3QWUA

Putative atp-dependent dna ligase from aquifex aeolicus.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
366
structure length
366
Chain Sequence
ISPELVKEALKKKKVRSEEAFGLEYLRFNDDYKDIPRGTAIFKDFIIWGYPHIGRIFLLETGLREQFEAPFWVEEKVDGYNTRIFKYGDNYYALSRGGFICPFTTDRLPDLIDLRILDENPDLVICAEVAGPENPYIEESPPYVKEDVQLFVFDFMKKNEQGFLSQEEKMELIEKYNLPHVEILGRFTASEEGIKKIKEILKRFNEEGREGVVFKEDSERNKRAKYITSYANLMDIKTNAKNMLQLPPEYYTNRILRLVLFMYEEGLKTTEHLYEELGRAFIDGLFQAIEQFEKEHKVYKTFTCKFRKKENAIALLELLSKTSKHIQVKERRLEKEGDYWRLEFDKVFLNMTGLLGHLLSGGIVYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Putative ATP-dependent DNA ligase from Aquifex aeolicus.
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 116
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18330 Lig_C Ligase Pab1020 C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.320 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3qwuA01
3.30.70.2160 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qwuA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3qwuA02
3TY8A 4E6NA 3W1BA 1TA8A 1CKMA 2OWOA 3BA8A 1CKNB 4EFEA 3QWUA 1TAEA 1XDNA 4CC5A 2HVQA 3RTXA 1V9PA 3GB8B 4UCSA 3TY9A 2HIXA 4UCOA 2Q2UA 5D1OB 4LH7A 3PN1A 3L2PA 5FPRA 3JSLA 3W5OA 2CFMA 1P8LA 3S24A 1X9NA 2HVSA 1S68A 3NBZB 1VS0A 2VUGA 3BA9A 2HIVA 4UCRA 1DGSA 3TY5A 5FPOA 1A0IA 3GDEA 4GLXA 3NBYB 3KYHC 1CKOA 5D1OA 4UCTA 4LH6A 2HVRA 4EEQA 3GJXB 1FVIA 4UCUA 4DRFA 1CKNA 3JSNA 4PZ8A 1B04A 1P16A 3RR5A 5D1PA 4UFZA 1XK5A 3BAAA 3VNNA 4EFBA 4EQ5A 4PZ6A 3UQ8A 3W1GA 5DISC 3BABA 4UCVA 2Q2TA 3NC0B 4CC6A 4PZ7A
chains in the Genus database with same CATH superfamily
1FRHA 3B6BA 3VPDA 3RW7A 3IWNC 2CJQA 2BKPA 4USMA 2NU7B 2XYPB 4MA0A 1JLCA 3L4BC 2M3DA 1N56A 3VQTA 2HLUA 5E3RA 4WYLA 3W5XA 3BEGB 3C2PA 1VQNS 1YWXA 3PKMA 3WC2A 1IYEA 1LFPA 1RLYA 3CB4A 5LM7E 5IT9U 4DR1F 2AGOA 3CMA1 4CWBA 3N6LA 3G8CA 3ADAC 1VQ9Z 5DM6Q 4FFPA 1QDUB 2DGQA 3O5TB 2MGZA 4DR6J 4USVA 3DCAA 4HKQA 2HIYA 1K44A 2CPIA 4HI1A 3WX8A 4DQNA 3NBYB 4LF5J 5BJRA 1CKOA 3AX6A 1E4EA 4OI6A 1Q8IA 2EXUA 1Z2NX 2M2BA 4X4TA 2IP4A 4EEQA 1UPMB 4HL9A 2HQDA 5DLFA 2AT1B 2GHWA 4ZIWA 1LWEA 1M5HA 3SGIA 1KWMA 2F8HA 2GQRA 3KLGB 3VVUA 2MKIA 3ISNC 1H7WA 4LRCA 4MKVA 3TW7A 2MKSA 3BH7B 2RQMA 4QW9A 3NC0B 3CWJA 1E4EB 4CL1A 3GV8B 2GHVC 3HFVA 2OOXB 3OR2B 3BO4A 2GPSA 2Q3PA 4PG4A 1X4BA 3MEDA 2QIFA 1SH3A 3G87A 2LEAA 2BKOA 1QAXA 1NMEB 3GP9A 4KGXB 1HNZJ 1PAUB 1NSPA 2JR6A 5D3GA 4Q0BA 2MKCA 1RBOB 1JLFB 3HFKA 4EG0A 3QJLA 4RW7B 3CNQP 4LF8F 1TR0A 3C8YA 3KLHA 4USWA 1FJGJ 3KMQA 4OHVA 4KO0A 4FPRA 4IWXA 1VQ91 3NGRA 1P27B 3IF8A 2I8EA 5KX5F 3H2VE 1QVGZ 4A8SA 1NO8A 4B9VA 2ERRA 2G2KA 1U1RA 4YB6A 3GFYA 3I6PA 1U49A 4A3KI 2PD1A 4YQWA 2PN1A 3MD3A 1FDBA 2PIIA 1JLBB 2MJUA 2AYGA 1KJJA 1HNWJ 2PBZA 4RU9A 3KLHB 2DE7A 2DH9A 4DOZA 4KO0B 3U1NA 3GKQA 2KN4A 4E0DA 3OLBA 4P10A 1UEVA 4BHQA 2VUMI 1RHKB 3WZ0A 4CO1A 2JRSA 4O0NA 3W62A 4GC7A 1KEKA 3NKYA 5F8MA 2HZAA 3BSOA 3RAQA 2J9GA 4RUHA 1MN7A 2V2QA 4IWYA 2DO4A 3KJVA 5ETRA 2IYIA 3GIMA 2NXJA 2V4QA 5KFJA 5RUBA 2YNHA 2W7AA 3ZZYA 2XYHB 2KVIA 4FS1A 1TWAI 4C8ZA 5H1SV 4WU2A 1YJRA 3VALA 3VZIA 5KFWA 4C5CA 3HSDA 2DRDA 4EMDA 2XY7A 1D9DA 5K3WA 4WBFA 2ZE2A 2PGCA 1ULRA 3WO0A 1BUXA 1DURA 5FLXY 2DCLA 3JSMA 1YRTA 3KALA 5CA5A 2P9GA 4WE1A 2X3GA 5C24B 3DDNA 3LGNA 2YNHB 3FCVA 3RYLA 1NK7A 4ZCKA 3CCM1 1SI9A 3T9FA 1DTQB 2Q6BA 2NYIA 2DGOA 4MAMA 2F4FA 2EJ3A 4NBAA 5HQMA 2ZE2B 4PYAA 4P75A 2OAUA 3CC71 4DR7F 1L5UA 2JFKA 3JSMB 3UCGA 1SQFA 2RQCA 1RTDB 4WE1B 2ZVSA 3UDEA 5B08A 4CH7A 3T9EA 2V67A 3JSBA 3R1LA 3CCQ1 1I2KA 4HEA9 5HMWA 4K6NA 4OI2A 1ZM3A 1JLEA 3Q0AA 3JSLA 2DNHA 2RDIA 4RPFA 3RRKA 5JXSA 1HNXF 2WB4A 1XNRF 3NNCA 3K89A 1RTZA 3S1NI 5BWUA 1B70B 3L7OA 3AQPA 2CWKA 1RHUB 2AGQA 5K2MA 4DQSA 2W7OA 4PZVA 1PBUA 2ZH7A 4DQYB 2B3TB 4MYTA 2FUG9 4DV0F 4KGZB 2HW3A 1KD11 2F9DA 2ZH4A 2R7OA 4WKRA 1U47A 3MPWA 3FGVA 3QGGA 1VQP1 1S59A 4FYVB 1JLEB 3KG1A 4FFOA 1JJ4A 1TFYA 3N6NA 4WFBQ 4F7VA 1WHWA 2CQGA 2XZDB 1NHVA 4EQ5A 2RDJA 2MZQA 4X4NA 3LP1B 2I3CA 2DXEA 2WAQD 2E2II 1IKVA 1H2UX 4CM2A 3D28A 1C4AA 2J9EA 1D09B 2LXFA 2KH9A 5IYZF 3B8HA 3NAHA 3DM2A 1WKLA 1VOMA 1DIKA 1IBMF 1MN9A 1Q861 3ETJA 3TAQA 4HNTA 4YJ3F 3D3CJ 1UJ6A 3AA8A 3ETMA 2AW0A 2QA2A 3C3LA 2CJXB 4MIAA 3DKDA 4X84A 2RSQA 2DE5A 2HMIA 4OYOA 4XYMB 2A1BA 3M05A 4O0IA 1S68A 2UVUA 3DLBA 2QSWA 3FK4A 1U1NA 1FD8A 1EARA 1HBMB 2G1DA 5ADZA 3IO1A 3MMCA 1AB8A 5C25B 2AZ1A 4J9RA 1AXQA 1FDIA 2E5JA 3NOCA 1FEHA 2OHDA 1PILA 3MHYA 3BBBA 1U24A 1FRLA 4QBUA 2HMIB 3Q2TC 1B6SA 4EBDA 4KQZA 2HHWA 4AD6A 4U95A 4PXCA 4NLSA 2Q6CA 4F26A 5F8HA 2BJOA 2IY5B 1VK8A 2DIKA 2KU7A 4K2JA 3T6BA 5BWXA 3MMCB 5E3AA 2NU9B 2VBYA 1X4DA 5KG1A 1NJYA 4WKYA 4ED4A 2HQIA 3GV5B 1Z2LA 2KI2A 4A8MP 4NZ6A 4X65J 1ACMB 2UZAA 4O7YA 1T9YA 2D3OR 5IT0A 2HWHA 1C0TA 4WZMA 5KFFA 4FNHA 5CHCB 4DR4F 3AB2B 2JMOA 3UN2A 4JB8B 1YIT1 2AYBA 2ZUAA 4YBZB 4B3SJ 2C28A 1Q821 2CPJA 4OI4A 3BA9A 3ORRA 3QT6A 2YKMA 1YVFA 2DNKA 1ZAUA 3CXCZ 2QN6B 4EU0A 4ECZA 1ZETA 2DGUA 1WJ2A 1Q81T 2QLXA 5BYBA 4DXLA 8ATCB 2DHGA 1K731 1FVIA 5CM0A 2HHVA 3H42A 1C0TB 5F0UA 2XZWA 2VQFF 2RF2A 5T67A 2CADA 3ETOA 4W4MA 4Y2IA 4CLFA 3JSRA 3J81Y 2VA2A 5T41A 2J9DA 2XMJA 1VC6A 4FBTA 2YX4A 1Q7LB 5FLMI 2DJWA 3CDUA 3PDNA 3WX4A 2QFJA 3H3VJ 3JQMA 5F8JA 2DZDA 2UUBF 2HSEB 1QYPA 3UCZP 1WC3A 2EC2A 2KG1A 3CCV1 4O4JF 1VQ7Z 1SPBP 2B9YA 2ZWPA 3FMBA 2Z57B 1XR5A 3QT5A 5ETNA 2QRDB 4IYQA 2YTCA 4WJBA 2BE2A 3GJTB 3F44A 1GX5A 5M2UA 2HGSA 2JX2A 3D68A 2DK2A 3D6HB 2RRNA 4I6YA 4ZPAA 5KT6A 4DLEA 2F4VF 5JVLA 4CZCA 2ROEA 2CJAA 3CDAA 1DV2A 1VDHA 3PHTA 2FPPB 3RUBL 1YRUA 1QSLA 3KLIA 1RGVA 8RUCA 3TEHB 2MHEA 4RW4A 5ETTA 2DXFA 2AGPA 2BV3A 3OR1A 5FDLB 4QYZJ 3TUJC 2Z4PA 2ZDGA 2MKJA 1JJ2Z 4UY85 2VIHA 4CCHA 2AJFE 1WDTA 3R7NB 1KT8A 3B82A 1W96A 1VLAA 4M8LA 2Y0BB 1KVIA 4ZOLF 3U0GA 4HLBA 1I7NA 3KLIB 4O4RA 4ECSA 4JI4J 3C6TA 1WOSA 3TUZC 2WB1A 2AEMA 2VFTA 4RW4B 1NSKL 1ZB9A 3K57A 1KJ9A 1WORA 4I64A 1OPIA 5JMNA 3RFCA 4C0OC 3OR1B 2FVQA 4OYIA 1M902 4OLPA 4RUAA 3TJ9A 1V3ZA 1BNCA 3AFGA 3NBPA 3DAAA 1VQ71 2J8AA 3HK2A 3BH6B 4C9DA 4YB1P 1LOUA 3LTOA 4Y7NI 1HYSA 3AOCA 3I4MI 2FD2A 2CNQA 5KFXA 2PDAA 2HZVA 2QX0A 2IA0A 3C6TB 4FYWB 3CD5A 4LQ3A 3NH5A 4EZ6A 1YJTA 2G2YA 2JNYA 2QL5B 1S6QB 2JIQA 5J2PA 4K59A 1WEYA 4P71A 3NBPB 4LH6A 2IBOA 3TUIC 2HS3A 3R8YA 4LFAF 1VRTA 1X9WA 2XYGB 4EO6A 3AB4B 4C8MA 1JXVA 4AYBA 2P9EA 3PX4A 4V19X 3HJFA 1S99A 1FKOA 1YZ6A 3FJ2A 1Y3JA 1QF8A 3TJ8A 3JAMY 4U96A 2DD8S 3N6RA 4XTTA 1KONA 1R8AA 1T9VA 2HGWA 2FZGB 2QLVB 5CXTA 2JNJA 3FSYA 3H8YA 1XMQJ 1QJHA 2EI5A 1VRTB 4QCLA 4IH5A 1KLMA 1V5VA 1WI8A 4WFZA 3OQ2A 5GMKa 2VODA 2J9DE 2YRXA 1T9TA 2MPUA 4DV1J 2F63A 1FKOB 3CCES 4TM5A 3E51A 2FLLA 2R7VA 4C3KA 3KNAA 1BQNA 5DDPC 2HBZB 1RAFB 2BQUA 1T02A 2DB1A 2RRBA 4B9MA 2RD5C 1Z2PX 2N3LA 1R0BG 1KLMB 3EYZA 3M4XA 4YFUA 3HB9A 1I50I 1K1QA 2L9NA 5F41A 1WF0A 1RTHA 1NHKL 4K7QA 2ZBQA 3MM5B 4EK2A 1FKAF 4XZ3B 2HBRB 1HQ2A 2EPIA 3IR7B 3SCKE 5I47A 3K59A 4MH8A 1APSA 1OMSA 3HM9A 1HBOA 4DV4J 1G2WA 2O1PA 5LMNJ 5AXNA 1A9NB 2Z02A 4N41A 2JIMA 2A2CA 4B3RJ 4DPTA 3E5NA 4QR2A 3PRVA 1D3WA 1RTHB 1X5PA 1XEZA 2K8GA 3NMAA 1CS4A 5CB4F 2ZBPA 4KHMA 1G1XA 1X4CA 9ATCB 2V4RA 3NG8A 1NKCA 1D9AA 4FBUA 4YDDB 4LF7F 2NU8B 3OV7A 3T3FA 2DVIA 3EXCX 4NLYA 2NXUA 1M1KT 1ET0A 2L08A 3CDWA 5C5JA 2MKHA 2R7RA 3U9SA 4HTIA 5JVHQ 4BCAA 2WZ1A 2KPIA 2V2KA 2MLXA 4LUBA 4MV9A 4FFRA 4J9SA 3SFGA 1CS4B 5HBRB 3PEJA 5HL7Q 4P2FA 1IKWA 3D6FB 4KC5A 3M8YA 3X3UA 2C42A 2M8HA 2LEBA 5HV6A 4K50A 1R0CB 3IRXA 3LULA 5A8KB 3JS9A 5DDOC 1WNEA 4F02A 1S97A 3SI8A 2ZZTA 5K8MA 5KT5A 2QA4S 4EEYA 4ZVFA 3PEHA 2B4OA 3H5SA 1OSCA 2EFVA 4HGYA 3EZOA 2FPGB 1TVRA 3JXOA 3AJ1A 2VOPA 3MEGB 2GIQA 1FTCA 5CAEB 4P73A 1DFDA 2W9CA 3IRXB 1VQSA 2HVDA 1N52B 5L46A 3BSNA 5H9FJ 1KQSY 4NYZA 5KTQA 3NP5A 3UZBA 3FBFA 4O86A 5K8PA 1EKRA 5A6WA 3RTVA 2Q43A 3LO3A 4I2PA 2QKDA 2RNEA 1Z01A 1VQ5Z 1TVRB 2LVWA 1MLAA 2A10A 1CULA 3NBZB 1RAIB 4NASA 1UA0A 3MPUB 2CQBA 2JLFA 4USIA 3AODA 4ZHQF 1Q7YT 3W8GA 2PEHA 5HSPA 5LXRA 1IR1A 1F2HA 4DN9A 1EETA 2F5GA 2K3KA 1SC4B 1NK8A 4JYAF 3NGDA 4CI0B 2BR0A 1RT2A 2IVYA 1GMWD 5I5YA 5ITHA 4EYHB 1VQKS 1EKSA 4JXUA 3WHIA 1Q79A 4RBUA 1FRMA 1FWPA 3FVYA 3VZHA 1I2LA 1KOOA 1KD1T 4OYPA 1PJ7A 5CA1F 3THTA 5B09A 1D1UA 3OTDA 1QVGR 3T54A 2JFDA 1REGX 1XBWA 4NEYA 1TUWA 2F7VA 4X4PA 3CIZA 4EWTA 3OW2Y 5C4JI 1EETB 1AYEA 3IGVA 2BBEA 3UFCX 3NL0A 4WP8A 3CO9A 1K1SA 3PJWA 3KMSA 1FO1A 3GIRA 1RT2B 1VQN1 1FWKA 1X4GA 4J9NA 1YDLA 1K47A 2O3DA 1GEHA 4GKJF 5L9XA 2YKAA 5KFOA 4Y2AA 3KLFB 1Q86T 2QC3A 5DGBA 3G6XA 3AD7C 5E3PA 3LWBA 4LRFA 1UETA 2K7KA 3E01A 2VQEF 2OLSA 2PMWA 3MMJA 2EIYA 1Y5NB 4C11A 2NUAB 1URNA 3KG4A 3DLHA 5B0EA 3DRPA 1YHQS 3KJNB 4F36A 3QAEA 2GAHC 1B0PA 5D1PA 4F67A 1IM4A 1X5SA 3WC0A 1IBCB 3DGPA 3PIOQ 4LF6J 4ATNA 1REVA 5D4OA 1NB7A 3LPYA 2IHR1 1MNEA 2R2UA 2PI5A 4JV1A 4J9LA 1VIXA 3NXZA 1UWBA 3THPA 4C11B 4OFZA 1XMBA 1ZAXA 4CDIA 1NP6A 1ROFA 3EXYA 4N47A 5DO2A 3TVKA 3MCMA 2OPPA 2B43A 2V2VA 2BJ9A 4KR0B 3KHLA 2ZC3A 5B0CA 4WWSA 4USUA 3UW1A 3DGPB 2VZ9A 5F8IA 3HKZA 4DBQA 1LWFB 2C22A 1MMDA 1RHMB 1HW9A 4NLWA 3M8QB 1N88A 4A3LI 2Y0SA 1KQKA 3R1HA 2BKNA 4Y3CA 2QL9B 1JLAA 5D8HB 1UWBB 3ZTSA 4KFBA 3PYGA 1IR0A 4RNNA 2VPYA 2EFQA 3FZ2A 2AJ1A 1HKAA 2ZVIA 1UVMA 3EGVA 3WNZA 4DUZF 3KYHC 1S9EA 2OPPB 3MM6A 1RA6A 2H3EB 2HVRA 3HHKA 3JYTA 3A4TA 4F04B 4X62J 1KEEA 4TVIA 4NBHA 2OP5A 3GFZA 5JVDF 3GSDA 4OJGA 4CHIA 7AT1B 4C6AA 4ZVOB 2KYXA 4UUWA 5LOVF 3C16A 1JLAB 2CZ9A 3ZFVA 2CQ1A 3PTWA 5LL6f 4KFBB 4LMZA 2VPYB 4H4MA 2VFSA 3BQ1A 3MFHA 2HK3A 1QY7A 3ELHA 3MWDA 3KTQA 2B7CB 3EPGA 3MF5A 3GCXP 4NLPA 2RMLA 3JYTB 1BWVA 4PKDB 4RJVA 3BG5A 1MWZA 2BZ2A 2OPRA 4NOHA 1SJFA 3RR7A 1VQLS 4DR2F 3HF5A 3T41A 5KFRA 5DGIA 2CDQA 3H2UB 3HHLD 3G6EZ 3C16B 2XMUA 4DV3J 3D1OA 2PI4A 1PJ5A 1RUSA 3QFWA 1UEUA 3WWJA 4BWMA 3I0RB 2OGUA 2NVYI 2DNNA 3CVKA 4E4TA 3PO5A 1NJI2 1LQ9A 2G0IA 2AU0A 1HQUA 2HPUA 3G4SS 4E32A 3V6JA 2QLFB 4YOEA 1YI2Z 4QPXA 4NMLA 1TTHB 1BLUA 1VBZA 5T64A 1NRKA 1Q95G 2ZEJA 3G86A 4HT5A 1HIYA 1CLFA 4DPXA 2OTLS 4ES1A 2VDIA 1OY9A 3MECA 5I5XA 3EGZA 1FA0A 3DLEA 2K2PA 4GO5X 1HQUB 1JLQB 4OX7A 2YVSA 1S48A 1X4AA 3TINA 5D15A 2DGTA 2XY6A 1U8WA 5CR5A 5IC4B 2EK6A 4NRTA 2JEGA 3NWRA 2YH1A 2JWNA 1Q4RA 3J7YI 3BKTA 2YS7A 3O8WA 2G1HA 3KAJA 1RTJB 3FBBA 1KJIA 1ZBTA 1RLCL 1C0UB 5C44I 2BOPA 1RISA 2VBWA 3FQLA 1WUUA 4NX9A 3MECB 1U1KA 3BGLA 4IG0A 1DRZA 4BY1I 2J6AA 5HNEA 2GO8A 2VQDA 4CKEA 1LV5A 2YQ3A 3T5HA 3NOGA 3BYPA 4LRBA 3BDPA 2PO4A 1IOWA 3CQZI 3TA0A 3GJRB 5ETSA 5EDWA 1SJ3P 4I7FA 3H25A 3MTJA 1O8BA 4E2XA 3QPIA 3U02A 2WONB 3MR7A 2ALYB 2I5JB 3HULA 2W71A 2CQDA 3IG1A 1YQHA 4CO4A 4A3MI 1NPRA 4MKYA 4P9SA 1YI21 3PYEA 2DR7A 4I50F 2YBVA 3BGFA 3FEXB 3CXCR 2MZJA 3FEYB 1KTAA 1U2CA 2A18A 3HOXI 2DABA 4WXOA 2HYIB 4NI2A 3JZFA 1T9WA 5L8RC 3SBMA 1JMTA 4TU7A 2YNGB 3ISZA 3JTNA 3I96A 2FJAB 2JIPA 5DDRC 4QSHA 4CLTA 2J0WA 2CZGA 3OUZA 3BBFA 1ULZA 3HD1A 3BSCA 2R7MA 2HVQA 2OSQA 3QMQA 5K14A 2DBBA 3RUPA 3T1YF 1G4CA 1M0WA 2YWFA 2GS8A 1U48A 1HR0F 3TQTA 5BMVF 3GCFA 1HWLA 3DC2A 3CE8A 2XMMA 4FF3A 4EYIB 2CVIA 3PO2I 1UA1A 4B9SA 1YIJZ 4X64J 1K0VA 4OIXA 5HANA 1HWKA 3V81A 4ZPVR 1S6PA 2XCAA 4DEZA 4M5NA 1KLNA 1N8R2 1WHVA 2IDLA 3E8OA 5FNVF 1J5EF 2HAFA 1TKXA 3KK3A 2HVHA 3PRDA 4ECQA 1MROA 3MPVA 1J5OA 1GH8A 5E3CA 4HTJA 4RW6A 1JIHA 1ZM4A 4IR1A 4M5MA 1CJUB 3I4PA 4HHJA 1CEZA 6AT1B 2W6NA 2GNKA 5EHHA 4ZVPB 4C4WA 3A8KA 4LF1A 4O3OA 4MV6A 1JJ2R 4WPAA 5CD4H 5L9NA 4TY8B 3ILJA 4ED5A 1HMVA 1VQMS 3OFHA 3RV4A 2OFGX 4ZP6A 2C2EA 2W1BA 2I6WA 1MROB 1IOVA 4Y2CA 1SKRA 2BANB 3FUYA 4RW6B 3F3FC 4YR3A 1S4EA 4QPTA 4X66F 3OL9A 3MUVP 2H54B 1UVNA 3EVOA 1VJWA 4HI2A 2H85A 1R31A 1FDDA 2ZNZA 2J6TA 3B4DA 4NZ0A 1WC0A 4N77A 2UXBJ 1L3UA 3HT0A 3T6JA 1HMVB 1DQ8A 2HQCA 3R3TA 2X1FA 1SCUB 3MZKB 2IAJA 2QJ3A 1YIJ1 4R0JA 3U7JA 1R3NA 2LU2A 3AXKA 7FD1A 3MAQA 4DQRA 1NJWA 3ETHA 1X5TA 1ZA2B 4DL5A 1B0TA 3RBDA 1CJTA 3AA9A 3FRYA 3CC4Z 1X4EA 3GFHA 3H7HB 5I3PA 5IQ6A 2R8IA 5L1IA 1T7PA 3K5PA 2EW9A 4JI6F 3CXCY 2VB6A 2IAJB 2P8IA 1Q822 4DR6F 1VQ4S 3SQOP 4CO2A 1Y5LB 1EX8A 2KKHA 3AW8A 3F56A 3T9CA 3RTXA 2I38A 3M9NB 4ID5A 3L7PA 3CCSZ 2BEFA 2ZAEB 5JQWA 5D0RA 4V1Ak 2LDYA 1K732 4ZKAA 1BD6A 3CULA 2HHFA 2HBYB 5E7OB 2WVBA 3R7SB 5IWAJ 2KB2A 2QF7A 4JI8J 2K3IA 2Y8YA 4IRDA 2MXYA 1FFSB 1S7IA 5D1OA 2DR8A 4HYKA 5LSOA 3UD3P 4P74A 1BQMB 2ZKUA 5E25A 4ME6A 4C8LA 3CCRZ 2ILZA 4M5LA 1KHVA 2ZHBA 4ED3A 3GYXB 4DFJA 3ENWA 1O6XA 2HHFB 3SDEA 2GGPA 1HNZF 3KAKA 1F3VA 5LSLA 3TUPA 4X4VA 4CH0S 2JVOA 3KUHA 4S1TA 1N33J 4Y34A 3GU0A 1BMQB 1FFWB 4ZLLA 1KC7A 1RAEB 3M9OB 1CKMA 3SNOA 2VHGA 2R84A 1SL0A 5A8RA 4R5PA 2B5JA 1SVDA 2OOYB 1UKUA 3CC41 2ZH9A 2B4PA 3KDOA 2CPEA 1TWFI 4KY3A 1U1OA 2UXCJ 1GSOA 4ERDA 4ZJQA 3VF0B 3SDEB 2GGPB 5F0WA 2CQ0A 4ZN1A 1R89A 1RAHB 4LF9F 4CO5A 2D1CA 2BJEA 1VQ8S 3Q8PB 3PW0A 1IR2A 5A8RB 4R5PB 1HNWF 2K7JA 3RJMB 2KRBA 2FB9A 3U27A 2B63I 2HDKA 2JA6I 3UNGC 4DLKA 4KE5A 2GC8A 4DCOB 2V69A 4CT8A 3BYRA 1S4FA 2YWWA 2ODTX 3HKWA 3R5XA 3AD8C 1NKBA 3FKII 2VG5A 3TZXA 3KHGA 4P6QA 3ORQA 4LF4J 2B51A 2YWKA 3GJQB 1WELA 4ZOSA 2I1RA 3CCR1 4WP3A 5GMEA 4WTOB 3VAHA 3DDIA 1TWCI 3NLCA 1TU0B 2FZKB 4A3FI 2ZZMA 1PYOB 4Q2LA 3RBZA 4JV5F 2VG5B 2LU1A 2DHAA 2POKA 1R6YA 1OJ4A 4OJHA 4A3GI 3TX8A 4MMOA 1HI0P 1O51A 2HIXA 1RNIA 4LH7A 3CT9A 4LFCF 2J9CA 1AW0A 4C48A 2IV2X 3VAGA 3UD4P 5F9NA 1RWMB 1VS0A 1WOOA 1QXFA 2MJNA 3KG0A 1WWHA 5FPOA 1WACA 1BXRA 2E29A 4L75A 4TY9A 3CJ4A 4J7CA 2CPDA 3JQJA 4GVBA 4M5KA 2O66A 3TYTA 2OFHX 1PSDA 3CUNA 4E31A 5K9FA 3H5XA 3GJXB 2C3PA 4YB8B 4DRFA 2RE1A 3HVRA 3PKYA 3PG9A 4JI0J 2VJVA 2U1AA 4XX0B 1S72Z 4ID8A 2CUYA 1M1HA 2QA1A 1RU2A 5B0GA 2GCFA 2OMLA 1IQTA 2C3YA 1M0SA 4WIQA 3G2XA 1TL1A 2BA9A 2K3RA 3ZTOA 3BABA 4ZPTR 3H90A 4BDPA 2PFDA 4GVBB 3R97A 1U45A 3CDBA 3NNHA 2GLTA 3TO8A 3MCNA 5HLFB 1W2BZ 1S0NA 5HMXA 4NYPA 1AT1B 4MFBA 3OFGA 1Z03A 1FKPA 3C15B 1CJVA 1NB2A 3VGVA 1X7VA 3DYAA 1TL1B 3MM8B 2NREA 2UXDJ 3S8SA 3W5OA 1H3DA 1OQ3A 3QRPA 3VA7A 2VPXB 4MAKA 1OYEA 3P5TL 2ATLA 2FJVA 1X3WA 1RZMA 4ER8A 3LAKA 2W25A 2QSFA 4DZ6A 1N36F 5CZVA 2CJBA 1PAEX 4MFBB 3LOUA 5HJYA 1FKPB 1BC6A 1CJVB 5IP7I 4BBRI 4WU3A 4I55F 3DYAB 4O4LF 5LSRA 2XS7A 4URGA 3CDEA 2QA41 1SJQA 5BYQA 4MIBA 1KNZA 3HVWA 4M95A 4XDDA 5D77A 2EFPA 2B56A 2HFNA 1A7GE 2DLNA 4K0KF 3M4OI 1RHRB 2EFOA 2UUWA 3UWTA 3RG6A 1FVSA 3W7BA 1I51B 1HQEB 4ECTA 3MWEA 1MWYA 5M2PA 1V9PA 4ZPWR 2M48A 5ETPA 2E2JI 3RB6A 3H98A 4H4KC 2A2DA 3RBXA 1CQMA 1HHTP 2OSRA 3SV3A 4LR7A 5HJXA 4ZCLA 4DUYF 2BABA 2RS8A 1M5OC 2HRYA 1YHQZ 1RJJA 4ZITA 1Q16A 4A8FA 3DRRA 2MQPA 2RDDA 3DLJA 2ZBCA 2FHJA 4ZLJA 3IWLA 1TAUA 3SCIE 4DAAA 4IH7A 4DS4A 3T1HJ 1C3OA 1ZB8A 2P3YA 3Q86A 4J91A 4LSZB 1WSRA 2JZ5A 4NLQA 1T03A 2R3VA 1B04A 2I87A 3W60A 4O4IF 2K1RB 1FXLA 3QLHA 1VQK1 2LA6A 1J27A 1T9XA 2ABYA 3TAMA 5BYAA 4J9PA 4FDFA 3IAM9 3BQ2A 3IC1A 3VAMA 1S0VA 3T9NA 2D69A 3CTRA 5IC6B 5KFQA 4FYYB 1R9TI 2AJ0A 4DV7F 4G6VB 1WF1A 4B3SF 3IGNA 4ANEA 1Y11A 3TW6A 1LW0A 3E3XA 3N4WA 3D6WA 2AYDA 3HOVI 5I5VA 4G65A 4O44A 1P8GA 3CMEZ 4C7QA 3QLHB 4AE5A 7FDRA 1GFWB 1OPZA 3DRSA 3HBLA 1SBRA 4DL7A 3TAMB 2CQHA 2QG9B 1E6YB 3ZZ0A 2WHOA 3BO3A 4NE9C 1IXKA 3BDEA 3LUYA 1KP6A 3QT7A 2GQSA 3ZO7A 4KH0B 3S2HI 1JXLA 4QYRA 3PW7A 5I3UA 1U4BA 3AD9C 3BZQA 1LW0B 2IPOB 2QYGA 3R5DA 1Y8CA 1EHWA 2R7LA 2OEKA 1YHQ1 2IFXA 1S5ZA 3JSNA 1FESA 1U09A 3DRSB 3GCWP 2V8IA 4OX9J 4R8UA 2XMKA 1A9XA 5C7PA 1TP7A 1BXNA 1FRKA 1DBDA 4KHRA 5I3UB 3K8VA 3GTLI 1DL6A 4AYBD 2RRAA 2R7KA 3OT9A 3SEOA 2ZGIA 3NH8A 4URQU 3MM9A 4RUCA 3Q23A 1N5QA 4YEAA 3GTOI 1SCJB 3RZDI 1IM6A 2XBPA 4Q7AA 3UN5A 1EJ7L 4QQBA 2CZ4A 2HNDA 4OZ3A 1I1KA 2ZD1B 2VBZA 3M2RA 3QATA 4LFBF 4DL3A 1JLLB 3GIIA 3J7A4 2NVXI 1VR6A 3HZEA 2ZFHA 2I9SA 3IFEA 1WC1A 4X4UA 1SXLA 1X9NA 5F3ZA 4E33A 4ZVEA 1R27B 3MM9B 3KHHA 2R42A 1C1BA 3R5HA 2E7ZA 3I5BA 5LJ5Y 4FFLA 4A8XA 1KC8T 1FNOA 4DUTA 2HNDB 1FI4A 4DQQA 1TL3A 3RRGA 1PFTA 1I94J 1WW9A 1P6TA 1S1XA 4JI4F 1NH8A 2AJ4A 2HQFA 3R2DJ 4WZQA 4RCNA 4IFVA 3RB3A 1TK8A 4NLGA 5BXIA 2XSJA 2OTJZ 2B0GA 1UW9A 5K8NA 3W1GA 1C1BB 1BGXT 4DWIA 4OJ3A 4BLGA 1RABB 4I6WA 1RT3A 2Y1IA 1AUDA 4HDGA 1TL3B 1HNXJ 1XNRJ 1S1XB 2VD3A 2IRXA 2RHQB 1RT4B 3M8PA 1ZM2A 2E7VA 4CLZA 3G71S 2HF1A 1S1VA 6FD1A 2HNYA 3LP8A 4PAAA 5DS7A 4IFVB 3CPWZ 1VQL1 1LFWA 4Q2MA 4DV0J 1U6FA 4ED6A 4B3OA 4KPYA 1M1K2 5DETA 4RWXA 2QEXS 2A3JA 5F8GA 1ZH5A 1P8LA 1JLGB 1RT3B 3RV3A 1VFJA 3OBIA 4I67A 4KGMA 3Q8RB 1UZHA 1VBKA 3LANA 4B3TF 3M8PB 4DSLA 1S1VB 3G6YA 2HNYB 5IZHA 1QTNB 4IOBA 2AX0A 4RVDA 2LA4A 3T9AA 3MURP 1XMQF 4B3OB 2VFRA 1KSPA 4KAIA 8AT1B 1K9M2 3FDSA 4DU8A 2R82A 2KFYA 3CJKA 5CAAA 2WTFA 4I2QA 4DV1F 2YWEA 4PABA 4JI7J 3ENAA 3GIDA 3GR0A 3VAFA 2OO4A 2IM1A 3D2LA 5D4NA 2G0JA 2CQCA 4WF9Q 2NSBA 3FSIA 2YWHA 1YJ7A 2XWXA 4Z37A 3CC2S 1Y3KA 2OPSA 1NKEA 5U47A 2VFVA 2CJ9A 3GQCA 1F5BA 2QR1B 2LEPA 1T8EA 3SCLE 3CJKB 2BVZA 1HD1A 2YL2A 4ZCMA 1EB0A 4I2QB 1JQGA 1T3OA 3MTKA 4DX7A 4AXIA 2R8KA 2C2MB 5IFMA 2HFZA 4UTGA 4K4TA 3EGWB 2E9TA 3T5LA 2VUGA 3TOQA 1FE0A 2OPSB 5JQGF 2Z04A 2I8CA 2NXNA 4DV4F 4GLWA 3JQKA 5LMNF 3S1RI 3M32B 2VF1A 4NWBA 4B3RF 4OYAA 1S57A 1EKVA 2AQ4A 3G82A 3PYDA 4CM0A 2YX7A 4FKYA 4OI3A 2FC9A 1AZSA 4M5JA 2DEJA 3TP2A 4WXWA 2V8GA 1KR4A 3BAAA 3PFOA 3K7AI 2KZMA 5J2QA 1FDAA 2OD6A 4DS5A 4UZCA 5KT3A 5DISC 4PPDA 3GSIA 4TNUA 3CMAZ 2ZJRQ 1GLVA 5CE8A 3BGRB 1Y0HA 4C8OA 1RWWB 3O3LA 4FXVA 3QNWB 2EFGA 1VQ6Z 2CNKB 2ZJPQ 4YJ2F 2M70A 3HO8A 4DSJA 3G82B 1IQZA 2XS5A 3CSKA 2CVEA 2ZH5A 1F9FA 3U1LA 1Q78A 3OL6A 4DX8H 4ZP7A 1AZSB 2ALZA 1G6BA 1R43A 4CTAA 3ZTRA 2ACMA 1OY8A 2MY7A 4KHPJ 2CNOB 2QE5A 1SFOI 4UOFA 3LA0A 2C3OA 3HSGA 5IOLA 5IT9Y 4IFYB 1DTTB 3TQEA 1XK8A 1VS3A 1PKUA 3VMIA 4GKKF 1ZYQA 3K5MA 2A6OA 3FSXA 3NEKA 2LLZA 4UY8T 2NSCA 4IOAQ 3NH4A 3C46A 4DPYA 2L9DA 3QAUA 2UUBJ 1UVJA 1RLDA 4HNUA 1HWJA 3SIPB 3S7RA 1Y00A 1ZPVA 1X9MA 2XCPA 3J80Y 4ZP8A 2FPIB 3K5LA 1R8PA 2W24A 2DKOB 3RBEA 3NS6A 4IHJF 2B7BB 4IOCQ 2F4VJ 1VRUA 3D2WA 3LF0A 2A1HA 2L41A 5ETQA 3GIKA 3I55Z 2H5IB 1LW2A 2PFFB 1S6OA 1S10A 3M8RA 1X0FA 2DGVA 5LXYA 3KLGA 2CNLB 4FZVA 4HH0A 2PA3A 1KN6A 4ZVGA 3D66A 2QMWA 2YKPA 2UV8A 4OHXA 4KT0C 1VQ61 4CC5A 1Y9OA 2VV5A 5LXTF 2YKOA 1WC6A 1FX2A 2BW7A 4NLVA 5T6BA 4HT7A 5AE2A 1RSCA 1WOPA 1U6ZA 2RU3A 1NDPA 2AEJA 1VGYA 4S0MA 2BJ8A 3FEZA 1F3FA 2EBGA 4C3LA 3OR2A 4NLUA 1VRUB 5LL6d 4LIWA 5C4XI 2LXUA 1I5OB 4UQGA 1LW2B 3WO1A 3EUNA 1FNMA 1UPPA 2DPJA 4JBCA 2ZDOA 2F4MA 1H74A 1TMJA 2HG8A 2LMIA 4RNHA 1JLFA 2E1AA 4RW7A 1HNIB 4M63A 3UR0A 3TIGA 1AA1B 4RKUC 2VONA 4DV6F 2DGXA 3PRBA 4DN0A 1VQ9S 1WG1A 1WTFA 2FZCB 3PVXA 1FJ7A 2W4DA 3Q24A 2Z2LA 5HVGA 4PXBA 5DGHA 4M5HA 2GA7A 5B0AA 2ZJQQ 4X2BA 3T5JA 1JNZB 4NCGA 2R7XA 4LIRA 2C2OB 1VQ41 1JLBA 2GHPA 3HOZI 2H5EA 3AH6A 4QZVB 3ZC4A 2O53A 2BUNA 2AF6A 4U7UD 3I551 1HWIA 1KUTA 4UUXA 2X1BA 5B0BA 4RS4A 4TVAB 4P2SA 4NH1C 3MAHA 1GSAA 1CSJA 4BC9A 3OHAA 2Q79A 4IO1A 3H40A 3HT3A 4NCGB 3CCMZ 2GV1A 1GXTA 4ECWA 1F0XA 2R7NA 3CEBA 1NJI1 1R8CA 2NCKL 4NBDA 2GIRA 1QUVA 1SL2A 4PG5A 3OL7A 2LQBA 3CC7Z 2OEJA 4B9NA 1QVFZ 2HRUA 1N54B 2J0SD 4DV2J 2JEJA 2V8JA 3S17I 5KFSA 3CCQZ 3DLKB 3UFXB 2ZM6J 3DHWC 1HPZA 1XJWB 2HGLA 3HZGA 1I1LA 1P1LA 2PN6A 1B99A 4YUDA 2BMBA 1WDDA 3MOJB 5SZTA 3A3OB 5HAOA 5C24A 2IJFA 5KG4A 4G1QA 2GX8A 3NGUA 4OZJA 1S1WB 2HNZB 1R7IA 1FE4A 3I4HX 2DNPA 1NSAA 3OHBA 3BM7A 5ETOA 5KT7A 2VG6A 3BB5A 2Q7DA 1VQPZ 1DTQA 4HR7A 4X62F 2EJ0A 1ZTWA 4KKOA 5E41A 3AJ2A 1HPZB 5GADU 1VQ81 2AWZA 3FMWA 1M90T 4A4JA 4OV6A 1W2BR 2WVDA 4MKBA 5GAEU 1RTDA 3ILIA 4WFYA 3HFZB 3GTYX 4J9MA 4G1QB 3CD7A 3DU5A 1GQEA 4USJC 1D8YA 4NBGA 2G13A 2H48B 3T99A 2VG6B 4JV2A 1AUSL 2L48A 1CS0A 4ANDA 3JB9k 2GJIA 4TNOA 4KKOB 1ML8A 2NVQI 2VL1A 1PYTA 2Z8QA 3VTNA 3UVJA 2C2DA 1PJ6A 4F4KA 1F6TA 5LYJF 2V9KA 1F9HA 5CZXA 1K8AT 4XAKA 3R5AA 3UDCA 4DFKA 3MEKA 2HU9A 5DDQC 4EI2A 1D9FA 4IG3B 2P6TA 4N7TA 3UR3C 2Z2YB 5KFLA 4PG8A 4MXUA 2Z30B 2PE8A 1VC0A 5GVQA 3LP1A 2WRMA 3BKUA 2CQ2A 3V4MA 3GG1A 3UVJB 5I42B 4QWAA 3DMJA 4CMDA 1Z2OX 2ZKTA 3SZ2A 2W7PA 1VYAA 1VK3A 3FZBA 3QIPA 1N5YB 2LCWA 2V34A 1YJ9Z 4HACA 5A2Qf 1WG5A 3AOBA 4LSNA 4C3MA 1Y1WI 4FGRA 3TA1A 4P7VA 3GZ7A 5THWA 1KVKA 2KG0A 3R5JB 2V6AA 1NH7A 4KGVB 1JK9B 4AXJA 1N8R1 3DMJB 3JSYA 3LAMA 5GAHU 2FPHX 2HGMA 2DYAA 3GONA 1HBMA 3QIPB 4FE2A 2J6SA 4FNIA 2XI3A 5C25A 2HVZA 4HACB 1NCLA 4JI5F 3S6EA 5SUHA 1RHJB 4LSNB 3BGOP 2X0SA 2EVZA 4QU6A 3R5FA 3Q89A 3GTPI 3CCLZ 1MW7A 1YITZ 2ZUGA 4N5SA 1S9GA 3SV4A 1H0HB 1FRXA 3VMMA 1TZ0A 3J80f 2GMLA 3TIIA 3GG0A 4IKAA 1IKYA 2GQQA 1U0HA 4F50A 4EUVA 3QZ8A 3J81b 4Z7CA 2YPYA 4UCOA 1Y4ZB 4YR2A 1UZDA 5KFZA 2HRTA 3NNAA 4NZ7A 2EG2A 1T11A 4NXMF 5HATA 1P9NA 2RHSB 3S01A 3TE5B 4TV8F 4M5DA 1S9GB 3GYGA 1ZPWX 1HLWA 2ZH3A 3ISND 5F8LA 3DLLQ 3US5A 3TWZA 3TQ1A 4HHHA 3D6MB 3OPKA 3GTJI 3GILA 1QUPA 1S12A 5KFBA 1YJ91 1IKYB 3FC9A 5AXKA 3D6TB 3CCVZ 1U0HB 1Z4UA 4NXNF 4TXSA 2MQQA 4K4SA 3AT1B 4G1IA 1NM2A 1UEKA 1W2BY 2XNRA 2CQ4A 1TKTA 5HN0A 3BN4A 1WKJA 2W6OA 4NRUA 3UO0A 2GMJA 2G9OA 2V45A 4M5DB 2Y1JA 2XEXA 1SC1B 4FYXB 1YKWA 3W64A 3M6WA 1OO0B 3O6QA 2ILYA 4GKJJ 2ZH2A 2YRWA 2V2ZA 1ZZNA 4PWWA 2BX6A 1YBTA 4LRAA 4C8YA 1RCOB 2MKKA 3CCL1 2CYYA 1N5VA 2QO3A 1TKTB 3NDIA 2VG7A 4X64F 4DSFA 5F8NA 3CJ0A 4Y28C 3KFWX 4PWDA 1LNQA 3TDHB 1RAGB 3W1YC 4X4OA 2DR9A 2DR6A 2YWGA 4MK9A 3P45B 3CJ3A 2RVJA 2JJ4D 1VLYA 3CJQA 3RZOI 2DWCA 1SIZA 2QLBB 3EVMA 3OJUA 1NLKL 1KOHA 2MZTA 5EZYF 2R93I 4U67Q 2MKYA 1U1LA 3QGPA 2CRLA 1HBNB 1N34F 2QL7B 4Q44A 2ROGA 2VG7B 4OHYA 3T5KA 4PWDB 4DSIA 4O4HF 4O2BF 3KDNA 5KT4A 4Q8EA 1RE1B 1TKDA 4K4VA 2M6NA 4UOHA 4PXEA 4KGKA 2HQGA 3HI9A 4NZNA 4XDCA 1YJWZ 2BQ3A 5FDLA 3HXMA 4Q45A 3RB4A 3EDRB 3IBWA 4YAJB 4YY3F 2R85A 4DG1A 5BYSA 4EBEA 5M2RA 2OPQB 4ED1A 1TAEA 4B9UA 4RVGA 3D9BA 4HQ6A 2FLOA 1EZZB 1GAOA 4DR5J 4L72B 2IVMA 3BREA 2C00A 3LWMA 3TAPA 2JHEA 4L74A 5LT5A 4CYUA 3Q1KA 2KTQA 2KM8C 4OLOA 3QIDA 1Z2ZA 2B6AA 3CF5Q 4PPZA 4ZI7F 2MYFA 1DGSA 4PG7A 1VQ7S 4DG1B 3NWGA 1LXNA 1SKUB 3POTA 2P6SA 5FLXf 5HQ8A 2GVZA 5I5WA 5I3QA 2OI2A 2WSFC 1TK5A 4HH4A 4CYUB 1U02A 1S9FA 1CQNA 3W9IA 3V6HA 2RIJA 1ZOTA 2CPZA 2B6AB 1S6QA 3ONQA 3ZTPA 3G71Z 2NU6B 2IA6A 2OJ3A 5D0EA 3W63A 4K2XA 3BF4A 3HP6A 2E9HA 3KUGA 3CCTA 3Q2SC 3W1BA 4NZMA 1AFJA 3POTB 4DL6A 1YJW1 9RUBA 2GVZB 3Q83A 3N5BA 1SB6A 5KT2A 2GU2A 1T05A 2PK7A 3MXHP 5HQLA 2G2OA 1RAAB 2HQ3A 2C3MA 4O7NA 3EZ5A 4ILLA 3OTBA 2XSFA 5B0FA 4G3IA 4ZVQB 4FXDA 4R25A 2LQ5A 2C2RA 3PYFA 1UW4A 3GJSB 1XMOF 3OXFA 1G7CB 2IRYA 1TL7A 1N33F 1KVJA 1J2VA 1S1UA 2X7IA 5LOQA 2RT9A 2HFUA 1WCMI 1T05B 2DHHA 4HHUA 5K20B 2DY9A 4ZPCA 2ZHAA 1KQSR 4DL2A 3CCJZ 1PO6A 1M5KC 2CQIA 4YN3B 4WFAQ 3UPFA 4NLOA 4F0MA 3I12A 4MK8A 1RQFA 1NUIA 2ZZNA 4DDFA 1OY6A 2NZ4A 2UXCF 3D1HA 5AJ3J 2MZSA 4IQXA 1FCAA 1PBAA 4UCVA 1EP4B 4PG6A 3GFXA 1RO2A 3MM5A 1RT1A 1TL7B 1S1UB 2MSSA 3VGSA 2IM2A 1L3VA 3IR7A 2JC0A 4EGJA 2HHUA 3G711 2DNQA 2XULA 1YLXA 2RUGA 4JP8A 3EEDA 1UJ5A 5DG9A 1RAJA 2ZITA 4A3JI 4ZVHA 2H9ZA 4J90A 2DRBA 3GB8B 4ZQIA 5KAKA 2VOOA 4JV0A 1UFWA 2DY1A 5J2NB 1G3OA 1ZAWA 1GGOA 5LMUJ 3D7SB 2XG8A 1RT1B 2BJ7A 3AOAA 4LF4F 1N4LA 1GNKA 2RILA 2VKRA 2NXEA 2HFOA 4O3QA 2KFZA 1BHNA 4IZOA 3S16I 3OW2R 2CNUA 1Q811 4JI3F 4UCTA 4OZNA 1VQOZ 3KLEB 2WBRA 3HHLB 5EWGA 4PCQA 3CPWY 2R8GA 1FRJA 4OZ0A 2WW8A 5BPFA 2F8EX 5BWWA 1NJIT 3ET6B 1Q8KA 3CCJ1 2R2RA 1NHUA 3H0GI 3T1YJ 1UJ4A 1NXIA 1SJ4P 3MI7X 3I56Z 5A8KA 2FHKA 1HR0J 2PMZD 2H51B 1WKKA 2COGA 2N4CA 4K4UA 2V59A 3NCPA 4KPCA 4P2MA 2GIFA 3PZPA 3C66A 3GLJA 3RU0A 4CE5A 1JJHA 2WOMA 3R7BB 1H73A 5KFEA 1TV6A 2BXJA 2M4MA 2YQ0A 3LP2A 1KJQA 3MEGA 1I3OB 2GVDB 4ES3A 2YZLA 2R86A 4JI0F 5HVFA 4DIMA 1S6UA 4A48A 2BE9B 3PJXA 4BXXI 2CAJA 3W8PA 1UFLA 2WOMB 1WF2A 2ZDHA 1G2EA 1TV6B 4DV5F 3IM9A 2J6UA 2RH3A 1S7HA 3LP2B 1FDNA 2OIHA 4ILRA 2QA4G 5J1EB 3MFIA 2CDRB 1VQNZ 4H4KA 2V8DA 2FHJD 2WK4A 3J81f 1VQO1 5L1KA 3SE7A 4FYDA 3IM8A 2E1CA 3S14I 2DXDA 1IWAA 2AV5A 3P5BP 3I9V9 4ZS6A 3SXLA 4AQYF 4NBEA 5F9LA 2GTHA 4J9VA 1Y7PA 2ZOGA 5BWRA 4K8RA 2LQ9A 1T36A 1TQLA 1X5OA 4M94A 3DF7A 2E5IA 3K5IA 1NNDA 1U8SA 3I561 3PO4A 1N2FA 1UVIA 1N6QB 2XNQA 1M1GA 4E2WA 2FJDB 2EGTA 1HHSA 2XD4A 5A2QU 3MAAA 1GSHA 1KFDA 3KK1A 1FTRA 5BR8F 2FB0A 3TARA 1U7LA 4F2SA 1JDBB 2JUBA 4ZDNA 1RA7A 1NZAA 3KLFA 4JI6J 2KT5A 1RWNB 4ED0A 4URSA 4DF4A 3BPDA 1GTHA 1JLCB 2QRCB 2GZOA 1VQ5S 2R7ZI 4FFMA 3MAAB 2R7SA 5MAOA 1RYSA 4A3EI 5DQHA 4TQSA 3PJ9A 4LVNP 3KK1B 5A0YA 2FLNA 2FTRA 1X31C 1N48A 3AHPA 5J2TF 3J80U 1N8RT 5HO4A 5DM7Q 2F4OA 3PX6A 5DZ7A 1QVFR 3E2EA 4DU7A 5B0DA 2MGZB 5AE3A 3PFEA 4TLRA 3TRGA 4NA2A 2R2TA 3CCZA 1HW8A 1RWOB 3T1HF 4DPWA 5A0YB 5JJBA 4QJVA 4C5BA 3Q8QB 1S1TA 2HAIA 1RKIA 4PQUA 1VI7A 2HHXA 1NEEA 5FJ4A 4H54A 1LWEB 1UL3A 4JI2F 2E1MC 1LQLA 4MV7A 4K4XA 4I6AA 1KC82 4OJ1A 5E33A 6FDRA 2WW4A 1A0IA 2GQCA 4PR6A 2JIOA 1WC4A 4KBIA 4C2MA 3CJ2A 5DQGA 4W92B 3DTFA 4MT1A 1LWFA 3PIPQ 3M8QA 1Y1VI 4ZLPA 2UUTA 2BM1A 4MYUA 3BGUA 1C1CA 2MLYA 1DQ9A 4P7TA 1YJNS 2QMXA 1T9UA 2PSZA 2QLJB 3LW5C 1S1TB 3QJJA 3FCWA 2RHBA 3BN7A 4O3RA 4PQUB 4IDKA 3J7Z5 4A8OA 3KJQB 3MEDB 2V3VA 4XYLB 3JAMf 4DFMA 2YQ1A 3A3NB 4HDHA 5D0GA 5KKNB 3PFFA 3H5UA 4CC6A 4LF9J 3S1QI 5K8OA 5D3GB 2EEYA 4Q0BB 1NBEB 4NA3A 3VMGA 4QR1A 3ZNUA 5E5NA 4KSEB 4XO0A 3U9TA 3KXDA 2RIQA 2RJZA 2UU9J 1C1CB 2LEXA 1S79A 2W03A 3DOMA 3WDOA 5D0HA 4IDKB 1WTBA 2FVRA 3NAIA 1N32F 3VMHA 2X1GA 1NDKA 2YW2A 4FKXA 5GAGI 3OSNA 4QYZK 1NK0A 2B4UA 1RT6A 3VWSA 1M1K1 4OX9F 5B7WA 2VICA 4ZJLA 2V5HG 3PV8A 1RDRA 3R5BA 2JLEA 1C4CA 4I0WA 2CPXA 4RL1A 1Q82T 1JDEA 3T9BA 2RT3A 2YS6A 2VASA 3MPDA 3PO3I 1TAQA 3EZUA 3BO2A 2QMUB 3D9XA 5L39A 5KG7A 3LH2S 1XTZA 3DOMB 2MSTA 1K73T 3HVAA 3FQKA 3OD2A 3I0RA 3GTMI 3SSQA 5LJ3Y 4F4YA 1RT6B 3MDFA 4JV5J 1K9M1 5AXLA 1WIIA 3UQ8A 2EFNA 1S7MA 2NPIA 4HVZA 3IMQJ 2W4CA 2FHMA 3R5GA 1RWPB 4LFCJ 1ICEB 2JSXA 3RB0A 3KJVB 3CJ8A 4PZ7A 1KQGB 1GT8A 1O5JA 4TU9A 3Q87A 2KHDA 2NPFA 5T14A 4I69A 1FRIA 1SQGA 2KT3A 1MMLA 1YUAA 4Y65A 2FC8A 3W3SA 4OX8A 1XR6A 2ADBA 4TYBA 1I94F 1QVFY 4KIAA 1SUQA 1UMJA 1JLQA 5IQQA 3DFEA 3L2PA 4TYAA 5BPHA 2FJWA 1OSDA 4U7UK 4DI6A 2R8JA 3NGTA 1PGZA 2G2ZA 3DGVA 3T19A 3DNCA 4USTA 2D3UA 3OTOF 3JRXA 5EGYA 2DGWA 3N79A 4USHA 3CGIA 1B6RA 4UCRA 1RTJA 2DNOA 5HMYA 2HWIA 1C0UA 1Q7Y1 1SL1A 1EUCB 4LR9A 2H1YA 5FLXU 4USKA 1IYDA 1IUJA 4F25A 3KKFA 2XY5A 1SUQB 5HMZA 3IA0A 3G6ES 3OL8A 2N4DA 1RXOB 5DRKA 1M6VA 2CPYA 3GLKA 2BQRA 1KFSA 1IBLJ 1RBLA 2LKZA 3A8EA 5KFAA 1OWXA 3AQOA 2NS1B 2AYEA 1SH2A 2MQMA 5A76A 2X51A 2MQ8A 1UWAA 4PRFA 4ENOA 2WONA 4DJBA 2I5JA 3FQQA 3PHEA 1PK8A 2CJYB 1HHQA 1KHWA 2XGQA 3ZTQA 1YI2S 2YWVA 5D78A 3SCJE 2CKWA 4ITSA 4F2RA 1TUGB 4N8OA 1AROP 3PW5A 4EGLA 1AFIA 3LQSA 3BR8A 1N36J 4QIEA 4L73A 2YNGA 3IBCB 1SJRA 2BE7D 3GTGI 2RUSA 4OL8A 1XR7A 4MH4A 4NOZA 1PCAA 4B08A 5AN9F 2OZKA 4M5IA 5DAAA 4A3DI 2ASDA 5EN1A 1S0MA 2YNIA 2QLWA 5A6PA 2RU9A 2ZNYA 2CJKA 4FXWA 3ESWA 4JI7F 2JOQA 5E2QA 3VAJA 1I1MA 2APOA 2DR5A 4K0KJ 4O81A 2XO7A 1IKVB 3L7UA 1RYRA 2ZH1A 3OVBA 2AD9A 4A47A 1P16A 2E5GA 3DM2B 3G96A 1AA6A 1JNRB 2EKYA 4ALZA 3QQMA 5DJBA 4B17A 5CA0F 3T9DA 3UQSA 4FS2A 2QTWA 5KFHA 3M8SA 2ACYA 2Z2ZA 2DH7A 2JA8I 5CYMA 2YNIB 4B3MJ 3BG0B 3PM9A 3IWXA 3SFUA 1MU2A 1U2FA 4LREA 5ETVA 3EICA 4J5OA 1RWXB 4CQ1A 1H7XA 3R9RA 3L3CA 1A3GA 4OMFG 4C0HA 3CO0P 1Y10A 4DUYJ 2FVPA 2R92I 3UYYA 1JWWA 3ULHA 2FJXA 2AKLA 2AKWB 3O1LA 2RPRA 3T4NB 5C3EI 3DN9A 3ILLA 4YB7A 2GJFA 2VFUA 4ZA1A 3QRQA 1F9EB 1CJUA 4KYZA 2GPWA 5CYMB 2M52A 4N8NA 3BR9A 1MU2B 3S24A 3QT8A 4RNOA 1WEZA 4E2YA 4TY8A 1CBKA 1KRPA 4IR9A 3HSZA 2DAAA 2V68A 3Q8SB 1N0UA 4ZK7M 4CT9A 2BANA 5J1PA 2E5LJ 1EQ0A 4ES2A 4DV7J 4LF2A 3MR3A 1CKNA 3M8WA 2N7CA 2DITA 4O2AF 4M0JA 4ELTA 3VHQA 5H9FK 3U54A 4CIOA 3HLUA 4PQAA 3R6LB 1A0GA 2XMWA 1U0SA 2AZ3A 4DSKA 4Y8VB 4ZPDA 4Q43A 1IWGA 3K5HA 1YIJS 4KHPF 3VV2B 2P2CB 4TKTA 3V5RA 2GW8A 3R6GB 1WJ9A 4O7ZA 2ZDQA 2COIA 2W6PA 5L1LA 1CKNB 4ECVA 2KXFA 4MKAA 4ECUA 1QE1A 1XDNA 4O84A 2YKMB 4AL6A 3SMZA 4CLKA 3MCOA 2HFVA 2OUGA 4LSLA 3NGKA 4KH1B 2XLKA 3MMBA 4DL4A 4ELVA 2BJDA 4NPOA 1T0TV 2UUCJ 5DZ6A 1B64A 1NU4A 3K0JA 1KTVA 1RKJA 1YTYA 2R7QA 1KTQA 2GTIA 3KYLA 2RF2B 1Q5VA 1RAOA 1YUKA 2HEKA 2JLGA 4AL5A 3VOTA 1YGYA 1VJQA 1QE1B 1X8DA 1LKZA 2X5RA 4OYWA 3M30A 3KNGA 4I56A 4LSLB 1BY9A 1W25A 3UNYA 3MMBB 3J81U 4RNMA 4Y2KA 2VH7A 1F1BB 3PX0A 1HD0A 4C98A 4WFNQ 3EERA 3MR5A 4LFBJ 2BE2B 1Q8BA 4ECRA 1XN9A 2CPHA 5C2GA 4LF5F 1CQJB 1BQMA 3BV8A 3M30B 4ECXA 4UW2A 1WR2A 2UV8G 3KUEA 2ZH8A 2W6ZA 2DNRA 3P96A 1SV5A 2F40A 3FQMA 2FGCA 4U6PA 1M5SA 5KFIA 1X60A 4OZ1A 1F5CA 3FFIA 2DNGA 3PCOB 4CP5A 3TY9A 2M5YA 5DG8A 4A3BI 3N6MA 3GB0A 4O7RA 3HX9A 1XIQA 3CC4S 4W98A 3J7A1 1FNXH 2HVSA 1C30A 4RBVA 1WZNA 1R0AA 2EBEA 2IJNA 2E9RX 3P49B 2JL9A 5C8YF 3UI3A 4GLXA 4DR3J 1N0VC 1SV5B 1URRA 1I3QI 5KG6A 2HJWA 2KDOA 4RWWA 3FFIB 3NCRA 4UQTA 5KFKA 2FDNA 4UCUA 2UUAJ 2MTLA 4A8YA 3CCSS 2OMOA 4K4WA 4XX2A 1WRVA 1JKJB 5K5MA 1R6VA 3QGIA 3CCEZ 4OYZA 2B9WA 5KFGA 3VNNA 2F65A 1R0AB 4ZIVA 1FJGF 1EKPA 3K5NA 1Q8LA 2GO9A 3D3BJ 1K8A2 2L9WA 1B7YB 4PUOA 1HYSB 4EGQA 4IRKA 3CJRA 2W2OP 4DL0C 3RAXA 3K3PA 5AT1B 4B3TJ 1OYDA 1U1QA 3MR6A 2QK4A 1EHIA 5ETLA 3CCRS 4HNVA 1Q0NA 2NR0A 4IQMA 1JJCB 2AP6A 1FK9A 5J2PB 1CG2A 5JH7F 2JC1A 1N5SA 2XB2D 3D4JA 2OELA 4LJMA 2NXCA 2GFFA 4PUOB 1SQEA 2WBMA 4DV2F 2P0AA 2YYAA 2MQOA 5ETKA 2DIUA 1QLNA 2HIVA 2FYXA 3H20A 1SC3B 2HG4A 4U9RA 2DRAA 1OBGA 2ZM6F 1XERA 2JEFA 4MK7A 4RU2A 4ZVRB 5I5UA 1VHFA 2J7WA 2V63A 4NCBA 2Y1LB 1WSVA 3F3PC 1FK9B 2XHWA 3DXSX 1GK8A 3G6VA 3JAMU 2XCLA 4TUYF 2LFUA 4ED2A 3W2VA 3W5ZA 3H5YA 4MV3A 1KBRA 2W2NP 1FJCA 3CCE1 4YHHJ 1NPKA 3KIFA 1LWXA 5DLGA 4A93I 2JA5I 1BQNB 1FT8A 4NYOA 4UOGA 1RADB 4DCPB 3HCXA 3ZZZA 3TR5A 3LGMA 1I6HI 3NFZA 3GV7B 2IJRA 2NLWA 4D3HA 2R7TA 3FRZA 4XPEA 1IBKJ 3TZZA 3TA2A 3W2VB 4EFAC 4DHVA 5KG0A 1B4SA 4O3PA 2HHHJ 5AXMA 2QA4Z 3ZNJ1 4IUFA 3HDSA 2ASLA 5GMDA 3K5OA 5HLFA 4Y2MA 1EAYC 5F3TA 1M5VC 2W8KA 1MSWD 1A48A 2AMCB 3OFEA 1U26A 1CVJA 3C15A 3HSJA 2AEFA 1HBOB 3HHLC 2AHOB 3QQCD 3MM8A 2J7KA 4MJKA 1HBUA 3EE3A 1YBUA 4DX6A 1TL4A 3IR5B 4JI1J 4JUZA 3ZZTA 2HURA 1I6JA 1W7WA 4O23A 1Q53A 4ELUA 1XNQJ 2VPXA 2CPFA 3I07A 4GVLA 2V8KA 2EK1A 3WQPA 1FHTA 4CLSA 4U8VA 4EFBA 3JRWA 2FY8A 2QV6A 4FVMA 2JDJA 4ECYA 3BBCA 3GWCA 4R0EA 2W2PP 3THVA 1I7LA 1HBUB 3HHEA 2I0XA 1K9MT 2BACA 3LGHA 4GKKJ 1VMBA 2B8PA 2LP4A 2YZMA 4ED8A 2FLPA 1S72S 1TMMA 3QYYA 3P6YC 4QWCA 5H9EJ 1Q812 1IKWB 1DAAA 2O4HA 1M5PC 2WSEC 1XQIA 3M8ZA 3I5AA 2VDHA 3M6XA 1VQKZ 2KT2A 2YPZA 2G0CA 3VCDA 1HQEA 4O4GA 5CABA 2VA3A 2G4BA 1Q5YA 3H0PA 4J9OA 4ZJOA 2V8VA 2KXNB 3MZIA 3MR2A 1QSSA 5KFCA 4DR1J 4FF2A 5GAGU 2ATCB 5IV3A 5EWEA 2W9CB 2J5AA 3Q8UA 2R2SA 2PM9A 2I2YA 1S49A 3MOZA 2WVEA 1UC8A 4O4GB 1HARA 2XMTA 3R2CJ 4RW9A 2KO1A 5HBMA 3MZLB 2PMHA 4I2PB 2YADA 3BG1B 3D54A 3CMQA 4BBSI 1L3TA 2K1RA 5KFMA 1CULB 2C2KB 4PXDA 3TX0A 2PA8D 2SCUB 4PYDA 2JVRA 1QSYA 3NS5A 4E2ZA 5H80A 3A8IA 1D8ZA 1DHMA 3SSRA 3C19A 4ED7A 1QD1A 2XLJA 4NLDA 2SXLA 3I32A 3DI6A 2JH3A 3EJMA 5KG3A 4RW9B 1PC5A 4B9LA 5HBMB 3VTIA 4HR2A 4DV6J 3K17A 3OVAA 1A6LA 2C1EB 2KI7B 3MWBA 1EUDB 1RB0A 3L95X 3MGJA 2ZOMA 4X65F 1X4FA 4LR8A 5KFDA 1YJNZ 1RHQB 2RBLA 4J9QA 4QTUA 4PEOA 2NZCA 5KG2A 1E6YA 2EWHA 2HWTA 5C42A 3ZZRA 3PW4A 2MB0B 1NK5A 3P3DA 3WIVA 3VAKA 5I5TA 3DI6B 4NZOA 1VQ51 4LF8J 3T7AA 2PEBA 3WIUA 3RR8A 2COJA 3RAMA 1RACB 3RW6A 4C8KA 4FP9A 1CE8A 4CH1A 4WFXA 3FCHA 1AUVA 3AJDA 1PYSB 4L1KA 1PX2A 4V19J 3EWGA 1NDLA 1GXUA 1NZ8A 3TY8A 2WB1D 2CZVC 2B8QA 4KJIA 3GTKI 2DE6A 2R9LA 2D7SA 2AX1A 2RKIA 5C42B 4F0KA 1KQFB 2XTJP 3QBCA 4E98A 2FVSA 1WG4A 1ITPA 2L3MA 1FD2A 2YZGA 4ZPBA 1FERA 4QTTA 1VBYA 4BS2A 3VR1A 4DQIA 2A0FB 2V58A 3E01B 4RZQA 2KM8B 2KL8A 4LT6A 3J7YU 1VBXA 2DNYA 3DRPB 2E66A 3NUAA 1GX6A 4L3KA 5IT4A 3CJ5A 4F3MA 3K8WA 2E44A 2VPWA 2RKIB 2ZD1A 2JA7I 4NFRA 4E2FB 1U6BA 1REVB 1ZH1A 3KLVA 1ZM9A 3CMES 3V6KA 3DHXA 1DY3A 4KB7A 4I1TA 4ZVSB 4IIJF 1YJN1 2CWXA 4C97A 2EJ2A 1YRXA 2V0NA 2XS2A 1VQLZ 2FHOB 1VLOA 2W4PA 3CCUS 3S1TA 4O7WA 4FVCA 4DCJB 4DR5F 1U1MA 3N0VA 1JXEA 4A8KA 2HGNA 2VPWB 2KXHA 2MQNA 4BC7A 2VU5A 1VCTA 5IV4A 2QZ8A 5EX0A 1IVZA 2HHTA 1FDOA 4IRCA 1JKHA 5KFPA 3G4SZ 4ZHRA 4Z7YA 3QFFA 4B9TA 3ZZPA 2HHSA 2B9XA 2MEWA 1DJ0A 4OHWA 2XWYA 2WVFA 3TZWA 2CNNB 2HZCA 4X6AI 5L1JA 4MD9A 1L1OC 1S9EB 4NBFA 3MM6B 1Q1KA 2YY3A 2OTLZ 3MPYA 4HH1A 1W2IA 1RT4A 3A12A 3ZZUA 4CKBA 1PG5B 5E0OA 1CQIB 2Y4RA 1U2RA 2DNLA 4DR7J 1QVGY 3JTOA 2Z58B 1FXDA 3JTPA 4LQ9A 1JKHB 2FJEB 2MQLA 1T94A 3UN3A 3WBZA 4ZHRB 4TLQA 3R5CA 2V50A 2XMVA 4FPIA 4EBCA 5CYJA 4H4MB 1IJFB 3HMJG 2HKEA 1JLGA 4A3CI 4LVOP 3CD6S 2O67A 5EX3A 3D67A 4AT1B 2OPRB 3LQVA 1GXLA 3W5YA 2K5RA 3IX0A 2CG8A 5BWTA 3RZAA 2V4JA 3NGSA 4L3NA 2BJ3A 2FVCA 1YBAA 4OX6A 2DIVA 1LK5A 4FF1A 5A8WA 4GC6A 1B7FA 1VISA 2M88A 2DHXA 2HIQA 4O83A 4OYMA 1V9OA 2OTJS 4Y6IA 1CC7A 3G4S1 1MG7A 3BJYA 2Q2UA 4J9KA 3PN1A 4MD7A 2QYCA 2OKQA 5C1OA 2XMAA 1DQAA 2V4JB 3WWIA 4MTPA 3JZ6A 4L76A 4RVFA 1IBMJ 4XIUA 5A8WB 4LBPA 2OTL1 5IS2A 4JI5J 5AJ3F 4ANCA 2A6MA 1IN0A 5IXUA 4Y0FA 3GE9A 3DLEB 3CJSA 1RO4A 1FFGB 5A2Qb 2ZBRA 3G6E1 2ZDPA 2KJWA 3AAWB 3KOAA 1FVQA 1Y1VS 2QFIA 3QO9A 4LRDA 4DK1A 4UFZA 4ZLNA 5IT9b 2KFNA 3F73A 4PZ6A 3M32A 2QGFB 1TFWA 1NUEA 5E3QA 2R6MA 2HLTA 4IO9Q 3TVZA 1WEXA 5LMUF 1CC8A 4IG0B 4NXMJ 1SJ1A 3F41A 4OZLA 1TK0A 4O7VA 4RUBA 4F4WA 1RI7A 2GJ2A 3GR1A 5L38A 3QWUA 1GMVA 2D9PA 3GMGA 5J1NA 1YX2A 1WHXA 2VJUA 3M2VA 1Q7Y2 3QO9B 2Z56B 3K7RA 3DU6A 3J80b 3UZOA 1CJKA 4I7FB 4UCSA 2D41A 4NXNJ 3BGRA 3Q8YA 4YMEA 2E5HA 3ENVA 5CCLA 3JZIA 4MRIA 1RWUA 2E7WA 4ILMA 2C2ZB 3A3PB 3PY8A 1JX4A 4C0BA 1K0TA 3IG1B 2VF3A 4A8QA 1BWEA 1ZAVA 1NJXA 1QAYA 3DOKA 5EUHA 4CRJA 1KD12 2VC0A 4J9UE 4DGLA 4NI2B 3P5JB 1PIEA 3GPAA 2NQPA 3M2VB 3PO3S 4UZBA 1CJKB 3GTQI 2WAQA 3TEKA 4UUGA 2W2MP 3FBCA 4DR4J 1VQMZ 3F0NA 4IFYA 1DTTA 2V8HA 2KZZA 2BRLA 2BOAA 3QZ7A 3GTMS 4MONA 2HHPA 4YS2A 2MDAA 2KHCA 3IP0A 3IXQA 1LK7A 4TU8A 3VPCA 1H2TZ 4MV8A 3DOKB 5K14B 3V2UC 1NPPA 4QU7A 4WYWA 1X0PA 3D5MA 1KRLA 3SQGA 1Q862 2DNZA 5AE1A 2OWOA 3OUUA 2VQFJ 2YH0A 2H4YB 5H9EK 4QWBA 1N34J 1UAWA 1XWLA 3UDVA 4X4RA 1HL6A 1H38A 3NCQA 3V81B 2CQPA 1S76D 1S6PB 3ICLA 5CCMA 2H65B 4OZ2A 3CMAS 1VIOA 2DEIA 2VPQA 3HT5A 2MY8A 2XQCA 1DLOA 2W9AA 1TKXB 3KK3B 3AY0A 1FF2A 3SQGB 1VQ6S 4P52A 1TUVA 1J5OB 4F4XA 3GDEA 1XC9A 1KC81 1P9YA 3PR5B 4QOTA 4RX6A 4ETXA 3S15I 1VQ4Z 4YY3J 1W26A 3P4UB 2FQQB 3G9CA 1DLOB 4ZMMA 4YP3A 4BBYA 1VQM1 4ZVTB 2GAGC 1VBHA 2VPZA 1YK9A 1U25A 1L3SA 3G8DA 1VBGA 1QTMA 1OIAA 2XM3A 2EC0A 3V4ZA 2FGOA 4CMFA 1TA8A 1HNIA 3HPOA 3D0GE 4Z2XA 4MD8A 4KV8A 1B3TA 4X4QA 1H98A 3BPSP 3PR4A 5T7LA 1NK6A 4BY7I 1KS2A 4AFFA 3ILOA 4K4ZA 3HKZD 2LYVA 2IM0A 4L6V3 3PXGa 5D4PA 2NVTI 4MIWA 2F8MA 1KJ8A 2Y0SD 2VPZB 1WHYA 4TQRA 4YR0A 3VGUA 3MM7A 3I82A 4QR0A 3MD1A 4M1KA 3I55S 3W9JA 4KV8B 3PACA 5J2MA 1S0OA 2ROPA 1ZTTA 2RB7A 1CJTB 2N82B 4OI0A 5T7LB 3M6VA 4HGZA 1N5TA 2J0XA 4CLWA 4WIIA 1B0VA 2U2FA 3SYZA 3V4IA 2K06A 2W2QP 3M7VA 4W90B 3NRBA 4U7CA 3TI0A 5C2CA 4GO7X 3LALA 4OQJA 4FF4A 3TZYA 1X9SA 5FLXb 3MM7B 1RWKB 2E9ZA 5FIIA 3VB9A 4ID5B 1UVLA 5J2MB 4D3GA 4Q8FA 4A3II 1VQ8Z 2LQJA 2Q4ZA 4LFAJ 4OYBA 2Y9HA 1A0OB 4EZ9A 3BA8A 3ZZOA 1NK4A 4KRWA 3DLKA 3V4IB 5D8DA 4CLPA 4UT4A 1XMOJ 5KG5A 2KJVA 2IM3A 3MUMP 3N5FA 2VKZG 5CYQA 4LF6F 4DLGA 5D1OB 4EWCA 4E30A 2AYMA 3TVYA 3MEEA 3OLAA 1R8HA 4TV9F 1NJZA 1RT5A 1YG0A 2GMHA 4ZP9A 1MMNA 1S1WA 2HNZA 2UVRA 4X4SA 3MONA 3BSAA 1JJ2Y 1RTIA 2Y8WA 4QWDA 1QM9A 4QW8A 4RVHA 5CYQB 3CCS1 2CNVA 3DXBA 4FFNA 2Y1RI 3LPEA 4I4BA 4BWJA 2B5JB 3MEEB 4NB9A 2UU9F 3GIJA 1LXJA 1RT5B 2RS2A 4MA5A 2DGSA 4C8NA 1FXRA 4CO3A 5KFTA 1EIYB 2P9CA 2ZHOA 2C2NA 3CCMS 1RU1A 1IJEB 2ZC4A 3TNVA 1TL5A 1RTIB 1JWHC 1YSJA 3HOWI 1I1GA 1ZZFA 4IH6A 3CC7S 2M9KA 3EM1A 3LUSA 1Z1ZA 4K5RA 2QREB 3OXGA 3C14A 4JI3J 1T95A 1DARA 2WVCA 5HROA 2HBQB 3CCQS 3IBFB 2YXLA 1C2PA 4C5AA 1ZA1B 3NDJA 2W6QA 4IG3A 4G1PA 4O7TA 4OYXA 1LWCA 2XZTB 2XI2A 1UP1A 2B9EA 2VR1A 2X3DA 1P1TA 2NUHA 4GMKA 2Q1LA 2YKNA 2LFVA 1SH0A 2PT0A 3IAS9 4LF7J 5I42A 1E6VA 2M8DB 1RP5A 5KFUA 3C14B 4HN2A 4DV3F 1X4HA 5HROB 1N5YA 1R8BA 1VQPS 4PBCA 4K5SA 3RR5A 3MJFA 2R7UA 1WC5A 2JS4A 3J7AN 4M5GA 3QRRA 4O7SA 3R27A 1LWCB 4J37A 4WK1A 4RNFA 3FKBA 3GYNA 3I9ZA 4F3OA 5CH7B 3OFFA 1ELOA 4K4YA 2YKNB 2E1RA 2D74B 2ZBIA 1E6VB 2OLWA 2ABJA 2R7WA 2R8HA 1F2GA 2DH8A 2LQ8A 3G8SA 1OQ6A 2DCUB 5C1PA 4O7LA 2N3OA 2E1PA 2WYOA 3W66A 1NK9A 2CQ3A 2XC9A 1RO0A 3V4SA 2J7UA 3OSPA 3S2DI 4DV5J 1VKZA 1L3KA 4CLLA 5KFVA 2BM0A 4YAKB 4KTQA 4WP9A 2AJ2A 5IT9f 3K58A 2QT7A 3I31A 4ZN3A 2LIYA 4AUKA 1IBLF 2IZ4A 1X0TA 1NDCA 4CKCA 3MCSA 4YDXA 5BWVA 1RCXB 3TANA 3P8BB 1UCNA 1Z02A 4AQYJ 5BYRA 2IMWP 1LEOA 2ZOFA 3G8QA 4QIVA 3UE2A 3OJSA 1DZ5A 1GMUA 2QB5A 4F0HA 3OUYA 4QIFA 1SKWA 4Y00A 1XK5A 2DTJA 4Q4CA 1YJ9S 3CJTA 1TWHI 3CCWA 3EPIA 4DMZA 4ETZA 2W6MA 3LWLA 3IRWP 1NSQA 3QJPA 1TKZA 2ZH6A 4AL7A 3IS9A 3N8DA 4N76A 2PMZA 4JYAJ 3MMAA 2WCXA 5BR8J 4FU0A 2QRRA 3K2YA 1X3ZA 3N01A 5KOXA 4MV1A 5CQGA 1S721 3OUYB 5KFNA 2YX1A 3H4DA 4RO0A 1M0TA 4Q4DA 5GADI 4ZCIA 1EYZA 3A13A 3M9MB 4DFPA 1T3NA 5GAEI 1HFEL 5I60A 4RZRA 4P2XA 3ENQA 3PNIA 3D1QA 2BRKA 1TKZB 3CCLS 1YITS 3IS9B 2V8PA 3U55A 3N9UC 4N56A 4OHZA 4WBNF 2MMYA 2V5AA 3MMAB 2JIRA 4NLXA 2E2HI 2HK2A 4B3MF 2O5DA 2DT9A 3NS7B 3BQ0A 1V5IB 3R23A 5GONF 3J7ZT 2WSCC 3Q8VA 2E7XA 1O0PA 3ZXWA 2W70A 4CNZA 2CFXA 2BW2A 1UC9A 2HVEA 2BDPA 1CPZA 2W04A 3EMTA 3KWMA 4NMXA 1HBNA 5IP9I 1SIWA 3HOUI 2W8LA 2I80A 1MWQA 3BKFA 3CSWA 4XPCA 2IC3A 4TN2A 2VQEJ 4EO8A 1SKSA 3BACA 1QAJA 1EZ1A 3H59A 3DRYA 1OS5A 2HHQA 5LA6F 4JI2J 4B02A 2UVWA 3CCVS 1F5AA 4Q5VA 4ICLA 4E8UA 2MZ1A 3UDLA 1VQYA 4OZ5A 1DAXA 1Q16B 2X1AA 2M0GB 3DRRB 2V94A 1VHIA 2D9OA 3H2LA 2E5LF 2O01C 2H5JB 5HK4A 3VAIA 1SIWB 2DO0A 2NAPA 5HP1A 1BE4A 4H4OA 1UVKA 2IC3B 4I4TF 3T9ZA 1IKXA 2OH2A 1T03B 3HO1A 2OPQA 1M901 2KRRA 3TY5A 4WTYA 3MUTP 4U8YA 4ZVUB 2DPIA 4F4AA 3I0SA 4ICLB 4P72A 2XO6A 1GMWA 2Q51A 5G0RA 4QIWD 5GAHI 4O3SA 1WD6A 3CCUZ 2BJ1A 5HI7A 3L9ZA 2ZWOA 4DF8A 2FP4B 5HP1B 3B78A 4H4OB 1HI8A 1RWVB 3HD2A 2PC6A 1IKXB 1WI6A 3VGTA 5I4MA 2IBKA 1S77D 5KOWA 3L09A 4O44B 1H2VZ 3O2IA 1N32J 2J0QD 3DTGA 2UXBF 4MV4A 3HOYI 2Q2TA 4DPOA 2UUCF 4DUZJ 3I0SB 4NL5A 1K8A1 2C3UA 4E6NA 3EVWA 5G0RB 2ASYA 3IFUA 3JAMb 1YJUA 2KYZA 2DNMA 1OBDA 1TELA 1FWLA 2B4VA 3NMRA 5D6GA 1V3RA 1KKHA 4M9UA 3DOLA 3SSSA 4DSEA 3R9LA 5J2UF 4NB8A 3FBEA 5G4DA 2CA9A 3DDKA 3CPWR 2IMOA 4OI1A 4RW8A 5MLCV 5FPRA 2D3ZA 3TEGA 5JVGQ 2H4WB 5IM0A 2YU9I 2XGPA 2Y3YA 3RRHA 1YJWS 3BS9A 4R8UB 4PWUA 2J8SA 3I87A 3QSIA 2NUUG 4OV1A 4DR2J 2DHSA 4Y52I 1H72C 3CD6Z 3DOLB 3CME1 2EKNA 5CM2M 3HHDA 3W61A 2M7SA 2IDEA 4RW8B 4PZ8A 2KVQE 5IM0B 3N28A 4CLUA 1EKFA 3CCU1 3CD0A 3C6UA 3QFHA 3VQSA 2QEXZ 2P5VA 3OTEA 4WK3A 3CEDA 3W65A 5IWAF 4F3QA 4JI8F 2HVIA 3M2RB 2NYHA 3M6UA 4O82A 2XHCA 3OTOJ 2D3O1 4DQPA 2RQKA 1FX4A 1P9QC 4DR3F 3G8TA 3VVTA 1VRQC 3C6UB 1EP4A 5DQIA 3M3YI 2Z2MA 3Q22A 4CNYA 2UUAF 1K83I 1UFKA 2P28A 2CFMA 2FJBB 3U50C 3HHNB 4QIGA 3B4MA 5HVHA 4JOUA 2XSJB 5KFYA 4UOCA 2IIHA 2HFSA 5J2NA 5D4LA 1V6HA 3CC2Z 3H4BA 2XLIA 4GRSA 1KBLA 1AUXA 3OXLA 2ADCA 4NLRA 3QWPA 2YNFA 4CO0A 1QAIA 2EG1A 2Z0GA 2BYCA 2CG4A 3CD61 4I68A 4FN5A 1HNVA 1USPA 1NAQA 1RT7A 1W93A 2V9WA 3M2UA 2HS0A 5JUMA 1PC4A 4NYEA 3KLEA 5DMXA 2W01A 3HHLA 2QEX1 3HJVA 5DG7A 2N7YA 3VPBA 3DRXA 4RBTA 3CIMA 2IRUA 4DZDA 3CCJS 3ITHA 2YNFB 1YZ7A 3ET6A 4XK8C 3V6DA 2R4FA 5EWFA 3KK2A 4UF4A 2OTJ1 2MLZA 1D0EA 3QSYB 2GQ2A 1HNVB 1USPB 2HS4A 1RT7B 3RGIA 2ASJA 2AJQA 1EQMA 2YZNA 4A8WA 3W9HA 2W9BA 3EGNA 3M2UB 4YB5A 1H6KX 4NEZA 2YKQA 3UCUP 3W2WA 2CIMA 4QWEA 1SC6A 3TW0A 3A8JA 2R87A 3IN5A 2CXEA 1YJVA 2F1FA 3ITHB 4CLYA 1KQSZ 1V3SA 3V6DB 3U1MA 3KK2B 4YHHF 3DLGA 2GVDA 2RQ4A 3J81j 3M1VA 5FD1A 1U1PA 3X1LB 4NA1A 2MZRA 3CC21 3D0HE 2W9BB 4A46A 1ZS6A 1GTEA 1IBKF 3KJFB 2COLA 2UVVA 3W2WB 5I5SA 3Q2OA 3EX7B 4NBBA 3OTCA 2HHHF 4DX5A 4RLEA 2OD4A 3IR6B 1HWUA 3OVSA 2LECA 2FIUA 4RV9A 4WCEQ 5J1EA 1DV1A 2LXIA 3KHRA 1TWGI 3DLGB 1TFIA 1J5EJ 1JB0C 4RR5A 1VQOS 3M1VB 5CD4A 2VBXA 3I5CA 4EFEA 5ETMA 4NCAA 2IZ3A 3TJAA 2Q66A 1UTAA 3HVTA 1HA1A 3LP0A 2IYGA 4DPUA 4F8RA 4O3NA 3AXMA 4NBCA 4JI1F 1RK8A 2JEIA 1FEEA 2OEMA 2DISA 2F9JA 1XNQF 5DGAA 3NY0A 4LBIA 3I56S 4F4ZA 3EDQB 5KS8A 3OW2Z 2HGXA 5A2QY 1RBAA 1RQ0A 2F3JA 3T1AA 2UP1A 1N6QA 5LP6F 1BQXA 4NLTA 1Y5IB 5J2QB 2FY1A 2LDIA 3QGHA 3PW2A 3UD5A 3HVTB 2AIRB 3S1MI 2VC1A 3WWHA 3LP0B 2IVFB 2UXDF 2RAQA 2MHNA 3KREA 4X66J 2PVPA 3A1YG 1F60B 3FNNA 4WHXA 3KIHA 4LBHA 1HI1A 3D0IE 1FJEB 3I4NI 1KDNA 4CTAB 3CW2C 5FR9A 3O44A 1VC5A 3B54A 2J76E
chains in the Genus database with same CATH topology
1FRHA 1ZZNA 3RW7A 3IWNC 2CJQA 2PMHA 4I2PB 2YADA 2GNKA 5EHHA 3BG1B 3D54A 4C4WA 4BBSI 4C8YA 4O3OA 1L3TA 1JLCA 2K1RA 5KFMA 1JJ2R 5CD4H 2MKKA 2M3DA 4PXDA 1N56A 3CCL1 5L9NA 3VQTA 2CYYA 2PA8D 1N5VA 2QO3A 4TY8B 1TKTB 3NDIA 2VG7A 1HMVA 4ED5A 2JVRA 2HLUA 4X64F 1VQMS 1QSYA 3NS5A 3OFHA 5E3RA 4DSFA 4E2ZA 5F8NA 2OFGX 3CJ0A 4ZP6A 4WYLA 2C2EA 3BEGB 4Y28C 3C2PA 1VQNS 1YWXA 3PKMA 3KFWX 4PWDA 3WC2A 3TDHB 1MROB 1LFPA 1D8ZA 1DHMA 3SSRA 4X4OA 2DR9A 4Y2CA 2YWGA 1SKRA 1RLYA 4MK9A 2BANB 3CB4A 3CJ3A 4ED7A 2RVJA 4RW6B 3F3FC 4YR3A 2JJ4D 2XLJA 4NLDA 4QPTA 2SXLA 3I32A 4DR1F 2AGOA 3DI6A 2JH3A 4X66F 3CMA1 1VLYA 5KG3A 3RZOI 3N6LA 3OL9A 4RW9B 1SIZA 1VQ9Z 3MUVP 3OJUA 1PC5A 1KOHA 2MZTA 4B9LA 1UVNA 5HBMB 3VTIA 5DM6Q 1VJWA 3OVAA 2R93I 1A6LA 2DGQA 4U67Q 3O5TB 4HI2A 2H85A 2MGZA 1R31A 2KI7B 1FDDA 3MWBA 2ZNZA 1U1LA 2J6TA 3B4DA 3L95X 3MGJA 2ZOMA 4X65F 3QGPA 3DCAA 2CRLA 4NZ0A 4HKQA 1X4FA 1HBNB 4N77A 1N34F 2CPIA 4HI1A 4Q44A 5KFDA 1YJNZ 1L3UA 2RBLA 3T6JA 3NBYB 2ROGA 2VG7B 1HMVB 1DQ8A 5BJRA 4J9QA 1CKOA 4QTUA 3R3TA 2X1FA 4OI6A 1Q8IA 5KG2A 4OHYA 3T5KA 1E6YA 2EWHA 2HWTA 2M2BA 4X4TA 4PWDB 4EEQA 5C42A 3ZZRA 4HL9A 3PW4A 3MZKB 2IAJA 4DSIA 1YIJ1 5DLFA 2MB0B 4R0JA 3U7JA 2GHWA 1R3NA 1NK5A 3P3DA 1LWEA 5KT4A 1M5HA 2LU2A 3VAKA 7FD1A 3MAQA 4DQRA 1NJWA 1X5TA 3DI6B 2F8HA 4Q8EA 1VQ51 3KLGB 1TKDA 4K4VA 2M6NA 4PXEA 2MKIA 4DL5A 1B0TA 3ISNC 3RR8A 3RBDA 1H7WA 3RAMA 3RW6A 4C8KA 4FP9A 3AA9A 4KGKA 4CH1A 4WFXA 2MKSA 3FCHA 3FRYA 3HI9A 2RQMA 4XDCA 4QW9A 1YJWZ 3CC4Z 2BQ3A 1X4EA 4V19J 3NC0B 3GFHA 5IQ6A 1GXUA 5I3PA 2R8IA 5FDLA 5L1IA 3TY8A 2WB1D 2CZVC 3CWJA 4KJIA 3HXMA 3GTKI 1T7PA 2DE6A 3K5PA 4Q45A 2EW9A 2R9LA 4CL1A 2D7SA 3GV8B 3RB4A 4JI6F 2GHVC 3IBWA