3QWUA

Putative atp-dependent dna ligase from aquifex aeolicus.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
366
structure length
366
Chain Sequence
ISPELVKEALKKKKVRSEEAFGLEYLRFNDDYKDIPRGTAIFKDFIIWGYPHIGRIFLLETGLREQFEAPFWVEEKVDGYNTRIFKYGDNYYALSRGGFICPFTTDRLPDLIDLRILDENPDLVICAEVAGPENPYIEESPPYVKEDVQLFVFDFMKKNEQGFLSQEEKMELIEKYNLPHVEILGRFTASEEGIKKIKEILKRFNEEGREGVVFKEDSERNKRAKYITSYANLMDIKTNAKNMLQLPPEYYTNRILRLVLFMYEEGLKTTEHLYEELGRAFIDGLFQAIEQFEKEHKVYKTFTCKFRKKENAIALLELLSKTSKHIQVKERRLEKEGDYWRLEFDKVFLNMTGLLGHLLSGGIVYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Putative ATP-dependent DNA ligase from Aquifex aeolicus.
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords DNA ligase
total genus 116
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18330 Lig_C Ligase Pab1020 C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.320 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3qwuA01
3.30.70.2160 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qwuA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3qwuA02
4UCTA 3RTXA 3GB8B 3TY9A 4CC6A 4DRFA 3UQ8A 3L2PA 1P16A 4GLXA 5DISC 3PN1A 4PZ7A 4UFZA 4CC5A 2Q2UA 1DGSA 1P8LA 4LH6A 3S24A 2Q2TA 1B04A 1V9PA 3BA9A 4PZ6A 3RR5A 2VUGA 1TAEA 1VS0A 1XDNA 5D1OA 2HVQA 3BABA 4LH7A 5FPOA 1CKNB 1CKNA 1S68A 1XK5A 2CFMA 2HIXA 3NBYB 3W5OA 4PZ8A 3KYHC 2HVSA 5FPRA 1CKOA 4UCSA 3TY5A 3GDEA 2HIVA 3NBZB 1CKMA 1FVIA 3W1BA 4EFEA 4EEQA 4EQ5A 3TY8A 3VNNA 1A0IA 4UCOA 1TA8A 2HVRA 3BAAA 3JSLA 3GJXB 4UCRA 4EFBA 4E6NA 3W1GA 3BA8A 2OWOA 3JSNA 4UCVA 4UCUA 1X9NA 5D1PA 3NC0B 3QWUA 5D1OB
chains in the Genus database with same CATH superfamily
1IJFB 3FDSA 4ZVSB 2HRUA 3HF5A 4QIWD 2GO9A 1X0PA 5IV3A 4LT6A 1F6TA 1ZAXA 2GPSA 2Y4RA 4JI1J 3PKMA 2MGZA 1BXNA 1CULB 2BQRA 3OVAA 3D67A 4A93I 4RW8B 3MM8B 2AJQA 1GXTA 4RUCA 3ILJA 1OYEA 4WFAQ 1Q79A 2G1HA 2G1DA 2JEJA 5KT5A 5ETSA 2V4RA 1VQ71 1DY3A 1JWWA 3H40A 1CJKA 3GONA 5KG6A 3VAMA 1TFIA 3R9RA 4NOZA 1HBOB 1X4EA 1MN9A 4K0KF 3OW2R 1CQMA 3GU0A 3UWTA 1RWOB 3Q8VA 4OYMA 5K8MA 1RT5A 3CO0P 4Y2IA 2Q43A 1T7PA 4FBUA 1T9WA 2IVMA 3U9TA 3NFZA 4RL1A 3RR7A 3UD4P 3GTQI 4IRCA 3L7UA 2RVJA 3IP0A 5B0GA 1HWLA 1U02A 1YJ9S 2P5VA 3CCM1 2RDIA 3RAMA 5KFOA 2R7SA 4O7YA 1Y1WI 4FFOA 1Q7Y1 4DPXA 5BJRA 4CLYA 4ZIVA 4DCJB 3K7AI 4CLKA 2P3YA 3X1LB 1FXDA 1CQNA 3JSMA 3Q24A 1SCUB 2UVWA 1N0VC 1YTYA 2LIYA 1VKZA 4DR5J 3DM2B 1UAWA 1DARA 1NKBA 3MR3A 5IWAF 3CCQZ 2HFSA 4M1KA 3JTOA 4NLPA 2VQFJ 2O66A 4O86A 2Z30B 1TELA 4IG0B 4LFAF 4ZJOA 2IV2X 3LWBA 4EBDA 5IS2A 3QBCA 3VAGA 2RQKA 1DTQB 2COIA 1SJFA 3EEDA 1PYTA 2FVQA 2UUCF 4H4OB 3VAIA 3K5PA 2HF1A 3CCWA 3PNIA 1S57A 4IFVA 2DNYA 3RB0A 1YUAA 1NJI1 4MAMA 3DOKA 1H2VZ 3GKQA 2G9OA 5DMXA 5ETKA 1VQ41 2BACA 4ZDNA 3WZ0A 4MFBA 3PW2A 3Q2TC 1RO2A 1KD12 3K5LA 1JB0C 3BSAA 1IBMJ 2ADCA 3VHQA 4MXUA 1BQMA 4ZPAA 3O1LA 3Q89A 2ASDA 1VQP1 2Y9HA 2QEX1 1UFKA 2GQ2A 3ORRA 2DRBA 2CZGA 2M6NA 1KSPA 1RU2A 3KAKA 1VQMZ 1R27B 3FQLA 2YNGA 3DKDA 3N79A 1RCXB 1GSHA 1S1TB 4B3RJ 4YAJB 3PX6A 3NS7B 3RUBL 2YWKA 3OL6A 2KYZA 4O81A 2E1PA 3DRPA 3C6UB 2W8KA 1G2EA 4MYTA 2C28A 1JLBB 3GSIA 1HFEL 4AQYF 3DRRB 1TKDA 1K73T 5J2NA 4QZVB 1ZETA 1CEZA 3HXMA 1N54B 4LVOP 4UUXA 2RIJA 4XDCA 2QYGA 3NMAA 3MCNA 4BY1I 2HFZA 3PEHA 4NBHA 3D28A 3Q2OA 3DGVA 3O6QA 4O4GB 4DV5F 1RYSA 2ZBRA 3NLCA 2RF2B 3H5XA 3DLBA 5IZHA 3QT5A 3CD61 2IBOA 3BO2A 3EJMA 4DOZA 1RWWB 4N7TA 3MEKA 3IFUA 4KC5A 1D09B 4J9QA 1K8A1 3C14B 2NSCA 4DV0F 2NAPA 3CDAA 1YIJ1 4KHRA 2B43A 4E2XA 3R27A 1K8AT 5FDLB 3ULHA 3CCUZ 2MPUA 3BM7A 2JIOA 4DFKA 3A13A 3C8YA 2MEWA 1RT1A 2CJQA 3JYTB 2FD2A 1P6TA 3UDVA 2BOPA 4OI6A 1AA1B 3MMCA 1HBMA 2E1AA 3CDBA 2FHMA 1WOSA 1Y9OA 3DHXA 2O5DA 1DLOB 3G6XA 2JDJA 2PMWA 2H4WB 4ES2A 2W2QP 3ZZRA 4LRBA 3A8EA 5BWXA 2MKJA 2OPRB 1VK8A 1WNEA 4USIA 1KOHA 4JV1A 3HZGA 1W96A 2IM0A 4TN2A 3AJDA 1Y7PA 4WE1B 3OFEA 3B54A 4K4WA 2HNYB 2J9CA 2P9EA 3MD3A 5GAHU 5FLXb 2OLSA 1HI8A 1B6RA 4DL2A 2AU0A 1T03B 3UYYA 3GJRB 4NEZA 3ZZYA 4FU0A 4MFBB 1WACA 3T5KA 2UUTA 3T9EA 1FNXH 2BJ3A 4K2XA 5F9NA 3GJQB 1EX8A 3RV4A 1ZYQA 1RT7B 2OAUA 3TA1A 3BDEA 1XTZA 3UR0A 4LFBJ 3MI7X 3EWGA 3DF7A 1X9WA 2DR9A 4MV1A 3W9JA 1JNZB 2J9DE 2KZMA 1WR2A 2MQQA 2ZJQQ 2YVSA 4MH8A 2LXUA 4O4LF 2H85A 3G86A 3BA9A 4P73A 4GLXA 2L3MA 4LSZB 2UXDJ 2IVYA 1OY9A 2Q6CA 1JDBB 3D68A 1PFTA 1TWAI 4EMDA 1AYEA 5ETLA 2IZ3A 2G2YA 3CCJ1 5EWGA 2X3GA 3I9V9 2ZD1B 5A8RB 3NMRA 1JLBA 3KK3B 4K6NA 4JI2F 2XWXA 4MIBA 3PDNA 2F4VJ 5T7LA 3H20A 3BACA 2OD6A 3UCZP 2WAQA 1V5VA 4U7UK 3T1YJ 2XD4A 2E5GA 2JNYA 4OYZA 3CXCZ 2BE9B 4O4GA 3LANA 4OIXA 4P2MA 4OZLA 2CZVC 3MTKA 3GSDA 4EYHB 1PBUA 2HG4A 3G4SS 4GVBB 2F8HA 1PO6A 4A8MP 5F8MA 3B4DA 2YX4A 3D3CJ 3UQ8A 4ZLLA 4YDDB 4ECZA 1GSAA 1N34J 1KVKA 4S1TA 3KIFA 3KHLA 1HW9A 4QWCA 3SQGB 3HD1A 5FPRA 2HFUA 2AYGA 3KLEB 4DQNA 5HANA 9RUBA 4TVIA 1WHYA 1DTTB 2QLJB 4L1KA 2GC8A 4CHIA 3I56Z 3MMCB 3SXLA 1UVNA 2DIKA 2EC2A 4C0HA 3NGSA 4X6AI 3RZOI 4B3MJ 3G711 1YJNS 2CNLB 3E2EA 3LP8A 2JSXA 2HHTA 1L3KA 1YJTA 4QTUA 4C9DA 5D1OB 2YWEA 4MV6A 3TJ9A 1HWIA 2BE7D 1H0HB 1HYSA 2G4BA 3W9HA 3CMQA 5HQLA 2F65A 3A3PB 3CCJS 4KKOB 4WE1A 5LMNF 1FF2A 5GVQA 4ED7A 5IXUA 2PMZA 4XYMB 3QYYA 4CTAB 3VWSA 2QA4S 4EO6A 4ZPBA 2NXJA 4OZJA 1KEEA 4Z7YA 4BHQA 5B08A 1DV1A 1QAXA 1MMNA 3QAEA 4A3JI 1JDEA 1XR7A 8ATCB 3MWBA 2D9PA 3HO1A 1Q8KA 3S1QI 1SXLA 3LF0A 2KG0A 1REGX 1RT6B 3BN4A 3GIDA 4FXWA 4OJHA 3R8YA 3UDEA 3ETMA 4PXBA 5IM0A 2E2JI 1V3ZA 4LQ9A 5IWAJ 2DGTA 2CPDA 2GIQA 4HNTA 5HQMA 4DPUA 1JJ2R 4O7LA 4NX9A 2ZH1A 2Q1LA 2MZRA 1R8AA 3T1YF 3K17A 2JJ4D 2J0QD 3CDWA 2DE6A 5A0YA 1HQ2A 2DNNA 4OI4A 4Z37A 1FDBA 2B6AA 2AYMA 2MSSA 2RE1A 3PJXA 3H5YA 3TNVA 1YJWS 1F5CA 1KVIA 4IZOA 4A3GI 4MJKA 1XNRJ 1YK9A 2XS2A 6FDRA 5A8RA 3S6EA 4OYAA 4DPTA 5D77A 4NA3A 3EERA 5KFYA 3FEZA 1S6UA 3M8YA 5AE3A 3NGDA 2BBEA 2OI2A 3SZ2A 1IKVA 1S59A 3TVKA 3RBZA 2BZ2A 1F5BA 4DUZJ 2FP4B 2HURA 4E0DA 4Q5VA 4XK8C 3MCSA 4R8UB 4YOEA 4FP9A 1FRXA 3UZBA 3TZXA 1ZM4A 4TV9F 5CH7B 4ZJLA 3CULA 2FHKA 4YUDA 3W5OA 4KFBB 4K4SA 2X7IA 3AD9C 2ACYA 1IVZA 3MGJA 2ILZA 3KJQB 4JYAJ 3OJSA 4JI8F 3RTVA 4B08A 3QJJA 2V2VA 4USTA 4X65J 2DD8S 3FNNA 4CO2A 1SH3A 2CQPA 4HACA 4M5DA 5I5UA 1EQMA 3K7RA 3SCIE 4CH0S 2EKNA 1RAGB 4BDPA 2A10A 2PFDA 2BX6A 2NVYI 4KH0B 3NBPB 2Y1LB 5L1KA 4FF1A 4ZLPA 3L9ZA 2NUUG 2VFRA 3R2CJ 3IWLA 2R82A 2Q7DA 5C3EI 4DV2F 5HLFA 1T9VA 1JXVA 1RO0A 2D41A 3VGTA 7AT1B 4JI6J 4KKOA 3IAS9 3OLBA 1RT2B 5D0RA 4KSEB 2OWOA 5D8DA 4V19X 2D74B 3OTDA 1BHNA 5CZXA 2A18A 3CJRA 4M5KA 5M2RA 3BBFA 2FJBB 3HCXA 2YNIB 2DY9A 4L76A 1RA7A 1RTJA 2J0SD 1S1XA 2FQQB 2DPJA 4DL0C 2JC0A 1TL3B 3PCOB 3QWUA 1PYSB 4F25A 1NDKA 5IM0B 3KLGB 2R4FA 3N28A 2FDNA 3EGVA 2IY5B 1QY7A 2LEAA 4DFMA 1UC9A 4KT0C 2M0GB 4RBUA 1IKXA 3FUYA 1M5SA 4OI0A 4ED3A 4YB6A 1FD2A 4C8MA 2KXHA 3J81f 3UE2A 1SV5B 5BXIA 2W24A 2DRDA 3D6TB 4GKKJ 2HGXA 3JB9k 3V2UC 3DRXA 1ZH5A 1CQIB 2E7XA 1TWHI 2FGOA 4PQUA 1UVJA 1HNVA 1WUUA 3CCES 2M7SA 4C11B 4NZ7A 2MTLA 1KFSA 3J7A1 2NU8B 2YZMA 4OYPA 3SFUA 1Y10A 4JOUA 4ZP7A 3CCJZ 2MZQA 1S1UB 2B9XA 2I5JA 1SIWA 2VPYB 1TAUA 3PW5A 2I1RA 4O7WA 3S2HI 1IXKA 2IDLA 1S0NA 1IOVA 3WX4A 2HNZA 5D78A 5ETOA 1YJRA 2VHGA 2COJA 2ZH9A 2CDRB 3UQSA 4O7RA 3PJ9A 4AXJA 3DU6A 3HHDA 4IR9A 1X0TA 4DK1A 3NS6A 1B3TA 2ZVIA 1V6HA 2LCWA 4M5IA 4YQWA 2B56A 5D3GB 3W9IA 1S9GB 2ADBA 1Q1KA 3B4MA 2HK3A 2ZC4A 4ID8A 4WU2A 2JEGA 2QEXZ 3MOJB 3J80f 1LWEA 2IYIA 2H3EB 4CCHA 5KX5F 3T9FA 1HWJA 2ACMA 5C24A 3I4NI 3QLHA 4DR7J 2J76E 2KPIA 4PPZA 4MAKA 2AJ0A 5T6BA 5L38A 4P74A 3HMJG 1NSKL 1SKUB 4RW4B 1HWKA 1T94A 2EI5A 3LP1A 1GX6A 3HKZD 5JMNA 2MLYA 2ZH8A 1U49A 1IQTA 3EDQB 2HU9A 1WOOA 4PABA 5LXYA 2VBZA 2KM8B 4ENOA 1X9MA 3KLGA 2FPIB 1FDDA 1JLCB 1VR6A 5B0DA 4N47A 5G0RB 3CCR1 2MYFA 3QGPA 3KHRA 3QAUA 4X64J 4ED0A 2YPZA 1T3NA 2HGNA 1PAUB 2E5LJ 2BANB 4CKCA 5CA5A 3L95X 3VZHA 4OZ2A 4OZ5A 3T54A 2XTJP 4CLTA 1XDNA 4LF6F 1XK5A 3GYNA 3PY8A 2DE7A 3ESWA 1GGOA 4DWIA 4XTTA 2CNOB 4C0BA 5B0BA 4PQUB 3S2DI 2QGFB 4DBQA 4QW8A 2ZDHA 3KNGA 2AGPA 4CZCA 2R8KA 4C11A 3MR5A 4FGRA 2BJ7A 3SDEB 3W60A 1N5QA 2EJ0A 3LUSA 4BBRI 2PO4A 3JAMU 3J7AN 1SH2A 1OSDA 3J7YI 3DLEB 1U1PA 4RVGA 1VIOA 5DG9A 4C6AA 1QTNB 1BWEA 4DL6A 3ZTOA 3KJVB 4K50A 1CG2A 3GWCA 2R2TA 4TY8B 2AZ1A 4DEZA 3SCKE 2V0NA 2ZH5A 2GQRA 3UD5A 1GT8A 3M2VA 4NZOA 2HNZB 3SNOA 4NCAA 5DGIA 3OL9A 3DXBA 3MEDB 3M7VA 3GR0A 2SXLA 3SSRA 4FFPA 4AQYJ 2G2KA 1S76D 2MQNA 5K8OA 5F8NA 1U0HB 2ALYB 4ZA1A 4P9SA 5LYJF 4I6AA 2AP6A 2CQ3A 3DFEA 1PJ6A 1IR1A 2AYDA 4EYIB 5DGBA 1Z2NX 2BRKA 4DR1F 1WC0A 2B0GA 4F0MA 3TI0A 1VQKZ 4AFFA 2HEKA 3QO9A 3PEJA 5BYQA 1NKCA 3GV8B 5K9FA 1WG1A 2YKOA 2ASLA 1T95A 1NSPA 3M8RA 2CJKA 2DABA 2UUBJ 1R43A 2B9WA 2V8KA 3DLGB 3GYGA 1DHMA 4LFCJ 1KDNA 4J9PA 3R5AA 4P10A 3DMJB 2HBYB 1S6PA 3OTOJ 3MAAA 2LYVA 2B5JB 5KFBA 3UI3A 4IFYA 4XAKA 1ICEB 1B04A 4YBZB 3GV7B 2UZAA 1RWMB 3S8SA 3GTJI 3ISZA 4EFEA 3UDLA 1A0IA 2RKIA 4HLBA 2CNQA 2RB7A 1SJ1A 3K5HA 3ITHB 2RIQA 4MK7A 2XS7A 2BQUA 2EJ2A 2GQQA 3E01B 3PM9A 1D9DA 1Q862 3I4HX 2R42A 1PKUA 5KT4A 1RJJA 1FRJA 5IOLA 5F8IA 3IA0A 2EPIA 1UC8A 4A8SA 1KP6A 3BO3A 2E7WA 2QZ8A 3VALA 5F8GA 4U95A 2X1FA 2FPHX 5GMKa 2DO0A 3LP2A 4A3II 4O3PA 3J81U 1HIYA 1R31A 1Z1ZA 2DK2A 4DV6F 4JV0A 4NB8A 5FD1A 4D3HA 4HQ6A 5HI7A 1SVDA 3M2UA 3QWPA 4J91A 1AUSL 2YYAA 3MPUB 2ODTX 3Q87A 1YHQS 2QFJA 3MMAB 4LSLA 1KOOA 2ZZTA 3PX0A 3DGPB 4Y6IA 2R6MA 3EGWB 4TXSA 4YJ3F 2VH7A 3R5DA 5BMVF 1QSSA 1AFIA 3CCSZ 4Y34A 3RW7A 3JSYA 4P2SA 3GTGI 2C3MA 2UXBF 4ZVQB 1E6VB 3HBLA 1KNZA 1V3RA 2WBMA 2QA4Z 3GG0A 2CA9A 1R0AB 2KT5A 3C15B 1S72Z 2HG8A 1CKMA 2XMWA 4MYUA 2C3YA 1VQNS 5LL6f 4OLOA 2PC6A 3I96A 4OZNA 4L73A 4IYQA 3M9OB 3R5XA 1HD0A 2QO3A 5H1SV 3MTJA 2AEJA 1PILA 4HEA9 1KWMA 1EUDB 3T5LA 3BGLA 4BBYA 4HHJA 4KYZA 1UWBB 2PFFB 3ENAA 4K8RA 4J9UE 5JUMA 2ZHOA 3ZNJ1 2B8QA 1KJQA 1P1TA 5LMUJ 3GLKA 1YJNZ 1XMOJ 1AROP 2GS8A 2HGLA 2WSEC 2GLTA 1IN0A 4A3BI 5BPFA 4IHJF 4Q4DA 1S0OA 1CE8A 1PIEA 2CNUA 4U8VA 4CI0B 2CJBA 3TQ1A 1UTAA 2ZITA 2C2RA 1T0TV 2FLOA 3BBBA 3FMWA 2HBRB 1VIXA 3OSPA 4YDXA 1KQSZ 1IR2A 3G6YA 2B7BB 1QUVA 2HVIA 4O83A 1KQKA 3S24A 5LJ3Y 4TLRA 1CS4A 4LF5F 3AA8A 2GMHA 4PUOB 4QIFA 2GHPA 4C0OC 4LREA 3DMJA 1FKAF 1PSDA 1Z4UA 5AXKA 2DXFA 2HAFA 3S15I 3KG0A 4DR3J 2B5JA 2GNKA 3QIPA 3U1LA 1SQGA 1DAXA 3FK4A 2MHNA 3P5TL 2R7WA 3IM8A 3RZDI 2HVSA 1YIJS 4JI3F 5EDWA 2OO4A 2VODA 3I9ZA 4Y0FA 1VQN1 1UETA 2FJWA 3MR7A 4F4AA 4N56A 2MQ8A 3D6HB 2EFOA 2OTLS 1NJXA 2F8MA 3R7BB 2B4UA 1I5OB 1LNQA 2E7VA 1TU0B 4LF9J 3V4SA 2CG4A 5D1PA 4HR7A 3NOGA 3G71Z 2J9DA 2HRYA 2ZM6J 2YRXA 1FK9B 2DLNA 5CHCB 3NBYB 4OJ3A 3I5CA 1JKJB 2FY8A 3IR7A 3LUYA 3M1VA 2FJVA 3KHGA 4PXDA 2OEJA 4YR0A 4LUBA 1ZB9A 2QFIA 1TVRA 3ETJA 1YLXA 1VMBA 3RFCA 4B9LA 3J7Z5 1ZM9A 1XERA 2UU9J 5I5WA 3OR1A 1ROFA 5CM2M 1NEEA 4ILRA 3E5NA 4S0MA 1W2BR 4LRFA 2C42A 1E6VA 2VFSA 5F3ZA 3RB3A 2DNHA 1M5KC 2EFQA 4XO0A 4DU7A 2Q66A 3HHEA 3QZ8A 1SKSA 1OIAA 4ZMMA 3W62A 1SBRA 3N0VA 4HH4A 4OJGA 2LXIA 3SEOA 3MZIA 4Y52I 1MW7A 3IRXA 4HDGA 5D4PA 2GTIA 3VQTA 1GNKA 4NOHA 1NSAA 4DLEA 5I5TA 1R0BG 1NJIT 3DRYA 3FRYA 5GMDA 3PTWA 1URNA 4ELUA 2FB0A 2HBQB 1NDPA 2VA2A 4ERDA 3KNAA 2IFXA 5JXSA 3M6UA 2OTL1 4FYDA 3DM2A 3H3VJ 5KG7A 4I2PB 3DCAA 4EZ6A 2ZDQA 3CEBA 1T8EA 4KY3A 1BE4A 4ZPTR 1BNCA 2BJ9A 3PHEA 2VU5A 2XGPA 4XZ3B 1K9MT 2CJAA 1GMWA 4KHMA 1RTZA 1BQXA 1RI7A 1X3ZA 1IR0A 2BUNA 2DNKA 2KH9A 1VQSA 1HHSA 4JXUA 3PN1A 3QFWA 2YZNA 2MQLA 3UZOA 3GQCA 1RAFB 2KU7A 2EIYA 4X65F 4W98A 2YX7A 1NUIA 3LQVA 4QYZJ 4CM2A 3BGRB 3DOKB 4C3MA 4DGLA 3F73A 1EKVA 3CCMS 2EFPA 3WO1A 2C2ZB 2OP5A 1V9PA 4KGMA 2I0XA 4K4XA 4TKTA 2DGOA 2YKNA 1VC6A 3R5CA 1JK9B 2IZ4A 5JQGF 4CH7A 2G0JA 7FD1A 2AMCB 3JSBA 4I67A 2CNKB 2HS4A 1ML8A 3Q1KA 4UZCA 4NBAA 5DGHA 3MURP 2GJFA 1M1HA 1UW4A 3I87A 2C1EB 2RUSA 5E3QA 3L7OA 2V8DA 1PK8A 4FZVA 4WJBA 5J2QA 3FJ2A 2RSQA 4NXMF 2V3VA 1RWXB 4JV5J 1C30A 5CA1F 3VZIA 3LP0B 3CC21 2D1CA 1RADB 3BH7B 1S1TA 2EJ3A 3IR7B 4QR2A 3M1VB 1RA6A 2A3JA 1ULRA 1NJZA 4ME6A 3CO9A 3CMES 4HYKA 3MPWA 3VQSA 2K3IA 3T9ZA 2ZNYA 2D3O1 2O53A 2QA41 5I5YA 5D15A 1EETB 1UPMB 1VQKS 3JSLA 2F3JA 3I0RB 3OR1B 4ZVFA 3SYZA 1NK4A 3OTBA 1YVFA 4WIQA 4C3KA 4PZVA 1KN6A 3MF5A 2CQBA 2GAGC 2VBYA 4K5SA 2F1FA 2ZH4A 4HVZA 2XSFA 2BJDA 3C14A 3B82A 1X4HA 2G0IA 1XN9A 2HS0A 4FFRA 2MKIA 4PAAA 4IG3A 4B9MA 4I4TF 2LMIA 5CCMA 1SJ4P 3W2VB 1MMDA 3ONQA 2R7NA 2PI4A 1G1XA 1FHTA 1KLMA 1FJ7A 3CCQ1 1GFWB 4P71A 3GE9A 4FS2A 1S1VA 4DMZA 5DS7A 4DL7A 4B02A 4USJC 1M5PC 4DSKA 1TQLA 3O2IA 1HR0F 1OPIA 5J1EB 4KPYA 3CC2S 4ID5B 1I94J 1YRXA 2BDPA 1HPZB 3N8DA 2IRXA 2OPRA 3VMGA 4PQAA 2LEXA 4YHHJ 3ZZUA 2RHBA 2WVCA 3LWMA 4DF8A 1XNRF 5A8WA 5AJ3J 4LR8A 4B9SA 1RTDB 3ISND 3MM5B 2DVIA 3M9MB 2MKCA 4M9UA 1FERA 3T9AA 2PSZA 2X1AA 4CO4A 2VJUA 3QRQA 1JJ2Z 3MM7A 3R5HA 1L3TA 1KONA 2J9GA 2RNEA 4OX9F 3L2PA 3U9SA 3T1AA 2OLWA 2AV5A 1EIYB 1O51A 3G6ES 4DL3A 4JI4J 3DNCA 1RT7A 2A2CA 4R0EA 3ENVA 3KFWX 2KRBA 2AHOB 1VQ8Z 1HA1A 2HHFB 5EZYF 1A48A 1HARA 5AE2A 1M1K2 2MKYA 3PRDA 2E5IA 5LMNJ 4KRWA 3PO4A 3OHAA 1WTFA 2CFXA 1O0PA 2DEIA 5I5XA 3Q8UA 3CCQS 4B3OA 4AD6A 1AUXA 2P2CB 4GRSA 1VQ91 2E2HI 3KHHA 3OJUA 3FCWA 3R7NB 3EZOA 2R86A 3K57A 3J7ZT 3UO0A 3N6RA 2CFMA 1ULZA 1XMQF 4CKBA 4Z7CA 5CYJA 3J81j 2DGXA 3HSZA 4TLQA 3GJXB 3KAJA 3P3DA 2QA2A 3R97A 2XMAA 2OMLA 3HP6A 3EPIA 2HVEA 4ANEA 3FSXA 3IXQA 3MONA 2AGOA 2F9DA 1QTMA 4QW9A 3S17I 1D9AA 4X4OA 4NLOA 4LF9F 1XEZA 3EGNA 4E98A 2L08A 4NLDA 2LDIA 4XX0B 5C4XI 4O23A 2GHWA 2PM9A 3HFVA 4OL8A 5D8HB 3CJKB 3BZQA 4E2ZA 2MMYA 5AJ3F 2NU9B 2YNHB 3MEEB 1I6JA 1UFLA 1YKWA 3SQOP 1ZZFA 3QT7A 4M5MA 1XC9A 2AWZA 2LEPA 3WIVA 1FDAA 4O7ZA 3CC4S 2J8AA 3M6WA 3DLKB 3KUGA 2MKSA 1Z01A 3US5A 4UFZA 2KRRA 3S1NI 5SZTA 1HNXF 1A0OB 5JVDF 1WEZA 2KG1A 3AXKA 4B9TA 2HZVA 2FPPB 4JB8B 2JS4A 3BG5A 4IG0A 2GVDB 2BJ1A 1B70B 2VPZA 2FB9A 1LWCB 1Q7YT 3F44A 3AXMA 2NPIA 5CCLA 5BWUA 2D3UA 4IQMA 4JI5F 4KHPJ 2RMLA 1LQLA 1IYDA 3O3LA 1HBUA 3CCLZ 1W7WA 3RW6A 1T9YA 4QYZK 2FZGB 2OPQB 3Q2SC 1LWFB 3T9DA 5DG8A 1AXQA 4RNHA 4PWDA 4A8OA 1CKNB 2WOMB 2V34A 3CJ4A 2HHHF 2BV3A 3KUEA 4E30A 3UNYA 2CNVA 3S16I 3DXSX 2MB0B 2YWVA 4KQZA 3D0IE 1Y5NB 3HHNB 3RBXA 4L6V3 3FEYB 3FBCA 3NH8A 4LFBF 3VTIA 4FF4A 3U55A 1YDLA 4O3SA 1VK3A 4NRTA 5GAEI 4WIIA 2LA6A 3EZ5A 3TY9A 1S7HA 3TIGA 3NDIA 5A0YB 1FCAA 3U02A 2E5JA 3HVRA 3R6LB 3MUVP 3R5BA 2JZ5A 5DO2A 2QE5A 2KHCA 2HNDA 4KV8B 3IGVA 1T9TA 2AX0A 2DTJA 2DR6A 3KLIB 4ELVA 5FLXf 4IOAQ 3Q8YA 1VBKA 1HQEA 2A0FB 1NUEA 1VBYA 3IRWP 1TV6B 2UP1A 2UUAF 4FFNA 2ZHAA 4U8YA 1TMMA 2B4OA 4AL7A 2N7YA 1KD11 2YZLA 2QT7A 5THWA 4YAKB 1G3OA 1UZDA 5BYRA 2HS3A 3KLHB 1DQ8A 2PA3A 2HHQA 3QJLA 2VQDA 2MQMA 1VJWA 2PT0A 3DC2A 2KKHA 4OHZA 5KS8A 3FEXB 2P9CA 3M8QA 2CJYB 3CJKA 2XULA 5CAAA 4RNNA 3CIZA 2MKKA 5CM0A 2GPWA 2ZFHA 2WONA 5EWFA 1X3WA 4KBIA 4JI1F 1GAOA 1U6BA 3T6BA 3EVOA 1NK0A 3HVTB 1YIJZ 3DLKA 1RLDA 4EU0A 1TKXA 3W61A 1NKEA 3FQMA 5BPHA 2Y0BB 3TO8A 1M0TA 3NBPA 3HOZI 3QZ7A 4RU9A 3NWGA 1OMSA 1GMUA 2AEMA 5KFWA 4DX7A 4X4QA 1I1GA 2A6MA 4O84A 6FD1A 1XNQJ 5H80A 2DKOB 1H3DA 4TY9A 3NS5A 2YWGA 1V3SA 1D3WA 4DHVA 2UVUA 3AJ1A 3BEGB 2MXYA 5EUHA 4MV4A 2WRMA 3PFOA 1KQGB 3D1HA 3M6VA 3PW7A 2HNYA 4O82A 2HQGA 3PACA 1S7MA 2D3OR 4DZDA 2KI7B 1TUWA 2F9JA 4DXLA 4FKYA 1UWAA 5A8KB 3ELHA 3D5MA 1S7IA 2YNIA 1CKNA 2UVVA 2WYOA 4YEAA 4JI2J 5I4MA 5CB4F 3CCRZ 3GR1A 4RUHA 3PZPA 2L41A 4ED8A 3W1GA 2WBRA 4DL4A 1K9M2 4Q0BA 1HMVA 4U96A 4GO7X 3TAMB 2PD1A 4NMXA 4M5LA 2GCFA 3V81A 4L3NA 4LRCA 1RU1A 1HHQA 2QA1A 1N0UA 1UJ4A 2RDDA 4JI7J 1VQPS 2OOYB 1HNZF 4KO0A 4ZP8A 3HVAA 2W03A 3EZUA 4R5PA 1SV5A 4OHYA 3EMTA 1H2UX 1KTQA 1TL4A 2JFKA 3C19A 5AT1B 2OD4A 1SPBP 5KOWA 1IKWA 4CLPA 2B63I 1RTIB 1WG4A 1P27B 4EFBA 5KT2A 3KLIA 3LWLA 2C2MB 1NZ8A 5SUHA 4DCOB 2V9KA 4G1QA 2B9YA 3W65A 2DNGA 2OIHA 1FKOB 3BQ0A 2N4CA 2FY1A 1TV6A 3TRGA 1FXLA 2V8IA 4DQIA 4DSJA 3TUIC 3EE3A 1M1GA 3MEGA 1RBOB 4F36A 2VPYA 1F2GA 4RKUC 1D0EA 3KLHA 1C3OA 4JI0F 3PX4A 5B0FA 4IUFA 1S4FA 4DSIA 1M901 2ZKTA 1U8SA 3R9LA 2VDHA 4OMFG 3O44A 2V2ZA 4K4YA 3RV3A 5IT9f 2XI3A 3RR5A 1WDTA 2JVOA 5LSOA 1HLWA 4ZN3A 4UCUA 4O3NA 4Q7AA 4USHA 1PYOB 4M94A 1S9GA 3DOMA 2JNJA 4ED4A 1IBCB 3D6FB 4DPWA 3TEGA 1U48A 1X4CA 1WD6A 4DZ6A 3NH4A 4HGZA 4CL1A 4DR2F 3LAKA 1UA1A 4F3QA 3R6GB 5IFMA 2W71A 3DRSA 2OUGA 2E7ZA 1YX2A 4NCGA 3GCWP 4FS1A 4ECUA 2Z58B 3I0SB 1Q0NA 4X4SA 5C24B 4CT8A 1HYSB 4F2RA 4QJVA 2J6UA 2DH7A 2E5HA 1XMBA 2FLNA 5DETA 4ECTA 4E2WA 1LEOA 3TZZA 1WJ2A 4MKVA 3U50C 2PA8D 5JVLA 3M4XA 3I31A 3F41A 4ED1A 4WBFA 1Z2OX 2CZ4A 2V8GA 1UZHA 1E6YA 5FLXY 4PG6A 3QQCD 5A8KA 3UN5A 3C66A 2XCAA 2H9ZA 1VBXA 1AA6A 5L1IA 5F41A 2GGPB 1SH0A 2AJ1A 2BXJA 1R8PA 3V81B 1CJTA 2HRTA 4A3EI 2XY7A 4CLFA 1PC5A 5G0RA 4BBSI 1RE1B 3IG1B 4ZPWR 4KO0B 3QGHA 2HVRA 2WW4A 1MSWD 1SB6A 1AUVA 2BANA 2F4VF 3CMEZ 1J2VA 5B0CA 2ZH7A 1YI21 2EFNA 3CT9A 1DIKA 4RJVA 4MV7A 3LH2S 2UV8A 2HGSA 3WQPA 1N8R1 1RHMB 2RQCA 1QE1B 2KFNA 2QMWA 1L3VA 3TP2A 1JX4A 3ZNUA 3MM6B 2JLEA 2K1RA 3JSRA 1WF1A 1M0SA 1FJEB 4YR2A 1XK8A 2YH1A 2V63A 4YN3B 3FKBA 4G1QB 5KFRA 5HMZA 1T05A 2XMKA 3HOVI 1RHUB 1WF0A 3CSKA 1NJI2 1A7GE 4RNMA 2DHAA 5CYMA 5HJYA 3I4MI 1HBNA 2KN4A 1B4SA 1M1KT 1S72S 4MK9A 4A47A 3RAQA 4QPTA 1WEYA 2QX0A 4EUVA 4LSNB 1CJVA 1U24A 2GJ2A 3LOUA 3CCRS 2RILA 4DLGA 1SKWA 4AT1B 2LEBA 4PKDB 4QU6A 1VFJA 4NASA 3VPDA 3VB9A 1SFOI 3CC2Z 2IM3A 1WC4A 4RW6A 1M5VC 2QN6B 3A3NB 1OWXA 1LXJA 1GXUA 4HACB 3TX0A 2HHWA 1VBGA 3C6TA 1RHJB 4CLLA 1YZ6A 4O7SA 2HHSA 4EO8A 3HJVA 5H9EJ 1HI0P 2NPFA 1KKHA 1YBTA 2W01A 3PR4A 3QO9B 5CYQB 4FF3A 2IJNA 3K59A 3KOAA 2ZM6F 2DNLA 4NCGB 1Q82T 4X4NA 4QYRA 3JSNA 4CWBA 1USPA 1P1LA 2IRYA 2D69A 3BGOP 3F0NA 2GVZA 4OYBA 2KYXA 1IBLF 3GFHA 1LQ9A 2ATCB 4Y65A 2CQDA 1KHWA 2IC3A 1NK5A 5BWWA 3FZ2A 1E6YB 2ASYA 3I561 3H5SA 3AFGA 4JP8A 1AZSA 2V67A 3JTPA 1U1LA 4CIOA 3ET6B 1RTJB 4BS2A 2R2SA 2PMHA 4QWAA 1R8CA 2NQPA 3SE7A 4V1Ak 2GGPA 1FDOA 1MWQA 3FKII 1FXRA 4NXMJ 1PGZA 4UW2A 3UCGA 3FC9A 3NEKA 2Z0GA 1T02A 3M8WA 1TA8A 2K3KA 3S01A 2R7KA 3V6DA 2HJWA 4AE5A 1VQMS 5DRKA 4RW9B 4R0JA 3HOUI 5HBMA 4V19J 1VHFA 2LVWA 3CJ5A 1B0PA 3KJFB 3T19A 2XHWA 4NLTA 4UY85 2K1RB 3A8IA 2OKQA 3IWXA 2LQJA 2WSCC 4I2QB 2IVFB 3UN2A 2UXCF 4Y2AA 1QLNA 5FR9A 3H2UB 3TW0A 3V6KA 2XO6A 1TWCI 3BO4A 2R93I 2MDAA 2M48A 4OI3A 2X1BA 5CYMB 1FE0A 1Y00A 4I69A 1GX5A 2JA7I 2ZZNA 2MZJA 3W64A 4LR7A 3A8KA 4UCSA 1LV5A 1QVFY 2R7RA 2QSWA 4WFBQ 1IKYB 3I56S 2VL1A 2W9BB 4LSNA 5KFNA 1ZAVA 4FXDA 1Q821 4IR1A 1D9FA 1DGSA 2JIRA 4E8UA 1KEKA 5KT7A 4A3MI 1HNIB 1LOUA 1ZOTA 2Q79A 4QWBA 1AW0A 1FDNA 4DQQA 4DFJA 5IT9Y 1C0TB 3G9CA 1VI7A 1SCJB 2V94A 3BSNA 2DH9A 1DJ0A 5BWVA 3V4MA 2FZKB 3M30A 1QJHA 3H25A 3WX8A 2HIXA 2W6NA 4DU8A 3NBZB 4IH6A 1ELOA 5D0HA 3CCLS 4NMLA 1FWLA 4KGVB 4DQSA 4HTIA 3CW2C 4XPCA 3J80b 2RS2A 1K8A2 1NK7A 3WWHA 2OTJ1 1RISA 3QLHB 4NPOA 2DEJA 2Z04A 3TEKA 4C97A 2RRBA 1M1K1 2P28A 3HK2A 1TL5A 1X0FA 4RZQA 2NZCA 1T36A 4QIGA 1OY6A 2Y1RI 3CD7A 3G8TA 2ZOFA 2M8DB 1B0TA 1S68A 1S48A 2GX8A 3ET6A 5F8HA 1URRA 1YUKA 2YKMB 3IR5B 1S0MA 3CCZA 5F0WA 2P9GA 4DUYF 3PO2I 4AUKA 2WVEA 3HOWI 4GMKA 3OV7A 2Y1JA 3ZTPA 2EEYA 2Y0SD 4DJBA 5I42B 1YJWZ 2VKRA 4C2MA 4BCAA 2JRSA 1MG7A 1Y5LB 3V6DB 4PYDA 5KFHA 3NCPA 5K20B 3EXCX 5HBMB 5KFXA 1XBWA 2O1PA 4OFZA 2F5GA 4P2FA 1JJCB 2HZCA 3IS9A 5I47A 1R6YA 1T9XA 4ZVUB 2XNRA 1S1WA 1Y3JA 2QL9B 4U67Q 1F9HA 4ECYA 4URSA 4KR0B 2I8CA 4Q4CA 4I2QA 3CCL1 3OR2A 3G82B 1YITZ 3BREA 1RWKB 2K7KA 2WCXA 2I8EA 1U0SA 3SCLE 1ZAWA 1N33F 3QNWB 3DLEA 1VQ6S 1JLAB 2J0XA 4CLUA 4YB8B 3P6YC 4YB7A 3TOQA 2VUMI 5KFFA 2ROPA 4HL9A 1HKAA 3T7AA 2OPPA 4TQSA 2C2NA 1N4LA 7FDRA 1EB0A 1RWVB 3FRZA 2XSJB 2H54B 2M4MA 2R84A 1EKSA 4QCLA 2J7WA 3PR5B 2W9BA 4WTOB 3M9NB 3GCFA 4NBFA 2MHEA 5HVGA 1MU2A 3CNQP 3AQOA 1KQSY 1U25A 3DTFA 1YJVA 2HQIA 4C8KA 1HNXJ 1D1UA 1RK8A 5ITHA 2BVZA 1SKRA 2DE5A 1U6FA 2V58A 1C0TA 4G1IA 4PR6A 4GC6A 5J1PA 1N5VA 4NBGA 2EC0A 1A6LA 1TR0A 4RLEA 1SC4B 4EGJA 4EQ5A 2FJDB 1KC8T 4J9LA 2HIQA 3NUAA 3P8BB 2E2II 1Q7Y2 1YJN1 3G71S 4ES1A 3K89A 2DCUB 1GK8A 3AD8C 5F8LA 4EWCA 2YQ3A 3D4JA 3I4PA 5C8YF 3RJMB 4DG1A 3MAAB 3BGRA 1D8YA 1O8BA 2V8JA 4KGZB 3H42A 2HKEA 2VUGA 2HVQA 1U09A 2DNMA 1HHTP 1GTHA 1SL0A 2YKMA 4I6YA 1A3GA 3QQMA 2RU3A 2P8IA 4F7VA 2HQCA 4H4MA 1Q8IA 3ITHA 1OBGA 4NLSA 3MECB 1H6KX 4XPEA 5K5MA 4DI6A 3F56A 1VQ5Z 5A6PA 2YZGA 1JKHA 4DR4F 1NU4A 2CQGA 4OYOA 1VQ8S 2MGZB 3G6VA 4UTGA 3Q8QB 2PN6A 5EX0A 2E1RA 2ZDPA 2J6SA 2LLZA 5E3CA 3BH6B 1VQ9Z 4EG0A 2QRDB 4OYIA 4MKYA 3B78A 4RBTA 3T5HA 2XZWA 4NYOA 4XIUA 3LP0A 2ZZMA 5DQHA 3GTLI 4F4ZA 1XR6A 3TVYA 3B6BA 3HB9A 1SC3B 4JI0J 4P75A 3TUPA 2W8LA 3M2UB 2J7KA 4OX8A 1S1WB 1HBOA 2DY1A 1ZM2A 5I3PA 4MD8A 4P6QA 4LSLB 1Y8CA 4IOBA 2YTCA 2JFDA 2W4PA 2WHOA 2OSRA 2V8HA 5T14A 1H7WA 3OUZA 3VAKA 3G6EZ 2KFZA 1NAQA 1CJUA 5K3WA 1VRQC 4Y2CA 2JX2A 1BQNA 2BJOA 1F0XA 3D3BJ 2N7CA 1B64A 3AQPA 2XSJA 4ELTA 1KRPA 1R0AA 3ORQA 2VZ9A 4DPOA 1NDLA 3VF0B 4H54A 2RH3A 1VGYA 1NB7A 2AYBA 2QK4A 2HHXA 2DXDA 1YBUA 1UWBA 4D3GA 4PPDA 3SSQA 2OFHX 1A0GA 1QVGR 5E3PA 4DAAA 5I3QA 1WZNA 3JSMB 4NEYA 2VD3A 1QSLA 1JJ4A 1KLMB 2IA6A 1NSQA 4URGA 3DDKA 1S1VB 4MKBA 4ZLNA 1S49A 2FVRA 4LJMA 3IN5A 3HHLB 2YWWA 3R5FA 4EEQA 1LFWA 4OI1A 1NHUA 4C7QA 4I7FA 1P9YA 3HSDA 4N5SA 3BKFA 4ECVA 5HQ8A 5EGYA 2DJWA 3MM5A 3GTKI 1FFGB 1BLUA 4IFVB 1GQEA 4NRUA 4PG4A 3U1NA 2ZOMA 1WTBA 1GSOA 2VG5A 3AH6A 5E33A 2CPFA 1Z2ZA 3T1HJ 4H4MB 4BWJA 3RB6A 5A2Qf 3HJFA 4QSHA 2NU7B 1V5IB 4Y8VB 2ZDGA 3BGFA 1YHQZ 2OJ3A 3J80Y 4G1PA 4FE2A 1H73A 4OJ1A 2V6AA 1FRMA 1Q16A 3KDOA 2ATLA 4DV5J 4LVNP 1Q53A 1CLFA 4RZRA 1W2BZ 3IMQJ 5FIIA 3L4BC 3PHTA 4MA0A 1TKTB 5L39A 4LMZA 1NB2A 3MR2A 1NJWA 4MH4A 4E32A 3T4NB 3DRRA 1OQ3A 5DM6Q 4DX8H 2F8EX 1G7CB 3Q83A 3CD6Z 4IH7A 4TVAB 1RWPB 4N8OA 2B3TB 2FGCA 4UF4A 3TY5A 4M95A 3LULA 3LTOA 5LMUF 5IQ6A 4JBCA 5A2QU 4AL5A 2R9LA 1WHXA 1AFJA 3OFFA 2QRRA 5CD4H 1CJUB 1BQNB 5KFPA 4K5RA 4X4RA 2R7TA 3G8DA 2CJXB 3R2DJ 1NH7A 2XQCA 2C3PA 5CAEB 2QREB 3IBWA 5JVHQ 5RUBA 4E2YA 5U47A 2VPXA 4C5BA 2OFGX 2R87A 3BGUA 1FNMA 4X4VA 2WW8A 3C46A 1NHVA 5IP9I 3G2XA 2OH2A 3GLJA 3RR8A 5KFKA 1UPPA 5I60A 4Z2XA 4ANDA 4F4YA 2R8JA 1ZH1A 3UN3A 4DV6J 3GIKA 5T67A 1VQ9S 4ITSA 3FMBA 1N8R2 2JC1A 4K2JA 5BR8F 1F9EB 1FT8A 2R8GA 3POTB 2DIUA 2V69A 4HTJA 3K58A 1EKPA 2K3RA 2Z2YB 3VCDA 3M8ZA 3FCVA 4ZHRB 1YBAA 3JTNA 2DR8A 4MIWA 4DX5A 1SJRA 4UOFA 4E6NA 2OPSB 1DAAA 3N01A 3CCS1 2O3DA 2YS6A 2CQ2A 3ZO7A 4B9NA 2FLLA 5F9LA 1VBZA 2QB5A 3T3FA 4L74A 1YQHA 2XYPB 3BKUA 2NUHA 2LKZA 4GKJF 5DZ6A 5LXRA 2ZVSA 3VGVA 2PBZA 3GJSB 5CZVA 4F8RA 4NLQA 2MZSA 4OI2A 1QYPA 2JIMA 1RZMA 3NY0A 3D0HE 3EVWA 5G4DA 1FTCA 1Z2PX 2BKOA 2X51A 2VFUA 4MD7A 3OW2Y 3CCVZ 1ZPWX 2QG9B 3QMQA 4C98A 5CQGA 1JIHA 4RW8A 4DV3J 2NLWA 3SCJE 1RHQB 2VQEJ 3Q86A 5HK4A 4J7CA 5FPOA 4UOCA 1VQM1 3SGIA 3TDHB 3OL7A 1JXEA 3H59A 1WIIA 2BABA 2AZ3A 3D2WA 5HNEA 2Q4ZA 3VPCA 2D3ZA 4YR3A 5LSLA 2NXEA 3QJPA 4KJIA 3D2LA 3CD5A 4NLUA 1S9FA 3CMAZ 3MPVA 3OT9A 1FI4A 5KG3A 1EETA 1VLOA 2C2EA 1P9QC 2V45A 1FE4A 1N36F 2KO1A 3CPWY 2WVDA 4IH5A 4CDIA 1H2TZ 2XCPA 4WFXA 5L1JA 3CF5Q 4WPAA 4QTTA 3VMHA 4MRIA 1RHRB 2LU1A 3BS9A 2ZAEB 1N8RT 3W63A 3HHLC 1NPRA 4UUWA 1D8ZA 4KGKA 3FGVA 4C3LA 3FQKA 5DDRC 1FKPB 2XNQA 2JHEA 1KQSR 3GTPI 2HQFA 4IG3B 2V5HG 3MZLB 1KTAA 3KLEA 3KMQA 4ED2A 5LXTF 1WRVA 4ZQIA 2QTWA 4MKAA 2PVPA 4NCBA 3FSIA 3J7YU 2V68A 1IUJA 2NVTI 1TAEA 4PBCA 2LU2A 3IFEA 4B17A 1NZAA 3D7SB 5J1EA 4CKEA 1PX2A 5IT0A 2NU6B 2VA3A 3GILA 1HWUA 1DV2A 3Q8SB 4PG5A 5D1OA 4PG7A 1IYEA 1RO4A 3V6JA 3KXDA 1NK8A 2VJVA 2FHJD 2UU9F 4CE5A 1VBHA 1BGXT 3CJQA 4H4OA 4ZVEA 4F4WA 2HVHA 3G8QA 2V5AA 2PGCA 2OPSA 4AYBA 2W1BA 3J80U 4CTAA 2ZNZA 3K8WA 1B7FA 1S721 2L9NA 3J81Y 2B4VA 4K7QA 2JA6I 2KXFA 1NRKA 1X4GA 5L9XA 4PZ6A 3ZZTA 5HVFA 4UOGA 1RT6A 1X9SA 3PKYA 3KLFB 4CMFA 1YWXA 1F5AA 2CWXA 4Q0BB 4OHWA 4DN0A 3CB4A 4C5CA 1VQLZ 4WCEQ 4LQ3A 2FPGB 2R7VA 4K0KJ 4USWA 2RJZA 4QU7A 3BBCA 4B3SJ 1KR4A 1I1MA 2MQOA 2EXUA 3HO8A 2NYIA 3UFCX 4B3OB 4OX9J 1RTIA 5D0EA 2EFVA 3MPDA 2CPEA 2Z02A 4IDKA 1VQ7S 1RXOB 2YQ0A 3TIIA 1FVSA 3ILLA 1Q8BA 4K4UA 5J2NB 5CA0F 2AKWB 3TZYA 4WHXA 4FPIA 2EWHA 2RT3A 1VRTA 2XLJA 1NMEB 2CVIA 1U26A 1ACMB 3GV5B 3JS9A 3W5XA 1IBLJ 3K5IA 3ADAC 1IKVB 1S79A 2CVEA 1T9UA 1UVKA 1VC5A 1K47A 4A3LI 1KBRA 3IBCB 3MEGB 4W92B 1J5OB 2VFVA 4QIVA 2VC1A 2XB2D 4FN5A 3ILOA 2VQFF 2MJNA 3FZBA 3R1HA 3VMMA 2POKA 1RYRA 2XS5A 1ET0A 3HI9A 4FFMA 3V5RA 4KPCA 4CH1A 4FXVA 1QD1A 2Q2TA 2E66A 2YW2A 2CUYA 2YNHA 3QRPA 2MJUA 3IM9A 3MAQA 4A8WA 1N33J 2NXCA 2SCUB 3H0GI 1VS3A 5DGAA 1N34F 1K1QA 5J2PA 2YQ1A 3OXLA 1FX4A 3MOZA 2WB4A 2X0SA 3N6NA 4Q8EA 5KFEA 1W93A 3KTQA 2HFOA 1NK9A 2MY7A 4Q44A 1FDIA 4UQTA 4ZLJA 3GIMA 3HHLD 4UCTA 5HLFB 2VPZB 3HT3A 4QBUA 1CVJA 2FZCB 2JIPA 1I51B 4DX6A 1WDDA 2CAJA 2QLFB 1RT2A 1HBUB 4DFPA 3LPEA 2OPQA 4GC7A 1U1RA 2RAQA 1T03A 4PWDB 2IMOA 3NL0A 2V8PA 3H98A 4CO3A 4I1TA 3VR1A 5C1PA 4NBEA 1S5ZA 1C2PA 3HVWA 1BC6A 1S1XB 5BYBA 4QOTA 4I56A 4F4KA 1FRHA 4DS4A 1YJ91 4ZHQF 1C0UB 2GV1A 2HQ3A 1HNWJ 2YNFA 3V4ZA 1B0VA 1I6HI 4A8XA 5CD4A 2Z2LA 3TWZA 3CJ2A 2GU2A 2XYHB 2Q51A 3AOAA 1OQ6A 2RDJA 4DS5A 4LBIA 2CQHA 3PRBA 1I50I 3I82A 1EAYC 3MMBB 2D7SA 2CJ9A 2HNDB 4A3KI 4KV8A 1QE1A 4I4BA 2EKYA 4YJ2F 2R7ZI 4B3MF 4C8NA 4CYUA 2ZH2A 2Y1IA 4WYLA 5B7WA 1LFPA 5JJBA 1HQEB 2QF7A 4NFRA 3H4DA 5FJ4A 2W25A 1FO1A 1HL6A 4ED6A 1VRTB 3QIDA 1UEVA 2GHVC 3LALA 1RUSA 3FFIB 2UUBF 3CDUA 1BY9A 2C2DA 1LWXA 1S1UA 4CLWA 5ETMA 3GG1A 2UV8G 4K4VA 1TK8A 1EUCB 2Z8QA 3EDRB 1HBNB 5HATA 2F4FA 4UY8T 3KYHC 2O4HA 4DQPA 2AQ4A 5LL6d 1ZPVA 1CJVB 2RRNA 3MCMA 4EZ9A 5LP6F 2CWKA 4IOCQ 3GCXP 3IAM9 4ED5A 2XO7A 4OYWA 4O4HF 2A1HA 4ZKAA 2ZDOA 3ZZZA 1OSCA 3NRBA 3D9XA 4RW6B 2R8HA 3BG1B 3K5NA 1NCLA 3L09A 5K8NA 4A8FA 1K9M1 3HVTA 4GKKF 2YWFA 1GEHA 3K2YA 3UR3C 2V9WA 2JR6A 4OV1A 3WWIA 2WVFA 3AJ2A 5FLXU 4NE9C 1WC3A 4DR5F 1HD1A 1SJQA 5C5JA 2HBZB 1K731 2PDAA 5E3AA 1U1OA 1A9XA 3TJ8A 5KG1A 1W2IA 2GVZB 4QWEA 1K0VA 5C42B 3U0GA 1VHIA 3NAHA 1FVIA 3S1MI 1KC7A 4HI1A 1P8GA 1ZA1B 1N5YB 3HFKA 2ZOGA 1OPZA 4PZ7A 4DL5A 1I2KA 5L1LA 4M5HA 3HPOA 4CLZA 3W2WB 1Z03A 1AZSB 4DV7F 2ZBIA 1QAJA 2BM1A 2AD9A 4NH1C 2O67A 4I6WA 5EWEA 5ETPA 3DLLQ 1WHVA 1C0UA 2JIQA 4MA5A 4WP9A 4LH6A 2ABJA 2YNFB 4CMDA 2AGQA 2W9AA 1NJYA 3J7A4 3HZEA 2QMXA 3LO3A 3TA0A 1ZZNA 5F8JA 3W5ZA 4R5PB 3KJNB 1F2HA 2JOQA 3U54A 3TQEA 4L75A 2HVZA 2I3CA 3D6WA 4NYZA 1YHQ1 1Q78A 3G96A 5D4OA 1QAIA 4CYUB 4M5NA 3HSJA 3VTNA 4FPRA 3GIIA 4IRDA 2VF1A 1U1MA 3HD2A 3MPYA 4BWMA 3WHIA 3CME1 3SDEA 1FKOA 1FFSB 3AODA 2KM8C 1FD8A 2XYGB 3EPGA 4H4KA 1I3OB 1MMLA 3ETHA 1R3NA 4X4PA 4NYEA 2WAQD 4DR3F 5KFTA 2R7OA 2RUGA 4YB5A 5C25A 1UKUA 1BUXA 2C2KB 4RX6A 3NDJA 2UVRA 3QSIA 5A2QY 1F60B 1JLQA 4OZ3A 4JV2A 2HLUA 3JZ6A 2M8HA 5D6GA 4CO0A 4WKRA 1TWFI 3TX8A 4LF6J 1E4EB 2X5RA 2YPYA 5F3TA 3KG4A 2WB1D 1KS2A 3W1BA 4J90A 1KQFB 4I55F 4O0NA 1Q4RA 5A2Qb 4BY7I 2R2UA 1X31C 1RHKB 3GB8B 4NZ0A 2LFUA 3I0SA 5HL7Q 3CCVS 5LOQA 2QL5B 2RD5C 1M5HA 3VA7A 1PCAA 2P6SA 3DN9A 2H48B 2GA7A 4FKXA 4C5AA 2NZ4A 1VQ4S 2XI2A 5KFIA 3UVJB 2DH8A 2I80A 5IYZF 4BXXI 3R5GA 5KFSA 2R7QA 3PO5A 4IFYB 1BD6A 2V8VA 3OVBA 4LRDA 1RBAA 3OTCA 3W2WA 1VJQA 5H9FK 2HVDA 4X4TA 2HAIA 2RKIB 4LF8J 4DV4F 2YH0A 1TL3A 1UVIA 3G4S1 2OZKA 2BA9A 3E01A 1TMJA 1U45A 2HYIB 5GADU 1CJTB 4DQRA 2W2MP 5ETTA 5HROA 2VIHA 2PE8A 1TP7A 2JA5I 4C8YA 1UFWA 2AYEA 4ZK7M 3IG1A 5DQIA 4ZOLF 2DGWA 5IV4A 2MZ1A 3VPBA 3KK2A 4DCPB 4USVA 5IC4B 4FF2A 4RUBA 3BDPA 4CT9A 1U7LA 1OBDA 4YY3F 4UCRA 2NXUA 3NAIA 2AJ2A 2DRAA 4YS2A 1Q8LA 3NOCA 4ATNA 5HMYA 1G4CA 3OR2B 1WKJA 3MMAA 5A6WA 2UXDF 4R25A 2R7LA 3BV8A 2NVXI 3FSYA 1NLKL 4KB7A 4WBNF 4ZN1A 2DPIA 4A3FI 2DB1A 4Y3CA 3R7SB 1S9EA 4TNOA 3SFGA 1H98A 3T9BA 2OELA 4U7UD 1WOPA 2W6PA 1I2LA 1KT8A 3D1QA 2I5JB 4RNOA 1SIWB 4U6PA 2VFTA 4P52A 4DIMA 5CABA 4DSFA 2VG7A 4U9RA 1FRKA 3PYGA 3A12A 3VNNA 1R0CB 2ZWOA 4HR2A 3TAPA 5C25B 4OV6A 3S7RA 4IO9Q 3GZ7A 2YL2A 1TKZB 4LF2A 3C16A 1JLQB 3Q23A 2LQ8A 3SBMA 1Y11A 2BKNA 4X2BA 3UFXB 1VRUA 2HGWA 4NXNF 1JLGA 5KT3A 4ECSA 2DGSA 2YWHA 5KFDA 4USUA 4WZMA 3C6TB 3W5YA 2RT9A 4A48A 2H1YA 2BR0A 2JWNA 4LF7J 1JLLB 2VV5A 3PXGa 1J27A 3ZTQA 4JV5F 2W7OA 4A46A 1JLEB 1S4EA 3CMA1 5DDQC 2KVIA 2DHXA 1WHWA 1Y1VI 2HW3A 1X7VA 2MY8A 3G87A 2A6OA 3NH5A 1EZ1A 3CXCR 3PIPQ 4MIAA 4UOHA 4A8YA 4RUAA 4YP3A 4B9VA 2ERRA 2KZZA 2RS8A 2WZ1A 1FA0A 4HH0A 3HHKA 2M5YA 3TAQA 4QWDA 2IC3B 3UVJA 3KUHA 3X3UA 1V9OA 5MAOA 5HBRB 4OLPA 2UXCJ 2IJRA 5MLCV 1VQ7Z 4FYYB 1RQFA 1EP4B 4PZ8A 1WC6A 1CC8A 3G8CA 1JMTA 4Y7NI 3VAHA 4X84A 1PG5B 1RBLA 2XBPA 1RCOB 4ZVHA 1RABB 2VOOA 4WU3A 5DQGA 1X4DA 1U1KA 3OL8A 1JLCA 2FC9A 4LH7A 4FNIA 3K8VA 2IMWP 4NBBA 3LGHA 3A3OB 1Q811 9ATCB 3RBEA 3DYAA 1MROA 4WP3A 1KJ9A 4A8KA 4RS4A 3NGRA 4RW9A 5DG7A 4G3IA 1TTHB 1I7LA 3O8WA 2DT9A 2K5RA 1KVJA 3BB5A 1VQNZ 5I5VA 2RHQB 3UW1A 4IWYA 2H4YB 1YGYA 1TZ0A 3V4IB 4LFAJ 5H9FJ 4DR4J 2U2FA 3GB0A 4NLYA 1GH8A 3CCSS 3MZKB 2MKHA 1UJ5A 3CJ3A 3IX0A 1VLAA 1ZAUA 1C1BA 4ZITA 2QV6A 3DOLB 3OUYB 1JLFA 2HQDA 1YI2Z 1DQ9A 4NLGA 2V4QA 2G13A 1VLYA 1NH8A 4DV1J 1KC82 2J6AA 3ZZOA 4HHUA 2N3OA 1XMOF 4ICLB 1LW0B 3ZZ0A 4BC9A 3MEDA 3IO1A 2KVQE 3PRVA 2GIRA 2K2PA 4OZ0A 1RLYA 3P5JB 3C16B 3PVXA 4MMOA 1R7IA 4ZCIA 1HNIA 5D0GA 3M05A 1DBDA 4C8ZA 3CCEZ 4B3RF 4DUYJ 2LQ5A 1Y1VS 3VVTA 2KXNB 3HHLA 3OVSA 3NCRA 3SMZA 5HP1B 1S77D 3N4WA 2IJFA 1C1CA 2Y8YA 1I1KA 4E4TA 3OHBA 4W4MA 4IIJF 3WO0A 3BABA 2NUAB 2E5LF 5KG0A 5KFVA 3JRWA 2XEXA 1EQ0A 4JI3J 4ZP6A 2V2QA 3CCTA 4QQBA 4CM0A 4ECQA 5B09A 2IAJA 3KG1A 2VG5B 1EP4A 3QT8A 4ER8A 2YKNB 4LF1A 3UD3P 2I87A 3HKZA 1REVA 1KTVA 5BR8J 2UUCJ 2C00A 5FNVF 2CPZA 1A9NB 1I94F 1RAOA 3LQSA 5I42A 4ZOSA 5D4NA 1IM4A 2VPWA 2JH3A 1CULA 5HMWA 2DR7A 4Q43A 1Q16B 4LRAA 4WXWA 3DYAB 3GPAA 3BA8A 3GJTB 3CXCY 3FBBA 2FVPA 2APOA 3UNGC 1FRIA 2HPUA 2M9KA 5HAOA 3JRXA 1WORA 1FESA 3LP2B 3IGNA 1TKTA 1GXLA 5LM7E 4M5JA 3IS9B 1CJKB 4UCOA 5DAAA 2YKQA 2HMIB 2ZC3A 4WKYA 2P6TA 1FWPA 5IT9U 2R3VA 3D66A 2EVZA 3V4IA 3DGPA 4TU7A 2XWYA 1QVFZ 3R5JB 2OGUA 2HHUA 1EYZA 3UPFA 2N82B 1JLAA 3I0RA 4EEYA 2VB6A 3D9BA 1NP6A 1SUQB 3KK1B 3MJFA 1DQAA 5J2MB 2DO4A 2OPPB 3GFXA 1N5SA 1UL3A 1R89A 3P45B 4PXCA 3FVYA 5KFQA 1UJ6A 2DHHA 2MZTA 2HFNA 2BJEA 2KJWA 4NZ6A 5JVGQ 2LQ9A 1X5OA 4MK8A 4B9UA 5CR5A 2HHHJ 3GFYA 3W66A 1FEHA 4X66F 3DLHA 2N3LA 1RAIB 4J9SA 4DR6J 2Y3YA 1Y3KA 4E2FB 2W70A 4X62F 2HIVA 2V59A 3JZIA 2FJXA 1GTEA 3BJYA 3LPYA 2EBGA 2BJ8A 3H4BA 2HGMA 1PJ5A 1TL1B 3JQJA 1XNQF 3M3YI 2HHVA 2L48A 1SIZA 4DV0J 3PW0A 3CJTA 2OSQA 5HP1A 1M5OC 2CPJA 2X1GA 2FHOB 5HJXA 3JXOA 3POTA 2R7MA 2ASJA 3NCQA 2KJVA 1Z2LA 2KT2A 4ZHRA 1JJ2Y 1CS4B 1U8WA 5A8WB 3AY0A 1VQ51 1U47A 2M3DA 4WK3A 3T41A 4HH1A 4MT1A 2RBLA 4NL5A 1KJJA 5FLMI 1YJUA 3VMIA 4DG1B 2M88A 3RBDA 4HN2A 3ENWA 3T1HF 5E41A 1U2CA 3CD0A 3A1YG 1ZS6A 2IAJB 4A4JA 2F7VA 1RAJA 2EK1A 4WFYA 3BYRA 3GTYX 4LF8F 4ZCMA 1J5EF 3NWRA 1SC6A 2I2YA 3TW6A 2YXLA 2CPXA 2EFGA 4MD9A 1DL6A 2V50A 4IO1A 4C4WA 3O5TB 1YITS 4O2AF 2H5IB 3W1YC 1DZ5A 4NBDA 2ROEA 4P2XA 3MDFA 2VOPA 2VPWB 1C4CA 3NGUA 4MV8A 2HHFA 2E9HA 3HFZB 4KE5A 4DR1J 3I07A 5GAEU 4NZNA 4H4KC 1H74A 2YU9I 1H38A 1S99A 3U1MA 2W6QA 4O4JF 3IF8A 2OEKA 5AE1A 4AL6A 4ZPVR 4DPYA 3TANA 1FK9A 3SIPB 1SQEA 4YY3J 3HKWA 4URQU 5K8PA 2C3OA 3DDNA 2HMIA 4X66J 3CE8A 4BC7A 4ZIWA 3C6UA 2QC3A 2VKZG 1G2WA 2BEFA 2I6WA 1ZBTA 1Q861 3NNCA 3QRRA 4GO5X 4MV9A 2IM2A 3WC0A 4E31A 2MLXA 1T3OA 2CRLA 3P4UB 2J9EA 3W3SA 1YRTA 2VONA 4O7NA 4MTPA 1KJIA 3CJSA 3KK1A 2W4DA 4LIWA 3QGGA 5JQWA 2VG6B 2HK2A 1VQ61 2NVQI 3N5FA 4CC5A 4FBTA 3CPWR 2XG8A 4OQJA 3TW7A 3IRXB 5AN9F 1Q95G 5ETNA 1RNIA 4F04B 5DISC 2WSFC 1FKPA 2W2PP 2YX1A 3GTMI 4RU2A 1DRZA 4B3TF 4DV2J 2IM1A 3AB2B 4J5OA 3TUJC 1RT1B 2DXEA 2LECA 3THTA 3N5BA 1CPZA 4JI6F 1ZA2B 3BN7A 2UUAJ 4NLRA 4NA2A 4I2PA 1WI6A 4P72A 1N6QA 3MCOA 1HBMB 2AJFE 1BXRA 3HSGA 4RWXA 1DLOA 3OLAA 2K8GA 4DV4J 2IDEA 2G2OA 1FX2A 3IWNC 4I7FB 1GLVA 1LWCA 3W8PA 4DQYB 2CDQA 1QXFA 2NSBA 4ETXA 4ILMA 1S10A 1HR0J 3GP9A 1KLNA 2DNZA 3M6XA 5C2CA 1YRUA 3EM1A 2MQPA 1TFWA 5K14A 3T99A 3QFHA 5GONF 1UW9A 2NS1B 2ZJRQ 5DDPC 3KREA 2F4OA 5ADZA 4O7TA 2FJAB 3L7PA 4RV9A 1XWLA 4NWBA 2NXNA 2CPHA 1X4BA 2WOMA 2FHJA 4ZS6A 2ZE2B 3KLFA 4O0IA 2PIIA 2B7CB 2E29A 1B99A 4PWWA 4M5GA 5AXMA 1BMQB 5C2GA 3AB4B 1VYAA 2ZJPQ 4XYLB 3LGMA 5GAHI 3V6HA 4W90B 3FQQA 3CDEA 2YADA 4RO0A 2RHSB 1VQL1 5AXNA 2XMUA 2QLXA 1JNRB 5GAGU 5J2QB 2RPRA 4HDHA 2WTFA 3BSCA 1TFYA 3C3LA 4USMA 1WWHA 4EBCA 1FTRA 5LT5A 2ZBCA 5EHHA 4IDKB 3JQKA 5J2UF 2ZD1A 1ZTTA 3ZZPA 5KT6A 3RRHA 3KK3A 1Q812 3EUNA 3N9UC 5T7LB 5IQQA 4E33A 4WFNQ 3MHYA 2H51B 1MLAA 1IBKJ 2XHCA 1RB0A 4WWSA 1QDUB 1RKIA 2VG6A 1P16A 3IR6B 1W25A 4B3SF 3MD1A 4RNFA 1J5OA 3BG0B 5KFGA 3RYLA 4GVLA 1OY8A 3KMSA 2FUG9 3CC7S 2QRCB 1GMVA 3BAAA 1IOWA 2XLKA 4FNHA 3I551 2W4CA 3RTXA 1WJ9A 2DNPA 3HULA 2VPXB 2DNQA 1WSVA 3SQGA 1EZZB 1B6SA 4PEOA 4ZCLA 3DHWC 2PN1A 1CC7A 3A4TA 1IJEB 2QEXS 1FJGF 4GKJJ 1DTTA 3M2RB 2AEFA 2CQ1A 1VS0A 4ECWA 4N41A 4RVFA 1EKRA 4ZJQA 3NP5A 2CQ4A 1IBMF 4ZPCA 4C8OA 2JL9A 5DDOC 2JUBA 2GAHC 2J8SA 2NYHA 4WTYA 4M63A 1T11A 3OXGA 2Z2ZA 1KHVA 4YFUA 2OHDA 3PIOQ 2IP4A 1RTDA 5K14B 4F3MA 1M90T 3PW4A 3AD7C 3KWMA 4NZMA 3MM7B 1NHKL 2YS7A 3CTRA 3M8SA 3GIJA 1VQYA 3CCUS 2ZBQA 4K59A 5C4JI 4F4XA 1LXNA 3HDSA 1RAAB 2GQCA 3EICA 3CD6S 4HHHA 3N6LA 3TAMA 1BQMB 2PMZD 1EHIA 5DZ7A 4A3CI 3KALA 2HHPA 1YJ9Z 2W6ZA 4PYAA 3M4OI 1YI2S 1SQFA 2BQ3A 2Y0SA 4X64F 1NK6A 3TR5A 2XMJA 5ETRA 3MR6A 1FEEA 5KFZA 1F9FA 4MONA 1MN7A 2IHR1 3VGUA 2AF6A 2YNGB 5KFJA 3R23A 1UEUA 1LW2B 3MMBA 2W04A 2QJ3A 3ETOA 1U1QA 2ILYA 3CCE1 3DI6A 6AT1B 1I1LA 3CCV1 3QT6A 3KDNA 3DRPB 4IQXA 2QIFA 1NM2A 3TZWA 4CC6A 4ZVGA 3JAMY 4JI8J 4ETZA 1AT1B 1MWZA 4JUZA 2XZTB 1TL7A 5IT4A 1J5EJ 4KTQA 3MFIA 4WF9Q 3SSSA 2GJIA 3ZTRA 2XCLA 3FBEA 2V2KA 2MSTA 2RF2A 4CO5A 2XLIA 2JMOA 4J9OA 3H2VE 2JLFA 1O5JA 4I50F 3OD2A 2KL8A 4ILLA 4RW7B 1WCMI 2JEIA 3WC2A 3FCHA 3H2LA 1Y4ZB 2R2RA 2Q6BA 3OUUA 3AOCA 4F0HA 2ZUAA 4LF4J 3T9NA 3VV2B 4DN9A 2CADA 2JEFA 3RGIA 2V4JA 2BYCA 5FDLA 2E9ZA 3MEEA 1KRLA 2AX1A 3Q8RB 1HW8A 5GAGI 2FJEB 3JYTA 2CIMA 3M2RA 2VF3A 1NBEB 4RVHA 1MWYA 3BPSP 2J5AA 1Q81T 3DOMB 1WKLA 3D1OA 3E51A 3M8PB 2KI2A 3AT1B 4Y00A 3QATA 3PYEA 2U1AA 1B7YB 2Z2MA 3DRSB 3ILIA 5GADI 3CC7Z 5AXLA 3THPA 1PBAA 1M0WA 3CC4Z 2GVDA 3S1RI 2IIHA 1WELA 2BE2B 1Z02A 2DCLA 5KG2A 1L3UA 5KAKA 3MMJA 1CKOA 2LP4A 5L46A 4LFCF 4TYBA 4EK2A 4RR5A 3I55Z 3MXHP 4FYXB 1VQOS 5DLFA 3NC0B 3HT0A 1N5YA 5A76A 1LWFA 2LXFA 1ZM3A 1L5UA 3KKFA 2BKPA 1KD1T 1U1NA 1U4BA 4OX7A 2QLBB 1IWGA 1WC5A 2QLVB 2EG1A 3G6E1 5KTQA 3I5BA 1IKXB 8RUCA 5HN0A 5F0UA 1UP1A 1VQPZ 3SI8A 4DR2J 1L3SA 5DM7Q 1EARA 4WZQA 2DITA 4ANCA 4AXIA 3TE5B 3CMAS 1LW2A 3CEDA 3JZFA 1SC1B 2QL7B 3DI6B 4LF7F 2GMJA 4ZI7F 1RACB 1TK0A 4OHXA 3R3TA 3MM6A 4YHHF 1K1SA 2RQMA 3WDOA 4XDDA 4RCNA 4ECXA 4F2SA 5HSPA 1QSYA 2XM3A 1YG0A 5E0OA 1LK7A 4ZVOB 4X62J 1TL7B 4LBHA 4K4ZA 4HI2A 3T6JA 2LDYA 1EKFA 3P5BP 1AB8A 4WK1A 3CIMA 3T9CA 5I5SA 4FYVB 2IA0A 2VBWA 4GVBA 3GDEA 1R9TI 4L72B 3OW2Z 1JJHA 3CJ8A 4RW7A 2YY3A 3DAAA 5L9NA 3M8QB 1NPPA 4N76A 2V4JB 5BWRA 4Q45A 1PJ7A 2FYXA 1KJ8A 2WONB 3BPDA 5BYSA 2EG2A 1RTHB 2I38A 4LF5J 3NG8A 2HDKA 2CNNB 5D3GA 4ALZA 5BYAA 5IP7I 1E4EA 5J2PB 1GMWD 1TKXB 3M8PA 1HQUA 4Q2MA 3CC41 5CYQA 1SJ3P 2FLPA 4LIRA 1BWVA 2OTJS 2RRAA 1N88A 1LWEB 2KB2A 1USPB 4QR0A 1X9NA 3GTMS 3L3CA 4HGYA 3JAMf 1QUPA 5KFMA 4EBEA 3RRGA 2BE2A 1YJW1 4CLSA 4O3OA 3TQTA 2VPQA 5LOVF 1Y5IB 4IKAA 1TWGI 1W26A 2WB1A 2ZBPA 4TV8F 3NGTA 3BQ2A 1VCTA 2DNOA 4RW4A 3CQZI 4NXNJ 1LK5A 3LP1B 2CG8A 1VISA 4CRJA 2YBVA 2UXBJ 4WFZA 3TVZA 1FJGJ 3VOTA 1Q7LB 2ABYA 3TY8A 2Z56B 4I68A 2ZUGA 2KHDA 2R7XA 1HMVB 3H7HB 4ES3A 3TEHB 3KLVA 1NPKA 1P8LA 3G4SZ 2HWIA 4UZBA 5KG4A 1CBKA 1K83I 5KFLA 4J37A 5HV6A 2W2NP 5DJBA 3HT5A 1TUVA 1MNEA 1X4FA 1R8HA 2K7JA 3NNHA 4PWUA 2AW0A 4DR7F 4O7VA 4TM5A 1S0VA 2L9DA 2ZEJA 2GTHA 4ZP9A 1C4AA 2B6AB 3Q8PB 3U27A 1IKWB 3F3PC 2JA8I 3TYTA 2OMOA 1YJ7A 2Z57B 2QA4G 1K732 3CUNA 4PXEA 4CO1A 1FVQA 1AUDA 1VQK1 3WIUA 2ZWPA 1R8BA 1X5SA 1N32J 3MFHA 2N4DA 3NKYA 2ZHBA 4DV3F 4PCQA 1HNWF 1I3QI 3CJ0A 3FFIA 3RG6A 3K5OA 1CS0A 3NGKA 4C48A 5IT9b 1W2BY 1X5PA 2A2DA 4R8UA 1RT4A 3IBFB 2PI5A 1UA0A 2VG7B 2D9OA 1TK5A 2PEBA 1RDRA 2KDOA 2DBBA 4QR1A 1VOMA 2R8IA 5DLGA 3R1LA 2L9WA 3RAXA 3M2VB 4KFBA 1VQ81 1VQ4Z 4F02A 3GIRA 1TKZA 2HIYA 2VC0A 1RSCA 3K0JA 3PV8A 2COLA 1UCNA 2H65B 4Q2LA 2W6OA 2COGA 1RTHA 3W7BA 1NXIA 4O2BF 5E2QA 1KC81 2W2OP 4M5DB 1EJ7L 3HM9A 3K3PA 2BW2A 1K44A 1HQUB 3M30B 2JLGA 5JH7F 3DU5A 4G6VB 1JLEA 1S97A 2QKDA 1F3VA 1OJ4A 3S14I 2KTQA 5C7PA 1M6VA 3PO3I 2F4MA 2BOAA 2QMUB 4Y28C 2HZAA 1NDCA 3GTOI 3TUZC 4JI7F 3CCMZ 4OHVA 3DLGA 5C42A 2FVSA 3SV3A 2CXEA 4QIEA 2NR0A 3I32A 4J9KA 2FC8A 3DDIA 2PK7A 3U7JA 3GFZA 1WEXA 1S6PB 4N8NA 1UMJA 2ZH3A 4LF4F 3ZC4A 1L1OC 3WNZA 4HT7A 1QVGZ 1YZ7A 2DHGA 2Z4PA 4WP8A 2RQ4A 2J6TA 5EX3A 4TQRA 5GMEA 3OTEA 3I12A 1F3FA 2OTJZ 4KIAA 4NI2A 1Y0HA 3W8GA 3VGSA 1QVGY 1U2FA 4DUTA 4EGQA 4M0JA 2EBEA 5HO4A 2E9TA 1N32F 2O01C 5ETVA 4HT5A 4P7VA 3C2PA 2GQSA 4DDFA 1WF2A 3MWEA 3CSWA 2J0WA 4J9RA 4RBVA 1WSRA 1MROB 2B51A 2B4PA 5T41A 4O44B 2HLTA 2GZOA 1VQLS 2Q3PA 1VQ6Z 3KIHA 2RU9A 3AAWB 5M2UA 4DR6F 1NO8A 5L8RC 5HMXA 2BMBA 1X8DA 4O4RA 4FVMA 3Q22A 3UCUP 1WC1A 1G6BA 1HNVB 2ZH6A 1FWKA 3E8OA 3RZAA 1Q5VA 2C22A 1OO0B 3BR9A 2H5EA 1ZTWA 4A8QA 3P96A 1H72C 1T05B 3AW8A 4PRFA 2BM0A 2FTRA 3H0PA 1Q86T 1RAEB 4I0WA 2DGQA 2CKWA 2IPOB 4HNUA 3FBFA 1I7NA 1NNDA 2B8PA 3MM9A 2AT1B 1C1BB 3GYXB 3T5JA 3DOLA 2M70A 3RU0A 3OUYA 4DSEA 3DTGA 2GO8A 1APSA 2XY5A 2XZDB 2ALZA 1RT4B 4DF4A 2ROGA 2X3DA 5B0EA 2MLZA 3EYZA 4XX2A 3PG9A 2XC9A 1YIT1 3CVKA 1KBLA 4IWXA 4RVDA 4ICLA 1LW0A 5ETQA 2EK6A 2QR1B 3RB4A 4KH1B 1RT3A 1FNOA 3BSOA 1HNZJ 3I55S 4CNYA 2FIUA 1S6QB 3TARA 3NXZA 5I3UA 3MAHA 4FYWB 1IQZA 5EN1A 3PFEA 3LAMA 2DIVA 1VC0A 3LW5C 3F3FC 4FVCA 2QLWA 3ISNC 1WI8A 3THVA 1X60A 4NB9A 4G65A 2LFVA 3AX6A 2EGTA 1CSJA 1LKZA 1U2RA 3RRKA 3MUTP 4EI2A 5K2MA 8AT1B 2ZGIA 1ZB8A 1C1CB 5M2PA 3OPKA 2DGVA 4O3QA 2WVBA 2J7UA 4U7CA 4PUOA 4NBCA 4NLWA 3QGIA 3EX7B 5BWTA 3E3XA 1N52B 3OTOF 1SL2A 1ITPA 2VR1A 1QVFR 3QIPB 3HLUA 2GW8A 4JYAF 5J2TF 2C3UA 2IBKA 1DURA 2IYGA 4LBPA 2F63A 5C1OA 4J9NA 5B0AA 4KAIA 1H7XA 2CPYA 4NI2B 4Y2MA 3CCU1 3MECA 3VAJA 1SL1A 3QFFA 4JI4F 1JKHB 1QAYA 3AA9A 3I6PA 3S1TA 4UUGA 5HROB 4OZ1A 4ECRA 2VQEF 2E9RX 1S6OA 4DSLA 3ZXWA 3BQ1A 1EHWA 4B3TJ 4YB1P 5KFUA 3KK2B 1XMQJ 4O44A 1RWNB 2FVCA 5KKNB 4BLGA 3TA2A 1CQJB 3LGNA 3AOBA 4F67A 5HVHA 2LQBA 2DNRA 3AHPA 4DRFA 5KOXA 1VDHA 4ZCKA 3MUMP 1TVRB 1KFDA 4TYAA 4PG8A 2EW9A 4F50A 5CE8A 2W6MA 1S9EB 4M8LA 1SUQA 4ZVPB 3MM9B 1XQIA 1YSJA 4P7TA 1PAEX 5J2MA 3KJVA 2VICA 4TU9A 2AJ4A 2QYCA 4TY8A 4Q8FA 5KFAA 2UUWA 2XMMA 1IKYA 2B9EA 4UCVA 4EWTA 4DV7J 3PYFA 3TJAA 3OBIA 3EXYA 1RLCL 1RT3B 1N48A 2NCKL 1RQ0A 3HOYI 1S6QA 1N2FA 3SV4A 2OEMA 5I3UB 5LA6F 2XY6A 3NNAA 1U0HA 5H9EK 1WW9A 2JVRA 1VRUB 5E25A 3OXFA 1JLGB 2HFVA 2R7UA 4F26A 1N56A 1S12A 1RAHB 2DGUA 1JQGA 3CWJA 4ZVRB 3WWJA 1R6VA 1TL1A 3ENQA 3OQ2A 2Q2UA 2CZ9A 3VAFA 1M902 1TAQA 3D6MB 3GMGA 2W9CA 1WKKA 4EFAC 3HX9A 2QSFA 2G2ZA 1VQOZ 4QPXA 3ZTSA 2H5JB 1O6XA 3J81b 3P49B 2M52A 3K5MA 4DLKA 2HWTA 2YKPA 1U6ZA 1JXLA 2KT3A 3QPIA 5C44I 5E7OB 3KYLA 5KFCA 2NREA 4GLWA 4OX6A 2VBXA 4RPFA 3CC71 4K4TA 1UVMA 1X5TA 4LR9A 1VQO1 2GFFA 2E44A 3MWDA 2YKAA 3I5AA 2CQ0A 3PFFA 1UVLA 1QM9A 3G8SA 3M32B 1RGVA 2WK4A 3H90A 4WXOA 2F40A 4UT4A 1IBKF 4AYBD 2E1MC 4NLVA 4TNUA 4O3RA 4WYWA 3OSNA 1JWHC 3BF4A 2DWCA 2AKLA 5T64A 5IC6B 1RKJA 2VDIA 2G0CA 4NA1A 4DV1F 1XJWB 3EGZA 1XR5A 4CNZA 3QSYB 2DHSA 1TUGB 2DISA 3MM8A 3TINA 2BRLA 4HKQA 2IRUA 1OS5A 3VVUA 2K06A 4UQGA 1FRLA 3PO3S 4FDFA 2GIFA 3A8JA 3HOXI 2XMVA 4MV3A 1FJCA 3ICLA 5KG5A 3OFHA 3CGIA 1VQ5S 4YMEA 1WG5A 4J9MA 3G82A 2I9SA 3DLJA 1IM6A 3BYPA 2E1CA 1RT5B 2XGQA 4NLXA 3JQMA 2DZDA 3B8HA 4TUYF 3N6MA 1HI1A 3BKTA 4JI5J 4KHPF 4ZVTB 2CYYA 1OYDA 1SI9A 4N77A 1JLFB 4O4IF 3Q0AA 4EGLA 1UEKA 4IRKA 2M2BA 4A3DI 2OTLZ 1RP5A 3C15A 1F1BB 2VASA 3PYDA 2GMLA 2BW7A 2LA4A 2R85A 3UDCA 4FFLA 2ZKUA 2CQIA 2W7AA 2AIRB 2XMTA 3IC1A 3LA0A 2R92I 1MU2B 3ZFVA 3PJWA 4ZPDA 5E5NA 3H8YA 4TU8A 1XIQA 3BR8A 2C2OB 2P0AA 3W2VA 1N36J 4USKA 1Q822 2HWHA 2CQCA 5LJ5Y 2DR5A 3JAMb 4CQ1A 2KFYA 4DUZF 1N6QB 2YRWA 2A1BA 4OYXA 1P9NA 2OOXB 2W9CB 1N5TA 3H5UA 2CPIA 4NYPA 1KUTA 1QF8A 4ID5A 4X4UA 4KGXB 1HPZA 1X4AA 4Y2KA 2PEHA 2DYAA 4CP5A 4J9VA 1FFWB 3RUPA 5LSRA 3CPWZ 1DTQA 4F0KA 5CXTA 2Y8WA 5E3RA 4RWWA 2W7PA 3OFGA 4F3OA 1PC4A 1DFDA 5J1NA 4HNVA 4I64A 4C8LA 2DAAA 1IWAA 5D4LA 4L3KA 3D0GE 1RWUA 1Q5YA 1K0TA 3D54A 2HSEB 3EVMA 2ZE2A 3WBZA 1REVB 3M32A
chains in the Genus database with same CATH topology
1IJFB 1ML8A 3FDSA 2CPXA 2EFGA 2HRUA 4MD9A 3HF5A 1DL6A 4QIWD 2GO9A 4IO1A 1X0PA 4C4WA 4NBAA 3BGFA 3O5TB 1YHQZ 1YITS 4LT6A 2OJ3A 3MURP 3J80Y 1DZ5A 4NBDA 2ROEA 1UW4A 1ZAXA 3I87A 3MDFA 4G1PA 2VOPA 4OJ1A 2VPWB 1C4CA 2MGZA 3PKMA 1FRMA 2E9HA 2BQRA 4KE5A 5E3QA 3I07A 3L7OA 5GAEU 2V8DA 4H4KC 2ATLA 4FZVA 3OVAA 2YU9I 1H38A 4LVNP 4WJBA 4A93I 5J2QA 1Q53A 1S99A 3FJ2A 4RW8B 1CLFA 2RSQA 3U1MA 3MM8B 4RZRA 2AJQA 1GXTA 4NXMF 3IF8A 1W2BZ 4RUCA 5FIIA 4WFAQ 1Q79A 2G1DA 5AE1A 2JEJA 3VZIA 3LP0B 3CC21 5KT5A 4ZPVR 4AL6A 2D1CA 3TANA 2V4RA 1S1TA 1FK9A 1VQ71 1JWWA 1TKTB 5L39A 4LMZA 3H40A 3IR7B 4QR2A 3VAMA 5KG6A 1SQEA 1TFIA 3HKWA 3MR2A 3M1VB 1RA6A 4URQU 5K8PA 2C3OA 2A3JA 4NOZA 1ULRA 1HBOB 3DDNA 1NJZA 4MH4A 4E32A 3CE8A 1X4EA 3CO9A 4BC7A 2HMIA 3CMES 3C6UA 4K0KF 3OW2R 3T4NB 4HYKA 3MPWA 2VKZG 3VQSA 1CQMA 3UWTA 2K3IA 3T9ZA 3DRRA 1ZBTA 1Q861 1OQ3A 3NNCA 5DM6Q 4DX8H 2F8EX 1G7CB 4GO5X 2ZNYA 5K8MA 2O53A 3CD6Z 2QA41 1RT5A 2IM2A 4IH7A 4N8OA 4Y2IA 2Q43A 2B3TB 3WC0A 4E31A 2FGCA 1T7PA 1T3OA 2CRLA 3RAXA 4FBUA 4M95A 3TY5A 1EETB 2IVMA 1VQKS 2J9EA 3NFZA 3W3SA 1YRTA 3JSLA 2VONA 2F3JA 3I0RB 3OR1B 4ZVFA 3SYZA 4MTPA 3OTBA 1NK4A 3RR7A 3UD4P 1YVFA 5IQ6A 4JBCA 5LMUF 3KK1A 2W4DA 4LIWA 4AL5A 4C3KA 3QGGA 1KN6A 2R9LA 3GTQI 4IRCA 1WHXA 2VG6B 1AFJA 2RVJA 3OFFA 2QRRA 3MF5A 2CQBA 5CD4H 1VQ61 2NVQI 3N5FA 4CC5A 4FBTA 1BQNB 5B0GA 5KFPA 1HWLA 3CPWR 2XG8A 2VBYA 4K5SA 4K5RA 4X4RA 1YJ9S 2R7TA 2P5VA 4OQJA 3CCM1 2F1FA 2RDIA 3RAMA 5KFOA 2ZH4A 2R7SA 1Y1WI 1NH7A 1Q7Y1 3IRXB 4HVZA 2C3PA 5BJRA 2XSFA 5AN9F 2BJDA 2QREB 3IBWA 3B82A 1X4HA 1XN9A 5JVHQ 1RNIA 5DISC 2HS0A 4E2YA 2WSFC 5U47A 1FKPA 2MKIA 3K7AI 2OFGX 2YX1A 3GTMI 4IG3A 4RU2A 2LMIA 4B9MA 2P3YA 3BGUA