JB 3THML 3QG6A 4HIIA 3BKJL 1PKQB 5E5RB 1RUAL 3DROB 2H32A 12E8L 1U8QA 4GOSA 1E28A 1XR8B 3ARFA 1U8KA 3B9DA 3LRSB 4FQ2L 2H6PB 3HR5A 5D1ZB 4YFLI 4YHYC 4GUPB 4Y4HC 2XWBA 1G0YR 4YFLF 3V6OA 5EU3A 3G6JA 4LOUD 3QP3A 2AGJL 2LFGA 4X80H 5M7QA 4W68A 3O41B 1E27B 1XGTA 3J8F7 5CILL 3CSYB 3WSQH 2BSRB 4LF3B 4P2RA 2AABH 1KENL 3IVKA 3WS3A 1MFDL 2ID5A 5FO9A 3LHPH 4YWGL 2ZOKA 3UBXB 2D7TL 3UO1H 1X5KA 2IJ0C 2VLKE 4LLMB 3V9FA 1S7RA 2XTJB 3IDMB 3O6KH 3PJSA 4GW5B 3MODH 5ESAA 5EIIB 4JRYE 1A7NH 5LG1A 4TNWK 3SKMA 2DQCH 1QBMH 2BC4A 2NXYD 4OCWH 4Y4KD 3O3BB 4GSDL 1ZANL 1NAMA 4PJHB 1EBAA 4CVZA 3EOTL 4OZIA 2AJ3B 2R2HB 4Z77B 1IT9H 1ZHKB 5T1DH 5ICXB 5H2BA 1LNUB 4RGMC 2GKIA 3UYPA 1MAMH 2XA8L 3DGCR 4Y5VC 2FBJL 1FIGL 5DVNA 5KVEH 4NP4L 3PV7A 3NIFF 2L7JA 1FFQA 1FAIL 4R6UA 3TH4T 3GGWA 5B4MD 4DJMA 2XRAH 2G9HA 5F9AC 1P6AB 4OI8A 2FL5A 1KB9K 3MRJA 4HZLA 2P5WD 4GO6B 1A3RH 3DIFB 4J3VA 3CZJA 3GM0A 2XQBH 2KL6A 4P3DB 2AP2A 3WDIA 2ICWA 5E8PA 4H8WH 4MZ3A 4YDVA 3M07A 4J8RB 4QHLB 3QFJE 2XQYG 4PLKC 3B9KA 3MRBA 1DQLH 1OF2A 1QSFA 4E0RB 1CICD 3ILPB 2DQTH 1N2RA 1Q9OB 1UC6A 1P9MC 4L3CB 1QLEH 1AC6A 3S3PA 1IQWH 1OD7A 3TBSB 2J8HA 4KAQH 2J8UE 4R4NC 5HYSB 4MB3A 3VH8G 1P4BL 3FFCE 1ZSDB 4NCC1 5ELIA 1T66C 5DJYA 4AQOA 2CDEB 4EBQH 5JPMB 1M05A 5DEFB 3VG0L 4JFXA 1HKLH 1MF2H 4MD5B 5EZJA 1J10A 2YBRA 4NO0A 3P0VH 4NHCH 1FN4A 3CDGB 2EYTA 4L9LA 1AGBB 3FQUB 4MDIB 2X05A 1TVHA 1AQDB 5CMAB 3CUPA 3CZFB 3S34L 1DQML 3SCMB 1JHTB 5BRZA 1QR1A 3OF6A 2HVJA 4HLJA 3DTXB 3DV4B 1TJIL 4U2YA 4HS8L 2V17L 4LLAA 1A14L 3WFDH 1Y18A 4UBDD 4R9HA 1J9CT 1LGVA 3GHBH 3CXDL 5J6HA 4NQVB 1RUKL 2P24A 4XVUC 2NY6C 3T04D 3JUYA 2C5DC 1UWXH 5JW4N 5I1IH 3X12B 4PGBA 1UA6H 1ED3B 2ORBL 5FGBC 1CGSH 2P7TA 4UNTA 3O0RL 5GGUB 3BMVA 4E42B 3JZ7A 3QO1B 1W72H 2X4RA 4UINH 4BSJA 1X5XA 4X6EB 3QNZA 5HGAA 4PTUA 3WIHL 5C0RL 1UADC 3P40A 1KJ3H 4Y5YA 3ZYIA 3RWIB 1QLRA 3L5XH 5FCUH 1X5AA 4G5ZL 2APVA 5DFVC 4PY7B 2EIZA 2VLJE 4QRQA 3FOLB 1MRFL 3VFSA 5IB2A 3MBEC 1Q0XH 3IRPX 4OLXL 5AAMA 2DWEA 1CFTB 4G42A 4N5ED 1LEGA 2DIBA 1EJOL 1MCOH 1FG9C 4QHNA 5HVHC 1A9EA 4WI9A 3QIWD 1XGPB 1CK0H 3JTSB 2PCPB 3VXTA 1XMWA 3M45A 1A7QL 4ZPVB 3ZTJH 4MHHI 3FAXA 2SEBA 4PB0L 4MQ7B 5HYEA 3WL9B 3PV6A 3RWJB 2XXMB 1G6RB 5KW9H 5GGVY 4D0BA 3HZKB 4KJPC 4XNYH 1AD9B 5BZWB 1CGTA 4NT6A 4GRWH 3EDDA 4OM0H 3MV8A 1FZOB 3ULUF 4AEIH 3VFRA 3VXMA 3ALWA 1N8ZA 1L7IH 1KXTB 3QUXC 3DRTB 3BP6B 5F3BB 1MOEA 1FFNA 3EFFA 1GGCH 2VXVH 5EU6B 1QYGL 4PD4K 5ISZA 3BIBX 3MR9A 4HEPG 4WU7A 3QHZH 3KR3H 4W81A 4J3SA 2X4PA 1FL5A 5HHPB 3K7UA 4LRIA 3RPIA 5GGRB 3CVHL 4GKNB 4S1QL 1GOHA 2G75B 4S0SD 2VXUL 3S3JA 4HMDA 3NIFE 4JFPA 5FDWB 4Q2ZB 1RIUH 1CGUA 3BP4A 1CN4A 3NPSB 2WBJA 1VGEL 3O3EB 3FQNA 1N4XL 4PJ9B 1HDMB 4FMKA 4HCRL 5LWYH 2GTZB 2ATKA 5BV7B 3LEXA 1HSAA 1UACH 1AIFB 2Y07H 4K2UH 5HHXH 2EC8A 1OAYL 5T3ZE 3IU3B 3MROA 1HHJB 1DQQA 2HFEB 3W9EA 3FB6A 3WNPA 2Y36H 3JWDH 4BZ1H 2YPKB 4POZC 4OD3H 4Y2DD 1EXUA 4WUKL 3AS3A 4YBHA 1OSPL 3U6RA 1VACB 2P48B 3S35X 1ETZA 5HDBE 1AKJD 4GKOA 5HHME 1A21A 3CU1A 4TN9A 2DDQH 4DN3L 2R1WB 3O4LA 3VJ6B 4S1DD 4DKFH 1NCWH 4RGOH 3P77A 4CN4A 1NCDL 1JZ5A 5DXWA 3GSWB 1BBDH 3VD7A 3IDYB 5C9KA 1AJ7H 4WHTA 4ZS7L 1CG9B 1LEIA 5F9DC 1A6VL 5F6IB 1FH5H 3H9HA 5DEZA 2H3NA 5GGSY 4YDKL 1OLZA 3P73B 3PP4L 3BWAA 3V4PL 1HHIA 1PSKL 3IJHB 2IGFH 5CJ5A 4HWZB 2HN7A 3HE7C 4JG1L 1OCWL 1MJJB 1OTTC 2AJUL 4RMWA 3D3VB 4KHXL 5J1TC 1TXKA 4TRPH 4M48H 2GK2A 4KQ4L 3D5OF 3DUUA 2BDNL 2FR4B 1QEWB 4G8EB 3DETC 3BQUA 3DV6A 3RKDD 4NKIH 4IJ3B 5I1AA 1IQDB 5HYJE 5KG9A 1JZ8A 4PJ7A 1YEIH 1NCCL 3MYJA 2AV1A 1NBVH 5BVJB 3UMTA 2W60B 4M1GL 1AXSB 2OM5A 1JF1B 1VENA 4K3EH 5C07E 1HH9B 4BSWB 4PTTA 1W0YT 3S5LB 1M7IA 3P2TA 4UNUA 4BH8A 3TIDB 5DEGA 4Z7OF 4L4JA 4WUUB 4UV4H 4KVCH 4F8TA 1FZMB 3KLHC 4PJCF 3BRFA 3QO0B 2YN5A 4HFUH 2WP3O 4CVXB 3TN0A 4L8DA 1PD6A 2G2RB 3MGAA 4XVTH 3RWDA 3DRQA 3ELAT 4ZAKD 3F7RA 1FORL 3HPLB 5DR5H 3EYOA 4XWGH 4NBXB 1WBYA 2NY4D 3EFDH 3C09B 3RL2B 3ZE1F 1H3WM 1MVUB 1WWCA 4R7DB 2XKNA 4H0IA 4M7JH 4WI7A 3VGBA 3W5MA 3BGMA 5B8CC 3MMEB 1J0IA 3VG9C 1NMCC 3OQ3B 2F5AL 1QD0A 4JPVL 3B9AA 4OZGA 4WNQB 1ZT7A 1JFQL 1HZHH 4KKBD 1ZOXA 4Y19E 4NO2B 3GSNA 3ULUE 1ZT1B 4HIJA 2IBGA 3TNNA 1NPUA 4Y4HD 3T0EA 2J2ZA 3TJEH 2E7CA 3OV6A 4BSVB 1WFNA 2VXTH 4NO5A 4TUOB 3KYOB 4D8PB 2EECA 1IEAB 5I76A 1P5VA 3HI6H 4HIXH 3PWPD 4MNQA 2VIRA 4X83A 1UQSB 5K33A 4L29A 3ULVH 4EEEA 1MFEH 4P23C 1YPZF 2CDGA 1N3NB 2YPLA 4MHHG 2HJFA 4WWKA 3HFMH 4KY1H 4GBXA 3O2WH 2BVPB 4GRLC 4P3WA 4X7SL 1AQKH 4UI2A 5FYJE 2DIAA 4NQSA 4OCXL 4LLVB 1NEZA 4Z7WF 4KJQC 4I77H 1BQHG 4FZEH 3BIKB 4J4PD 4G9DB 1BLNB 5C0IA 1DLHA 1W8NA 3VRIA 1JK8B 3VGGA 4KMQA 4CVWA 1DZBA 5KJRL 5IM7B 2DM7A 2Q8AL 4JHAL 4Y1AE 1KEMH 4ODWA 4WFED 5CGMA 1FCGA 1RPQA 5T5FL 4FQJL 43C9B 4X9GA 3EYVB 3RP1A 4OBRA 4IS6A 1QSEA 3P9WB 4NQEA 4BUGA 1CLYL 2AJZA 3KLAA 2VLKD 1BBJA 5GRJL 1NFIA 3A6BH 4I18C 1HNGA 2ZSVB 5TPWH 4G6JL 1R3IL 3RWGB 2BOBA 2IH1B 4U3HA 3UTPE 5IMMA 5CP3A 5FYLH 4Q0XH 3QG6B 2XA3A 1CXFA 5LGJA 5KTEH 2H32B 2ZUQB 4M9PA 1U8QB 1V7NL 4M8VA 3I50L 3AM8A 3P30H 3ARFB 1F4YH 1U8KB 3MLVH 3QNXA 3MCLL 3HR5B 4UB0H 1QBAA 2EH8L 3BT2L 1EEZB 4XHQA 5I9QB 4ZS6C 2XWBB 1JZ2A 3P9MA 4IMKA 5EU3B 3G6JB 4PR5A 4XXDA 3TYGH 3S37X 3B5TA 2VXSH 4LCWB 2CMRL 1XGTB 2XWTA 1AO7E 3W9DA 1OGAE 3FN0H 1N6UA 1FBIL 3IVKB 4X5XB 3WS3B 2ESVA 3RVXC 3HI5L 3WDJA 1F00I 1QVOA 4PLKD 4R8WL 5FO9B 3QXTA 4ZO9A 1CE6A 2DL2A 2IPTL 2ZOKB 2IWGA 4PY8I 2F5BH 4MA8L 2E7MA 4U6TA 1S7RB 4PRDA 3CLEH 3PJSB 1KNOA 4FZ8H 5ESAB 5C0JA 1KG0B 5JW3H 3F6IA 5CJBA 5CWSB 3SKMB 3U4EA 1T66D 4TVPE 2BC4B 1UJ3A 2UZYB 2MQ3A 3ULUL 3TGXA 1T1ZB 1NAMB 5CFHA 4CVZB 3U7WL 4Q9RL 3GSUA 5H2BB 4YIQA 3VCLB 4DGIH 4DTGL 4ODTH 3GSQA 4HBCH 4PJ8A 1K6QH 1CIUA 2AJVL 3NAAL 2ITCA 1MFBL 1DQJA 5IBTL 4P49A 2YK1H 5KSUA 3QJFB 5ADOH 3GGWB 4OZHA 5D71L 2LAGB 4F58H 2G9HB 2BXZA 5FYJL 4R2GC 2FL5B 4PJCE 4TSBH 4ONFL 5EFIA 2FH6A 3MRJB 4HZLB 1MRCH 4GFTB 5E70A 5ILTL 3P4LA 1UYWH 5F7YC 4E9LA 4NSKA 4D9RD 2NY6D 2R8SL 3BPCA 5FUOH 1BIHA 1KB5L 1OL0A 3LH2L 1M6OA 4S2SA 1CXKA 1FVDA 2ICWB 5E8PB 4HH9A 1YN6A 4YDVB 2XN9A 1F8TH 2A9MH 1T6WA 4OFYA 3C5ZA 3B9KB 3MRBB 1OF2B 1QSFB 4WTZG 1U2CA 1FGVH 3WFCL 1FSKB 4BK5A 1X3DA 5C7XH 1BM3H 2AKRB 5F7MC 4EUPG 1BFSA 2R2BA 4Y2OA 2R23A 3CFBA 4M3KB 5DFVD 3X3FH 1N6QH 4XX1E 2R4SL 5DJYB 3MBED 1M05B 2EH7H 1DFBH 2OJZH 4JFXB 5J57B 5EZJB 2YBRB 4NO0B 3SDYL 5KOVC 2Z93A 3LEVL 1TQBB 4QRTA 5DC4B 4HXBH 1FN4B 3BE1H 3EDFA 2EYTB 1LVEA 3BSZH 3H7BA 1YPZE 4HF5H 1TVHB 1IBGH 5JQ6H 2W9EL 4JZNA 2FLRT 4AH2A 4ALAH 1LQSR 5L0QB 4CAGA 5BRZB 3VMPA 4OZ4A 2HVJB 2VLJD 3WXVL 5JXAL 2D7MA 4F80A 3FCTA 1CS6A 4KJPD 4Z7WE 5HHNA 3QFJB 3O6FA 3H2WA 1EJ6A 1JTTA 1RIVL 1A9BA 4XX1G 3UDWC 1Y18B 1XT5A 3D18A 3QUXD 4JRXA 2KUTA 3TJHC 3CDCA 1QKZL 2DQUH 1ORQA 4OCYL 1RAMA 5J6HB 3AREA 2P24B 1C5CL 1YYML 5D7LA 4X8XA 5D2NA 4TVPL 4PGBB 3SCMC 3UPRA 3TBVA 3DMMB 1SEQL 2X4RB 5BCAA 1RZFL 5HGAB 3QNZB 1Z6JT 1F02I 3N1FC 1MJ8H 3HC3H 1S9VA 1OPGL 4M4RA 4OGYL 1CDHA 3GJFH 2MNUA 4MA7H 1HXMB 4Y5YB 1CLOL 3W11C 1QLRB 4KMTL 2GSIA 2VRAA 1R0AL 2EIZB 5SX5H 4PGJA 4QRQB 3VFSB 1U3HA 5F93C 2MFNA 3GK8H 2DWEB 4G42B 1BFVH 1YN7A 3D1MC 4YJZL 1CLZH 4QHNB 1A9EB 1F4XL 3RX8A 3TA3C 5BS0A 3GMLA 4JFED 1QFUL 5IK3A 3VXTB 4OKDA 4FXKA 3J7HA 3BN3B 3PV6B 4LDOB 5DUPL 4Z95L 4MX7A 5CSGA 1ZA3A 4POZD 2QSCH 1U93A 4D0BB 1MHHA 4OFIA 1IAIH 4NT6B 1T83A 3VI4F 5IW6A 3C5JA 3MV8B 3MXWH 1IEHA 4JFHE 2DI8A 2FATL 3VFRB 3VXMB 5L6YL 5HHOD 1N8ZB 1A6PA 1L0QA 2DYPA 3VXRD 3WJLC 1TZIA 3A6CH 2VR9A 1FFNB 1E6JH 4IHOA 4Z7VE 4NM4H 2IC2A 3P4NA 3REVA 4WO4B 5ISZB 1JPST 4Z0XA 3VXOA 2D31A 3ZSTA 3MR9B 4WU7B 1HHHA 1IAIM 1CFBA 3IFOA 4M7ZC 5IBUB 1U8JA 2X4PB 4H1LG 3RUGE 5JXEA 1FL5B 4JCMA 3RPIB 5E6IA 1F58L 3AB0C 3EYQC 4PG9A 1G9EA 5J1AA 4JFPB 1AHWC 3BP4B 2EXWC 5EA0L 5J11B 5SWZA 1KXQE 2PKDA 2WBJB 3HE7D 3GJFA 5MI0B 1BHGA 2VLRD 4N8VG 4Y4FA 1N6VA 1NSNH 1OTTD 3SKOB 1CDIA 1OSZA 5DURB 4Z7NE 1IC5L 1UXWA 4Y16C 2F8XC 2ATKB 3GO1L 4NNXB 3LEXB 3N85H 1HSAB 4U6XA 3AS0A 3KNBA 2X09A 3DETD 4YR6A 2R0KL 3VXSD 3MROB 4HUVA 1DQQB 4JFQA 3IF1A 4LSTH 1QFPA 3RL1A 3W9EB 1A02N 3FB6B 1FDLH 3NPSC 5E4EB 5GJTH 4QT5A 5I1LA 1MCNA 3CK0L 4YDLC 2WANA 5BOZG 3RIFK 4S11A 2CGRL 4PJ9C 1CGWA 3WUWG 2CD0A 3U6RB 1ETZB 5BV7C 3VD4A 1RZJH 3NA9L 5L2KA 3OPZL 1BGXL 4MJIA 4I48A 1YEKL 2QQKH 3KLHD 4W6WB 5HYJD 3EHBC 3SDCC 3P77B 5DHVH 3HMXH 3L5IA 2WWKO 1FIEA 3A0OA 4WHTB 1RUPL 2XIDA 3L95A 4JGJA 5C07D 1DVFD 1FCCA 1LEIB 5FB8A 1NC4A 3H9HB 2H3NB 2ADGA 3OBAA 3QG7H 4JAMA 3BKCH 3VFOA 3LVEA 2ADJB 4JM2F 2UUDK 2NTSP 4XBPA 1T7YA 1QFWI 1BP3B 2B1AH 3BWAB 3X3GL 5J06A 2D03H 1K4DA 4XVJH 5FECA 2HN7B 1Y0LA 1A6WL 2WNGA 4MB4A 4JN1H 2B1HH 2A9NH 4XZUA 4OTXL 2R2CA 3MV7E 2AV7A 3DUUB 2L4OA 3F7PC 4OCLC 4XPAL 1OAUH 5FUCC 3BQUB 3DV6B 3QDJD 3EJYD 3UJIH 3FHQA 5I1AB 4OZIF 5KG9B 4PJ7B 5GXBB 1RFDL 5C0AA 3RJDA 4XB8A 1A4KA 3MYJB 4P23D 2AV1B 4MQXC 3LIZH 5IVNA 4RDQF 3LQZA 4Y19D 1IC7H 4KZDH 2FO1A 4XNZB 1IGFH 4GRLD 5FYKH 1Q0YH 2UZIH 1NLDL 3SKNB 4Y8DC 4QHUA 5JIKA 1M7IB 4LEOA 4LNRA 3JVGA 4KJQD 1B4JH 4BH8B 5GRVL 1DBML 1KCSL 1CIDA 3U9UA 1R3HA 2ENSA 2ZUUA 4KUCD 4L8DB 4J3XA 4YX2L 3RWDB 4RWYH 4LCIL 3TN0B 2OP4H 3DRQB 4P5TB 4JANA 4LHUA 4DFIA 3HMXA 5I8OL 5DMYA 3HAEH 5JDSA 1UWGL 3EYOB 3C6LA 3LKNA 1WBYB 1KV3A 5FYJD 2ZKHL 5EG6C 4F9PC 1NMBH 1MWAA 4IDJH 4PJEA 2XKNB 4X99A 2VDLH 1E0OB 1U8MB 3MBXH 4L5FL 2Y06H 3ZDYF 4OZGB 4N0RA 5B39A 1ZT7B 5K9JH 3VI4E 2WV3A 4GMTH 1MY5A 1SHMA 5B38A 3GSNB 1MCCA 4KI5C 5I73B 4HC1A 4HIJB 1LEKA 2XACC 2Z4QA 3TNNB 3T0EB 3U30B 5FHAL 4ZUVA 4NO5B 3V7AE 1TITA 4ZS6D 4LKCA 1KCVH 5I76B 3A6OA 4HJJH 4MNQB 4I8DA 3BGFB 4XCFH 5FIEA 4PRIA 4L29B 5TE6L 2H2PC 4L3EA 2CDGB 2YPLB 1DBJH 4PJDE 3KLSA 4WWKB 4GBXB 5DMGC 6FABH 4PS4H 4KHTL 4LIQH 4NQSB 1IAOA 1NEZB 4Z7QE 1PLGL 3UTTA 4MVBC 1OP5K 4M62L 2GJJA 1QG3A 4JFFA 3V7AG 3OKLB 5C0IB 5FOJA 1MCKA 3ZE2F 3VRIB 5IHUH 1AO7D 5T5NF 3O6MH 4UILL 4YHIA 3ROLA 3MRHA 4JB9L 2QHLA 4XMPL 3BIAX 4ODWB 4F9LA 2HP4A 1BZQK 3UC0H 3HAEA 4H0GA 2MCPL 1PG7L 4NQEB 1QSEB 4YXLL 3IGAA 2AJZB 3KLAB 2DS4A 1BBJB 1NFIB 2AEPH 4JFYA 4G7YL 4NWUL 2XTJD 2BOBB 4XAWH 5JOEA 5IMMB 2WAHA 2ADFL 2ZCHH 1H8SA 3QYCA 2A2QT 4TVPD 5LGJB 1CL7L 4MXVF 4WHYG 3HNSL 2ADIA 3QHTC 4WEUD 3QNXB 4FQQA 1MLBA 5CLWA 3LRHA 2V9QA 5IEKB 2VAAA 5DVKA 3L3DA 5E8OA 3V8OA 5E5UB 1MIML 3P9MB 1VFAA 1AGDA 3KPRA 4PR5B 2AEWA 4XXDB 3RIAF 4YH6A 3BESR 2B7DT 4N9GA 2H45A 2XWTB 4M6AA 3W9DB 4Y1AB 3W0WE 2ESVB 5CEYA 5EORH 1OTUC 4OD1L 1QVOB 2IPUK 1PX3A 3PL6C 3VWJC 5IFJA 2CIIA 3WJJA 5I2IA 4PJAA 1CE6B 1AGFA 4QRPA 3OG4B 3MX0A 2CK2A 3OXRA 1MHCA 4PRDB 5D93B 1KNOB 3MACL 5DK2B 5C0JB 1X5FA 2QV2A 4LU5L 5C08A 1DLFL 4JKPL 3QWQB 1UJ3B 5SWSE 2ZUWA 4GG6F 5IQ7L 3NFSL 2DQGH 4O9HH 1YMMA 2DLIA 4JM2C 4OGZA 2K1MA 4M5ZL 4ISVA 1ZKAA 3GSUB 1KPUA 2I5YL 1G0XA 2VLME 1FPTL 3GSQB 1TVBA 4PJ8B 2A77L 3FKUS 3ROOA 1A7OL 4XWOC 3T65B 1ZLSH 4APQA 3HMWL 1DQJB 3OSKA 3VFGH 3KXFA 5IF0A 5KSUB 1I1AA 4OZHB 4ZMAT 3HG1E 3O2VH 4LSUL 3V52H 4KKAC 5EFIB 3LEYL 4HQQH 1BQLH 1J8HA 1J1OH 3SBWA 1TDQA 5IT2L 4LSDA 1LK3L 3BPCB 3VFPA 5DWUL 4JVUA 1M6OB 4PBWD 4S2SB 3SCMD 4RDQG 4HH9B 1KLGA 1YN6B 1LHZA 3L1OH 1JIBA 1JNLH 4NFBA 3G9VA 4NWTH 2XN9B 1MREL 3QCUH 3C5ZB 3D0LA 3U79A 2Q6WA 4FFZL 5GS1B 4XB7A 3ZDYE 1RU9L 2BNQA 5I1DA 4LEXL 3W11D 1FNGA 2R2BB 1NUGA 2BNRA 2R23B 3CFBB 4PGDB 4GRWF 2R0LL 3QIUC 3MREA 4JO2H 1D6VL 3NVQA 3CVIH 5DFWH 5GHWL 4JHWL 3RAJL 1KTDA 4MXWH 1CQYA 1VEOA 2YRLA 3QPXH 2Q86A 2Z93B 3Q6FA 2YWYA 2P8LA 4LPCA 1FFPA 3H7BB 1FC1A 4F2MA 3NH7L 1SJVA 3LN9A 2O61A 4JZNB 4AH2B 2VL5A 2D0HA 4RRPA 2W0KA 2F9BT 1INEH 2WBKA 3FCTB 3AS1A 2E6QA 5HHNB 1I7UA 3O6FB 1A9BB 4FHBD 3EO0A 5A1AA 2D0FA 3D18B 4JRXB 4P5KA 3VA2C 3ZE2E 1QFWL 5F88A 1ORQB 1TQBC 2QSVA 4Q6IA 1I8KA 4L9LC 4AL8L 4WEBH 3AREB 4PJFA 2B0SH 4URTB 5D7LB 2A6IA 1EK3A 5D2NB 5IKCA 2BY2A 2C4XA 5L0QC 1WT5C 2PR4L 3I6KA 4NDMA 1CGVA 3UPRB 3TBVB 3BRGC 1MCIA 3EO9H 4LLYA 2N7BA 2IG2L 4JFHD 5DK0A 5F44A 2X4UA 2A0LC 1S9VB 3QEHA 4X8JA 5KS9F 4MXVE 2EXWD 1IGCL 4HBQA 3TNMA 2FEDC 2BHUA 2GSIB 3U0PA 1HYSC 1P1ZA 2NR6C 5E08H 4F33A 4Y16D 1YN7B 3IDNA 2NX5A 4XNXH 1RJZA 2RCSL 4H8WC 1XF1A 5BS0B 4RBPK 5ALCL 1GC1H 1T5XA 1FO0H 3GMLB 3WV0A 3V4UH 5IK3B 2DRUA 4FXKB 1Q72H 2EZ0D 4MX7B 1ZA3B 4NO3A 1CU4L 4W6YB 1U93B 1X4YA 3C60A 1U3ZA 1MHHB 4P2QA 4PJ9D 1H9VA 5IW6B 3C5JB 4HJGA 1CE1H 2AABL 2UYLA 2K7QA 2EDBA 2FH8A 5CEZH 2DYPB 1D3CA 4CADA 5EPMA 2HFGH 1TZIB 3EHBD 3SDCD 2XY1A 4L8SA 4Z18A 4EI5A 2D0GA 3LHPL 3K81A 4IHOB 4GG6E 5ACMA 2PTUA 3UO1L 3P4NB 3REVB 4Z0XB 3VXOB 1NKOA 2D31B 5C6PB 4GRMB 2WUBL 1HHHB 2VSDA 4LPWA 1U8JB 4PYHA 4Q97A 4CMHC 2FYYA 4LFHD 4OCWL 5E6IB 1YNLL 3MLWH 4PG9B 4MAYA 4LRNH 1QBLL 5J1AB 4XP5H 1IT9L 2NY3C 5T1DL 3LKPB 5DFTA 4O02L 5SWZB 5DC9B 5F7KC 4CN1A 4CU7A 1MAML 3GJFB 3GSRA 3SGKC 1VFOA 4Y4FB 2CRIA 3CDYA 1OSZB 1H8NA 5DMIH 5KVEL 2GJ6E 1UXWB 1B4RA 1R24A 3L3JA 1EHLL 4U6XB 3EGSA 3MRMB 3KNBB 1FE8H 4LRIC 2XRAL 4YR6B 5F7UA 4OLVH 2VZUA 1O0VA 4HUVB 4JFQB 2KKQA 2KQMA 4Z7VB 5C0CE 3C6SA 3RL1B 2AEQH 1A3RL 3D6GA 5J11C 1EFQA 4QT5B 5MI0C 2EDOA 1OT2A 2YUZA 3HI1A 4DAGH 1E4WH 2OSLA 1T3FA 5I15L 1SM3L 2XQBL 3KS0H 3ESUF 5H37G 3RUGB 3MV7D 1MIEH 3K1DA 1FNAA 4P46C 4PV9A 3B2UC 2AXGB 1KSRA 2EYSA 1SJHA 2V7HA 4H8WL 4P9MH 4RFOH 5L2KB 4MJIB 4I48B 5EU7C 3RU8H 4KWUA 5ENWA 2DQTL 3TEUA 4Z78B 5ECJE 1XIWA 2EDXA 2XYCA 5DZLA 2BNUB 1QLEL 2MQCA 5HD8C 1GYAA 5CBEA 5FB8B 1IQWL 1GSMA 1NC4B 4CDGC 1F6FB 2ADGB 5ABDE 3HN3A 4JAMB 4NZTH 1JZ7A 3VFOB 3ZTJG 5CD3A 3T4AA 5GS0L 5FUZH 4XBPB 4PJBF 1HKLL 1MF2L 4AEHH 5BO1H 2MWCA 2YRZA 3GIZH 3I6LE 3P0VL 4O58L 1K4DB 1BVKA 5FECB 4JQIH 3ILQD 3ZHKA 1J0KA 4KI5D 5B3JF 5C09A 2Q7YA 2B5IC 3PQYA 1MCWM 2AV7B 3ZHDA 4U33A 3H9YA 1DN2A 3TBTA 4J6RH 3H3BC 1KLFA 2VDPH 5C0AB 2AJYH 1NKRA 1A4KB 1RUML 2H2PD 3GHBL 4YLQT 3LQZB 5TPWL 3GNMH 5J8OA 2YD4A 3NCYS 1LO0H 2BY1A 4QHUB 5I1IL 4LEOB 4LNRB 3RTQA 4GT7A 1CGSL 4Z76B 5KS9E 2RIKA 5DRWA 4MVBD 5DLMH 3U9UB 1LWRA 3I3BA 3EAKA 4XPFH 1W72L 5MENA 1R3HB 1KJVA 4ODHH 2ZCLH 3FOMA 4U1NA 3EDKA 3IU4H 4JANB 4LHUB 3B8SA 5DD3H 1FLRH 5JDSB 3C6LB 2DLTA 3L5XL 5FCUL 1UH2A 2R0ZH 3JWDC 1MWAB 1ZLWK 3S4SA 4PJEB 4X99B 2Y4SA 1MI5E 1IAMA 3ABZA 4RMVA 1MCOL 3OAZK 1KC5H 2MMXA 1AP2A 1R5WA 5B39B 5IG7A 4JREB 1CF8L 1CK0L 1T2JA 1YNTA 3U1SH 3ARWA 5B38B 1LEKB 4OFDA 2ZWLT 4PJGF 1DSFL 1N5YH 1ZK9A 2HKFH 2HLFC 4OI9A 4NUGL 4ZUVB 1FNHA 4LKCB 4JO4H 2AI0H 1AI1L 5E8NA 4GLRI 4PRIB 3FT4A 4KK5D 3TLRA 1L7IL 4UDUB 1RZGA 4L3EB 3QXDB 2FO4A 1OTUD 4KRLB 3PL6D 3VWJD 4O51A 5I73C 1IAOB 2BSSB 3BEWB 3QHZL 3NCEB 3UTTB 5JR1L 4EQ3A 1KCRL 4JFFB 4R3SA 5D2LA 3DBXB 1XF3A 4JQXC 4U1KB 4YBLC 5GRVK 2GITA 4HAGA 3BGFC 3QQ4A 4K3JL 4YHIB 3ROLB 1KPRA 4NM8H 3TV3H 1ZE3C 1RIUL 3W0WD 4P2RD 3O3AA 4JM2D 4LARH 2LVCA 1RMFH 3HAEB 4NNPH 4X6CE 2GUOA 3UTZB 4AM0A 3IDJA 4YBQC 4J3WA 1I3RA 4M6NH 3IGAB 5DYOA 5LWYL 4XWOD 4JFYB 1QUNA 4WFGE 1G7LA 1P4IH 3L9RB 4K2UL 1MCBA 5HHXL 4LVHB 5SWSD 2PTVA 4PJDB 2ADIB 2GW5A 3E3QC 2J88H 4FQQB 1MLBB 3L5JA 2VQUA 4KKAD 3JWDL 5E2TH 2BX5A 4BZ1L 2VAAB 2HH0H 2VLMD 4OD3L 3L3DB 1DP0A 5E8OB 1SY6A 4MYWB 2PNDA 4OGXL 5LXGH 1VFAB 1AGDB 1HE7A 2Z8VC 2EEDA 1S9WA 4P5MA 1J0JA 2DDQL 4RGOL 35C8H 4RWHA 5CEYB 1BBDL 5L8LB 1GHFH 1AJ7L 4L9DA 4PJBE 2CIIB 3UEZA 4OQTH 5I2IB 1FYTE 4PJAB 1AGFB 4QRPB 5I1CH 2AERT 1FH5L 5L9DH 3OXRB 1MHCB 5AWNH 4IMKC 1TNNA 1R5IA 5B3JE 5IEHA 3F7VA 4OLEA 4PBVC 3FONA 3R06A 1CXIA 3QIUD 5I1JH 1YMMB 3ULVC 2BY0A 3GMRA 1UCBH 4L4TE 3P4MA 1MHPH 1G7QB 4U7KA 1QSFD 1KPUB 3L7EB 2GQHA 1TVBB 4M48L 3WNNA 1QACA 3OXSA 4APQB 3R8BB 5D93C 1CVSC 1DQTA 1J88A 3KXFB 2VR5A 2Y5TA 4IRSA 1I1AB 4HZAA 5D72H 1WBXA 1HHKA 1YEIL 5CGYC 2WLYA 5JW4Q 1NBVL 1GAFL 4M7KH 3SDXF 5KBNC 1J8HB 5TGBA 4PJ8C 1NCBH 3W82A 2E7LA 1PYWA 4KVCL 3G5ZA 5BZDA 4LL9A 4GAJH 1FGNH 5TH2B 5BRZD 2VH5L 1KLGB 3OF6D 4P48A 4HFUL 3HUJF 3KPPA 4XVTL 2H41A 4HUXA 5D7IA 3D0LB 5JO5A 2Q6WB 3V6BR 2A0LD 4XWGL 3CLFH 1EAPA 4YGVA 3TWCL 3RZCA 1MCRA 3EFDL 2BNQB 5I1DB 3QHFH 1FNGB 2PXYA 4MCYA 5DA0B 2BNRB 2FEDD 4M7JL 4QXWA 1VA9A 1HYSD 2NR6D 3NACH 4PJGE 4UT6H 3NFPA 1RJYA 3MREB 1A1NA 3Q48A 5GRUL 4N0UE 1BVZA 2JELH 3DXAA 3EKCA 4O2CA 4ZOAA 1KTDB 2WWMC 2AAVA 2ERJB 5I71B 2Q86B 4DZ8A 3Q6FB 4FTVA 3RGVB 4XBGB 1FV1A 1FFPB 2VZTA 2I60L 1T1YA 2JCCA 5CAYB 3PUCA 2YR3A 4IIQA 1IZKA 3RY6C 1S9KC 2VXTL 2VL5B 3BRDA 5I19H 3HI6L 1JF5A 4J2XA 3JTTA 3OAYK 4P4KA 1JI1A 1TNMA 1MFEL 4R0LA 3HFML 1B2WH 3M8OH 3BPNC 3EO0B 1P2CA 1MCPH 4P5KB 4NN7C 3RWFA 4YQXL 2Y7QA 1HCFX 5F88B 4Q6IB 5JIPA 1W8OA 4IMLA 4PJFB 3BW9A 3BYYA 2A6IB 4FZEL 1VERA 5IKCB 4PJ5A 1S8DA 3GJEA 4NDMB 3I6KB 3DX7A 4LLYB 3MJ8A 1PG7X 4OIAA 1MFNA 5JHDA 1CBVL 2H1PH 2K9UA 3VXPA