3QWUA

Putative atp-dependent dna ligase from aquifex aeolicus.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
366
structure length
366
Chain Sequence
ISPELVKEALKKKKVRSEEAFGLEYLRFNDDYKDIPRGTAIFKDFIIWGYPHIGRIFLLETGLREQFEAPFWVEEKVDGYNTRIFKYGDNYYALSRGGFICPFTTDRLPDLIDLRILDENPDLVICAEVAGPENPYIEESPPYVKEDVQLFVFDFMKKNEQGFLSQEEKMELIEKYNLPHVEILGRFTASEEGIKKIKEILKRFNEEGREGVVFKEDSERNKRAKYITSYANLMDIKTNAKNMLQLPPEYYTNRILRLVLFMYEEGLKTTEHLYEELGRAFIDGLFQAIEQFEKEHKVYKTFTCKFRKKENAIALLELLSKTSKHIQVKERRLEKEGDYWRLEFDKVFLNMTGLLGHLLSGGIVYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Putative ATP-dependent DNA ligase from Aquifex aeolicus.
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords DNA ligase
total genus 116
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18330 Lig_C Ligase Pab1020 C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.320 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3qwuA01
3.30.70.2160 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qwuA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3qwuA02
3VNNA 4EFEA 3UQ8A 3PN1A 3BABA 2HVQA 3L2PA 5FPOA 2CFMA 2Q2UA 4UCVA 2HIXA 3GJXB 1CKNB 4LH6A 4PZ6A 4GLXA 1CKNA 3BA8A 3TY8A 1DGSA 1V9PA 3NBYB 2OWOA 1XDNA 1CKMA 1FVIA 4PZ8A 4UCRA 3BAAA 1A0IA 1CKOA 2VUGA 3W5OA 1X9NA 4UCSA 5D1OA 4UFZA 4EFBA 1XK5A 4LH7A 3GB8B 5D1OB 1P16A 1VS0A 4PZ7A 4UCUA 3TY9A 3W1BA 4CC5A 3GDEA 4CC6A 4DRFA 2HVRA 3NBZB 2HVSA 1S68A 1TA8A 4E6NA 3TY5A 4UCOA 3KYHC 1B04A 2HIVA 3RTXA 4EEQA 1P8LA 3BA9A 3QWUA 4EQ5A 3RR5A 3NC0B 1TAEA 5D1PA 4UCTA 3S24A 3W1GA 5DISC 5FPRA 3JSLA 2Q2TA 3JSNA
chains in the Genus database with same CATH superfamily
4CMDA 4DV7J 2KJWA 1RHKB 2W2NP 5B0GA 2RPRA 2ALZA 4O7SA 2AWZA 1VQ41 5D1OA 3F56A 2HRTA 4I7FB 5E25A 2IP4A 4H4MB 1YJ9Z 1WKLA 4PXBA 1ZPWX 5E41A 1JWHC 5LJ3Y 1IKWB 2CADA 1TKTB 1JLEA 1TL1B 2CKWA 5B0EA 4FU0A 2OPPA 4URSA 1CVJA 2X3GA 2XZDB 1QVGR 1W26A 4FKXA 4M5JA 3DI6A 2JA6I 3CSKA 3FQQA 1U09A 2FJEB 2NU6B 2RBLA 5HLFA 5KFXA 3DRRA 2VFUA 4NBAA 1WIIA 1XIQA 2ZBRA 1H38A 2ATLA 2UXBF 3HSJA 4LSZB 4CM2A 4WYLA 4F26A 5HMYA 2CNLB 2OJ3A 1MWZA 3PX6A 1NK4A 3CJ2A 4F25A 1RT6A 2R7TA 3PJWA 2XI3A 2ZHOA 1BD6A 1S72Z 2CPIA 2QFJA 2YQ1A 2J6SA 1OYDA 1TKTA 5A8WA 4UOCA 5CYMA 1ZM2A 5LMUJ 3C14B 2QF7A 3A13A 3ZTRA 1NEEA 4A3LI 3EZ5A 2A0FB 1UKUA 2VBYA 2BXJA 4NLYA 2CPJA 2MZSA 1Q53A 4FNHA 2NXJA 4CLPA 1HWLA 1K8AT 1U6FA 1GGOA 1VQKZ 4U7CA 3GJSB 1FKOA 2JHEA 4C9DA 4J9KA 2MLXA 3QT6A 1K731 4FXWA 4D3GA 3NGKA 1MWQA 2QG9B 3DGPA 2ZD1B 2KXNB 1SC1B 3PCOB 1B4SA 3Q24A 2OTLS 3TE5B 2GV1A 5DMXA 4ED0A 3HOXI 5F8JA 4ME6A 2VIHA 1S1VA 2DH7A 1JXEA 4MKYA 4OI4A 4QYZJ 2E1AA 1U0HA 4A93I 1VQPS 8AT1B 2C22A 5CA1F 1YWXA 3EXCX 3EGNA 2GU2A 1CC7A 4K5SA 2W9CB 2D3UA 3KJVB 4Y2KA 1RCXB 5CAEB 1KJQA 2JZ5A 5GAHI 5KFCA 4PXCA 2ZBCA 5HQMA 3KHLA 2HHWA 4RX6A 2O3DA 2XLIA 1S1XB 3FKBA 4ZP6A 1NKEA 4R0JA 3VGVA 2FHJD 4KGZB 1BGXT 1T9TA 1HQUB 4EWTA 2LECA 3E01B 4B3RF 4Y0FA 1FK9B 4NI2A 2AKLA 1IWAA 3I5CA 4LRBA 3CT9A 3OD2A 4H4KC 3WIVA 2KI2A 4KSEB 3BF4A 2HHSA 5HBMB 1F2GA 1HL6A 5J2NA 3H2LA 2B7BB 4DR6F 4MXUA 1RT2A 4ZVRB 1AROP 5FLXb 3M9NB 4LIRA 3UZOA 3RU0A 4FF2A 4F4KA 3CD0A 2XS7A 3VMHA 1FKPA 3M8PB 2NYIA 1YJ91 3PYEA 3BSNA 5KT6A 2OUGA 1K83I 2CRLA 1HQUA 3RR5A 3IC1A 1E6YA 5EN1A 2KDOA 2PK7A 4K7QA 1VBHA 3UW1A 2I8CA 3KALA 3VALA 2DXEA 2FC8A 1Q812 1FXDA 1XQIA 2WW4A 3SE7A 1K1SA 4PPDA 3RBEA 1N34J 2RDJA 3T1AA 1FJ7A 4OQJA 3DXSX 5CD4A 3TAMA 2IDLA 2OTL1 2NUUG 1IJEB 5H1SV 3NOGA 2EGTA 4NYEA 1RT2B 2ZH9A 1D3WA 1VBGA 3BG5A 2DT9A 2JC1A 2WW8A 2HFUA 4QIWD 5J2QA 3D6FB 2FVRA 2VU5A 1FT8A 4H4OB 1N5VA 4EUVA 2BQRA 2FPPB 1LWCA 2E1PA 3TW7A 1DV1A 2HQIA 1JKHA 2ZFHA 1TKZA 1HQEB 2R7XA 4CWBA 3HO1A 2XLJA 3GIMA 1I7LA 4NRTA 1T95A 3KYHC 3O6QA 5KFHA 1EKPA 4TY8A 4M5HA 4UCTA 3H5XA 2GIRA 4I55F 3TX8A 1QDUB 4PXEA 2WVBA 2Y9HA 4RZRA 3M6UA 2GCFA 2HBRB 5GADU 4YHHF 3PX0A 2HJWA 2YWEA 1HNVB 2RF2A 3QRPA 4DSFA 4M94A 3CPWZ 3TR5A 1VQOZ 3CPWY 2XCPA 3SSRA 3OR1A 3G96A 1S57A 1GAOA 3K5LA 3W1YC 3ISNC 2NVQI 3Q2OA 2C28A 1JKHB 3U9TA 1VK3A 1EKFA 3RG6A 3W1GA 3T9ZA 1HQEA 5GAEU 2BJOA 1QUVA 4PCQA 2QGFB 2QLFB 3CCVS 4ZVOB 2VPWA 3HOZI 1S1UB 4ETZA 1XR7A 1B0TA 4ZIVA 4LBHA 1VQ61 2DR7A 5KFTA 2OEMA 5I3UA 2AHOB 3QIDA 1AA1B 3MEKA 3EPGA 1TVRB 5CYQA 5HO4A 1KD12 3R5JB 1ZOTA 3PG9A 2E1RA 2Q3PA 2GA7A 4IOBA 4O3OA 3TEGA 3HSZA 3M8SA 3DOMB 1FFGB 4KH1B 3GDEA 1YZ7A 2HNZA 3HB9A 4NWBA 2MSTA 1JWWA 4BY7I 3PV8A 3CCUS 4QSHA 3IRXB 3GE9A 3DDNA 3FDSA 1CSJA 3QAUA 2YWWA 4Y2IA 1RTHA 3K59A 1RYSA 1G3OA 1MNEA 1TAQA 5AXKA 5KFIA 3J7YU 3BO3A 4HNUA 4KO0B 1T03B 2CJBA 4A48A 3LH2S 1NSQA 4P2SA 2DAAA 3CDBA 4MKVA 3RJMB 2I38A 3K5HA 2XWXA 3CCUZ 2DTJA 1KTAA 2MKJA 1L1OC 3ICLA 1EUDB 1OY8A 1RT7A 3RW6A 5DO2A 2CG4A 1F2HA 1TA8A 2O67A 1R0BG 1B04A 3K5OA 4ZLPA 3CDUA 3WWHA 4C11B 4GKJJ 2OTJS 2RHBA 2CFMA 2R42A 2IM1A 5CZVA 3MAAB 4YAJB 3BDPA 2DNKA 3P45B 1YLXA 1Z02A 3SQGB 4DV5J 1A0OB 4ZCKA 3IX0A 1UP1A 4JI6F 4CTAB 3OSNA 4KO0A 5C4JI 3G71S 3E51A 3R3TA 2VB6A 3QQCD 4NLUA 3FUYA 2MGZB 4WK3A 1VK8A 5F8IA 1QUPA 4A8SA 3FSXA 2UVVA 5IC4B 1RT7B 2CPFA 1RP5A 2N82B 4NBBA 3ZNJ1 2IRXA 4TYAA 3CTRA 2WBMA 3DHXA 1CJTA 1WSRA 4G1PA 5GAHU 1NM2A 1VQ7Z 2BJDA 2J8AA 3HFVA 4OX9F 4X64J 1I51B 1Q0NA 3SQOP 1KJJA 4CO5A 3T9EA 2R8GA 3R1HA 3EGZA 1F60B 4UUXA 4B3TF 4USWA 2ZH3A 1CULA 1XK5A 4XO0A 1A9NB 2M7SA 1QVGZ 2Z56B 4BBRI 2KPIA 3J81U 1SKUB 4TYBA 1NMEB 2YWHA 3JAMU 5D0HA 2I87A 2KXHA 2VBZA 3VGSA 1YJN1 2MPUA 4OZ3A 5J1PA 4TU9A 2AJFE 1Q7YT 2ASDA 1RQ0A 3MPDA 3K8VA 3LWBA 1KQKA 1FE4A 4GKKF 4EFAC 2R7WA 1N5YB 4IIJF 5J1NA 1CJTB 3JQJA 5I5XA 1RAOA 7AT1B 5I4MA 1BC6A 3Q1KA 2F9JA 1RXOB 1FXRA 4ES2A 2Q4ZA 3FCHA 4WU3A 1S6PA 3MTKA 3UDLA 4LF9J 2VKRA 2L41A 4F4WA 3N01A 4RVGA 2V9WA 3EVOA 1N32J 2GQSA 1JB0C 3BBBA 2VG5A 1RHMB 2DNRA 4WTYA 3A8KA 3MECB 4LFAJ 4X6AI 1BMQB 1KTQA 2ZE2B 4DUZJ 2E9ZA 3TP2A 3I07A 1R8AA 1KD1T 4DQYB 3MF5A 2QB5A 4PZ6A 4EMDA 2HRUA 2SXLA 4DPWA 1GSAA 1SXLA 5E33A 2W2QP 4YB8B 4I67A 4QU6A 1VBKA 3NBPB 3N6MA 4BWMA 2VFTA 2V8HA 5ETNA 1HBOA 4OI6A 5IWAF 1Q95G 5C2CA 2NS1B 4OI1A 4WTOB 3G711 3W2VA 2VOPA 5FJ4A 2GZOA 3EDRB 4B02A 4ECYA 3CW2C 1I94F 2Z0GA 1X4BA 1X31C 1TAEA 4QZVB 2EC2A 1UFWA 4HI2A 3G6E1 1CJVA 5K20B 1CKNA 3V6HA 2FTRA 2GVDA 1J5EF 1KBRA 3K57A 1F5BA 3HMJG 3PZPA 4UCUA 1K1QA 4KFBA 4CLYA 1KNZA 1V6HA 3CXCY 1YI2Z 4QJVA 1FI4A 3D0GE 1YBAA 1KC7A 2PN6A 4RUHA 2XY5A 4TVAB 3THVA 1T9YA 3PJXA 4DI6A 4ES3A 2WSEC 1MROA 3FSIA 3KHHA 3TZYA 1KSPA 1U4BA 4WFAQ 1UZDA 3G8SA 4YN3B 2VPZA 3SNOA 4V1Ak 1IM4A 2H51B 3M9MB 4DQPA 2NREA 3MAHA 3SBMA 3H4DA 4OYXA 1F9FA 1N34F 3VQSA 3FEYB 1LW0A 3LP1A 3C15B 2HF1A 4L75A 1YIJZ 3CMAZ 4CMFA 4M5NA 1RAJA 4X4VA 1HYSA 3ZZRA 3X3UA 2HS4A 4N8OA 4AL5A 1ZH5A 3AJ1A 4P52A 5T67A 1C30A 2POKA 4FNIA 1HR0J 1F0XA 2MKIA 1MROB 3KAJA 3NWRA 4C48A 4FFNA 3CCES 3JSRA 2ZH5A 3T1HF 2G1DA 4OV6A 4PZVA 4KYZA 2R7SA 3IA0A 2Q6BA 3WIUA 4OIXA 1FDIA 2V8PA 1IR0A 2FHOB 2MQOA 3UWTA 4Q5VA 3M2RA 1QXFA 2A6OA 3GR0A 4Q8EA 5KT4A 5E3RA 4M0JA 2MQ8A 3S15I 1Q1KA 3V5RA 1K0VA 4QYRA 5GADI 1HYSB 5GVQA 2VQEF 2ZHAA 1VFJA 1Y5IB 3H90A 1NKCA 1FFSB 3N5BA 3HO8A 3EZOA 2ZNZA 4C0HA 3H8YA 4K4SA 1FA0A 4DL5A 3RTVA 4DSJA 3MJFA 1FD8A 3KHGA 3DRYA 2R8IA 2FZGB 2PM9A 4DS4A 5ITHA 4XX2A 1YJWS 1YZ6A 2HMIB 3KK2A 3G8TA 1FRKA 1VQL1 4KJIA 5KOWA 2LYVA 4K0KJ 1LFPA 1RWWB 1R27B 1RHUB 1HWIA 1KRLA 3P5BP 5CYJA 2V63A 2HHFB 1APSA 3W5OA 1UCNA 4KGKA 4DG1B 8RUCA 1JX4A 2KHCA 1YJ7A 2X1GA 2AMCB 3G82A 2H5EA 2HS0A 3BBFA 2H4WB 1USPA 2EVZA 1Y10A 3I56Z 2EFPA 3CJ8A 4WWSA 4ZK7M 1NPKA 4F3QA 2ZDPA 1HPZB 4M5MA 3ZZYA 4FFPA 4USIA 4RVHA 2R92I 3DRPB 4ENOA 1O6XA 2JIRA 1N36J 4QU7A 2NVXI 4DL7A 1JLAB 3IS9B 3ZTSA 4MV1A 2KVIA 3CDWA 1ZB8A 3K7RA 4ECQA 4WF9Q 2CJAA 5MLCV 1FWLA 2G4BA 2K5RA 4ED7A 3SYZA 3MM8B 2C2KB 4J9LA 1S79A 2YQ3A 3K5NA 2BRLA 4NXMF 3P6YC 1RQFA 3MMBB 5G0RB 1D8ZA 4RBVA 2X1BA 2VUGA 3FBBA 2J0WA 4YY3J 2OPSB 3DOLA 4WPAA 3IAM9 1RTDB 3DLJA 3OW2R 1N56A 4N56A 2VA2A 2AV5A 1WORA 1CBKA 2MQPA 3DRPA 4DSIA 1WTFA 2AJ4A 3ITHA 4ZPAA 3D67A 4F0HA 4USTA 2GHPA 2FLLA 4QIVA 1PJ7A 1JLAA 2PD1A 3TX0A 2LQ5A 3KJQB 5B0DA 5EHHA 1GTEA 2XB2D 3M6WA 1RA7A 3O8WA 4ZLJA 4URGA 3O5TB 5A6PA 4FYYB 2R86A 2WB4A 3C2PA 3FVYA 1IKXB 4YDDB 4QTTA 3VGTA 3JSMB 5IT4A 2CQ3A 1OQ3A 4O7ZA 1HQ2A 3QGPA 3IM9A 1TV6A 4ELVA 5BMVF 5I47A 1OYEA 2QMUB 4XDDA 2UU9F 2CNNB 3QJJA 4P7VA 3DOKB 3NRBA 1Y8CA 2Y0SA 2MXYA 2CXEA 4JV5F 3MEGB 1CLFA 1YKWA 3VWSA 2HK2A 1WWHA 2UXCJ 2E5JA 2J9DE 2P8IA 2VICA 2E44A 1X4GA 4DUZF 1K9M2 3AT1B 4QW8A 1TMMA 3FEZA 3KYLA 4ZCMA 5D3GB 4PBCA 1PILA 5ETOA 3KIHA 1K47A 1J5EJ 4DWIA 5F8NA 1VIOA 1Q86T 1X9WA 3CC7S 3DCAA 2KT3A 3NH5A 1IKXA 5JXSA 4QTUA 1RWOB 2JDJA 2CPDA 4DFJA 2QA4S 1F6TA 3F73A 1KWMA 1I94J 1TV6B 2Y0SD 1I50I 1Q7LB 5AE3A 2RSQA 1Y5NB 1C4AA 3DOKA 4ECVA 1VISA 5C1OA 2ZH8A 1HD1A 1WHYA 5C42B 2RUGA 4YR3A 4RW7A 4OYOA 3T5HA 3A8JA 2VBWA 1J5OB 1N48A 2HEKA 3ULHA 2W6ZA 2CG8A 1VQO1 2R82A 4F02A 4A3BI 2J0QD 2JLFA 3TO8A 1RHRB 2KU7A 1RKJA 2M3DA 5L9NA 2CFXA 4YHHJ 4Q0BA 4M5LA 4HHJA 4WXWA 2M8DB 3TUZC 1NPPA 1KLMA 2AEMA 2HHXA 2IPOB 1DHMA 4ZN3A 1UETA 2AKWB 2BE9B 4EI2A 3E3XA 4QWAA 1XNQJ 3CD6Z 3EJMA 4WK1A 5C24A 3MCNA 4FYXB 5B08A 1M0WA 1RB0A 2DITA 3D2LA 3KLHB 4UF4A 4PG6A 2BKOA 2QREB 2Y0BB 2MQNA 5GAEI 3PW5A 3BGUA 3AA8A 4CCHA 1QSLA 3ZZPA 3UD5A 1RAHB 2PIIA 3CC4Z 1S6QB 2E29A 3CO0P 4HNVA 5GMEA 4QOTA 5DRKA 1OQ6A 3MD3A 1SKWA 4E6NA 2OTJ1 3R7BB 2OPRA 3B54A 1KLMB 3IFUA 2VF3A 1VQLZ 3OVSA 2R84A 5IS2A 2R7KA 3U50C 2RRAA 2WB1D 3M1VB 2LEPA 4LF5J 3NOCA 4X62F 4ZCLA 3SXLA 5B0BA 2OD4A 4N76A 4GLXA 2RDDA 2GLTA 4DN9A 3KLHA 3W64A 2HHHF 5DQIA 3CJSA 1SC6A 1SKSA 4NBDA 3GWCA 4F7VA 4FF1A 4Y7NI 2VZ9A 4OHWA 2OOXB 2DNHA 4PUOA 1UZHA 1LKZA 5AJ3F 4EZ9A 4O3SA 2VC0A 3MEEB 3TIIA 4YB5A 4ICLB 4MK8A 1UC8A 4W4MA 1NK7A 2JEJA 4IDKA 3HHLD 4MK7A 4Y8VB 3QGHA 2FY8A 3JYTA 3MZKB 3EVMA 2R6MA 4Q7AA 3SCIE 3GIJA 3MHYA 2AEFA 3DU5A 4KHPF 2PEHA 2WVCA 3L3CA 2W9BB 4CYUB 4HACA 5C25B 3NDJA 5DQHA 4BBSI 3L9ZA 2B9XA 2A3JA 1S0MA 2P9EA 4MFBB 1NDKA 3HHEA 5BWRA 2BUNA 2YZMA 1KVJA 4CC5A 3R5HA 2FHKA 2ZVSA 3LPEA 4YMEA 3V81B 4LIWA 2AGOA 3T5JA 2JNYA 2C42A 5I42A 4JOUA 4O4RA 2EXUA 3GSIA 3GTOI 3O3LA 3DYAB 3UDVA 4N5SA 1MMNA 1RTJA 2KM8C 4C2MA 3T9FA 1P9QC 1U0SA 4BHQA 2QA4Z 4NYZA 4M95A 2CJYB 1JXVA 2RDIA 5K8PA 1T9WA 2P6SA 3N79A 1TELA 5IZHA 4U95A 1NLKL 2D7SA 4DXLA 4CYUA 5C25A 2IHR1 5BYBA 1DLOA 4LVNP 4MIWA 1RUSA 5DETA 3UVJB 3FKII 3LQSA 1ZA2B 3MOZA 1FDOA 5J1EA 1ITPA 1YX2A 2XBPA 1RT1A 4O0NA 4X4OA 1TK8A 1VDHA 1RT4B 2L3MA 3EZUA 3W7BA 4NLSA 4FDFA 1F9EB 4GKJF 1QLNA 3CC21 3ISZA 5CM0A 2H5IB 3U1NA 1RI7A 1VRUA 4MAMA 2UUWA 4MV9A 4JV5J 4ZHRA 3F3PC 4ECXA 2QT7A 2WTFA 5DGIA 2Q66A 3C16A 4DBQA 3AD7C 1S72S 1VQ6Z 1ZAWA 3TA0A 4NLOA 2VD3A 1SPBP 2YNGB 1M5VC 1WRVA 5C5JA 3W61A 2CPYA 5DM7Q 5B0AA 3S17I 1KT8A 1HHTP 1ZM4A 5J1EB 4A3CI 1FJGF 3DRSB 3FNNA 1KHWA 1VQMZ 4ED8A 2W1BA 2CQPA 4DV6J 4OYPA 4DU7A 3CCMZ 4PQUB 3HZGA 1SV5B 4QWBA 2EJ0A 3D9BA 1G2WA 3CCVZ 2HVZA 1WC6A 2VQEJ 3M30B 4FGRA 2VF1A 4ZDNA 1U02A 3MM5A 4CT9A 3C16B 5KG0A 4OZNA 3I0RB 2MZTA 2JIOA 2C3UA 2B8PA 2Z2ZA 4O81A 4CI0B 1WF2A 4KAIA 1TU0B 2K7JA 3B4DA 1M6VA 5BWWA 2QL9B 1U24A 4ZPTR 2M52A 5EDWA 3KNGA 1RJJA 2PEBA 5KFYA 2KRBA 4C6AA 4LVOP 1U1MA 4IOAQ 5C7PA 3D6MB 2EFQA 4PQUA 3G4SS 4KV8B 3NMAA 3H2UB 4DX7A 1WI6A 3M6XA 1BQMA 4W98A 2XG8A 3GFHA 4DRFA 5EX3A 5IM0B 3HOVI 4O3RA 3TQEA 4KIAA 1LEOA 3I0RA 5A2Qb 3JQKA 3G6YA 4O82A 5GMKa 4Z7YA 4LRAA 2AU0A 2J6TA 2NXCA 4ZPBA 3ISND 2CQGA 4UOFA 4MKBA 1KHVA 2WBRA 1MLAA 4KC5A 1TP7A 5A8RA 1K8A2 3VVTA 1VQM1 1OBDA 2CWKA 5F8MA 3SMZA 2J9GA 1A0IA 2R93I 1FTRA 2J5AA 2JA5I 1VIXA 3NWGA 4TY9A 3ETOA 1IUJA 4FPIA 4O3PA 1U2CA 1KRPA 2EG2A 3IBCB 3BS9A 4KE5A 2FUG9 1U1OA 5I5SA 3TOQA 5BXIA 1KR4A 3D1HA 2I1RA 2E9TA 2HNYB 2XHCA 1T94A 1VLYA 3JSBA 2C1EB 4PG8A 3CEDA 3GQCA 3WWIA 3VPDA 3QFWA 4F2RA 3TIGA 4TV8F 3LF0A 2N7CA 2DHHA 2RMLA 3AX6A 2VV5A 1YJW1 1NJI1 3X1LB 2B5JB 3CCQ1 4C98A 4U96A 3J7AN 4ATNA 2OPPB 4DV3F 4DFKA 1S10A 3PIOQ 3CO9A 1W2BY 4Y2AA 1UW9A 3CCE1 5E5NA 3GR1A 3U54A 3DFEA 2HNYA 4G3IA 2JLEA 3J80Y 2VG7B 2J9CA 2RS2A 5L38A 4LUBA 2QLVB 3OXLA 4FXVA 1JNZB 4KY3A 3RB0A 4KTQA 5J2PB 3GV5B 3F3FC 4X65F 1JLBA 3K2YA 1T9VA 4HR7A 4MKAA 1WOSA 2UXDF 3VMIA 5A8WB 4JB8B 2HFVA 3WX4A 1VQKS 4FF3A 2QMWA 4EO8A 4S1TA 5JMNA 2IMOA 3MPVA 2VASA 3JSNA 2Q2TA 3C6UA 4G1QB 4OYIA 1YQHA 1DTQB 4HHUA 1N8R1 1QD1A 1W7WA 2I9SA 3H5SA 4N77A 5LXYA 4PZ8A 3KUEA 3NY0A 2NCKL 4P6QA 3HHKA 2GPSA 2M0GB 2NU8B 1FKOB 2ZOGA 4QYZK 3FSYA 3FMWA 1B99A 3W8PA 3MZIA 1FX4A 1NXIA 1OJ4A 4C8MA 2IDEA 1YJTA 2ASLA 1YI21 2PBZA 2JWNA 4FYVB 2MZJA 3MR5A 2PGCA 2FLNA 4N47A 3MM9A 4A8KA 2NZCA 1S1VB 2HZCA 4LRDA 2WONB 2JOQA 2FPGB 2L9WA 4CZCA 4TXSA 2YBVA 1RHJB 5I5VA 4HQ6A 1TL7A 3ET6A 2B0GA 3I82A 4KKOB 2BR0A 2XY7A 2NSCA 2YWVA 3CXCR 5HROA 1N0UA 4UCRA 4E0DA 3T9CA 5H9EK 4Y6IA 4UY85 5CD4H 1VRQC 1NO8A 4NOHA 4QWEA 2HVQA 2JX2A 3NL0A 4AQYF 4Y2CA 4M5IA 2CZVC 2XYPB 1UEVA 2YS6A 2MZRA 5EWGA 3CC4S 4RNNA 2K1RA 1R0AA 2PC6A 2IM0A 1SC3B 1Q861 4A46A 4J9MA 1LWFA 1KDNA 2HQFA 3G6VA 2HAIA 2MLZA 3KK3A 1DRZA 2YZNA 3POTB 4NI2B 3FQMA 5KG6A 7FD1A 2UVWA 4KKOA 3KUGA 4R25A 3TARA 4JI1J 4EWCA 4JI7F 1RO2A 3GV8B 1Q862 1WC3A 2MLYA 1Y5LB 4ZLLA 3CCMS 2DVIA 4LRCA 2QL7B 3W2WA 2FB9A 1R0CB 3FEXB 5KFFA 1JDEA 4NASA 4DK1A 3CCTA 3V4IA 4ID8A 1D9DA 2BZ2A 3M2UA 4EG0A 3PW7A 3LALA 1JLFB 2F4MA 3LTOA 5DG7A 2VPQA 1REVA 2HDKA 1S1WA 3KREA 1NPRA 2UUAF 4HGYA 4R5PA 3JRXA 2NR0A 2MY8A 2ZH7A 3UE2A 2E7VA 3PY8A 5IOLA 4YR2A 4DSEA 2JVRA 4Q2LA 3POTA 1I6JA 1BE4A 4GC7A 4NZ0A 3QZ7A 1VBXA 2PVPA 1OS5A 3BR9A 1RKIA 2Z2MA 1R43A 1FJCA 3QO9A 1U2RA 4UT4A 3R5XA 2VL1A 4WFNQ 1C1BB 2DH8A 4QQBA 4JBCA 2BOAA 2DR9A 1XNQF 3PRDA 3E8OA 2O01C 2XCAA 1SB6A 1NSPA 3CJKA 4N8NA 3ZZZA 2J9DA 4RVDA 2AF6A 4IFYA 2YKNA 4DLGA 2DHSA 2HGLA 1H2UX 1GH8A 5I5WA 5JUMA 3U02A 3W65A 2DR5A 1I2LA 1RADB 1WEZA 1Z03A 5KFRA 4DMZA 4MK9A 5D1OB 3R5DA 4IRDA 3VB9A 3C66A 1R7IA 2HHTA 3W62A 4EFEA 1IQTA 2IA6A 4LF6J 1AA6A 4WJBA 2A1HA 1G2EA 1BHNA 2KG1A 3MWEA 3D3BJ 2UUCJ 1ACMB 2AYBA 3MR3A 1NH7A 2EK6A 1GLVA 4Q43A 1WF1A 2R7VA 2DPJA 3R97A 1XR6A 1KVIA 1HI1A 4L6V3 5AXMA 3OHBA 1UEUA 1GTHA 2MDAA 1EETA 3M8RA 1X8DA 1UVKA 2BOPA 3PFEA 4WP9A 4U8YA 2NXNA 2V4JB 3J81b 2W03A 2BQUA 3E2EA 4W90B 1WZNA 3F44A 4CNYA 3NCPA 1VQ8Z 4JI3J 1TFIA 3R2CJ 4YUDA 5LOQA 2D1CA 3LA0A 2W04A 5AN9F 3DLGA 4LF5F 3AAWB 2OIHA 5K14B 4MD9A 3AXMA 2X5RA 3DM2A 5IFMA 1SH0A 2BRKA 5ETMA 2ZJQQ 1SH2A 3C14A 3CMQA 1L3UA 1S59A 3B78A 2M5YA 4EU0A 5HL7Q 1RSCA 3K8WA 2LVWA 2R7RA 1H2TZ 2X51A 2BE7D 1CG2A 2F5GA 1DQAA 3NEKA 5CAAA 3LUSA 3LP0B 3TINA 1R9TI 2UUCF 2VQDA 2IRUA 2HU9A 4FN5A 1VHIA 3SV4A 2IBOA 3NMRA 2E9HA 5KFOA 2DGSA 2IY5B 1NB7A 1RTIB 1WR2A 3KLEB 3U1LA 2D3O1 3KXDA 5D4PA 3DM2B 3RV3A 4FE2A 4O4GA 2VHGA 3TI0A 4DZ6A 1IOVA 3NBZB 3NUAA 2J0SD 5KG2A 1S7IA 1MW7A 2YWFA 3CCU1 3CCR1 4DQRA 3TDHB 2HURA 3VMMA 2WZ1A 1IBKJ 4GO5X 2HKEA 2CIMA 4F4YA 1VQ6S 2E1CA 5I60A 3HFKA 1SJ4P 4DL0C 4UCSA 3TUJC 4PZ7A 1X0FA 3GFXA 2ZDHA 6AT1B 4AE5A 4OZJA 1QYPA 2DHGA 1KC8T 5D15A 1WHVA 1Z01A 2W9CA 2DR6A 2FHJA 4K4WA 2CJ9A 3CJ4A 4IUFA 1IKVA 3KJFB 1RWPB 3GZ7A 5DAAA 1SQFA 1VJWA 1FDNA 4OJGA 1HKAA 3KAKA 3LGHA 5E7OB 3DGVA 5IQ6A 4MAKA 2WVEA 2COLA 4CL1A 3N28A 2JH3A 3OFHA 2H54B 3CEBA 4HTJA 2P3YA 3OLBA 3IGNA 2V2ZA 2HGSA 2DNMA 4HN2A 3HKZA 1QF8A 4O44B 2W6PA 3WDOA 2LLZA 4CIOA 3GYXB 1JLCA 1GXTA 3GTKI 4DV0F 4LFCF 1AFJA 3PXGa 5HATA 3J7A1 1Q811 3OL9A 2O5DA 1JLGA 5HP1B 1HBMB 2P28A 2LFVA 8ATCB 2DNQA 2B63I 1RE1B 3T41A 4OLOA 2RIQA 2BX6A 4NLQA 4OFZA 2JUBA 3Q22A 1UWAA 2BJ7A 1D0EA 1DL6A 3I9V9 2WK4A 4CH0S 2B3TB 3VZIA 4JI8J 2HPUA 3JSYA 5DGBA 1U45A 5KG7A 2DXFA 4O44A 1RA6A 4MYUA 4DV6F 3TY8A 3N4WA 4O83A 3UQSA 3O1LA 3HVTA 2DGWA 4FVMA 3NP5A 1VS0A 1T7PA 2CJQA 1IBLJ 2HHPA 2HFOA 3MOJB 2CQIA 2NUAB 4K4ZA 2V59A 4HLBA 2GVZA 4A3MI 3DTFA 1YK9A 2A2DA 4NB8A 1Q16A 1TTHB 1FNMA 2MHEA 2HQDA 2M70A 1Y3JA 2P5VA 3TVKA 2EW9A 4RU2A 2V2KA 2B9YA 3ZZTA 4C5AA 4I56A 5AT1B 3H59A 5IQQA 4H4OA 3EGWB 3BABA 3J7YI 1TK0A 3MMAB 3G86A 3BZQA 1VBYA 4IH5A 2AGPA 3HVAA 2XNRA 4R8UB 4C0OC 2OSRA 1K732 2ZDOA 2B56A 4OHZA 4TY8B 1URRA 4OZ0A 1NH8A 2YWGA 4KQZA 5F8GA 4TN2A 5GAGI 5KFJA 1UTAA 5CH7B 2MTLA 2RVJA 4LF4F 1ZS6A 3R1LA 3L95X 1HNXJ 4BC7A 1T8EA 2W4CA 1HNVA 3Q87A 2N3LA 1TQLA 1WC1A 4FFOA 4A3EI 2ROEA 2WHOA 2ZKTA 2LQ9A 1RBOB 5A8KA 5KFVA 4ID5B 4F4AA 4MTPA 2C3OA 2YW2A 1WEXA 1KQSY 3MFIA 1S99A 3BKUA 2GC8A 2OAUA 3TY9A 5C1PA 1YJ9S 5L1IA 4HKQA 1WF0A 1FTCA 5DDQC 4G65A 5KT5A 4TLQA 1XJWB 1OO0B 4X64F 1HWKA 5F9NA 5ETLA 4TQRA 3T54A 2AIRB 3PEJA 1SIWB 3PM9A 5CCMA 2DEJA 2ZHBA 1XMBA 3NKYA 5KFMA 3RAMA 1TVRA 5CYQB 3CJ3A 4DAAA 1IXKA 3GIIA 3O44A 1VC5A 3CCWA 1E6VA 1SKRA 4XX0B 1UW4A 3I12A 3FZ2A 3CMEZ 1FWKA 4PXDA 2UUBJ 1YIT1 2EBGA 1N2FA 1TR0A 4OYAA 2G2ZA 3UN5A 5DGAA 4NPOA 1RYRA 2MQMA 5KT3A 4MIBA 3ZNUA 1FJEB 2E66A 5HAOA 2BJ1A 2R7OA 4X4RA 3JSLA 4ED6A 3MM6A 2NAPA 4DV5F 3UNYA 4DFPA 1SIWA 1O8BA 1SL2A 2BW2A 3GIRA 4ALZA 3T7AA 1FNXH 3IR7A 3BKTA 4DFMA 2GMHA 1VQ91 1M1KT 3FQKA 3H5UA 2K06A 3M2RB 3THTA 4ILRA 2BDPA 3D6HB 4X2BA 1NZAA 3UCUP 1NNDA 1LWXA 4OHVA 1FD2A 5A0YA 2KRRA 3QWPA 3HHDA 3MAAA 4DPUA 4B9VA 4DPXA 4UUWA 4FVCA 3W9JA 1TK5A 4M5DA 1FERA 3H20A 3UI3A 3VMGA 3CCSZ 1OSCA 4MMOA 1EARA 1CPZA 2CVEA 3BV8A 3CJRA 5JJBA 4CTAA 2DISA 4ZOLF 2RB7A 4DX8H 2DZDA 4K6NA 4RW6B 2NU7B 4OZ5A 1GSHA 5F0WA 1LWEB 4OYMA 2MKHA 2J76E 4K4UA 2AZ1A 4HEA9 3DAAA 1GT8A 4DUTA 5C4XI 1SCUB 4P71A 3FCVA 3M8QA 2F63A 1KC81 3HVRA 4JI2J 2MHNA 5HJYA 5A0YB 4B3RJ 4DQIA 5KG1A 1F3VA 1V3SA 2W2MP 5DS7A 5FPOA 1N8RT 1LV5A 4Y65A 3OBIA 4WYWA 2E5LF 4QPXA 5KFAA 3R9RA 4MV7A 2ASYA 1TKDA 5HMXA 1O5JA 1OMSA 3BAAA 1B64A 5LOVF 2R7QA 1FDAA 4XAKA 4OHYA 1S1TA 5K2MA 4IYQA 3DLEA 4IR9A 3PR4A 2CQHA 4IWYA 3GB0A 5E0OA 2H1YA 3BJYA 4Q4CA 3TANA 3RGIA 1VBZA 4DS5A 3ESWA 1YITS 1SQEA 3NFZA 1YJNZ 1YI2S 2FJWA 5HNEA 3PHTA 1VGYA 4IZOA 3HP6A 3UQ8A 1SIZA 3CCM1 3D66A 2XMVA 3PX4A 3UFCX 2KL8A 3HSDA 2HVEA 1SJQA 3D7SB 2R85A 3BR8A 1YRUA 4O3QA 2UXBJ 1KFSA 4NFRA 2YPZA 3TUIC 2YY3A 1S0NA 4NH1C 4HYKA 5J2MB 3AOAA 2YZLA 1YBUA 4HGZA 3GILA 3W8GA 1VLOA 4B3TJ 2VG5B 2UV8A 3DNCA 1BQNA 2CQ0A 4DGLA 1HNXF 2OLSA 3THPA 3ILOA 4EK2A 3MECA 5BYQA 2Y4RA 5LSRA 4OI0A 2GX8A 5EUHA 1N5SA 1QVFR 2BKPA 4CP5A 3WX8A 4OMFG 1F9HA 5C8YF 2MEWA 4XTTA 2IM3A 4X4QA 4WKRA 3UN2A 4X62J 2HVRA 4E4TA 4A3DI 5FDLB 3FGVA 1U6BA 1FCAA 1QTMA 1QE1B 2FZCB 4CLLA 2DGUA 3OFGA 5ETSA 1I5OB 2JFDA 2YRXA 2DE7A 3CWJA 3ZC4A 3M05A 3T1HJ 4NCAA 4RLEA 2F4VF 3A1YG 2IZ3A 3E5NA 3FJ2A 1N54B 4ZKAA 3NNCA 4TUYF 1SUQB 1BQNB 4ED5A 4PR6A 2I2YA 2MKCA 3CSWA 1NDPA 4CO3A 1PJ5A 4NLTA 4NBGA 4OZ1A 3I56S 2K7KA 4I7FA 2WB1A 3IXQA 1REGX 2ZH2A 2CNKB 2D9PA 2R2RA 4C8KA 1IKWA 5A2QU 4USVA 2B7CB 3BPDA 3LANA 2KG0A 3GTMS 1JLEB 1TL1A 1X9MA 3FQLA 2RQKA 1CS4B 2W4DA 4CHIA 1L3SA 4DSLA 2VG6A 3KLIA 4ZPCA 3AA9A 1TFYA 1S7HA 5DISC 2H5JB 2LDIA 1PG5B 3HT0A 3CCEZ 4QIGA 2CJKA 1CJUA 1N52B 5HLFB 3HK2A 1VQP1 5KOXA 5B0CA 4O7TA 1SUQA 2LKZA 3W1BA 5C42A 4EGJA 4ZJLA 2OTJZ 1PK8A 1PCAA 3BN4A 2ZVIA 1IBMF 3D5MA 1EIYB 1VYAA 2YKAA 1WELA 3I6PA 3GPAA 4JI2F 4P75A 3ZTOA 1PYTA 4U67Q 1Y7PA 3HX9A 1C1CB 1TL4A 3R27A 4DL3A 4K59A 1EX8A 3TNVA 4Q0BB 3CC71 3PHEA 3TW0A 2DY1A 3KNAA 4USJC 4DU8A 2E7ZA 3BEGB 2VG6B 3KLIB 1V9PA 4C8OA 2YX7A 3G71Z 4F67A 2QA41 3GG0A 4QR0A 3ETJA 2B9EA 1HWUA 1VQNS 3H3VJ 1TL3A 2EFGA 2OZKA 5ADZA 3ILIA 4ED3A 2YZGA 3OW2Y 3NS5A 5BR8F 1I1GA 3G6ES 1VQ81 2KYZA 4ECTA 4OX7A 1S5ZA 4J37A 2V2VA 3M7VA 1B0VA 2LCWA 4KPYA 1X9NA 4F3MA 2RHSB 3G8QA 1E4EA 1AT1B 2UVRA 3BGOP 2R8HA 4C8NA 3Q8QB 2M4MA 2GQQA 1EZ1A 1DURA 1CQJB 5L1JA 4PWWA 4JI0F 4HR2A 3WWJA 1IKYA 1ZTTA 4FFMA 1HA1A 4TLRA 1SJ1A 1JXLA 2ATCB 3MR2A 1KFDA 1U0HB 4NA1A 5KFEA 3DKDA 2IA0A 3US5A 2OO4A 3RFCA 4DL2A 2HMIA 2BANB 3HHLB 2RS8A 3W3SA 3CF5Q 1RDRA 4C97A 5HMZA 2DGOA 2DGTA 5ETPA 1RWVB 2FPHX 1CC8A 4BLGA 2I8EA 4LRFA 1RT3A 5GONF 1NB2A 2XD4A 4DF8A 2MB0B 3CJ0A 4DG1A 3IWXA 5SUHA 1S1XA 2JRSA 3BGLA 1USPB 4ED4A 2G0JA 1N5TA 4TU8A 7FDRA 2C00A 3AODA 1N8R2 4H4KA 3AXKA 2Q6CA 3C6TB 1HPZA 1QJHA 4OL8A 1HI8A 4YB6A 1FK9A 2OPQB 1BNCA 3EXYA 2B4PA 2ADCA 3SCKE 3DF7A 3AH6A 3CXCZ 5KG4A 4MFBA 4FBTA 2XMAA 5IP9I 2HGNA 1OPIA 1M1HA 3LW5C 5J2NB 4E30A 4HL9A 2C2MB 2AJQA 3QT7A 1U25A 3AJDA 2BE2B 4E33A 2GTIA 4E2FB 2X7IA 2DCUB 1T02A 4U7UD 3VCDA 3A8IA 1UWBA 1S7MA 1CKMA 2GFFA 5HBRB 2F8EX 5D0RA 1B70B 1Y0HA 1HMVA 2X1FA 3CCJZ 2OPSA 3MAQA 3DOLB 3WBZA 3GV7B 2PDAA 4JI4F 2XSJA 5HMWA 3G9CA 2MQLA 2MKSA 2QA2A 1VQ4S 1A48A 4ZITA 1IQZA 5HI7A 2VFVA 2ZJRQ 5A2QY 5F8LA 3T6BA 4LSNA 3OVBA 4NLRA 3NAIA 2Z58B 2HIVA 1QY7A 4CRJA 1NK0A 1UJ4A 4DV2J 2QRRA 4RVFA 1S48A 1JJ2Z 2GJIA 1Q5VA 3OL8A 1S9EA 1GXLA 2V3VA 4JI5F 2IIHA 4DF4A 5DGHA 4GVLA 3NNHA 2Y8WA 1LWCB 2XTJP 5H9FK 3GTYX 4MA0A 3CE8A 5DJBA 2NXUA 4IKAA 4ZVUB 4CO2A 1X3WA 2GO9A 3CC7Z 2DY9A 3RRGA 1Z2LA 1NJWA 3CUNA 5IXUA 1FRHA 2IFXA 4A3GI 2PA3A 3EGVA 1UVLA 2C2RA 1X5TA 3UD4P 3I0SB 4AYBD 5D3GA 2ZBPA 5IP7I 1CQMA 4IR1A 3VAFA 2FPIB 2CJXB 2QLWA 2J7WA 2MMYA 2MZ1A 1SJFA 2O66A 5LL6f 1SV5A 3JAMb 2KT2A 1QVGY 5D0GA 1KJIA 3UO0A 4K2XA 2W7PA 4O7NA 3PR5B 4NBHA 4ZMMA 4XDCA 1FRIA 5KFBA 4LF9F 1R8PA 1UFLA 1P1LA 3SIPB 4LJMA 3FZBA 2APOA 1UPMB 3GIKA 2K8GA 4DEZA 4RW4A 1YJVA 3G6XA 4RBTA 4RW7B 3LAKA 1XC9A 1RO0A 1XWLA 3I0SA 2QLJB 1DIKA 4RU9A 5KFSA 4I6AA 5KFNA 1S4FA 5K8OA 4LF7J 1WEYA 4ZLNA 3PO2I 2OWOA 2CQ4A 1XDNA 1I1KA 4C4WA 3DOMA 3UYYA 1WC5A 4JYAF 3NC0B 4X65J 1WTBA 1D9AA 4L3NA 2HHUA 1UVJA 1KN6A 3CCJ1 1KBLA 3HOUI 3V6JA 2BA9A 1CKOA 4ETXA 4MV3A 3W5XA 1T03A 2E2II 4JI7J 4USMA 3DLKB 3WC0A 4B3SJ 4WXOA 3FMBA 4RW4B 2HW3A 3OHAA 4DR5F 2SCUB 4RNMA 3TAPA 4I64A 3MDFA 2BKNA 1NUIA 1RAGB 1JJ2R 1FRMA 4NLVA 4OI3A 3ENQA 1P1TA 1T3OA 4RJVA 2ROPA 4NYOA 2VJVA 4JI8F 3H5YA 1YDLA 2PA8D 1N6QA 2UUTA 4B3OB 1YRTA 2A1BA 2R87A 4OZ2A 1CQIB 2C2DA 2MJNA 3UDEA 3ZXWA 2M6NA 1HW9A 2CZ4A 1YHQZ 3QGGA 3SQGA 1W2BZ 3KLGA 2XCLA 1CS0A 4BC9A 2KB2A 2HG8A 1RO4A 1H2VZ 4KHPJ 3BG0B 3MUVP 3GTLI 3QRRA 1GFWB 2VBXA 2W8LA 2KFYA 3UPFA 2GAHC 3CPWR 2MY7A 2HNDB 3KDNA 2FVCA 2Q79A 1X4AA 4GO7X 2B5JA 5E2QA 2I3CA 4M1KA 3Q8SB 2AX1A 5LSOA 1KEEA 2GGPB 1R8BA 1WKJA 4UFZA 1MU2B 4E2WA 3QBCA 3UDCA 4JI1F 4WIIA 4USKA 4X66F 2IC3A 2BJ3A 1TFWA 3CNQP 1X0PA 4TU7A 2GO8A 2OSQA 4M5KA 5JVLA 2LMIA 1BXNA 2W9BA 1P8GA 4AUKA 1CULB 4ZIWA 4Q4DA 1VQ9S 5K5MA 3B4MA 1DBDA 2D3ZA 3AJ2A 3D6TB 1HNZJ 2V8VA 2DNOA 5CA5A 2JEIA 2ZDQA 5K8NA 1JLBB 4ZVEA 2NLWA 3AOBA 2LA6A 3OFFA 2HNDA 3NGSA 5DZ7A 4DV1J 2R8JA 5L46A 4KT0C 5DLGA 1N5YA 4O7RA 1FF2A 2JEFA 1LW2A 3NH8A 3EICA 2KH9A 2DEIA 2A2CA 4NEZA 2GTHA 3JXOA 5KT7A 3WQPA 1F1BB 5E3QA 5BWUA 2JMOA 4I6WA 1DLOB 2H4YB 4DV3J 4JI6J 3UVJA 2CNQA 3SZ2A 3K17A 1IBKF 3Q8PB 1JJCB 1RISA 2C2OB 2XGQA 2YH0A 2DNNA 3P3DA 4EEQA 5BJRA 2YL2A 2JS4A 1P6TA 2R7ZI 4DPOA 5AE2A 5IT9Y 1VQ5Z 3P5JB 3H42A 1VQ4Z 1ULZA 2OEJA 3ZZ0A 2B4VA 4BCAA 2MYFA 4NLGA 4RW8B 4CT8A 4WHXA 1G4CA 5CZXA 1PYOB 4O2BF 3JAMf 3GMGA 1NP6A 1GQEA 3TVZA 2XO7A 2W9AA 2EBEA 3EWGA 2YNGA 2KXFA 3MEDA 1M5SA 5HROB 4J9UE 3FFIB 2HLUA 1VQ71 1GMVA 1NK9A 5I5YA 4I69A 2G2KA 4BXXI 5T64A 4XIUA 1UEKA 4UCVA 2W01A 1CJVB 2X0SA 2ALYB 4LFBJ 1CKNB 4MONA 1M5KC 3CCLZ 1HBNB 3NGUA 1UVIA 3IAS9 1TUGB 2EKNA 1L5UA 2FY1A 1DFDA 2BM1A 3KFWX 3CIMA 1EUCB 2O53A 2C2EA 4NBCA 2D74B 3BYPA 4LQ9A 4CO4A 3HFZB 1UL3A 2RU3A 4ILMA 4F3OA 5IC6B 4URQU 2MKYA 3PFFA 2OHDA 2IMWP 2K1RB 2GAGC 3DLBA 3LO3A 3EUNA 3N5FA 1SI9A 3EDQB 3J80U 3KG0A 1QAYA 3KDOA 2VJUA 1V5IB 1OWXA 1S97A 1RLDA 1UC9A 4NLPA 1Q82T 1I2KA 2ZGIA 4NE9C 1GMUA 2RD5C 1IM6A 4NL5A 4M8LA 2DO0A 1I3QI 5JVGQ 3HHNB 1YBTA 4NLXA 4ER8A 1LNQA 1Q822 4J91A 3TRGA 3S24A 1HBNA 2IJRA 1RLCL 3HLUA 1S6OA 4Q44A 4RZQA 2HIYA 1WJ2A 3C8YA 1FDBA 5JQWA 4R0EA 2VPYB 1JLFA 2AJ2A 4NB9A 2AEJA 3KHRA 2NXEA 4MV8A 3U0GA 4L74A 3S1RI 3PACA 1N32F 1ZETA 2OFGX 4DV7F 1ZAUA 4FBUA 3I5BA 2F9DA 3NG8A 2CQCA 3PO5A 3R5CA 2W71A 1HARA 5F9LA 1NCLA 5H9EJ 3HXMA 3U55A 2KM8B 1XMQF 1EHWA 4WFBQ 3KWMA 2RRBA 4TKTA 4O4IF 4FPRA 2D9OA 4O7YA 3QO9B 2EPIA 2YKMA 2VPXB 5LA6F 2KVQE 4RV9A 2M88A 2HSEB 2ZWOA 4ZQIA 4KH0B 1HW8A 1EP4B 3SDEB 3SCJE 4EBEA 4C8LA 1FVIA 2RQ4A 4PYAA 2WAQD 3CC41 4K4XA 4PG7A 1Z2ZA 2GW8A 4IG3B 2PMZA 3BG1B 1CE8A 4CQ1A 2VPYA 2ACMA 2IV2X 2K3RA 3Q8UA 5KTQA 2XLKA 5KFDA 4RPFA 4P2XA 1KVKA 1W2BR 2GHWA 3W60A 1TWHI 2FJXA 2H65B 1YIJ1 1SH3A 3P8BB 1WOOA 3R8YA 1HNIB 2QEXS 2JA7I 3BM7A 4WE1A 3TUPA 3NGTA 2IJFA 1VQ7S 3TEHB 2YRWA 4C5BA 5D8DA 2CQBA 4OX9J 5IT9b 3V6KA 1P27B 1HHSA 3FRYA 2DR8A 4MT1A 3P96A 2YKMB 1S76D 2KI7B 4O86A 2OI2A 4K4YA 1H72C 2ZBIA 2I6WA 2GIQA 1Y1VS 4C3MA 5BPFA 4CLUA 3H98A 3M8WA 1OBGA 4E98A 1C0TB 3BYRA 1UPPA 4AYBA 2HHFA 2H85A 2CWXA 2W6QA 1C4CA 1M0SA 2HWIA 3VR1A 1ICEB 1JLLB 3R6LB 2LQJA 3KK1A 2WCXA 4EQ5A 2Y1RI 4LF6F 3TJ9A 1QAXA 3DXBA 2CNOB 4KGVB 4KPCA 4WE1B 2DK2A 3RBDA 3J80f 4YQWA 3RR7A 4KR0B 4L1KA 4JP8A 1ULRA 5LMNF 2B6AB 2WOMB 3HJFA 4K50A 2FVPA 1W25A 3DLGB 3BBCA 3I551 5KFZA 3NH4A 5K3WA 5HJXA 2P9GA 2ZD1A 4WFXA 2ZM6F 3ILLA 4ZVTB 4ZVHA 1B3TA 2FGCA 3S7RA 3RB6A 4GRSA 1WG5A 4RNHA 1NJZA 1JQGA 3MMBA 5G0RA 3VV2B 3GJXB 3BREA 4DR7F 3ENVA 4WIQA 2E5IA 1QVFY 2RKIA 3PJ9A 1N36F 4GVBB 2B51A 5KFWA 3VGUA 3J81f 4NCGA 5I5UA 1H0HB 3LP0A 3KMSA 4AQYJ 4MV4A 3T19A 2P0AA 1BUXA 3KUHA 2F40A 1HHQA 2B6AA 2V8DA 1RTIA 4ZPVR 1GX5A 3PKYA 2QN6B 2H48B 1Y00A 2KZZA 3IR6B 3MTJA 2HAFA 1IR2A 2IYIA 2RH3A 1M902 4LH6A 1A0GA 4ECZA 5D78A 4NYPA 3LULA 1KS2A 3IBFB 5KG3A 5ETRA 3K5IA 3CIZA 1Z1ZA 4ECSA 2N3OA 5CR5A 4RKUC 1TL7B 4DDFA 3GCXP 3ET6B 3WO0A 2ZJPQ 4XPEA 1N4LA 2QSWA 5RUBA 3OL7A 1X3ZA 3MEGA 1Y3KA 2YNFB 2BW7A 3W66A 4CLZA 1RZMA 4HT5A 1A9XA 1NSAA 2ZC4A 1OSDA 2CNUA 1EHIA 4S0MA 2DRAA 5IV3A 2ZITA 3OSPA 3OTOF 1VQK1 1FKPB 3M8PA 2JNJA 2W7AA 4FS1A 1PYSB 1WHWA 4FFRA 4FZVA 3OUZA 2PMHA 4Q45A 3OJUA 4B9LA 3EYZA 2ODTX 1X5OA 1E6YB 4I68A 4LQ3A 2ZZNA 4W92B 4DL6A 3QLHB 2AP6A 4NMLA 3BACA 5FD1A 1FRJA 2AT1B 2RT9A 3T9DA 1GEHA 4NRUA 3TA1A 1W2IA 3CD6S 4KHMA 5HP1A 1HBMA 2DHXA 2XS2A 4K2JA 3T4NB 1PFTA 3M32B 4X4TA 2XS5A 4PG5A 1HI0P 4CO0A 2F7VA 4ELUA 1SCJB 4I4TF 2U1AA 4CH7A 2PT0A 2NZ4A 5C2GA 3V4IB 2E9RX 3BA9A 4NA3A 1FVSA 5B7WA 1RAAB 1YG0A 2UZAA 1SC4B 1PKUA 1WSVA 1TKZB 1N33J 2QZ8A 4R5PB 2RNEA 2YVSA 4NZMA 5SZTA 1NU4A 3CME1 5HQLA 2UVUA 1K9M1 5C24B 5CHCB 4J9NA 1C2PA 2LEAA 3CCJS 4P72A 3H25A 1NJYA 3QATA 4FYWB 5KFGA 2YH1A 3HD1A 2ZH1A 1FRLA 2GQCA 2Y1LB 2L48A 4DLKA 1Q16B 5BYAA 2AW0A 3BO4A 1U1LA 2G0IA 2L08A 5M2UA 1GMWD 4LFCJ 1PSDA 2V0NA 1U26A 1EKVA 3R9LA 3OR1B 2NU9B 3CJKB 2JC0A 3N8DA 3UCGA 4OYBA 1G7CB 3N6LA 1FEEA 3I5AA 4ZP9A 3GONA 2RQMA 3JZFA 2OPRB 2YQ0A 3KLVA 3A3NB 4R8UA 3U27A 3MD1A 4DV4J 4DL4A 1S1UA 2VPWB 3F0NA 3RR8A 2M9KA 3M2VA 5KG5A 1VRTA 1Y9OA 3IN5A 2A18A 4EGLA 2LXFA 4OV1A 3AY0A 4TV9F 3BSAA 1JIHA 3OTDA 5A8KB 4ID5A 5F3TA 2HNZB 4LSLB 3PVXA 3OLAA 3UCZP 1G1XA 3U9SA 3MEEA 1IJFB 3SEOA 1X5PA 3LQVA 3S2DI 2LEBA 1RTHB 3C19A 4NOZA 1RWUA 3JYTB 3HOYI 4ANCA 1YITZ 2RUSA 2V4JA 3T6JA 4O4HF 5AXLA 1QVFZ 3QNWB 4BWJA 1RAEB 4JXUA 4HACB 4KGXB 3OTBA 3FK4A 4MYTA 2HVHA 3GFYA 4RWWA 3GB8B 4D3HA 1YUAA 4NA2A 2KFZA 4HH0A 5K14A 1M5OC 1P8LA 1XMOJ 2Z2LA 1H73A 4Y00A 2VUMI 2BYCA 3D6WA 4AL6A 3V6DB 4I6YA 1IN0A 4AT1B 4OJ3A 4LSLA 4ANEA 2Y8YA 5KFQA 2N7YA 1M90T 1M1GA 1FEHA 5L8RC 4DX5A 1KLNA 4NXMJ 2HWHA 2QA4G 3HBLA 4ECUA 4A3JI 1TKXB 4GMKA 1RABB 2CZ9A 3M6VA 1NHUA 3TJ8A 4ZCIA 3CCL1 2YX1A 4MH8A 2BACA 5AXNA 4OX8A 2MGZA 4RW9A 1TAUA 2EG1A 5IV4A 1HBUA 1URNA 1BQXA 4DJBA 2HHHJ 2ACYA 4IQXA 3ADAC 3VAHA 2DNYA 2YU9I 3SCLE 2EIYA 3OFEA 3D1OA 5LT5A 3V6DA 3I31A 4CLTA 3N9UC 3TEKA 3CDEA 3VVUA 1KJ8A 2Z57B 4ZHRB 3FBEA 3NAHA 1RLYA 4P10A 4PWUA 1KOHA 2HBQB 4YR0A 3CQZI 3LOUA 3VTNA 4DV0J 3KG1A 4ITSA 2E1MC 1VQSA 4RW9B 1U8WA 1KOOA 4JYAJ 1VQLS 3CMA1 2V69A 3R5AA 1VQOS 2OP5A 1VQNZ 5CA0F 4I2PB 4ZVQB 3MUTP 2XNQA 3CCRZ 5EZYF 2Q51A 1UJ5A 3VTIA 2HQ3A 1QAIA 4LMZA 3QFFA 4ED2A 3MPUB 1BXRA 3KG4A 2F1FA 3QFHA 5DZ6A 4TVIA 1HD0A 4P73A 4EEYA 3ELHA 2GMLA 4PG4A 4J9VA 3TY5A 1UFKA 3G8CA 1KJ9A 4AFFA 3LWMA 4AL7A 4YDXA 1U7LA 2PN1A 2D3OR 2KO1A 1ZM3A 1KTVA 1EQMA 4YS2A 2ZKUA 1Q81T 3DDKA 3T9AA 5KFLA 3NBPA 1VJQA 2FYXA 3U7JA 1HBOB 3Q8YA 3WZ0A 3CCRS 4X4SA 3TW6A 1WW9A 4ZA1A 4DN0A 3D0IE 2DHAA 3HCXA 3W2VB 1I1MA 1KEKA 1ZZNA 1UVMA 3C46A 5IM0A 1TUWA 2ZAEB 1YRXA 2IZ4A 1KQFB 5G4DA 5CXTA 3AOCA 4DIMA 3OL6A 2GVZB 2O1PA 1NBEB 3H40A 4QR2A 4KHRA 1AUSL 1Y1VI 1Q7Y2 4A8WA 1DQ9A 4ZPWR 4O3NA 5D1PA 9RUBA 3A4TA 2OMLA 3TVYA 2LU1A 5BYRA 2B4UA 3VF0B 2XY6A 1JKJB 3QQMA 3OVAA 3QT8A 4PYDA 1I1LA 2DCLA 3ZZUA 1WDDA 2KKHA 2O4HA 4H54A 2KZMA 2XZTB 4NEYA 3RBZA 2UV8G 1H7WA 4DHVA 3DI6B 2GIFA 5C3EI 4IG0B 4BBYA 2JJ4D 3PYDA 2ILYA 3DRRB 3H4BA 3DLLQ 2H3EB 2Z8QA 3ZTPA 3GCWP 2HG4A 4LR8A 1LW0B 3LP1B 4X4NA 3RB4A 3CMAS 1ZB9A 3KJNB 4L72B 3C15A 3RUBL 1PAUB 4O2AF 1IOWA 4NXNJ 1Q8BA 1UVNA 3IWNC 4JI5J 2IRYA 2DRBA 4UQTA 1QSSA 4LFAF 1DQ8A 2CPXA 1HNZF 5KAKA 4ZN1A 2ZOMA 3Q83A 3TQ1A 1KUTA 3S1MI 2ZOFA 2IYGA 4F50A 1QSYA 4FF4A 2F4OA 2QLBB 5IT9f 3D1QA 4F36A 3D68A 4USHA 4U9RA 4ZVFA 5FR9A 1FX2A 4O84A 2AX0A 1YTYA 2KFNA 3M3YI 3R5FA 4WP8A 3VZHA 4RNOA 3QGIA 3S14I 3KIFA 4PQAA 3UR0A 2I80A 3DGPB 4K0KF 1CEZA 2OFHX 4LF2A 1HFEL 3I55S 1V3ZA 3AD9C 1SL1A 1C1CA 4DR3J 1XK8A 2W8KA 3LP2A 3G6EZ 4ZP8A 4BS2A 3I4HX 1S9GA 3JZIA 4P2MA 3TZXA 4UOGA 2QEX1 2PMZD 3S01A 2OD6A 5L1LA 1DTQA 2EWHA 2OMOA 4OYWA 1FHTA 4K4TA 2QKDA 4LF8J 5CABA 2YX4A 4F8RA 4IO9Q 4IHJF 2M8HA 1VC0A 1VQ5S 4ZVGA 3VA7A 3SSQA 2RQCA 3PKMA 4DZDA 4B3SF 2CA9A 3Q86A 2JL9A 3KJVA 3M4OI 1WUUA 3PTWA 3J81j 1RWMB 1RU2A 2V5AA 1HR0F 2Q7DA 5LP6F 1GX6A 1E4EB 2DIVA 4DR3F 1RBLA 5JVHQ 3CJTA 4PWDB 4C3LA 3P5TL 1AZSB 2CPEA 3JTNA 1SL0A 5T6BA 1KD11 2C2ZB 3VAKA 4Y28C 1EAYC 2W6OA 3LP2B 3N6RA 1S9GB 4LR9A 1IKYB 4LT6A 4O23A 3HPOA 4QIFA 1CJKA 1FESA 4J9PA 2BM0A 5D77A 1YJWZ 3FRZA 2QSFA 1D9FA 5KX5F 3OUUA 3L7PA 2G0CA 3OQ2A 4UZBA 1T05A 4ILLA 3IS9A 2Z4PA 1R31A 5HBMA 2BANA 1H3DA 4IFVA 3QSYB 3EMTA 3C3LA 4V19J 2YNIA 3I4PA 2DYAA 4DCOB 4PWDA 4WP3A 4XYLB 3G4SZ 4G6VB 3MR6A 1S0VA 5H80A 1S1TB 3DLEB 3VOTA 2LDYA 3PRBA 5EGYA 1X0TA 4GKKJ 3GFZA 1VQ8S 1YJRA 2QR1B 2ROGA 3KK3B 3ITHB 2Q43A 4LF7F 4YB7A 2VR1A 3MXHP 1A7GE 2YTCA 2Y1JA 2E7XA 5J2UF 1ZZFA 3KOAA 2BJEA 3CD7A 1O0PA 1MN9A 3CD61 2DABA 4N41A 4WFZA 3LWLA 4A8OA 2PMWA 3TAMB 1UA1A 1LK5A 3W2WB 4NZOA 4IFVB 1IYEA 4Y52I 5C44I 4HHHA 5FNVF 3V4ZA 5J2QB 5K8MA 3RTXA 3JSMA 3K0JA 1REVB 2N4CA 4CKEA 1FVQA 4LREA 5AE1A 5J2MA 2RIJA 2J9EA 1OPZA 3N6NA 2YNHB 1DGSA 5DG8A 1U1KA 2XSJB 2QIFA 3SGIA 1VQ51 2RT3A 4PPZA 5ETQA 3CCZA 1FWPA 2KN4A 2F4FA 4RUCA 2KJVA 1V5VA 2DRDA 5H9FJ 3DN9A 4HT7A 4OJ1A 3SSSA 4ZOSA 4AD6A 3QRQA 4X4PA 3NS6A 3J80b 2RF2B 1T11A 4HI1A 2IM2A 3GU0A 2C2NA 3NGRA 1FDDA 1QE1A 3TWZA 3CC2S 2CZGA 3NDIA 3GTJI 1Q4RA 3R2DJ 1O51A 2QV6A 4LF4J 3A3PB 2GMJA 3M8YA 3BGFA 2NQPA 4RNFA 1U49A 2YNHA 3PW0A 1B6RA 3D9XA 2GJ2A 2HS3A 2YADA 2HBZB 2F8HA 2XSFA 5I3UB 3H7HB 4CDIA 1TWGI 3K7AI 1RT6B 1DARA 5AJ3J 1J5OA 3TJAA 2EFNA 1Q821 4F0KA 3T1YJ 2GHVC 2HIXA 3H0PA 5EX0A 5D4LA 5CYMB 4CM0A 4IOCQ 4MJKA 2B9WA 4YBZB 1RGVA 1UAWA 4RO0A 4YAKB 4MH4A 2CVIA 3B6BA 4EYHB 3IRXA 2EJ3A 3IGVA 1OY9A 1U1QA 3W5YA 4CKCA 2DO4A 3BKFA 1EETB 1CJUB 2YKOA 3T5LA 1KC82 1NZ8A 4N7TA 3VHQA 2BJ8A 4CLFA 1Z2NX 2IAJA 3IRWP 4OX6A 1X4EA 4DLEA 1H74A 2DGVA 4XYMB 4QWCA 3TA2A 5GMDA 4IQMA 4USUA 4O7LA 4XK8C 4YP3A 2RILA 1YVFA 3HM9A 3DTGA 2W2OP 5D6GA 5FPRA 4HVZA 4HTIA 3UR3C 5EWFA 1BLUA 2W70A 1LQLA 2HWTA 1SFOI 1FXLA 3GYNA 3K3PA 3A3OB 5E3PA 3MZLB 4NCBA 1SJRA 3PO4A 4B9MA 1VI7A 1F5CA 2HQCA 5FIIA 3H2VE 2HYIB 4L76A 4FXDA 3DLKA 2VQFJ 2IAJB 5ETVA 1OIAA 5U47A 1NJIT 1WG1A 2FP4B 2LEXA 5F8HA 1AW0A 4HH4A 2NSBA 3GIDA 3AB4B 1J2VA 1DTTA 2Y3YA 2J8SA 3QMQA 1NDLA 1T9XA 4O4GB 3G87A 5M2PA 4DQSA 4B3OA 3R23A 1N0VC 2YS7A 2DNLA 1XMOF 1X9SA 3E01A 2W2PP 1JDBB 2D41A 4P2FA 1G6BA 3G8DA 4OI2A 1Q78A 2HIQA 1YUKA 3IBWA 2R2SA 3TAQA 3KLGB 4EFBA 1BWEA 1ET0A 3CC2Z 1WACA 2BBEA 2Q1LA 2QE5A 4CKBA 4AXIA 1FRXA 2J6UA 1K0TA 3RV4A 2I0XA 4HH1A 1IKVB 4ZPDA 1Q8IA 3EPIA 1J27A 4LR7A 1RT3B 2OTLZ 4K4VA 3AW8A 1DTTB 1S49A 3CD5A 2NVYI 2CQ2A 3OTOJ 3CCQS 1D1UA 2UUBF 3DYAA 2CNVA 2HQGA 2BMBA 3PN1A 2QX0A 1I6HI 1MU2A 2V68A 4DCJB 3BSOA 3C6TA 1H6KX 3M4XA 4I4BA 3CCLS 3I55Z 2LIYA 1S6PB 3D0HE 4E31A 1FNOA 2CPZA 2JFKA 1JLCB 4K5RA 1WJ9A 3UD3P 1FJGJ 2CDRB 4TQSA 4DQQA 5IT0A 1KP6A 2UUAJ 4Q8FA 3KLFB 2VA3A 2J7KA 3T9NA 2WSFC 1VR6A 4C0BA 5L39A 1D8YA 2Y1IA 4ZI7F 2BABA 2DPIA 1RK8A 1RT1B 3WNZA 4OJHA 2BE2A 4DV1F 4DCPB 6FD1A 1VS3A 2R9LA 3MWBA 4I2QA 1I7NA 2FQQB 5BWVA 1VRUB 3R5GA 1L3VA 1PBUA 4B3MJ 3OT9A 2HFSA 5D4NA 1ZM9A 1LW2B 1NHKL 4DUYF 3NNAA 2M48A 1S77D 1LOUA 2XMWA 4P7TA 3GJRB 3Q0AA 3RAXA 3HVTB 4F2SA 2V2QA 4UOHA 5ETTA 4EBCA 2Z30B 1A3GA 3HT3A 2V45A 2BEFA 3PFOA 3FCWA 2DE5A 1RU1A 1VOMA 3MMJA 3G2XA 3KLFA 2QC3A 2KYXA 5F3ZA 1NJXA 3MWDA 5CM2M 3CCQZ 2GVDB 2OGUA 2VODA 3LPYA 2XZWA 3F41A 3GSDA 2GJFA 3NCQA 3WO1A 2CUYA 3PYGA 5M2RA 1S9EB 2XO6A 4KFBB 2V4QA 4WZMA 4I2QB 4YJ3F 1PAEX 2UXCF 2F4VJ 2WRMA 5F0UA 1ML8A 2XHWA 1TWAI 3MPWA 2V58A 2F3JA 3GKQA 4BY1I 3MMAA 3GLKA 2DB1A 1GK8A 1WKKA 3O2IA 1P16A 1HWJA 3AHPA 3RRHA 4AXJA 3QWUA 4O4JF 2R4FA 2KTQA 5LL6d 4C7QA 2BVZA 1S9FA 2IJNA 2VPZB 2DWCA 2OKQA 3GTQI 4U6PA 4P74A 3I32A 2GQ2A 5KFUA 2BV3A 3BN7A 5FLXY 4WKYA 1IR1A 3P4UB 3AQPA 1DAAA 2QA1A 3AB2B 2QEXZ 3IG1A 3RUPA 1R3NA 3AQOA 3T1YF 1K44A 4A3FI 3Q8VA 3MURP 4E2YA 3OV7A 4KB7A 4IH7A 3OW2Z 2V4RA 4V19X 2A6MA 5DDOC 3PW2A 2NPFA 4DV4F 4IRKA 2EFOA 1F5AA 2FC9A 2ZM6J 2KT5A 4NX9A 2VDIA 5IT9U 1NK5A 2FZKB 4CH1A 2A10A 2IVYA 2IBKA 1CQNA 2N4DA 1GMWA 3CJ5A 2ASJA 2E7WA 3OTEA 1E6VB 2M2BA 4C11A 2HRYA 3TQTA 4CLSA 2GQRA 2COJA 3KKFA 4YY3F 3RRKA 1QM9A 4YFUA 1WC0A 3IG1B 3HOWI 1GXUA 3MMCB 2DKOB 2HLTA 2LQBA 4NMXA 3QZ8A 3I9ZA 2V9KA 3GJTB 3JB9k 4CNZA 2LXIA 3RW7A 2OH2A 1K73T 3GCFA 2DNZA 4Q2MA 3DC2A 3MM6B 2UXDJ 4NLWA 2DIUA 3FC9A 1YJUA 3PEHA 4B9SA 1DJ0A 1XN9A 5JH7F 3D3CJ 3LGNA 3HSGA 1WNEA 4A8XA 3ENWA 1NAQA 1I3OB 1EP4A 2PFDA 4B9TA 3HF5A 3I87A 1S4EA 1N6QB 1XTZA 2FHMA 3MMCA 2MZQA 2OEKA 3BQ2A 4M5DB 4RL1A 2VH7A 2EI5A 4JI4J 5HQ8A 2VKZG 1RHQB 2E5GA 2VG7A 1Y4ZB 1JNRB 3BA8A 3IR5B 1HNIA 4MA5A 1D09B 1U8SA 1VHFA 4JI0J 1AUVA 2QJ3A 1ZAVA 4YOEA 1FFWB 1EJ7L 3ENAA 3NLCA 3MUMP 1TWCI 2FIUA 3DHWC 2VC1A 1M901 1RBAA 3GG1A 5CB4F 1JLQA 2VOOA 3S1NI 4ED1A 2ERRA 4MIAA 3OPKA 5D0EA 4E8UA 4O4LF 1WOPA 4E2ZA 4DR4J 2HVDA 4NBFA 4J90A 5CQGA 1EYZA 4E2XA 1S6UA 1C0TA 4YB1P 5BWXA 1L3KA 2XQCA 5T7LB 5BPHA 3P49B 2IC3B 3DMJB 3BPSP 3D4JA 1R8HA 3CJQA 4DR5J 2YKPA 3KK1B 1XERA 2OLWA 1TL5A 1YIJS 1RTDA 4ERDA 1YGYA 5KFPA 1R8CA 2AJ1A 3R5BA 3VNNA 2VFRA 3RAQA 2XI2A 4ES1A 2V8IA 1JJ2Y 2DH9A 5LM7E 4FS2A 5BR8J 1R6VA 2FD2A 5DM6Q 2ZE2A 3EVWA 4J9OA 2F65A 1VQYA 1TMJA 3DLHA 1W96A 4PKDB 1JLQB 2EEYA 3LP8A 4WU2A 3EM1A 5KKNB 5ETKA 4F0MA 2V8JA 4MD8A 1NKBA 2VONA 2EK1A 1JJHA 5T7LA 3L09A 2H9ZA 1DV2A 3T99A 3DMJA 1PGZA 3QJLA 4B08A 1VQ9Z 1X7VA 2EJ2A 4QBUA 1WD6A 3JTOA 4L3KA 1YHQ1 3CCSS 3GYGA 3PW4A 2RKIB 5I5TA 5FLXU 5LSLA 4J9SA 2Q2UA 3ETHA 1U1RA 4ELTA 1VLAA 3TZWA 3MCSA 2AYGA 2QYCA 3JTPA 2IVMA 1SJ3P 3A12A 3HJVA 1X4DA 4GC6A 5I3QA 1DAXA 2QMXA 5MAOA 1X4HA 1PX2A 2WSCC 2JIQA 4OYZA 4DQNA 4IH6A 5DDRC 1EZZB 4EZ6A 1IYDA 1M0TA 4ECWA 3IFEA 1MG7A 3V4SA 5IYZF 4O0IA 1NSKL 3N0VA 1NK8A 1WDTA 2GS8A 2ZUAA 2HGXA 1MSWD 1RACB 2JA8I 2FLPA 2L9DA 4DR4F 3MEDB 2FJBB 3R7NB 2NYHA 1XR5A 4E32A 2HBYB 3BSCA 4MRIA 2WYOA 1IBMJ 1RWXB 3UFXB 1U2FA 1N5QA 2XMTA 2EC0A 3HHLC 1T9UA 4I1TA 5LYJF 3BDEA 4ZJQA 2LP4A 2XM3A 4QCLA 1AB8A 2OELA 1S1WB 2K3KA 1CS4A 2ABYA 4F4ZA 1RWKB 2YXLA 1VMBA 3S8SA 2ADBA 3OJSA 3QLHA 4X66J 3EEDA 3PO3S 2VFSA 4M5GA 1Z2OX 4O7VA 2AGQA 3I4NI 3PRVA 4XZ3B 3QSIA 2HK3A 2JR6A 1PJ6A 2CPHA 1M1K2 4LBPA 5KFKA 3BQ0A 1EQ0A 2X1AA 2C3YA 2LA4A 1U48A 3R7SB 2ZWPA 3MCOA 3W63A 3HKWA 3HKZD 4HDHA 4UW2A 1M1K1 1Q7Y1 1PC5A 4A4JA 2LQ8A 1Y1WI 2YKNB 1XNRJ 4J9QA 3LAMA 3CCS1 1YHQS 3K89A 3ZZOA 3L7UA 1F3FA 3S1TA 5DLFA 2DIKA 2YPYA 2WVFA 1KQGB 3NGDA 3M1VA 4LF8F 1TL3B 5D4OA 2DBBA 4Z7CA 2V5HG 1S0OA 4UTGA 3KK2B 2VPXA 3SFUA 1R89A 4KRWA 2D69A 2L9NA 4MD7A 2MSSA 3SDEA 3ILJA 4PRFA 3CULA 1M5PC 4PUOB 3GTMI 3B82A 3Q23A 4IG3A 4IWXA 2R7UA 2OOYB 2QK4A 5HVFA 2E5HA 4U8VA 2G2YA 2P2CB 2HFZA 3OXFA 3G82B 3V2UC 4IDKB 2LFUA 4LF1A 2R3VA 4JV0A 1AYEA 2Z2YB 3L7OA 2W6NA 3NCRA 1SVDA 3IMQJ 4NZNA 1Z4UA 2RJZA 3T5KA 1DZ5A 2W6MA 4DSKA 2G9OA 2NUHA 4JV1A 2FJVA 1V3RA 5KS8A 4RBUA 4QR1A 1B0PA 1WCMI 3MI7X 2XGPA 3CGIA 3ZFVA 4X84A 2PE8A 4B17A 3PYFA 3HHLA 3MM7B 3MFHA 3OXGA 2K3IA 2E2JI 4NZ6A 2C3PA 1IBCB 3IWLA 2AYMA 1FE0A 5B09A 5D8HB 4LFBF 3V81A 3M8ZA 3HD2A 3MM8A 4NXNF 1U1NA 4UY8T 3J7ZT 3RB3A 1PBAA 1WHXA 4ZJOA 3I96A 4QW9A 2V94A 1QTNB 4DV2F 3SFGA 1K8A1 1RTJB 1WI8A 3D28A 2XMUA 3PNIA 1NK6A 2XYGB 2U2FA 3JAMY 1L3TA 3HI9A 3D54A 2OPQA 2J0XA 5E3AA 5BWTA 1SQGA 3BO2A 5LMNJ 2WOMA 3JS9A 2LU2A 2RE1A 5A76A 2HZAA 2ZC3A 3KLEA 3MM7A 2GPWA 3S1QI 2DE6A 2XYHB 3OTCA 1BWVA 4KGMA 4NLDA 4FKYA 4B9UA 4X4UA 3CDAA 1DY3A 3G4S1 3V4MA 3BGRB 2QL5B 2CQDA 3K5PA 1EKRA 1UWBB 5KT2A 4DR7J 2HGMA 2C3MA 1IWGA 2HZVA 1HMVB 4GVBA 5T41A 3L4BC 2I5JB 4TNUA 2J6AA 2PO4A 2QRCB 2B8QA 3W9HA 1TUVA 3VPBA 4NCGB 1KONA 4JUZA 1ZBTA 1LFWA 1VKZA 3J81Y 1NHVA 5DDPC 2YWKA 2ZBQA 2IVFB 3W5ZA 1V9OA 4LSNB 3UZBA 4ZVSB 3JZ6A 4ZS6A 5JQGF 3DU6A 3PDNA 2DLNA 4DX6A 2J7UA 1VQMS 1NUEA 3RYLA 2G1HA 4DR2F 2UP1A 1HLWA 1Q5YA 4CE5A 2E5LJ 4JI3F 2W24A 5L9XA 4C8ZA 4Z2XA 2AQ4A 3BGRA 2WAQA 4ZHQF 2AYDA 2RU9A 1JMTA 1H7XA 1LK7A 3DDIA 1X60A 2YKQA 2I5JA 4JV2A 2Z02A 1UJ6A 1BY9A 3CVKA 3IO1A 1JLGB 4RR5A 1FKAF 4DUYJ 2YNFA 3QPIA 1AFIA 3QT5A 1B7YB 4U7UK 2W4PA 3CB4A 1UMJA 4PABA 2XMJA 3Q2SC 5J2TF 3VQTA 4ZP7A 1UA0A 2Z04A 4FYDA 4A8MP 3HZEA 1KQSR 4CLKA 1HNWJ 1GNKA 2PI5A 2FLOA 1OY6A 2VQFF 3NBYB 4EBDA 4C5CA 2JEGA 1EKSA 3NS7B 1LQ9A 5BYSA 4BDPA 4A3II 2PI4A 4TNOA 2ZH4A 5HV6A 4OLPA 3EERA 1ZAXA 3RZAA 3ORQA 3ETMA 1ZH1A 1LXJA 3CCV1 1U6ZA 2CYYA 4PAAA 3M32A 4Y34A 1T36A 1M5HA 3MCMA 4C3KA 2DXDA 3IM8A 2FDNA 1HIYA 5GAGU 2V34A 2FJAB 1WC4A 1S6QA 2FVQA 2R7MA 5A8RB 1VCTA 3L2PA 5A2Qf 2CQ1A 2P6TA 3FBFA 3K5MA 4J7CA 3UN3A 4CO1A 4ANDA 3T3FA 5IWAJ 2QLXA 5LXTF 1Y11A 3H0GI 3D2WA 3R6GB 3ZTQA 4DR2J 4QIEA 4RUBA 4DR6J 5CCLA 2XMKA 4DR1F 1K9MT 3PIPQ 3DRXA 1C3OA 3KMQA 2DD8S 3MPYA 2CDQA 2XWYA 4F04B 2PSZA 3JQMA 1MN7A 4IRCA 2G13A 3BH7B 3GP9A 4A3KI 1RAFB 4ICLA 4A8QA 4UZCA 5A6WA 1KKHA 2B43A 4LBIA 3QIPB 4IO1A 3HULA 4FFLA 2ZEJA 3QYYA 1AXQA 5HANA 2JIPA 1U47A 2WVDA 4A8YA 1AUDA 2W25A 1W93A 2P9CA 4IG0A 2HFNA 3M2VB 3KTQA 4MV6A 1YSJA 2QRDB 3I4MI 1RAIB 1VRTB 1KQSZ 2G2OA 1MMLA 1ROFA 5LJ5Y 4G1IA 2RRNA 4EO6A 4PEOA 1C0UB 4OZLA 2ZNYA 5J2PA 3SV3A 4B3MF 4B9NA 1NJI2 1SBRA 3I561 2ZZMA 3IF8A 3LGMA 4Y3CA 5EWEA 5LMUF 5I42B 5LXRA 4DOZA 3WC2A 2RAQA 1T3NA 2DNGA 3U1MA 2V6AA 1PC4A 2E2HI 1X5SA 4M63A 3BH6B 2GGPA 3QIPA 3AFGA 5L1KA 4M9UA 1H98A 6FDRA 2ABJA 5FLMI 4DR1J 4EGQA 1S68A 5HVGA 4UQGA 4YJ2F 1MMDA 5HVHA 4RCNA 3C6UB 4G1QA 3GTGI 2HHVA 3CMES 3A8EA 1X4FA 1T0TV 5THWA 1S721 2PFFB 5DQGA 3B8HA 3IR7B 5DG9A 1XMQJ 2QFIA 2CAJA 5E3CA 1AUXA 1C0UA 2VDHA 4NBEA 2NPIA 3K58A 1ELOA 2R2TA 4L73A 1RT4A 2HHQA 2EFVA 4A8FA 1A6LA 1RTZA 2DGQA 1EB0A 3HT5A 2R7LA 4WZQA 5FLXf 3GLJA 1Q8KA 4ECRA 3MM9B 4A47A 3QAEA 2XULA 1ZA1B 1TKXA 5B0FA 5CE8A 4QPTA 1R6YA 1X4CA 2WONA 3S16I 2AZ3A 3VAJA 1ZYQA 2W7OA 4RW6A 1VQN1 1Q8LA 2ZUGA 1B6SA 3VPCA 2JSXA 1LWEA 2LXUA 3WHIA 2DJWA 1ZTWA 2HVIA 1RNIA 5HK4A 2NVTI 1HBUB 2MKKA 9ATCB 4HDGA 4UUGA 3M8QB 4Z37A 2QTWA 3S2HI 1S12A 3DRSA 4LH7A 4HNTA 4XPCA 3EX7B 2FJDB 4ZVPB 2AJ0A 2ZZTA 5HSPA 1ZPVA 3RZOI 4EYIB 3J7Z5 1HNWF 1U1PA 2V8KA 1WG4A 3IP0A 4I50F 5HN0A 1N33F 3S6EA 2EKYA 2XC9A 4J5OA 4C8YA 1GSOA 1AZSA 3MONA 3AD8C 3M30A 4I0WA 3Q89A 3RZDI 3MR7A 4WFYA 2V50A 3Q2TC 4RW8A 1R0AB 3PO3I 3NXZA 1XNRF 3MM5B 4Y2MA 1VC6A 3QJPA 4UCOA 4DPTA 1RWNB 1LWFB 2R2UA 1CJKB 2ZH6A 1VQPZ 1RCOB 3OUYA 1NRKA 4GLWA 2KHDA 1B7FA 3BB5A 2MJUA 1YJNS 2YYAA 2F8MA 2JVOA 1T05B 3MGJA 3UNGC 2RHQB 4K8RA 1IVZA 3FFIA 1MWYA 1PO6A 4DPYA 5K9FA 2R8KA 3EE3A 1Z2PX 1TZ0A 2BQ3A 4I2PA 4RWXA 2XEXA 1LXNA 2JIMA 4KV8A 1NDCA 2FGOA 3M2UB 2YNIB 1IBLF 4P9SA 3BQ1A 1JK9B 2V8GA 3FBCA 2JLGA 1BQMB 1N88A 4CC6A 1RT5B 3RBXA 1XBWA 3VAGA 2R7NA 2K2PA 3VAMA 3GJQB 2UU9J 1XEZA 2AD9A 5T14A 2ILZA 2V67A 3OR2B 2ZDGA 3JRWA 2FVSA 1Q79A 4WBFA 3TZZA 2COIA 3VAIA 3OUYB 1JJ4A 2GNKA 3T9BA 4FP9A 2BJ9A 2X3DA 4H4MA 1P9NA 1P9YA 3LUYA 3W9IA 3Q8RB 3ONQA 2COGA 3GTPI 3SI8A 4YEAA 2XMMA 4WCEQ 3ZO7A 3TYTA 2DGXA 4NZ7A 1C1BA 2HVSA 2QYGA 3ORRA 4CLWA 4J9RA 2AYEA 2QO3A 1FO1A 5FDLA 2FB0A 4QWDA 3HDSA 4WBNF 4RS4A 4F4XA 4TM5A 4O7WA 3J7A4 4RUAA 2DNPA 5I3PA 1RT5A 5JVDF 3HVWA 4KBIA 2HGWA 4IFYB 1PIEA 3M9OB 4OHXA 2MQQA 2B4OA 1QAJA 1TWFI 3OR2A 5F41A
chains in the Genus database with same CATH topology
3D9XA 3I0RA 5A2Qb 1P1LA 4LJMA 2KJWA 2GJ2A 2HS3A 2YADA 2APOA 3FZBA 5B0GA 2RPRA 3G6YA 2ALZA 3GIKA 2K8GA 4DEZA 2F8HA 5GMKa 2XSFA 2AWZA 4RW4A 1VQ41 1YJVA 3G6XA 2AU0A 2J6TA 5I3UB 5D1OA 4RBTA 4ZPBA 3ISND 4RW7B 2CQGA 3F56A 4I7FB 1TWGI 3K7AI 3LAKA 4MKBA 1XC9A 4H4MB 1RT6B 1DARA 1RO0A 1YJ9Z 1KHVA 2WBRA 1J5OA 1XWLA 3I0SA 4KC5A 2EFNA 4PXBA 1ZPWX 1TP7A 1Q821 5E41A 4RU9A 1JWHC 5A8RA 1K8A2 5LJ3Y 2GHVC 5KFSA 4I6AA 5KFNA 1IKWB 1S4FA 2HIXA 5K8OA 1VQM1 1TKTB 5EX0A 1WEYA 3PO2I 5D4LA 5CYMB 2OWOA 2CQ4A 1XDNA 1JLEA 1TL1B 2CKWA 5F8MA 4C4WA 3SMZA 5B0EA 3DOMA 4MJKA 4IOCQ 1A0IA 2B9WA 2R93I 1FTRA 2J5AA 1RGVA 2OPPA 4URSA 1UAWA 2JA5I 1CVJA 1VIXA 2X3GA 3NWGA 4TY9A 3ETOA 4MH4A 1IUJA 2CVIA 4JYAF 4O3PA 3NC0B 1KRPA 4EYHB 3IRXA 2EG2A 1QVGR 3IGVA 3DI6A 1U1QA 3BS9A 1WTBA 2JA6I 2DO4A 4KE5A 1D9AA 3CSKA 3FQQA 2FUG9 4L3NA 1U09A 1EETB 2FJEB 1U1OA 1UVJA 2HHUA 2RBLA 5HLFA 1KN6A 3CCJ1 3TOQA 2YKOA 5KFXA 1KR4A 3D1HA 2I1RA 2VFUA 3DRRA 2E9TA 3HOUI 4NBAA 1WIIA 1KC82 2HNYB 3T5LA 3V6JA 2BA9A 1T94A 1CKOA 1VLYA 4ETXA 3JSBA 1H38A 1T03A 2E2II 4PG8A 3CEDA 2ATLA 2UXBF 3GQCA 3DLKB 3WC0A 2IAJA 3IRWP 4WXOA 4WYLA 3FMBA 4F26A 5HMYA 4RW4B 4F2RA 4OX6A 1X4EA 3OHAA 2HW3A 2OJ3A 3LF0A 2N7CA 4DR5F 4DLEA 1MWZA 3PX6A 4RNMA 2RMLA 1NK4A 3TAPA 2DGVA 3CJ2A 4F25A 4I64A 1RT6A 2VV5A 3MDFA 4QWCA 1NUIA 3PJWA 1JJ2R 2R7TA 1YJW1 1FRMA 2XI3A 4NLVA 3TA2A 4IQMA 2ZHOA 4OI3A 1NJI1 3ENQA 1BD6A 4XK8C 3X1LB 4YP3A 1S72Z 1P1TA 2CPIA 2B5JB 3CCQ1 2QFJA 2RILA 1T3OA 2J6SA 1YVFA 1TKTA 4C98A 5A8WA 3HM9A 2ROPA 4NYOA 4UOCA 5CYMA 5D6GA 4JI8F 5FPRA 1ZM2A 4HVZA 3H5YA 2PA8D 4HTIA 2UUTA 3UR3C 1N6QA 4B3OB 5EWFA 1BLUA 1YRTA 2A1BA 4ATNA 2OPPB 4DV3F 1LQLA 2HWTA 4DFKA 1SFOI 3PIOQ 1S10A