3QWUA

Putative atp-dependent dna ligase from aquifex aeolicus.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
366
structure length
366
Chain Sequence
ISPELVKEALKKKKVRSEEAFGLEYLRFNDDYKDIPRGTAIFKDFIIWGYPHIGRIFLLETGLREQFEAPFWVEEKVDGYNTRIFKYGDNYYALSRGGFICPFTTDRLPDLIDLRILDENPDLVICAEVAGPENPYIEESPPYVKEDVQLFVFDFMKKNEQGFLSQEEKMELIEKYNLPHVEILGRFTASEEGIKKIKEILKRFNEEGREGVVFKEDSERNKRAKYITSYANLMDIKTNAKNMLQLPPEYYTNRILRLVLFMYEEGLKTTEHLYEELGRAFIDGLFQAIEQFEKEHKVYKTFTCKFRKKENAIALLELLSKTSKHIQVKERRLEKEGDYWRLEFDKVFLNMTGLLGHLLSGGIVYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Putative ATP-dependent DNA ligase from Aquifex aeolicus.
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords DNA ligase
total genus 116
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18330 Lig_C Ligase Pab1020 C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.320 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3qwuA01
3.30.70.2160 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qwuA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3qwuA02
1TA8A 3QWUA 3BABA 3NBZB 4UCVA 2HIXA 3RTXA 3JSLA 1A0IA 4E6NA 4EFBA 2VUGA 4EEQA 2Q2UA 3S24A 3W1GA 1TAEA 1P16A 3W1BA 5D1PA 1VS0A 5FPRA 1XK5A 5DISC 3VNNA 1V9PA 1CKMA 4PZ6A 4UCRA 3L2PA 2Q2TA 4GLXA 3JSNA 1CKOA 4PZ7A 4EFEA 2OWOA 1P8LA 4UCUA 1XDNA 4UCOA 3GJXB 2HVQA 1DGSA 1FVIA 2HIVA 4DRFA 2HVRA 3PN1A 1B04A 4UCTA 3TY8A 4CC5A 3GDEA 3NC0B 3TY9A 5D1OA 3BA8A 3RR5A 5D1OB 1CKNA 4CC6A 3UQ8A 3BAAA 4EQ5A 3NBYB 2HVSA 3BA9A 3GB8B 4LH6A 2CFMA 4LH7A 3W5OA 5FPOA 4PZ8A 4UCSA 1X9NA 1S68A 3TY5A 1CKNB 3KYHC 4UFZA
chains in the Genus database with same CATH superfamily
1S1WB 5BWWA 3UNGC 4I1TA 4TY8B 4ZPBA 4A3CI 1FEHA 3ISND 2HQFA 1LW2A 1C2PA 5L1KA 4ZLPA 3VCDA 1VI7A 1IM6A 4WF9Q 4A3MI 3PHTA 1UVMA 3R2CJ 2IJNA 1D8YA 2WB4A 3CSWA 1UJ4A 4IFVA 3DLKB 2ZHOA 1KHVA 1UAWA 3HD2A 3GLKA 1JLAA 1FESA 2BV3A 4OX9J 2HFVA 5GAHI 1YI21 1TQLA 4LF1A 3T1YF 1M0WA 1WF1A 1HKAA 2Z58B 1DV2A 2X1FA 2VDHA 5BYRA 3P4UB 3VNNA 2OD4A 3SV4A 5LP6F 3D6MB 1NZ8A 1M5OC 1F2HA 1IBCB 2OLWA 2V68A 3VAJA 3CEBA 3L7UA 2R7NA 3HB9A 1CJVA 2PC6A 1IBLF 1M5HA 1GLVA 2ZEJA 5LSOA 3BB5A 1SJ4P 3U9TA 4N56A 2B8QA 1LKZA 1CJTA 1YIJ1 3ET6B 4K59A 5IT9U 2NUUG 1TKZB 2QRRA 2G0IA 1Y1VI 2EBGA 3CUNA 2W24A 3FRYA 2YQ1A 3GFHA 2HGLA 2NYHA 2DGOA 2X3GA 3BBFA 3KYLA 1F2GA 3J7Z5 4J9PA 1F60B 2EW9A 1ICEB 2D3O1 3AH6A 4LFCF 2DNOA 2MZRA 2AYDA 4HQ6A 1DBDA 5M2RA 1APSA 4UOCA 4EO6A 1HQUA 1EZZB 3ZFVA 4KB7A 1GXLA 2FLNA 4O7SA 3WC0A 1UA1A 2M4MA 1KONA 2XMJA 4M95A 2FDNA 4LMZA 2W04A 1TELA 1R8AA 1KBLA 1ET0A 1WOSA 1RAAB 1WC4A 2UU9F 2MSTA 3BA9A 5D3GB 2VKZG 3R9LA 3EZOA 3L4BC 4ZP7A 1X4AA 3TW7A 4F8RA 2YH0A 2V8DA 4HN2A 1RABB 2PSZA 4TLRA 4DGLA 4Q7AA 2BJ9A 3KG4A 4LF8J 1BQNA 3HSJA 2GFFA 5HAOA 2OZKA 4P2SA 3IWXA 2J9DE 1G3OA 3QIDA 4LF9J 3G86A 3NOCA 4QPXA 3DHXA 2DIVA 1VIOA 4JI2F 4O4JF 2W4CA 4G1QA 4KH1B 4PG7A 5HV6A 3MM7B 4KGZB 2QEXS 4NOZA 5BYSA 4USWA 2V9WA 2P3YA 4XAKA 1HNIB 1X5SA 4MH4A 1CJUB 4ED0A 3TY9A 4DUZF 1RT3B 5CZVA 5IT9f 2JC1A 4BHQA 1PAUB 2CQGA 1HIYA 4KIAA 3M8WA 1M1HA 3X1LB 3AQPA 2JVRA 4C8ZA 4OJHA 4B3TF 1REVB 2NREA 5KFZA 3MUMP 1WZNA 3AD9C 4Y6IA 2WBRA 3EERA 1IVZA 1U2CA 2HGMA 5A2Qb 3Q23A 3RRKA 2ACMA 3SNOA 1RT1A 2FB9A 3DU5A 3K5MA 2EEYA 5C24B 4OYMA 1P16A 3M2RA 1HBMA 4QU6A 1EX8A 2GCFA 2HVZA 3MAAA 4JI7J 5D3GA 2MB0B 1UC9A 3VTIA 4RVGA 1FKPA 4USKA 1NJI2 4ERDA 1N36J 3CC4Z 5KT2A 1VC5A 2ZNZA 4H4KA 3V4SA 5GAGI 4DX8H 3RTVA 1RNIA 1YHQS 1JJ2R 2RQ4A 4NLDA 5CYQB 4IO9Q 2V94A 1PK8A 4C7QA 2GHWA 2O01C 4DV6F 3NMAA 1U1PA 1EAYC 3U7JA 1KRLA 1F3FA 1R8PA 5E5NA 3MXHP 1W96A 3HOYI 4RKUC 4OZ1A 4RV9A 2MY8A 4U8VA 5AJ3F 3PX6A 2V69A 1FRIA 3ISZA 4LR9A 3NEKA 3N4WA 2OSQA 2P9GA 2CDRB 4ALZA 1T36A 3G71S 2DRBA 5F0WA 2DRAA 1AUVA 4C48A 2QZ8A 3D9BA 2VFRA 4A3II 3KLFB 1X5TA 4X66F 3EMTA 1RT1B 4GO7X 5DG9A 1Z01A 5A2Qf 1CE8A 1KOOA 5ETLA 2BUNA 2FVRA 3H25A 2ZOGA 1XBWA 3IXQA 1FKOA 4TVAB 3UCUP 4KV8A 3PDNA 4E0DA 1R8CA 4K2JA 3W65A 1BQXA 3C6UA 4O2BF 3BZQA 3GR0A 4E33A 3M32B 4UY8T 5LSLA 3TVKA 4C0BA 4J37A 4KO0B 2JZ5A 4DUYJ 2F8MA 1B70B 2DHSA 1FKPB 3KJFB 4WKRA 4KHRA 3CCSZ 3TX0A 2XZWA 2Q6BA 3OVBA 1IKYA 3PCOB 2E5LF 4ZK7M 3H5XA 2ZUGA 2W71A 1R43A 4NLPA 1N5YA 1YITS 4U9RA 2MHEA 2NU6B 5H9EJ 4JI0F 1IUJA 1GGOA 4KHPF 1XR5A 2DGXA 1JWWA 4R8UA 1T94A 1Z02A 4Q2LA 1FVSA 1XERA 4P71A 5D1PA 3RFCA 1CULA 2C2MB 1F1BB 4I55F 2AX0A 4B9MA 4R8UB 1RT4B 2BVZA 1VHIA 4KV8B 5D78A 1JXLA 3BO2A 3FFIA 2C1EB 1B4SA 2ZDQA 2R92I 2VONA 2EC0A 3WX8A 3F56A 3SSQA 2MQPA 3CMEZ 3VGSA 1XNQF 2GX8A 1RXOB 3M8PA 3UE2A 2F5GA 1TKZA 5ETPA 2J6UA 4DR7F 3NGSA 3L95X 2ZJPQ 2K3KA 5EUHA 2E7XA 3I82A 1FNXH 1HI0P 4IUFA 3ZZPA 5BJRA 1XTZA 2FVQA 2BACA 3ZZUA 4LFBF 3AA9A 4E8UA 2YQ3A 4MV9A 2HIXA 4Q4CA 3US5A 4OI1A 3FC9A 3MCOA 3AODA 4ZVOB 2WBMA 1FCAA 3N0VA 2LCWA 4RU2A 2C2RA 4B3OA 4OYXA 4WFAQ 2BOPA 1PCAA 4ED1A 4NYPA 3RRHA 1CC8A 1XNRF 4CMFA 4GKKJ 2H54B 4ZN1A 3HOVI 2XMMA 1V5IB 3FBEA 3D5MA 3CNQP 4C5CA 1WWHA 4HACA 3GFXA 4LF7J 2BJ7A 3E5NA 1P9QC 3ORQA 5KT4A 3PKYA 1SJQA 2BW7A 1GXTA 2I2YA 4PABA 3MEEA 1IBKJ 4C0HA 3G71Z 1EP4A 3S1TA 1RWVB 5DGHA 5L1IA 3HP6A 4JI5F 3G4S1 1FRKA 1K83I 3HLUA 4NFRA 1HD1A 4K4TA 3GG1A 1N32F 2DPIA 6FD1A 2LQJA 1AW0A 2QF7A 3E3XA 1KVIA 4OX6A 4UUWA 5EWGA 2FHJA 2MQNA 3BSOA 5DZ7A 4R5PA 3NBPA 1GAOA 4PWDA 1HLWA 4ELTA 4JP8A 3N6LA 3GTQI 4YP3A 3QGIA 2YWGA 2RF2A 3DLLQ 3TA1A 5D6GA 2JNYA 3ITHA 3HXMA 3I87A 4A47A 2CJKA 5GAGU 3GWCA 4YAJB 4I56A 3CMAZ 1YDLA 2D3UA 2GO9A 2IRXA 2DO0A 1Q86T 3CCSS 3QRPA 4G65A 4B3MF 2SXLA 4Q44A 2POKA 2V58A 3JTNA 1VQ6S 3KLIA 3T9FA 1XEZA 4E32A 2HFNA 4ZVEA 4UCRA 1IXKA 5AXLA 3AXMA 1QAJA 3DCAA 5D0GA 3EXCX 4Y34A 2NYIA 3QO9A 2NVQI 2A18A 4X4SA 2COJA 2APOA 3FEYB 3NNHA 1W26A 2D3OR 2MDAA 2B6AB 2ZVIA 2W8LA 1F3VA 2XMVA 3W9JA 1KT8A 1UJ5A 3VB9A 1H2TZ 1TL4A 2DNZA 2FVSA 2Y3YA 4O3QA 4RZRA 2D3ZA 1RWMB 2MGZA 1S5ZA 2IVFB 1ZAWA 4ZVFA 1EJ7L 3CT9A 2CDQA 1KQKA 2HVQA 2C42A 3BR8A 4OI6A 2HQDA 4LBIA 2VG5A 3CPWY 7FD1A 4LJMA 2QA4S 3R5FA 5DISC 3CCJ1 1SH3A 4X62J 2GIRA 1I5OB 2VOPA 3DYAB 5DO2A 1PC5A 3FCWA 3VMHA 3MUVP 4PXCA 5HN0A 3NFZA 2IC3A 2AW0A 1Q821 2ZFHA 5BWRA 3IC1A 4F0HA 2DH8A 3SDEB 2G2KA 3MDFA 3HZEA 2OLSA 3I0SB 2ZGIA 2KDOA 1KQSY 2JA8I 1N5SA 5EHHA 4L3KA 2CVEA 3FQMA 5FLXY 4Y7NI 3I5BA 2R4FA 1VLAA 4ZJOA 1EP4B 5ETOA 2FY1A 1I51B 1TWCI 3M6UA 1RAHB 3ET6A 1M1K2 5F8HA 1RWUA 3K5HA 3QQCD 1E6YA 1GMWD 5FD1A 4Q45A 1T05B 3GMGA 4WE1B 5EGYA 4QYZK 2IRYA 2VB6A 2HRTA 5IP9I 1FWLA 5SZTA 3NS7B 2M8HA 5KT6A 4ETZA 3A3PB 2C3MA 3GTYX 3G6XA 4C11B 3TAMB 1Q8KA 1N88A 1AFJA 4WTYA 3RV4A 5IT9Y 3UFXB 2OI2A 2BANA 3R7SB 1X9NA 3JQKA 3PO3S 2EVZA 1I6HI 1P27B 3GIIA 4A48A 3V6DA 1Y5LB 4EZ9A 1VQKZ 1D1UA 1UL3A 2E1RA 3G96A 2ZHBA 3I5AA 2PDAA 4ANEA 3W2WB 3EVMA 4LRBA 1SKSA 1GQEA 4X84A 1QYPA 5I42A 2OHDA 4KSEB 3M6XA 1PYSB 2ASDA 2ZE2A 5HMXA 3MZKB 3SI8A 1I2KA 3DTGA 1LWEB 2VL1A 1FRXA 3E51A 4MFBB 5D15A 3DGPA 4LQ9A 1FRHA 4CH7A 4DV2J 4A8MP 4AQYJ 5LOVF 1RQ0A 2J7KA 1Z4UA 4I2QA 3PYEA 2ZWOA 2XMUA 1F5AA 3PX4A 2YNHB 3OTDA 2FIUA 4CLYA 4RU9A 4L1KA 3I4HX 1IKYB 3UI3A 3N8DA 2CJ9A 2O67A 1B3TA 3MMBB 4PQAA 2QEX1 1W25A 5F9LA 3L3CA 5GVQA 3R5XA 1P1LA 5C42B 1T11A 2V8VA 1RAIB 2ZUAA 3OD2A 2R7OA 2DXEA 5A0YB 4P73A 5I3PA 5J1PA 4UCSA 4CLKA 1VQKS 3CEDA 3UQSA 2BA9A 4H4OB 3MMJA 2EGTA 1DTQA 2G1HA 3TAQA 4MV6A 1MWQA 2KXFA 5IP7I 2B9WA 3F73A 3TEKA 1N4LA 2M6NA 5CM0A 2QSFA 3U1NA 3NWGA 5FJ4A 4QTTA 3NMRA 1IBMF 2A1HA 2PMZA 2J8SA 3NCQA 3RR7A 2UXDJ 1ZPWX 3JB9k 4O84A 2ALYB 2B4PA 3NP5A 2C2KB 2D9PA 4USTA 2XI3A 1R8BA 1ZZFA 3V4MA 4PQUB 1TZ0A 2WONB 2GTHA 4FYWB 3R6GB 4GKJJ 1LW0A 1LWCA 4K4WA 4PYAA 3H7HB 3JZ6A 1NKEA 5G4DA 3DRSB 2FZCB 2IHR1 5BWUA 2W01A 3PY8A 4RW4A 2ZH6A 4NLTA 4RUAA 4LR8A 2VQDA 3PACA 4RNMA 1DTTA 3I31A 4V1Ak 4I68A 1M6VA 4P7VA 5DQIA 3M9OB 4I4TF 4EBEA 4CYUA 4LRCA 1SCUB 2OELA 1H73A 1JLGB 4WKYA 4ZLLA 5J2NA 1NAQA 3C8YA 2DYAA 1FDIA 2CJYB 3T99A 3V6HA 2DHAA 2UUBF 1RP5A 2V4QA 3T6JA 3VAGA 3VMMA 2W6QA 4EU0A 1ZM9A 4EG0A 3HKZD 4OYOA 1Z2LA 2XHWA 3D68A 4YB1P 1B04A 2NXUA 4ID5A 5KFRA 2QGFB 1JLEB 1VGYA 1FX4A 2AEMA 1NDCA 4LUBA 5K9FA 3H5YA 5KFJA 1WHXA 1VBHA 3LULA 4F4YA 3MR2A 4AL7A 3VVTA 4IH6A 2V2KA 1SL1A 4NLVA 5G0RB 4F4AA 4A3BI 3GTOI 1AUDA 2RQKA 2ZZMA 3DFEA 4ZVHA 4FKXA 3W64A 1V6HA 3O1LA 4ED7A 3QJPA 2ALZA 2AD9A 4NA2A 4TY8A 4MONA 2V5HG 3GV8B 4LVOP 3J81j 1NB7A 2LMIA 3TJ8A 4I4BA 1NH7A 2ZC4A 5CA1F 3T4NB 3LP0A 1YTYA 3LP1B 2YKQA 5H1SV 3IWLA 2HNYA 1RHMB 2ZZTA 2I38A 3NGTA 1RT2B 5HBMA 1ZAVA 1NP6A 1UPMB 2ZH1A 4DL3A 3CCUZ 5JQWA 3RUPA 2Y1RI 5L46A 1TR0A 1TL3B 4KH0B 3I0RB 4CYUB 1NHKL 3TZWA 4YFUA 2UV8G 5LM7E 2ZBPA 4RW7A 1QJHA 2AYGA 4Q43A 2XTJP 1TL5A 1UEVA 2XB2D 3TVYA 2GJ2A 4OZ3A 3CF5Q 1R6YA 5KTQA 2B6AA 3QGPA 1U24A 2FJDB 2Q43A 3BGRA 3J7A4 3AB2B 3OUYB 2AMCB 1S1VA 4K4VA 3M8PB 4GKKF 2Y8YA 1SQEA 4QOTA 5G0RA 3M9NB 2FJBB 4FXVA 3IR5B 3R6LB 2F3JA 4N41A 2JIPA 4J9LA 3N28A 2W2QP 2LDIA 4ILRA 2DNGA 4PPZA 4DPOA 2IM1A 2BYCA 2YKMA 3ZNJ1 3HVWA 1CKNA 4LF4F 3D54A 2ZD1B 4NCGB 1N8R2 1K47A 3GQCA 1EHWA 1ZAXA 1RT5A 3SXLA 2CZGA 2Q2TA 1OYEA 4CMDA 2HS3A 4DV1J 5BXIA 3ITHB 5J2QA 2NPIA 5BYBA 2E7WA 1FDNA 2DE5A 4N76A 3FSIA 1JLFA 4C3KA 1K732 4OZ2A 4J9QA 3CCLS 1OY9A 1TTHB 1N52B 1RTZA 1P9YA 2EPIA 1Q8LA 1Q822 1UA0A 2AV5A 4LSZB 4NB8A 3J80U 4NLOA 2N3OA 3HDSA 1QTMA 2YKPA 1C0TB 2K2PA 2CWXA 2FJVA 3IMQJ 3U9SA 5IV3A 3G9CA 3ICLA 4YMEA 2K5RA 1SC6A 4IQMA 1FVQA 4WIIA 5DDRC 3UD4P 4K4ZA 4A3JI 1Z2OX 4QWBA 1RA7A 2GQRA 1FDBA 5DG7A 3TYTA 4Z2XA 1U2FA 4AXIA 1RKJA 1QDUB 1YRXA 4LF6J 3VWSA 3I55S 1X5PA 5DRKA 3B8HA 2MKKA 2YZGA 4C6AA 5LMNJ 3FDSA 2J9CA 1YI2S 1S1WA 1F9HA 3GJSB 2NR0A 3MWDA 2R85A 1KVJA 3MOZA 8RUCA 1OJ4A 4K4YA 3T5HA 4RVFA 4TYBA 3D66A 1HBOB 3VGUA 3HMJG 4O86A 2CPEA 3JSYA 4FGRA 3U55A 4NLXA 4M1KA 2YQ0A 2QA2A 1DQAA 4KRWA 1KKHA 3EZ5A 4LF7F 3BREA 2KM8B 2B43A 2DR7A 1N34J 3O44A 3P49B 4DPWA 2LQBA 4O44A 3HBLA 2YXLA 3CCRZ 3TRGA 3T7AA 5KFTA 3Q83A 3V4IB 4N47A 2KHDA 1SCJB 3T1HJ 3PFEA 3UN3A 1H38A 3TO8A 2CVIA 3Q8PB 4K5RA 1C0UB 1XMQF 3G6E1 2VA3A 1U25A 2FLOA 5A8KA 3RR8A 4NA3A 3CDEA 2XG8A 5IXUA 4F4KA 2NUAB 3X3UA 3V6KA 1KFSA 2E2HI 2MZQA 3G8QA 1WEYA 1U0HA 2FB0A 2NXJA 4FKYA 3A8IA 2UVUA 1Z1ZA 1NEEA 1R31A 1PJ6A 2HIYA 4KPYA 1IOVA 3W62A 4A8QA 5B0FA 3VR1A 3UD5A 3MTKA 2OEKA 1SIWA 5ETSA 4QWEA 4RW6B 3MECA 3KK2B 1QM9A 2QA4G 1UVNA 5J2PA 2YNIA 3PO2I 2EI5A 3GB0A 4TY9A 4WIQA 4AYBD 2W2MP 3Q8QB 1U1KA 4KHMA 4H54A 1HNIA 1T03A 1JNRB 4XO0A 2XLJA 2HQIA 4A93I 2D74B 3HHEA 4WBFA 3TW6A 3F44A 3VPCA 2R7XA 2C2ZB 2MKYA 3HT5A 3IF8A 4C8OA 2AJFE 2QLFB 1XC9A 1VHFA 2YPZA 4IG0B 5CAEB 3SGIA 1V5VA 2V8HA 4CLPA 2HHFA 4UW2A 2NU7B 2KT5A 4QTUA 3PEHA 2ADBA 3VPDA 3GSIA 1XDNA 3KLVA 2L9DA 4LRFA 4CO2A 3P5BP 2ZNYA 3PO4A 4LF5J 1S6PB 4NCAA 1TFWA 3FEXB 1BXNA 3BG5A 4NA1A 4Y00A 1DRZA 4J91A 1XN9A 4E4TA 3TA2A 3CCQS 1S9GB 1FA0A 4ZVGA 2XMWA 1WC3A 1C1CB 1G7CB 2B5JA 1N5TA 4WFNQ 1RWXB 4FFRA 2HNYB 2IMWP 1TVRA 3I4NI 3UWTA 2ZKUA 4USVA 3FNNA 2X3DA 1VQMZ 4DN9A 1N0VC 3BH6B 5ADZA 4X62F 2E1CA 4PXBA 4ZI7F 3VGVA 2NZCA 2AQ4A 2HYIB 1RB0A 3C16A 4OV6A 3IRXA 2MQOA 2LA6A 2IM0A 1TWAI 4QR2A 1FJGF 4M5DB 2QFJA 3D6FB 2JFKA 4H4OA 2FJXA 1RT3A 2V9KA 2JIMA 3QRQA 4P75A 3OXFA 1S1UA 3LPEA 2XMKA 4ID5B 4DL6A 1EZ1A 1EUCB 2DGSA 3NGDA 3CXCZ 2H4WB 2WB1A 5B0GA 5I3UB 4DQIA 5MAOA 4AL5A 4Y65A 2FYXA 1XMOF 3P6YC 1B0VA 3M2RB 2LQ8A 3SYZA 2EKYA 3QFFA 2RDIA 2RRAA 2VIHA 3QIPB 3THVA 4FNHA 2YTCA 3QIPA 5K8MA 1JJ2Z 4HH4A 4DPXA 4ES1A 4OIXA 3QATA 5I4MA 1LK5A 3CDAA 4DX7A 4X64J 2O5DA 1K8A2 4YR3A 1HNVA 2JLEA 3GE9A 2GU2A 1HQEA 2CFXA 1F5CA 3JSLA 5J1NA 3D0IE 2PMWA 3BQ0A 1YJWS 3AHPA 1LXJA 4NXNF 2G4BA 3E8OA 3PJXA 3W2VA 5HVFA 3BGFA 2W9BA 4YN3B 3ZNUA 4ZPCA 2VPYA 3NY0A 3CCLZ 2PI5A 3D7SB 3I4PA 2CKWA 3OTCA 1FKAF 2ATLA 1S0MA 4GKJF 2JEJA 1FVIA 3MUTP 2W7OA 1NK8A 1S9EA 2MZJA 1TKTB 5A0YA 1WI8A 4DV5F 3M2VA 4XK8C 3TEGA 2KT2A 1FNOA 2HHQA 1KJJA 4ENOA 1V3RA 1S1TA 1H98A 4JI0J 1JJHA 5CHCB 4YDXA 1ZB9A 2CQCA 2Z04A 1TUVA 2O4HA 4HR2A 2KB2A 3FEZA 3N79A 3BN7A 2D9OA 4M5MA 1NSKL 3FBFA 4YY3F 1SV5A 3SSRA 1RBOB 1RYRA 2VPXB 1W2BZ 4LR7A 1IQTA 1UWAA 4PAAA 2F8EX 4OMFG 2H4YB 4KJIA 2ATCB 3RAXA 4RCNA 2HJWA 3CC21 4W4MA 3T9EA 4QW9A 1Q95G 2P8IA 3J7A1 2LU1A 3BGUA 4AXJA 1CG2A 2GGPB 3KG1A 1IR0A 1NJZA 4EEQA 3W9IA 2D7SA 4DQRA 4O0IA 1L3UA 2L9NA 5DDOC 1T02A 3OR2B 1HA1A 4ZQIA 2DT9A 3CQZI 4OI0A 1VQ8S 3JSMB 1Y7PA 3MEGA 3IWNC 4O3OA 3CB4A 4L74A 2GHPA 5CCMA 3GIRA 4ZPWR 5CH7B 1X7VA 3S2HI 4N5SA 2ZH9A 1N6QB 2ZH2A 2NU9B 2G0CA 4ED5A 5K8NA 1WSRA 3JZIA 1S1VB 4HHHA 4L3NA 4IWXA 3QJLA 1YG0A 3IGNA 4P2MA 1RT4A 2DD8S 4CI0B 1H72C 2CZ4A 1YX2A 1UFKA 2GVDA 3NH5A 4DPUA 4WXOA 4DLGA 2Z4PA 3WIUA 4NBHA 4DL2A 1WIIA 2P9CA 5ITHA 1SJ3P 3POTA 4H4MB 3MR5A 3KLHB 3ULHA 4I6YA 5ETMA 3KTQA 1YJ91 2HFSA 1SPBP 1MLAA 3BDEA 5BWXA 3KLEA 1K731 4GVBB 1H7WA 1T9YA 2HHPA 3VQSA 3RYLA 3CC2Z 1A3GA 3KXDA 3OW2Z 1YVFA 1I3QI 1PSDA 1WI6A 4BBYA 3MEKA 3FQKA 3HHLB 3V4IA 2W9CB 3UVJA 4MMOA 4MA5A 2K7JA 1VQ9Z 3M30B 2DCUB 1RT2A 4O4LF 3NDIA 1CKMA 3C66A 3DMJA 3CMES 1RCXB 1PYOB 1OO0B 2UV8A 1M1KT 3TE5B 2WVDA 5LMUJ 4YR0A 3D6WA 4ITSA 2QRCB 2C2OB 2DR8A 5GADU 1FT8A 1FE4A 3R97A 3MD3A 2CNVA 2C22A 4DDFA 4IWYA 3PM9A 2JIQA 4LF4J 3VAMA 1S4EA 1B0TA 2C3UA 4QU7A 1MG7A 2L08A 1U8SA 3OW2R 3QZ8A 3NAHA 1UJ6A 3Q86A 5AJ3J 4YAKB 3CD6Z 4BC9A 1T3NA 3PYGA 4YHHJ 1HWUA 1EQMA 3D3BJ 4NLGA 3QFWA 3H2UB 2E44A 2R84A 1U8WA 1NSAA 3BO4A 4NLRA 2GPWA 4WCEQ 2E5HA 2IA0A 3CCL1 3ZZZA 1YJ7A 4RBVA 4O7ZA 2VFVA 2YADA 5H9EK 2HWHA 2HS0A 2DB1A 2R6MA 1RHRB 1IOWA 4QYZJ 1Q7Y1 1JKHA 5IC6B 1FFGB 1L3KA 5M2UA 5BWTA 5KFUA 5BPFA 4RL1A 3E2EA 3KK2A 3MPWA 1CKNB 2DZDA 1C1BB 1SIWB 2I8CA 2H51B 2XSFA 2CZVC 3KKFA 3CCV1 5I5SA 2B51A 1SXLA 2AEJA 2OPRB 1KNZA 4QWDA 2YZMA 2JIOA 4C5AA 1IKWB 1G6BA 2EG2A 4ZLNA 1TAEA 4A8YA 2K3IA 1QVGR 5M2PA 4IH7A 4X4NA 1C0TA 3HJFA 3FKII 1WJ9A 2QYCA 1VQ7Z 2L48A 5F0UA 4M94A 3LUSA 1WOPA 4I2PA 3K2YA 1NPRA 3KDOA 1VLYA 3ILIA 1QE1A 3MMAA 1GT8A 3PRDA 1AFIA 2HBZB 3AY0A 3QT7A 1OPZA 3CCES 3T1HF 3RW7A 3LH2S 2B7BB 4A3EI 3PO3I 2Y0BB 2GQCA 2V0NA 5J2PB 3MPYA 3PHEA 3VAIA 3I12A 2DAAA 3MECB 5AN9F 4LBPA 1NU4A 4LF2A 2YS6A 2GQ2A 4DV4J 6FDRA 3CGIA 4OZJA 4FU0A 4DL0C 1FXLA 2YKOA 3LQSA 5HQMA 3L7PA 5J1EB 2IYGA 3HOUI 3RR5A 3BG0B 1JWHC 4U6PA 2WOMB 1X5OA 4ZP8A 4DQNA 3UFCX 1CS4B 5E0OA 3JTOA 5KFDA 5KFFA 4CO4A 3V6JA 4DAAA 5C25A 4MYUA 2HMIA 2DXFA 3H0GI 2CQ1A 1J2VA 3TDHB 4CCHA 3JAMY 1I1KA 2H85A 4FF2A 1CKOA 2GPSA 3EGNA 5A2QY 2RAQA 2QMXA 4RWWA 3VAHA 3Q8UA 1OQ3A 2RHBA 2R7UA 4MV4A 2DNNA 3RBEA 2QB5A 1U49A 4L76A 2P9EA 5KG5A 3W1YC 3P45B 4QWAA 3RRGA 1S59A 4BBRI 5DMXA 2W7AA 3S1NI 1E6YB 3NG8A 3K5OA 2UUCJ 2ZWPA 1IJFB 3RB6A 3DF7A 3MWEA 3VQTA 3WO0A 3GCXP 2XLKA 2A10A 4XZ3B 1NCLA 3IM8A 1WUUA 1ZA2B 2PIIA 2UUAF 1U0SA 2HNDA 1NK6A 3RZOI 2SCUB 2JJ4D 3R3TA 2OPQA 4EFEA 4YB8B 3ELHA 4DL7A 2Y1JA 3T9AA 4ZPAA 3UD3P 1Z2PX 2IAJA 2IY5B 3RB3A 2WAQA 2CPDA 3HHNB 2YNGB 4P2FA 1KJQA 4KFBB 3MD1A 5F8MA 5ETRA 2BJ3A 2ROGA 4DV3J 1RTHA 4J9SA 1KD11 3AXKA 4EGJA 5A76A 3H4DA 4WP3A 3OL9A 1IKWA 4CE5A 2E1PA 4IQXA 4IYQA 2HGSA 1OS5A 4DFMA 5KFKA 1V9PA 3WHIA 3O3LA 2VQEJ 3HVAA 1KC82 3WX4A 3OTEA 2W6NA 1VS3A 2OEMA 5L9XA 4F3OA 3MGJA 4BCAA 5KFYA 1PG5B 1PFTA 1R6VA 3M4OI 1VISA 2RRNA 4QR1A 3PO5A 3FMBA 4DF4A 2W2OP 4B9LA 1VOMA 2VBWA 4JI6F 5D1OA 3FGVA 3OLAA 4ILMA 3MTJA 1IBKF 1Y1VS 2J7WA 1NK9A 1GTEA 2IVYA 4TUYF 2JMOA 5AXMA 3ILLA 1R89A 2ZBRA 3O6QA 4NPOA 4MYTA 3Q8VA 1BQMA 3TAPA 4C11A 3SCKE 4Y28C 2XCAA 4OLOA 5THWA 4N8NA 1JKJB 4CWBA 1K1QA 2DNQA 1RHQB 2PO4A 1TL7B 4ED8A 2E9ZA 2JLFA 2V2VA 2AJQA 1JLEA 3PG9A 1NZAA 1CJKB 4TYAA 1EKRA 1RQFA 4ECRA 1IYEA 5LA6F 4DR3F 1S68A 3UDVA 3N01A 3MCNA 4I2QB 1EKFA 1W2IA 1JLLB 3KALA 4FVCA 4F3MA 3J81b 2R7RA 1MMNA 3PFOA 7FDRA 5EWEA 4OYWA 3EPIA 4X4PA 1M901 2VA2A 2IFXA 3ZTOA 5DLFA 4FDFA 3DC2A 1VQL1 1EARA 2PN6A 1MSWD 3KYHC 1YJWZ 2R7TA 3TUPA 2YWFA 5GMEA 2LVWA 1TWGI 2C3PA 5JH7F 2RVJA 2EWHA 3W66A 2IIHA 4A3KI 3IAS9 1WNEA 3RJMB 3WIVA 1VJQA 1VBGA 3VVUA 3D6TB 4RBUA 3HHDA 3QLHB 4DZDA 1VRTA 2XGPA 2KJVA 2MYFA 3T54A 1FD8A 3THPA 1K44A 2HHTA 2I9SA 4ECVA 2R82A 3DU6A 3CULA 4WP8A 2JOQA 2YRWA 5K3WA 1Q8BA 2KVQE 1HNZF 5KT3A 3KK1A 2OH2A 4ATNA 4OJ1A 3PVXA 4KPCA 3CSKA 1S1TB 2JEGA 2V34A 3GJTB 3JSMA 2M8DB 1ML8A 1EB0A 3D0GE 4MD9A 3CIMA 3RAMA 2Z02A 4KGKA 2DITA 2OFHX 1SBRA 4PZ8A 3Q2SC 3BGOP 3K58A 1JJCB 1RTDA 1VBYA 2R7LA 3CIZA 1YHQZ 4QYRA 4CLZA 2GO8A 4I7FB 3A13A 1BXRA 4FYDA 1B6RA 2BQUA 1VFJA 5DJBA 4RX6A 5C3EI 4ZOSA 3A3OB 4B3MJ 4CT9A 1YBTA 1YK9A 3GV7B 4ME6A 3Q8RB 2ZKTA 2Z2LA 1JLAB 1CQMA 1VMBA 3CO9A 4YB5A 3PZPA 3WWJA 1IKXB 2QLVB 1R9TI 1VQ4S 4OHYA 3TWZA 2K8GA 4PYDA 2WOMA 3C6TA 4CH0S 2XO6A 1GK8A 2CNKB 2CPHA 3DDIA 2RT9A 2LIYA 1AXQA 4A8XA 2V3VA 4U8YA 1UC8A 2RMLA 5E3CA 2AKLA 3SZ2A 1MROB 4WPAA 2VPYB 1VYAA 3PRBA 3CCTA 1BMQB 1RBAA 2DNRA 2DKOB 5LL6f 4DK1A 1YZ6A 3HT3A 1JB0C 1MU2A 3BKUA 2PMZD 1WC5A 1QVFY 1TKTA 4DRFA 2MKJA 2HVRA 3SIPB 4KBIA 3HM9A 5D4PA 1CC7A 5FPOA 1YIT1 2H5IB 2OWOA 3KK1B 3KDNA 4USUA 1RDRA 2RIJA 2ZJQQ 3BBCA 1USPB 1QE1B 4JI7F 4NZOA 3NBPB 4I2PB 4EUVA 1U0HB 1ROFA 4BY1I 2MLZA 2Y0SD 4UCTA 1O6XA 5C5JA 3UDCA 3A3NB 4ED6A 3KLHA 3G8SA 4X4VA 3V6DB 3S6EA 2HHVA 3UYYA 1RT7A 2XI2A 1HBUA 2GMLA 4HGZA 1G1XA 4MD7A 3R1LA 5BR8F 2FP4B 3AOAA 4X6AI 2BE2B 2AJ2A 4DR2J 2P28A 3MF5A 2VPZA 4CKCA 4PXEA 4AFFA 1YJN1 1ZM2A 2CADA 1TFYA 1HQUB 2XBPA 4S1TA 2HFZA 4DR1F 1OBDA 2GAGC 2AF6A 5HVGA 1QSLA 4ZJQA 4ZMMA 1VQN1 2H1YA 1AA1B 3KG0A 5J2QB 5BYQA 4PG8A 3KK3B 4OZ5A 2GJFA 3KJQB 3OR1A 4ELVA 2FHOB 3M3YI 3NGKA 3MCSA 4WJBA 3CPWZ 3NLCA 1UEUA 3QAEA 3OFHA 1HR0F 1VQYA 4RJVA 3H5SA 1OSDA 4USJC 4R0EA 3LWMA 1RYSA 4C5BA 2B5JB 1X9MA 1UTAA 1X4GA 2ZITA 1N6QA 1NO8A 1CJTB 4UT4A 3CCQ1 1K0TA 1RTIB 3W8GA 2UUTA 2IYIA 4J9VA 2UXCF 3OBIA 4ZVUB 3VOTA 4C2MA 2FC8A 2VU5A 4J9UE 3MCMA 1SIZA 4EYIB 4G3IA 2R42A 4HNUA 2BANB 1RWKB 4FXWA 1PX2A 3WBZA 4Z37A 4DCOB 2H5EA 3BSCA 4FF1A 2JA5I 3T5KA 1VQLZ 3IG1A 2CJXB 2ZH5A 4Y3CA 4C98A 3L2PA 2OPRA 2PGCA 1K8AT 3QAUA 2QLWA 4I6WA 3MPDA 2EBEA 2COLA 4LSLB 4OI3A 2RDJA 3K7AI 3AOBA 3AB4B 1KLMA 4NI2B 1NJIT 2IAJB 2IVMA 5J1EA 4DPTA 4RZQA 1A9XA 4CO1A 2AJ1A 2DGQA 3DYAA 1B6SA 4EZ6A 2GS8A 3HVTA 3ZZTA 4DXLA 4XPEA 1TKXA 5B08A 1RJJA 4KGVB 5AXNA 1RTHB 4IKAA 4HTIA 5F3ZA 2XM3A 3EJMA 4P7TA 1KOHA 1PJ7A 2Z2YB 4FS2A 3V4ZA 3KLIB 1VQK1 4Q0BB 3ORRA 3M8QA 3H42A 4LQ3A 4PEOA 3MM8A 1HQEB 4HLBA 3A8KA 2Q51A 1RWPB 1Q4RA 4DFPA 4ZP9A 4K4UA 3IR7A 2QN6B 1P8GA 4YJ2F 4P9SA 2IPOB 2X0SA 2AYEA 4QIFA 5IC4B 1YWXA 1R7IA 2JH3A 2B4OA 3MMBA 1IBMJ 4QIVA 3MHYA 3HK2A 2W6ZA 4DU7A 1NUEA 1M5KC 1PAEX 2HNZA 2YKNA 1SFOI 2MLXA 2J9DA 5GAEI 4WTOB 1NUIA 5B7WA 3PW7A 1RE1B 3HOXI 1RU1A 4FZVA 3FCVA 3FFIB 3GU0A 1VQNZ 4LSLA 2R8JA 3Q8YA 2BW2A 3CJ0A 4M9UA 5ETTA 4FPRA 4B08A 1SB6A 2LFUA 1FJGJ 1ZM3A 5KG6A 3ETHA 4DV1F 1QAYA 4PZ6A 3CCJZ 2DY9A 2E29A 2LQ9A 3WWHA 1YBAA 3M05A 1X4HA 4I64A 3TR5A 4A3LI 1CQJB 1OY6A 3I9V9 5DS7A 3MAAB 1QVGZ 2IJRA 3TVZA 4OHZA 2YY3A 3S8SA 1ZM4A 2HAFA 4ICLB 4CLTA 1YIJS 4NB9A 3OL8A 2M2BA 1VQPS 3CD61 3I561 5J2MA 4DV3F 3C15B 2BMBA 1YRUA 4ZIVA 2DNMA 3S15I 3D1HA 4CLFA 2YKNB 2V8IA 1RLCL 4RVDA 2RBLA 5K8OA 4X64F 2LU2A 3M8RA 4YOEA 4WXWA 3Q89A 4FP9A 3KLGB 2NU8B 5AT1B 4B3RF 2J6TA 2CJQA 3NH8A 3TINA 2N4DA 2FC9A 2A3JA 5B0BA 1N2FA 1N48A 2JEFA 2J5AA 3TA0A 2L41A 5KFBA 3MURP 1RGVA 2FHJD 4B17A 3KNAA 3OTOJ 1QVFZ 4PQUA 1SH2A 1X31C 2J0WA 3CCJS 3AX6A 4Y8VB 3CO0P 2E2JI 1HD0A 1G4CA 4IG3A 3FJ2A 4NXMF 4ZP6A 5DM6Q 5IFMA 1KR4A 2X1BA 4E2YA 3EDRB 1SV5B 4DR6F 2YW2A 1CBKA 4YS2A 2FTRA 2HMIB 3LGHA 2XS2A 1BWEA 4E31A 1QAIA 4O82A 2XGQA 9ATCB 3VTNA 4NBEA 2YPYA 3OUUA 1Q812 1D9AA 3R7NB 2CNNB 3CCUS 2BQRA 4E2FB 1T9UA 2OMLA 4O4RA 2ZDHA 1HNXF 4ILLA 3JS9A 1KJ8A 3AQOA 1VQO1 3CD0A 4CO3A 3R5AA 3QGGA 4F3QA 5CYQA 4DMZA 1FDAA 1HWIA 3VV2B 1RA6A 4LRAA 3ZTRA 2EFGA 2ZDGA 2RQCA 2V8JA 1DARA 3IRXB 2BJEA 2B8PA 3LA0A 2W9BB 5JVLA 2QMWA 4LFAJ 3KK3A 2XHCA 1C4CA 2YWWA 1N8R1 2VOOA 4P2XA 1X3WA 5KFXA 3QFHA 2HF1A 2CPIA 3EXYA 4R0JA 3G4SZ 4ZVQB 3GTLI 3IGVA 5D1OB 1X0PA 1Y4ZB 1W93A 2DCLA 1WELA 3GCWP 4NBAA 5MLCV 4DLKA 3KWMA 1FX2A 2E9HA 4RW7B 3TW0A 3F3FC 2LFVA 3AJ2A 3RUBL 4X4QA 5LXYA 3NDJA 2H9ZA 3ILOA 4IH5A 3PR5B 4NX9A 4DHVA 3CCEZ 4U95A 4R5PB 1AA6A 2XCPA 3CCM1 1A9NB 3N5BA 3FVYA 2MPUA 2QSWA 4CIOA 3KHHA 2AGQA 4F4WA 4OJ3A 5KFGA 4I7FA 1OQ6A 3PW2A 1RTJB 5I60A 3BG1B 1TV6B 4ZJLA 4H4KC 4NZ0A 3HHLA 2GGPA 3DRSA 2B9XA 2V5AA 1QY7A 1HHQA 3TUJC 3O5TB 3WNZA 4LFBJ 1T7PA 5ETVA 3R5HA 3AJDA 3S24A 4HYKA 1S7MA 3HHLD 5KFEA 1K9M1 5E25A 4WK1A 1VK8A 2P2CB 3OT9A 5T7LA 2ACYA 1JLFB 5CD4A 5F8NA 2EFOA 1I94F 3OR2A 3NUAA 4DSLA 2VFUA 1HPZB 1WG5A 1IM4A 3OLBA 1X0TA 5I5VA 1U1OA 4DR4J 1PO6A 4DQPA 2YZLA 3DGVA 3DLJA 2YVSA 1KD12 1N36F 2PA3A 2UXBF 4UCOA 2HDKA 4MIAA 4G1IA 3KMSA 2IMOA 2PA8D 5KOXA 1VDHA 3KUGA 4EFBA 3ZTPA 4OYBA 2VUMI 3A12A 2UXDF 2IP4A 5CZXA 4UUGA 1VQ91 4E2XA 1YJ9S 5E7OB 4DV6J 2VDIA 3CCZA 3CCE1 2MQ8A 4ECXA 2O1PA 2AZ1A 3OPKA 2IZ4A 1Q16B 5DG8A 3OSPA 5HROA 3HVRA 4ZPTR 1M5VC 1HYSB 1JLCB 5B0DA 3TZYA 3OSNA 1RT7B 3QGHA 2NVTI 4HT5A 1PC4A 2C2DA 2W6MA 3HCXA 3ILJA 3PW0A 3Q22A 3L9ZA 2OTJS 4JI3J 3IR6B 2B0GA 4ANDA 1GMWA 2W9CA 4ZN3A 3W60A 5C2CA 3CPWR 1R0BG 4IIJF 2XYGB 3GTJI 4GC6A 1ZH5A 1I7NA 3MWBA 3BACA 4X4OA 3MR7A 5HVHA 1F9FA 2LDYA 3G87A 4B02A 4BS2A 3P96A 4RBTA 4HH0A 1AYEA 3T1YJ 2W6PA 4X4RA 4M5LA 4WFZA 4DF8A 4R25A 1R0AA 4HH1A 4NXNJ 2BM0A 1Y0HA 2RUGA 3QO9B 2C2EA 3S2DI 1VRUA 3BV8A 1U47A 1RWWB 3UNYA 1S49A 2M88A 3GILA 4OHXA 1VQOZ 3VZHA 1TUWA 5HMWA 1Z2ZA 2ABYA 3R5GA 2COIA 2FHKA 1VC0A 4RNNA 5HO4A 5ETNA 4DV5J 2DO4A 3K17A 3G4SS 1ZTWA 4FYXB 2ADCA 3BABA 4TVIA 5IYZF 4MJKA 4MKAA 5BYAA 5KFIA 2LP4A 2QYGA 4WE1A 2NXCA 4Y2AA 3DAAA 4MRIA 4W90B 2YX4A 2ASLA 4O7NA 4NZ6A 4MIWA 3BA8A 2LECA 3HF5A 3UVJB 4AYBA 1FDDA 1NDPA 4W92B 3PIPQ 3QWUA 1GXUA 3VMGA 2FHMA 4LF5F 5FR9A 2U1AA 2A6MA 5FIIA 5IM0A 1KC8T 4XDDA 2I1RA 2JL9A 4L75A 3TZXA 4PXDA 1TMMA 2KJWA 2CWKA 1NDKA 2EIYA 1Q811 2HHUA 1KTAA 2F4MA 4P10A 5FLXb 1KLMB 4NI2A 4CNYA 1RK8A 2DY1A 4BDPA 1YKWA 2N4CA 4GLXA 1WG1A 2OIHA 4ES2A 2W4DA 2W70A 3LTOA 1RACB 1TKXB 5H80A 1RWNB 4OYAA 1R0AB 2AKWB 5C7PA 2HWIA 1X9WA 3UCZP 1JLQA 1TVRB 2HGNA 3UDLA 3BS9A 2PEBA 3OQ2A 4WWSA 4J9OA 3W5ZA 2VG6B 4XYLB 1VJWA 3FBCA 4MTPA 2GMJA 1A7GE 4PBCA 2WCXA 1RISA 3GFYA 3M2UB 4ZCLA 4FVMA 4IRKA 1N54B 3T5LA 2CQ2A 1EKSA 4FPIA 3CCRS 5T14A 1H0HB 4FBUA 3JTPA 4ECUA 1WC6A 3TY5A 3T41A 3PXGa 3W2VB 4WFBQ 2OTLS 1Q5YA 4JI3F 4NRTA 2DHXA 3K5PA 5DQGA 1IR2A 1NHUA 3MMCB 5A8RA 2BM1A 1UCNA 1IKVA 4JOUA 4PKDB 4JI5J 3CE8A 2HZVA 5GMDA 3AAWB 5K5MA 1KTQA 1M0TA 3CDWA 1YUKA 3I9ZA 4D3HA 1CS4A 2X7IA 1NHVA 1S6PA 3OXLA 4DCJB 4HHJA 3S17I 1Q8IA 2H3EB 2HHHF 1LWEA 3BEGB 2HGWA 1NMEB 2KU7A 4QBUA 3HSGA 1QSYA 5K20B 3MJFA 1JX4A 2V8PA 2VQFF 1J5OB 1RT6A 1GSOA 3PN1A 4O81A 3DOKA 1S721 1HBNB 5JQGF 1JXVA 4RWXA 5FLXf 5IQQA 4NYZA 2VASA 3IRWP 1S10A 3F0NA 2WZ1A 5F3TA 2BX6A 4MAKA 2I87A 1VQM1 3CJKB 3K5LA 1OBGA 2HIVA 3B54A 1YUAA 2XEXA 2DPJA 3QJJA 1U48A 1U1MA 2WHOA 3M1VA 2C3OA 1VRTB 5DGIA 3A8EA 3GYXB 2OTJ1 1S0NA 3NRBA 1DLOA 5HNEA 2COGA 3ZZOA 5GAEU 5A6PA 3GIKA 4EMDA 2KG0A 3A8JA 3C14B 3TI0A 4DFJA 2BR0A 4UOFA 2GIQA 1QSSA 4Y2IA 1IKVB 2EXUA 3H3VJ 4ID8A 1ZETA 3AA8A 1QVFR 1WHYA 4IO1A 5JJBA 4F25A 2CNUA 2J9EA 3R8YA 2K1RA 3S1MI 3H40A 2R2UA 2VHGA 3LGMA 1U1LA 1FEEA 3UN2A 2YNGA 4MK7A 3NCPA 3CCMZ 1B99A 1HW8A 2WW8A 1ZBTA 4JI1F 1HFEL 3CD6S 3QT5A 4B3TJ 5JUMA 4B3RJ 2R8IA 1M1K1 3MM6A 1JMTA 5A8WB 2B4UA 1TL1A 4DFKA 1E6VB 3DOKB 1GMUA 2XC9A 2E7ZA 4LSNB 4F7VA 2WVFA 3JSBA 3C6TB 1RCOB 1Q7YT 3N5FA 1L3TA 1Y9OA 3FKBA 3CJKA 1WOOA 4DSKA 2YL2A 3CJTA 4NEYA 2CZ9A 2DH9A 4ZVSB 1NDLA 2YX1A 2E5LJ 4DEZA 2DR6A 2HVEA 3JSNA 2IRUA 2VG6A 5IT0A 4A3FI 1WRVA 5I47A 4MV7A 4C97A 2ZH4A 1U4BA 2OPSB 1KTVA 2F4OA 4MH8A 3CCU1 3CTRA 4A3DI 1DZ5A 2NPFA 5KT5A 1MN7A 3HO1A 1HPZA 3ZXWA 4CTAA 5J2UF 3M7VA 3SV3A 1JNZB 3C14A 4ECTA 3MONA 5I3QA 2A6OA 3CW2C 2CQPA 2W2NP 3HJVA 3DM2A 1WKJA 1OYDA 1X4CA 3EGWB 1N8RT 4MKBA 2K1RB 3DXBA 2RE1A 2UUBJ 4NZ7A 4U7UD 3IBWA 2MGZB 1XK8A 2W8KA 3UZOA 1Q862 3CJ4A 4X66J 1KC7A 4DQYB 2GV1A 4DSIA 1XNQJ 1MN9A 2V4RA 1HBUB 3LQVA 4HGYA 1RHUB 1XR7A 5HROB 4BC7A 1QTNB 1Q82T 1U6ZA 1VQP1 4HDGA 5A8WA 2ZM6J 1YITZ 1S72S 4M5IA 1NJWA 2XSJB 3KJVA 1M5PC 1SJFA 2ZH8A 2CQ0A 2RRBA 1ZTTA 3J7YI 3IFEA 3LP0B 3J81U 2XY5A 3JYTB 3BR9A 4YB7A 5DAAA 1C3OA 2MZTA 3DLEA 2LXUA 3WQPA 4F4XA 1DV1A 1Q7Y2 3DLEB 1KC81 4EBDA 1B7FA 3KAKA 2VJUA 2QC3A 4K7QA 2IZ3A 1CVJA 4KC5A 1Y5NB 1BUXA 3ZTSA 4Q0BA 5LT5A 1BQMB 3GIJA 3NGUA 2KM8C 2IM2A 5CE8A 4JB8B 5D77A 1GX6A 4ZLJA 1ZB8A 4UCVA 3OL6A 4FBTA 3M8ZA 2QL7B 3VGTA 4NMXA 2JEIA 4F0KA 3F3PC 1N34F 1RI7A 4NMLA 2DRDA 4G1PA 1UWBB 4WBNF 1MNEA 4A8KA 4O7LA 4W98A 2HQ3A 4QZVB 2DNLA 5CA0F 2K3RA 2BBEA 2ILZA 3AOCA 4IHJF 2HSEB 1KEEA 2H5JB 3EGZA 2UXCJ 3CCWA 1GNKA 2V2ZA 3T9CA 2OOXB 1TP7A 1URNA 3G8TA 3GIMA 3TP2A 2NAPA 2MKHA 1WF2A 3NC0B 3W63A 2M70A 4EK2A 2GMHA 1PYTA 1BC6A 4ZKAA 1LWFA 2F9JA 2ZC3A 3U1MA 1UVKA 4E2ZA 2CQIA 4DR7J 2J6AA 3TQ1A 3H2LA 2FPHX 4TQRA 1IKXA 2J7UA 3TIIA 1FWKA 4ZITA 1UEKA 2HPUA 1NRKA 4DR5F 1S77D 2E66A 3VF0B 3WDOA 2UP1A 4JV5J 3BBBA 3HVTB 4LRDA 5EDWA 1R27B 5D4LA 1GTHA 1S1XA 4NRUA 3OXGA 3K5IA 3TY8A 2CQ4A 3T19A 1MROA 3S01A 1URRA 1A0OB 2AP6A 5HBRB 1XNRJ 3MZLB 4OI4A 3PJ9A 2WB1D 1VQ4Z 4PG4A 4IR1A 5CYMB 2R7KA 3MEEB 1K9MT 1QXFA 5IQ6A 5CD4H 5T7LB 5EN1A 2ERRA 3UQ8A 4UTGA 2OO4A 3EVWA 5DLGA 2D41A 4MK8A 2KFZA 4JUZA 2G9OA 3MEDB 2MQQA 4DN0A 1T05A 4M5KA 5HJXA 4CLSA 2FPIB 2BQ3A 2YWVA 2Y0SA 2A2DA 4Y2MA 4L73A 3H59A 3H4BA 2AGOA 4OLPA 1JLCA 1Z03A 4UZCA 2R93I 3D28A 4DUYF 1UKUA 3PKMA 4ECYA 2NXNA 5K2MA 1VQ5S 2CPYA 4X2BA 3W2WA 2O66A 3BO3A 2HHXA 1DY3A 3ETMA 4E6NA 4FF4A 1F9EB 2IA6A 1WD6A 2OPPB 4I50F 4MXUA 1KQGB 3C3LA 3NS5A 1L5UA 5IT4A 1Q78A 1JQGA 1KP6A 1S6QA 1S1XB 2HWTA 4MFBA 1MU2B 1IWGA 2OAUA 1UETA 4URQU 4DOZA 3HHLC 4MKYA 1CQIB 4GMKA 3VPBA 2AJ0A 4KKOA 4NBFA 4UY85 4EGLA 2R8GA 1JK9B 3O8WA 4O7VA 3R5BA 3B4MA 3B82A 3VMIA 4X65J 4JI6J 4BXXI 5BWVA 4RW8A 1I2LA 2QIFA 3E01A 3LO3A 4M5DA 3OJSA 2V59A 4TXSA 5D8HB 3VALA 2XQCA 5T6BA 2HFOA 3NNAA 2DGVA 4ED4A 1X4EA 1JDEA 3FZ2A 1TUGB 3Q87A 4UFZA 2X5RA 1YJNZ 2FUG9 4OX8A 2OOYB 3Q2TC 2Y1IA 1RBLA 1JDBB 2MKCA 2HLUA 2KRRA 3G6EZ 4O44B 5K14B 2WSFC 4MT1A 2JSXA 1SL2A 2E1AA 5HK4A 2EKNA 2BZ2A 3ZO7A 4MAMA 2KXHA 3LF0A 1KQFB 3M9MB 4J9RA 2EJ3A 4FFOA 4KR0B 1UMJA 1RADB 2OD6A 2EFQA 5LSRA 2EFVA 3CCR1 3CWJA 3Q0AA 4PZ7A 1LK7A 4NXMJ 4TV9F 2MTLA 1AB8A 3LALA 1WEXA 2C28A 4HT7A 1FKOB 4Q8FA 2KG1A 1VC6A 3ENWA 1O8BA 1SKWA 3K59A 1FWPA 2CG4A 2W6OA 1C30A 1FD2A 3ZC4A 2JUBA 4M5HA 3BPSP 4NLSA 1TL1B 2DBBA 4WFXA 2B9YA 3THTA 3G6ES 4Y0FA 1D8ZA 4RNFA 3RBZA 3GTGI 1QF8A 2DJWA 3IP0A 1NKCA 1KN6A 4FN5A 3DOMA 4F0MA 3RB0A 3PFFA 3BKTA 2CQ3A 1DGSA 1DHMA 3LW5C 4USMA 4JBCA 2QEXZ 2Y9HA 2AHOB 2VH7A 3N6MA 3GPAA 3HFVA 4Q8EA 4RW9A 3RU0A 1P1TA 2LLZA 1LWXA 5AE2A 4ZPVR 3S1QI 4DBQA 4OZLA 4UOGA 5HLFA 2Q6CA 4IG0A 3BGLA 1RZMA 2BJOA 4OZNA 2DHGA 2ZBCA 4IFYB 2WONA 2RB7A 4MK9A 3D1QA 1U02A 5F8GA 3QZ7A 1ULRA 3DRRA 4KYZA 4DV7F 1LWCB 4CQ1A 4G6VB 2DNYA 4EEYA 3W7BA 5L1LA 2CUYA 2D1CA 4DR2F 2KI7B 3UCGA 5FDLA 2RDDA 4PWUA 4GRSA 5KFNA 1I7LA 2A0FB 3D3CJ 1LEOA 3DRYA 4QJVA 4ED2A 4K2XA 1HNWJ 2HFUA 5LJ5Y 1U1QA 1LWFB 4NBDA 3DOLA 1VQ41 1HHSA 2LEPA 4NASA 2ZAEB 1HBMB 4JYAJ 4DUZJ 1C4AA 3SQGA 5GADI 1WJ2A 3TIGA 1TAQA 2HLTA 3MM9A 3C19A 4O3RA 1EKPA 1N0UA 2DIUA 3MMAB 3BPDA 1IQZA 3IX0A 4TN2A 3MEGB 3U27A 2KPIA 3KHRA 5C42A 3C16B 5HANA 4UQGA 3D0HE 4ANCA 1DQ8A 4ZS6A 1HNXJ 1TL3A 5J2TF 1GX5A 4U96A 1J27A 1P6TA 3CJ3A 2HZCA 1L3VA 2UVRA 1EIYB 2VPWA 5C4XI 2Z2ZA 2W4PA 2NS1B 3MOJB 3TEHB 3DKDA 2Z0GA 2Q2UA 4K0KF 1IBLJ 3OHAA 4A46A 4Q5VA 4F26A 2MJNA 2K7KA 2XS7A 1O0PA 1T9XA 1G2EA 1U2RA 2DE6A 1H3DA 1AUXA 8AT1B 2VF3A 1XQIA 4NLYA 2VBXA 3BSAA 3WC2A 3IFUA 2KTQA 5KFVA 2F4VJ 2JNJA 4MV8A 2I80A 3HZGA 3TJ9A 2HRYA 2PFFB 1K73T 4ZHQF 2QA1A 3C6UB 2ZBIA 2KZMA 5HATA 2M48A 2VG7A 4BY7I 2ZOMA 3JAMb 2GJIA 4QIEA 1X8DA 4ETXA 3KLEB 1Y3JA 1BY9A 3W61A 2GTIA 1S79A 2FQQB 4LFCJ 4D3GA 3MM9B 4N7TA 4PUOA 1B64A 1VBKA 3KHGA 4JI4J 5H9FK 4LF9F 1RT5B 2H65B 1FK9B 1M0SA 1UFWA 1JXEA 4NCBA 2LEXA 2VUGA 5E2QA 1YJTA 2KFYA 4RVHA 2MJUA 2V4JA 2X51A 5JMNA 2XZDB 2UUWA 2ASYA 2GC8A 3CMQA 4DV0J 2UU9J 3ADAC 2EK1A 2QR1B 2R7MA 1JLGA 4AL6A 3MPUB 4ZCKA 4NBCA 5GONF 1S9EB 2JA7I 5L8RC 3MM5B 4Z7CA 1AROP 3KAJA 3QLHA 1CPZA 4ES3A 1AT1B 4GC7A 1TA8A 1FDOA 4DV7J 2MQMA 3W8PA 3CCS1 5BR8J 1WSVA 3IM9A 2J0QD 1HMVA 5F8IA 1YJVA 3ETJA 1CULB 3W9HA 1UVJA 1I6JA 2G2ZA 1U1RA 4FFMA 1YJ9Z 3HPOA 1R3NA 3JXOA 3M8YA 1VBXA 2MKSA 5DDQC 4A8SA 1S6OA 3A4TA 4WFYA 2NLWA 3QT8A 3TARA 1A0GA 5DZ6A 1HNWF 1H6KX 3SCLE 3IBCB 5GMKa 1RTJA 4IZOA 1B7YB 3KFWX 4OX7A 1T9TA 3H90A 3PW4A 4YEAA 2QJ3A 1LFPA 1WORA 2AZ3A 2RSQA 1WC0A 1E6VA 4TM5A 1D3WA 1YHQ1 4TV8F 1QUPA 4RUHA 3V81A 4F50A 4N8OA 3U0GA 1LW2B 3ESWA 3CC2S 2W03A 3AT1B 4NZNA 5CXTA 2JIRA 3I6PA 2KYZA 1MW7A 3CJ2A 4S0MA 1AUSL 4B9NA 3QWPA 1QVGY 1DURA 2WAQD 3LANA 3BH7B 1S97A 3M4XA 2IDEA 2BXJA 5LMUF 3G711 1X0FA 1BE4A 2KYXA 2QT7A 3OR1B 4UZBA 3GP9A 4A8OA 4HHUA 1XIQA 1FF2A 3GYNA 1UVIA 3MEDA 2RU3A 1LOUA 4KKOB 2E5JA 4EQ5A 2KXNB 1KEKA 4IR9A 3L7OA 1WEZA 3FK4A 2R8KA 2RUSA 5KFLA 1T9WA 1VQ9S 2OKQA 2VBYA 3R5CA 4DJBA 2XMAA 4DR3J 2F9DA 2V63A 5E3RA 2QA4Z 1RO0A 4M5NA 1V3SA 2E2II 5KG3A 2AWZA 2CA9A 2YNIB 2G1DA 1M5SA 2XYPB 5CR5A 5FPRA 2XLIA 1Q5VA 3KLFA 1H7XA 3EZUA 3MMCA 1C1BA 3MAHA 4DLEA 3N6RA 2QLBB 4RPFA 3DDNA 2DLNA 5HQ8A 2EG1A 3V2UC 4BWJA 1UZDA 2HBQB 2PEHA 2OTJZ 2I5JB 5KG0A 4FFNA 2IBKA 3R1HA 1OPIA 2VG5B 4DWIA 4PG6A 5HMZA 1LXNA 4QR0A 1FTCA 4NE9C 3EPGA 2HRUA 2KRBA 1N5VA 2KHCA 4JV0A 3G2XA 1S6QB 1LV5A 3DI6B 1U1NA 2E5IA 3LUYA 4NZMA 1RTIA 1S7HA 4OYZA 2F4FA 3D2WA 4A8WA 3SDEA 4TKTA 2NSCA 2FLLA 2HK2A 2DGTA 3G82A 1S72Z 1CJVB 3PJWA 4OHWA 4B9TA 3GSDA 1GFWB 3SEOA 3SQOP 1EHIA 1X60A 2I6WA 3C46A 1NNDA 3R9RA 4RW4B 4DSFA 2HBRB 3S1RI 4DZ6A 3NBYB 3BJYA 4XIUA 2OPSA 3FSXA 2JLGA 1XR6A 4USIA 1OMSA 4NWBA 4PWWA 4O4HF 3K0JA 2DXDA 3SE7A 4DR5J 3JQJA 4OI2A 4JV5F 1X9SA 3CD5A 2VPWB 1UPPA 5K14A 4IDKA 3RB4A 3AW8A 1NKBA 2Z57B 3JAMU 3J81f 5KG4A 2HW3A 3IN5A 4QIGA 2NVYI 2YZNA 4LT6A 2KFNA 5LYJF 2VV5A 1HNZJ 1CJKA 3UW1A 3Q1KA 3DGPB 3I56S 3IS9A 1FHTA 4URSA 4U7UK 4KTQA 2ZOFA 3GV5B 5KS8A 4ZA1A 1PBAA 1Y5IB 2OGUA 3IR7B 2CNOB 3GTMI 1PKUA 1KQSR 4FYVB 2HAIA 3P3DA 3T3FA 1W2BR 3OUZA 4NBBA 1IR1A 1RAJA 5K8PA 4YJ3F 2HHHJ 2Q7DA 2HURA 2PI4A 3EX7B 2R3VA 4C8NA 2M52A 1FNMA 2BRLA 2ZBQA 2VPQA 4YUDA 4DPYA 4DQQA 1Q53A 5KG1A 1G2WA 3TUZC 1FERA 2MMYA 3Q8SB 3J80f 1DTTB 2R7WA 1SQGA 2HHWA 5KT7A 1WR2A 5C4JI 2WVEA 2QE5A 4NEZA 5C1OA 3RW6A 2AIRB 2JWNA 5LXRA 1LQ9A 3EDQB 5I5WA 1KUTA 1M1GA 1NK7A 3H20A 1VQSA 3PYFA 4CTAB 3QRRA 1N32J 4HEA9 1VQ61 5B0AA 2E9RX 4CM2A 2CIMA 5T41A 4M5JA 3DM2B 4MV3A 4XX0B 4FFPA 5KFAA 1M902 2OFGX 1VQ5Z 2NSBA 2Z2MA 4TQSA 2ZVSA 4KO0A 3CMA1 4MA0A 3KHLA 1Q81T 3FSYA 3GKQA 2I5JA 5E3AA 4IG3B 4PUOB 4Q2MA 3GTMS 3QNWB 1VBZA 3PX0A 5IV4A 3JAMf 4Z7YA 2R7SA 1ZAUA 2HHFB 3WWIA 4BLGA 4CLUA 5KFWA 1X4DA 3U50C 4E98A 5C1PA 2M9KA 3R23A 3CC4S 2OEJA 2R87A 2Q66A 4FNIA 2HVDA 2AX1A 2LEBA 4ZVTB 3HSDA 1TV6A 4M8LA 5KFCA 3CDUA 4X4UA 2PT0A 4F2SA 4ZVRB 2NZ4A 2DISA 5KFOA 4J90A 5LMNF 4URGA 2FVCA 4O2AF 4QW8A 3BAAA 2XWXA 4RUBA 1NK0A 3RTXA 5T64A 2DR5A 2L3MA 3VA7A 1FJ7A 2CNQA 4HACB 4RUCA 2PMHA 5J2MB 4F4ZA 1VQ71 1WKKA 3M2UA 1NSQA 2KH9A 3BN4A 4QSHA 5IOLA 4DR1J 2GLTA 2A2CA 4YDDB 5B0CA 2JVOA 1F5BA 4BBSI 3W3SA 1T0TV 5U47A 5I5XA 2YKAA 2FLPA 3I4MI 3MFIA 1BD6A 1EETA 1W7WA 1FJCA 3EE3A 3PEJA 1FRMA 2Q3PA 4AT1B 3B6BA 1RAFB 4CRJA 2CRLA 5DETA 1Y1WI 1CJUA 4B3SJ 4FYYB 5EZYF 3FUYA 1TL7A 2DHHA 4MIBA 4IRDA 4WZQA 1GSHA 1WDTA 2FGOA 3DHWC 2CG8A 3T6BA 3RGIA 4DSJA 1RKIA 5D4NA 1M90T 1REVA 2I0XA 2QL5B 1Z2NX 2ZDOA 5KAKA 2N82B 1S57A 4GVBA 3PW5A 1HI1A 1WACA 2Z56B 2JRSA 1FO1A 4C8MA 4TLQA 4RLEA 5FLXU 1I1GA 5DDPC 3TX8A 3BDPA 3PRVA 3MFHA 4QQBA 3FMWA 4HVZA 5AE3A 2Y1LB 4ECZA 5KKNB 4OFZA 3ONQA 1WDDA 5KFPA 5C2GA 2R2SA 1ZZNA 1TWFI 3CJSA 3EM1A 2W1BA 1RHKB 5BMVF 3EICA 1KWMA 1PGZA 2XYHB 3R7BB 2ZM6F 3HKWA 4CC5A 1ULZA 4O7YA 5I5TA 2NXEA 3HD1A 4F2RA 1N33J 2IM3A 3KUEA 3HT0A 4DIMA 4LF8F 2L9WA 3D1OA 2VICA 3J81Y 1O5JA 1SH0A 4CNZA 2W9AA 4H4MA 1PILA 1WC1A 4O4GB 3P8BB 5CCLA 5IS2A 3UPFA 4CM0A 4UF4A 4AUKA 2KI2A 2D69A 2AYBA 4QIWD 4OYIA 4KHPJ 2M5YA 3PV8A 4GO5X 2RU9A 1HBOA 4U67Q 5JVGQ 1RTDB 4KQZA 1JKHB 1MWYA 2J0XA 4AD6A 2KL8A 3SCIE 1BLUA 1K8A1 5DGBA 2XY7A 3UN5A 2QTWA 2ZZNA 4B9VA 1NM2A 3OL7A 3VAKA 2CJBA 2IV2X 1NB2A 4MV1A 2YYAA 3GZ7A 4X4TA 1S4FA 1NBEB 4ER8A 2Y8WA 4IFVB 5L9NA 5F8JA 3GYGA 2X1GA 2C2NA 1YSJA 2U2FA 2AU0A 3RBXA 1RU2A 4Y52I 5D4OA 2QLXA 1ZYQA 1RWOB 1ELOA 2VJVA 2I8EA 5IM0B 3T9BA 3AD7C 2VF1A 4IOAQ 1FK9A 1SUQA 3V81B 3C15A 3S7RA 1FFWB 2HBYB 2UVWA 5KX5F 4CZCA 2HQCA 3CXCY 3DNCA 3OTBA 1HWLA 3CJ5A 3I0SA 1ACMB 1YZ7A 2WTFA 2IBOA 3TQTA 3CCVS 1U45A 2CPJA 1FRJA 3UR3C 3OVAA 2N7CA 4DS4A 1KLNA 3BGRB 1UWBA 3LP2A 2JDJA 4M63A 4LIRA 4P74A 2R86A 1TAUA 2Y4RA 4O83A 2GA7A 3VAFA 5JVDF 5C8YF 1NPKA 4OL8A 2R2TA 2F40A 4RO0A 2EK6A 4IOCQ 3EEDA 2J6SA 2GNKA 4IDKB 3LP2B 1S6UA 4I69A 1TKDA 1YGYA 1FXDA 2J0SD 2G0JA 1EYZA 3EYZA 4QPTA 4CLWA 5CQGA 3CVKA 2EJ2A 4O7TA 2RF2B 3K8WA 2JX2A 3QT6A 1S0OA 1PJ5A 2RHQB 2RILA 2AT1B 1HQ2A 2DH7A 3LP1A 4K50A 2EFPA 2ROEA 4C4WA 1CLFA 2OPPA 4LIWA 5HI7A 3U1LA 2ZE2B 3P5TL 5C25B 2OJ3A 4HNVA 5LJ3Y 4ZPDA 2EJ0A 2HVHA 3NWRA 1TK0A 1RT6B 1IWAA 2WW4A 1VQ51 2Q79A 4PR6A 1RLDA 1SC1B 4O23A 2FZGB 2W2PP 4KT0C 5SUHA 2P6TA 3I56Z 1VQ6Z 5DQHA 3LGNA 5IWAJ 2CNLB 3TJAA 2PK7A 2XZTB 3DI6A 5F41A 1X4FA 4ICLA 2J8AA 4O3NA 1V9OA 4WYLA 5E33A 1VRQC 4DR6J 2DGWA 2PVPA 3ZTQA 2MY7A 3D4JA 1VQOS 4J9KA 1KRPA 1GMVA 2FZKB 4TU9A 1VRUB 4CKEA 5KOWA 3BM7A 2NUHA 3CC7S 4DUTA 4DS5A 2FPGB 4ZOLF 3M6WA 5J2NB 4HNTA 1RAOA 5E3QA 2P6SA 4NLQA 5I5YA 3CCMS 5RUBA 1U6BA 3TAMA 1R8HA 1Q16A 1WTFA 4WHXA 4Q4DA 3KIFA 1D0EA 3QSIA 1OWXA 4IRCA 3LAMA 2YS7A 1ZPVA 2OPQB 4X65F 5CYJA 2ZD1A 4NCGA 2VQFJ 2LXIA 2IDLA 2NVXI 1HWJA 3MPVA 4HR7A 1RO2A 3LWLA 3BF4A 2UZAA 4PCQA 2GZOA 3SMZA 2E1MC 3LPYA 1I1MA 3MZIA 3DRRB 4ZDNA 4USHA 1D9DA 1ZA1B 2WSCC 2DNPA 1I50I 4CC6A 4LF6F 2YH1A 3MM6B 2V2QA 1NPPA 2FJAB 3VZIA 1TWHI 2ROPA 2X1AA 1ZH1A 4ECSA 1ZS6A 2YWEA 1FRLA 2IC3B 4V19J 3SFGA 2V50A 3MM8B 5B09A 4IOBA 3KOAA 4CP5A 4I0WA 3R5JB 1PBUA 1AZSB 1UW4A 2QREB 3Q2OA 4DCPB 3H5UA 2JA6I 4OJGA 4C8YA 1WCMI 1S99A 1BQNB 3J7YU 5A2QU 5C44I 2YBVA 1GEHA 3DOMB 2CPXA 2LKZA 2QX0A 4ZVPB 1YIJZ 4P52A 2F65A 2YWKA 4NYEA 1T8EA 3RAQA 4I6AA 3DLGA 3T5JA 1T95A 2N7YA 2CYYA 1SQFA 4CHIA 2HVSA 2VC1A 1VKZA 1J5EJ 3RZAA 3DTFA 2MKIA 1Q7LB 2KT3A 2DEJA 3CD7A 4WZMA 4K0KJ 2YU9I 3QYYA 3G8CA 4DU8A 3IG1B 3HO8A 2F8HA 1FJEB 5CM2M 4XYMB 3QBCA 2QFIA 2RNEA 1YI2Z 5I3UA 2Q4ZA 3HFZB 2BE9B 4NLWA 3MR6A 4K5SA 3MAQA 2DABA 4XTTA 5HL7Q 5D0EA 4CO0A 4NLUA 4HDHA 4YQWA 1NJI1 5HLFB 4DG1B 1L3SA 2V8KA 4RNHA 2MSSA 4I67A 3AFGA 5I5UA 3CCQZ 1NK5A 2PE8A 3TQEA 4C3LA 2BJ8A 1IJEB 3LP8A 1U26A 2VFSA 2CJAA 3AJ1A 5LXTF 1C1CA 2RH3A 4FS1A 1NLKL 2LA4A 2LYVA 4RW8B 1S0VA 2M0GB 3ENQA 4TNUA 2QA41 3S14I 3EWGA 5D0RA 3SQGB 3HSZA 1NJYA 1BHNA 2PM9A 1VQ81 3GLJA 5JVHQ 2E5GA 4EFAC 3ENAA 2R8HA 2WSEC 4JI2J 5KG2A 4JI8J 4CL1A 2RKIB 3GDEA 2GQSA 2HGXA 4AQYF 3DRXA 3I5CA 2I3CA 2R2RA 1N5YB 4JYAF 1EETB 1U09A 2DE7A 3CMAS 2JFDA 1QUVA 1FI4A 4KFBA 2HNDB 3F41A 3D6HB 5I42B 3FCHA 2EC2A 1OIAA 2FJEB 1H2VZ 4C3MA 2K06A 2QL9B 5IZHA 1XMQJ 2RQMA 4HI1A 2ABJA 2DTJA 3O2IA 3OFFA 5HP1A 2QO3A 1X4BA 1WG4A 2P5VA 3DRPA 1CSJA 3U02A 2Z30B 2GVDB 4C8LA 1VLOA 2R7ZI 3TUIC 5KFHA 3FRZA 4NOHA 3NL0A 1J5OA 1K9M2 5KFSA 2HEKA 5E41A 3OVSA 1DFDA 4GVLA 3IA0A 4WU2A 4ZCIA 2F4VF 3I96A 1N5QA 4JV2A 2UXBJ 3D9XA 3BSNA 1HNVB 3GCFA 1PIEA 3K57A 1LW0B 4CH1A 5HJYA 4B3OB 1A6LA 4NH1C 4B9UA 4B3SF 3A1YG 1Q861 1JLQB 4CO5A 3T1AA 3GJQB 4EYHB 2NQPA 2WK4A 3SBMA 3KNGA 4CKBA 1C0UA 2RT3A 4OQJA 2OP5A 1SKRA 4PZVA 3I55Z 1VS0A 1U6FA 2ILYA 2DK2A 1XK5A 2RIQA 3J7ZT 4FXDA 5E3PA 1XMOJ 2HNZB 2F1FA 2BKPA 3I551 2DIKA 3KMQA 1RAEB 4TU8A 2VKRA 1VR6A 3HKZA 4PPDA 2VBZA 3M2VB 2W25A 3R2DJ 4O4GA 5KG7A 4DL4A 4DQSA 4OV1A 2LEAA 2VODA 2WVCA 4OX9F 3QQMA 2VFTA 3LWBA 1LFWA 2XMTA 1Y8CA 2JC0A 1EKVA 4AE5A 4UQTA 2VZ9A 1CEZA 1T3OA 1CQNA 4ZHRB 1SC4B 4HTJA 1KVKA 3P5JB 1SI9A 3ZZYA 3NXZA 4RR5A 4C0OC 2A1BA 1T9VA 1L1OC 5DM7Q 3DN9A 4DI6A 4WP9A 2XWYA 1NSPA 1YRTA 2HVIA 4ZIWA 4NL5A 5D0HA 2XCLA 3FQQA 4DX5A 3ISNC 1XMBA 1Y11A 2DNKA 5L38A 3T9DA 1YJUA 1JJ2Y 2GIFA 1I3OB 5L1JA 2HZAA 7AT1B 3GIDA 1H2UX 4RNOA 5CB4F 1Q1KA 1KS2A 3NCRA 1Y00A 4K6NA 1R0CB 1KQSZ 2JS4A 2ZH3A 4OYPA 4UUXA 2OTL1 2RPRA 1NXIA 1IN0A 4DV2F 1KJIA 2FGCA 5DGAA 1YJNS 2UUCF 2XSJA 3KJVB 3GTPI 2V4JB 3NS6A 3M30A 2JHEA 2BDPA 1OY8A 2O53A 3CDBA 1HL6A 4LH6A 4YB6A 4KGMA 3QMQA 2ZJRQ 5CYMA 1GH8A 2UUAJ 2CQBA 3KJNB 1KDNA 1XWLA 2J9GA 1S76D 5EWFA 1KHWA 5LOQA 1YJW1 1KBRA 4YR2A 3HULA 2OUGA 3NGRA 3G6YA 3ETOA 1FE0A 3L09A 2GVZA 4EBCA 3HI9A 2GVZB 1E4EA 2HK3A 5CAAA 3OFGA 1W2BY 2RHSB 4EWCA 1FFSB 2QK4A 4WK3A 1K0VA 2OTLZ 5BPHA 2WYOA 1QLNA 3I32A 3ZZ0A 2FVPA 4EWTA 3OV7A 5HMYA 2ZDPA 2MHNA 3W1GA 2XNRA 2CPZA 4TU7A 5CA5A 1JJ4A 4EO8A 2V67A 3BYRA 2BJ1A 5CABA 3SSSA 5KFMA 1VQNS 3FQLA 5A6WA 4J7CA 2CPFA 4HI2A 4F04B 4OZ0A 1DAAA 2CQDA 3K7RA 1KJ9A 1RSCA 1UP1A 1X3ZA 2VPZB 2C00A 3S16I 1VIXA 1SJRA 3TZZA 4JV1A 2PD1A 2BEFA 4E30A 1TU0B 2DNHA 4L72B 1WKLA 4A4JA 4C9DA 1TMJA 1NH8A 1HARA 2N3LA 3DMJB 3D2LA 1BGXT 2FD2A 2MZ1A 3SFUA 4E2WA 1DAXA 4K8RA 2PFDA 3UZBA 3OW2Y 4NBGA 4O4IF 3EGVA 2XO7A 3NH4A 4K4XA 4N77A 1HW9A 2YX7A 3N6NA 3GG0A 1XJWB 4A3GI 3GTKI 1REGX 4ECQA 3E01B 4DV4F 4O3SA 3CJQA 3JRXA 2XULA 1BWVA 4F02A 3POTB 3FZBA 5FLMI 2B7CB 3T9NA 3PTWA 4DX6A 1HI8A 2DVIA 3ENVA 3RG6A 4ZHRA 1GSAA 3CJ8A 2YKMB 1WTBA 2GAHC 4G1QB 4F36A 2R7VA 3BKFA 1Y10A 3PIOQ 4BWMA 3HOWI 4ELUA 3R5DA 5F9NA 3M6VA 3J80b 3B4DA 2BE2A 2MZSA 1N56A 1P9NA 3SCJE 5H9FJ 3J7AN 2AEFA 3IAM9 5ETQA 1YQHA 2HIQA 1KD1T 4J9NA 4O3PA 4PRFA 3MI7X 2V45A 4P72A 3HHKA 3M8QB 4Y2KA 2XY6A 3JYTA 1SUQB 2ZHAA 3HOZI 1HBNA 1MWZA 2DWCA 1TK8A 3B78A 2RS2A 3U54A 2FY8A 2MXYA 2BOAA 4UOHA 1AZSA 2HG8A 1Q79A 3BYPA 1UW9A 3EUNA 4NYOA 4J5OA 3KUHA 2V8GA 2BKNA 2QRDB 3JRWA 3UO0A 3CC41 3RBDA 1NJXA 3G82B 2CQHA 1ZOTA 1E4EB 5FNVF 4WYWA 5LL6d 1DIKA 1WW9A 3DLGB 4YBZB 3KLGA 1S9GA 1VK3A 1WF0A 2RKIA 5A8RB 3J80Y 3UDEA 1QD1A 2AJ4A 4JXUA 3PR4A 2FJWA 5EX3A 3GFZA 2PN1A 2YWHA 1T03B 1A48A 4B9SA 4FFLA 1HWKA 1I1LA 3TANA 3W5OA 5HP1B 4KE5A 2KZZA 4DL5A 2BABA 1LNQA 1RUSA 2M3DA 2HQGA 4PG5A 1MMDA 2QV6A 1DTQB 2YNFA 1EQ0A 9RUBA 3IBFB 2Z8QA 2YNFB 3ZZRA 2B56A 2VC0A 2LXFA 4F67A 4KY3A 4DG1A 3IS9B 5C24A 4QWCA 2JR6A 4CDIA 5AE1A 1FTRA 1J5EF 3K5NA 2BRKA 1UFLA 5L39A 3NOGA 3C2PA 4QCLA 2B4VA 4OHVA 1ITPA 1JIHA 1FXRA 4A8FA 2FPPB 1NK4A 3H0PA 4CLLA 2DR9A 1YBUA 1U7LA 1YLXA 4U7CA 2QLJB 5A8KB 2GHVC 4M5GA 4FE2A 3K8VA 1S7IA 3M1VB 1VQ7S 2BJDA 2G2OA 1SC3B 3BQ1A 1UVLA 5JXSA 3GB8B 2CAJA 1YJRA 3I07A 1BNCA 3JZFA 3I0RA 1S12A 4O0NA 1LQLA 2YRXA 3MM7A 1VQLS 2VR1A 1D09B 2BKOA 4J9MA 2WVBA 3W5YA 2AYMA 1DJ0A 3Q24A 4MD8A 2IJFA 3CXCR 3CCVZ 1O51A 1S48A 4RW6A 1DLOB 1VCTA 4DSEA 1S1UB 4YHHF 1VQMS 3OTOF 3RV3A 3UR0A 3G6VA 4RW9B 2OSRA 2EFNA 3PYDA 3DLBA 4LBHA 1CS0A 4JI4F 1F0XA 4LH7A 8ATCB 2CFMA 3VHQA 2ODTX 4GLWA 2KO1A 2NCKL 5HQLA 2HU9A 2QG9B 1DL6A 4XDCA 2B63I 3H2VE 1RAGB 2Q1LA 2W7PA 4LVNP 2XNQA 3DOLB 2DGUA 3NNCA 3AD8C 3CME1 4IFYA 1HR0J 4FF3A 4DV0F 2R7QA 2RS8A 2HKEA 4V19X 3M32A 3PNIA 2M7SA 2ZH7A 2HHSA 2GQQA 1WHWA 2E7VA 1IYDA 5FDLB 4JI1J 5IT9b 3H98A 5AXKA 4Y2CA 5T67A 2XS5A 5EX0A 2PBZA 2QKDA 3HX9A 3W1BA 3TOQA 2KKHA 1I94J 5B0EA 1SVDA 3OJUA 4LFAF 3MR3A 1KFDA 4XPCA 1Q0NA 1TFIA 1MMLA 5HBMB 4DR4F 4ECWA 3GR1A 1A0IA 5ETKA 1DQ9A 2V6AA 3K3PA 3G8DA 1RHJB 1K1SA 3EVOA 1Y3KA 2G13A 1H74A 3DDKA 1UZHA 3MM5A 4KAIA 4L6V3 4WU3A 4O7WA 3NBZB 1SKUB 2F7VA 5GAHU 2MEWA 2RJZA 3OHBA 3TNVA 2O3DA 2VPXA 2VD3A 2BE7D 3RZDI 3IO1A 1N33F 1QAXA 1D9FA 4K4SA 1V3ZA 1S9FA 3CC7Z 1SL0A 4M0JA 4P6QA 6AT1B 4KGXB 2VG7B 3OUYA 1RO4A 2QMUB 5HSPA 5KFQA 1EUDB 4HKQA 3DXSX 4EGQA 3NKYA 2RD5C 3GJRB 1HYSA 3DRPB 2GW8A 4XX2A 3D67A 3QPIA 1VQPZ 4JI8F 2ASJA 3JQMA 3DLKA 2YNHA 1B0PA 4EI2A 1HHTP 2DEIA 3HFKA 2XD4A 2HS4A 1TK5A 3JSRA 2B9EA 2UVVA 4LREA 1RLYA 4LSNA 3W5XA 1OSCA 3LAKA 2B3TB 4TNOA 4ED3A 4CT8A 2KVIA 3KREA 1SJ1A 2CXEA 3OFEA 2HG4A 3WO1A 2P0AA 2WRMA 2AGPA 1F6TA 4C8KA 1HMVB 4MKVA 3V5RA 4HL9A 3NAIA 5IWAF 4O7RA 3CJRA 3QSYB 4RS4A 2J76E 2MLYA 1WHVA 4UCUA 3GJXB 5D8DA 1USPA 1JLBB 3KIHA 2F63A 3K89A 4ZCMA 3DLHA 3H8YA 2KN4A 1JLBA 2R9LA 2C3YA 2H48B 3GONA 5F8LA 3T9ZA 1VQ8Z 2OMOA 1KSPA 3LOUA 2G2YA 3FBBA 1P8LA 2E9TA 3BQ2A 3R27A 3M8SA 2MQLA 2VQEF 2LQ5A 3N9UC 4YY3J 3WZ0A 3CC71 4PWDB
chains in the Genus database with same CATH topology
5T41A 3OXFA 1Q16B 1S1WB 1S1UA 3DM2B 5DG8A 2XMKA 4ID5B 3OSPA 3UNGC 5HROA 5KFAA 3HVRA 1M902 4I1TA 4TY8B 4ZPBA 4A3CI 1FEHA 3ISND 4ZPTR 4DL6A 1M5VC 1JLCB 1LW2A 5B0DA 1HYSB 2DGSA 1VQ5Z 2OFGX 2NSBA 3NGDA 1C2PA 5L1KA 2Z2MA 3CXCZ 3OSNA 4TQSA 1RT7B 2WB1A 2ZVSA 5B0GA 5I3UB 3QGHA 4KO0A 3CMA1 2NVTI 4HT5A 4ZLPA 1PC4A 5MAOA 2C2DA 4Y65A 4DQIA 4AL5A 3KHLA 1Q81T 3VCDA 3FSYA 1XMOF 3GKQA 1B0VA 3P6YC 1VI7A 3PW0A 3M2RB 4WF9Q 3Q22A 2I5JA 2OTJS 4A3MI 5E3AA 3SYZA 4IG3B 3IR6B 1UVMA 2B0GA 2IJNA 2EKYA 4PUOB 4Q2MA 2RDIA 2WB4A 2W9CA 1D8YA 3GTMS 1UJ4A 2RRAA 1VBZA 3QIPB 4IFVA 3PX0A 3JAMf 3DLKB 2R7SA 3CPWR 2ZHOA 3THVA 1KHVA 4FNHA 2YTCA 1UAWA 3QIPA 1JJ2Z 1X4DA 5K8MA 5KFWA 3U50C 3GTJI 4GC6A 4HH4A 4E98A 1K0TA 4ES1A 1ZH5A 1JLAA 2M9KA 1FESA 4OIXA 2BV3A 5I4MA 1LK5A 3MWBA 4X4OA 3CDAA 1F9FA 2LDYA 1YI21 5GAHI 1TQLA 4B02A 3CC4S 3T1YF 2O5DA 1K8A2 4YR3A 4BS2A 1HNVA 2JLEA 2Q66A 3GE9A 4FNIA 3P96A 1WF1A 2GU2A 1HQEA 2CFXA 4RBTA 2AX1A 4HH0A 1F5CA 2LEBA 3JSLA 5J1NA 4X4RA 2X1FA 3D0IE 4WFZA 1TV6A 4M8LA 5BYRA 4DF8A 5KFCA 4R25A 3VNNA 3CDUA 2OD4A 4HH1A 1R0AA 3SV4A 4X4UA 2BM0A 1Y0HA 2PT0A 2RUGA 3BQ0A 4F2SA 3QO9B 1YJWS 2NZ4A 3AHPA 2C2EA 2DISA 1M5OC 1LXJA 5KFOA 3S2DI 1VRUA 5LMNF 2OLWA 4NXNF 4URGA 2FVCA 3VAJA 2G4BA 1U47A 4QW8A 3E8OA 1S49A 2M88A 3BAAA 3PJXA 3W2VA 3GILA 4OHXA 1VQOZ 2PC6A 2XWXA 1IBLF 3VZHA 3BGFA 2W9BA 1NK0A 3RTXA 5T64A 4ZPCA 2DR5A 1M5HA 3CCLZ 5HMWA 2L3MA 5LSOA 2PI5A 1Z2ZA 2ABYA 1FJ7A 3I4PA 2CKWA 2FHKA 3OTCA 3BB5A 2PMHA 5J2MB 4RUCA 4F4ZA 1FKAF 1VQ71 1VC0A 2ATLA 4RNNA 1SJ4P 1S0MA 5HO4A 3M2UA 4GKJF 4N56A 3BN4A 2KH9A 2DO4A 1LKZA 2JEJA 3MUTP 2W7OA 1FVIA 2A2CA 1NK8A 1S9EA 3G4SS 1YIJ1 2MZJA 1TKTB 5A0YA 4YDDB 1ZTWA 1WI8A 4DV5F