3QWUA

Putative atp-dependent dna ligase from aquifex aeolicus.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
366
structure length
366
Chain Sequence
ISPELVKEALKKKKVRSEEAFGLEYLRFNDDYKDIPRGTAIFKDFIIWGYPHIGRIFLLETGLREQFEAPFWVEEKVDGYNTRIFKYGDNYYALSRGGFICPFTTDRLPDLIDLRILDENPDLVICAEVAGPENPYIEESPPYVKEDVQLFVFDFMKKNEQGFLSQEEKMELIEKYNLPHVEILGRFTASEEGIKKIKEILKRFNEEGREGVVFKEDSERNKRAKYITSYANLMDIKTNAKNMLQLPPEYYTNRILRLVLFMYEEGLKTTEHLYEELGRAFIDGLFQAIEQFEKEHKVYKTFTCKFRKKENAIALLELLSKTSKHIQVKERRLEKEGDYWRLEFDKVFLNMTGLLGHLLSGGIVYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Putative ATP-dependent DNA ligase from Aquifex aeolicus.
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 116
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18330 Lig_C Ligase Pab1020 C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.320 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3qwuA01
3.30.70.2160 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qwuA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3qwuA02
1P8LA 4LH7A 4PZ6A 1TAEA 1V9PA 3GB8B 1X9NA 2HVSA 3NC0B 4DRFA 3UQ8A 1DGSA 4PZ7A 4UCOA 1CKNB 1FVIA 4LH6A 1XDNA 3PN1A 3BA9A 3GJXB 2VUGA 2HVQA 5FPOA 3RTXA 4UCVA 3TY5A 2Q2UA 2OWOA 5D1OB 5FPRA 3W5OA 1TA8A 3BA8A 4EQ5A 4CC5A 4CC6A 1B04A 1P16A 4EFBA 3L2PA 2CFMA 2Q2TA 4UCSA 3TY9A 3S24A 3VNNA 3W1GA 4E6NA 3GDEA 3TY8A 5D1PA 2HIXA 3BABA 3JSLA 4UCUA 1A0IA 4EEQA 3JSNA 3NBZB 1CKNA 2HIVA 1CKMA 1VS0A 3NBYB 5DISC 3W1BA 1XK5A 3KYHC 3BAAA 5D1OA 4UCRA 4UFZA 4UCTA 3QWUA 1S68A 4EFEA 4GLXA 2HVRA 1CKOA 4PZ8A 3RR5A
chains in the Genus database with same CATH superfamily
2E1AA 1Z2ZA 2RUSA 2HBRB 4CLUA 4S1TA 2YRWA 1FX4A 4LF9J 3WX4A 3GTMI 2VPZB 4Q0BB 1PYSB 4DV2F 4LBIA 3LWLA 4EYIB 4AFFA 1U48A 4JI0J 3I0SA 4NASA 4A3LI 2R7VA 3HJVA 4ZITA 5HLFB 2FVRA 2JWNA 4CTAB 3MM8A 1QJHA 1TVRA 2RDDA 4EQ5A 1ZAXA 1R6VA 4PQAA 3WHIA 2HNDA 5J2PA 2V2ZA 2FPGB 5LMUJ 4E4TA 2R6MA 1PGZA 4RW8A 2IC3A 2BA9A 3U9SA 1J2VA 1JJ2R 2ZDOA 3CC2S 2BYCA 2BEFA 5EDWA 5G4DA 3PX0A 4DV7F 3JSLA 1HHQA 3EGVA 3OVBA 8ATCB 2DE6A 3C16A 4WJBA 4O83A 2VHGA 3NBYB 3UDLA 4ENOA 1S1VA 4HNUA 4A3CI 4HDGA 5J1EB 5A2Qf 2AU0A 1VC0A 3G71Z 1L3VA 4ZVUB 5KFQA 4K4WA 4IHJF 5CAEB 1IUJA 4WYWA 5I5XA 2BE9B 3EJMA 1Y0HA 2ROPA 4QJVA 1JX4A 1R8AA 1S9GB 2OTJS 3C14A 1IR0A 1JLLB 2GX8A 3PYDA 1D9FA 2NUAB 1HLWA 2V8HA 3JZ6A 5CE8A 4LF8J 3CCM1 2WAQA 2DNYA 3VVTA 4YJ2F 2AZ1A 3D4JA 4PABA 3BR9A 3C6TA 1F9FA 1UEVA 4ES1A 1JJCB 4MT1A 3QRPA 2H9ZA 2PIIA 3FC9A 3PFOA 2ZNYA 4NB8A 4I6AA 1B7FA 5LOQA 4LF6F 1VQ9S 1HBOB 2C22A 1T9UA 4EFBA 1WUUA 2OKQA 5J2QB 3KLEB 3V6JA 2EJ0A 2PA8D 2FPIB 1LQLA 5HBMA 2ZITA 4O7TA 4HH4A 3MEGB 3OL7A 5KFPA 4C8YA 2H4YB 2OI2A 5MLCV 1HBNB 2GMHA 1SC3B 4OZ3A 2W01A 1KWMA 3THVA 2VPWA 4TV9F 4K4SA 2AJ1A 1VQN1 2NUHA 4DV6J 1T03B 4WXOA 1CKNA 2M8DB 3NMRA 1RAEB 1A6LA 1U1KA 4ZOSA 1WG5A 2MXYA 2PA3A 4ZPCA 4LF5F 3PEHA 1FWKA 3MZKB 3KHGA 4WXWA 5A76A 2W7PA 4ES2A 4FKXA 2XB2D 4JI5F 3IX0A 2HYIB 1XBWA 2D3ZA 2JLEA 2J9GA 3J81j 1XK8A 1NZ8A 3J80Y 3BBFA 5E0OA 1SUQA 4KB7A 2K8GA 1S5ZA 2QGFB 5HVGA 1J5OB 2QF7A 1C0TB 1Z1ZA 1ZM4A 5I5WA 3HHLB 4ID5B 1QYPA 5F41A 4B9LA 4LF1A 2M3DA 4O23A 3Q86A 2CVIA 2OPPA 3TRGA 3BGRB 2HBZB 1F5CA 2HHSA 4QIEA 5A2QU 5DGHA 3BGUA 1YUKA 4C11B 2JA5I 1LXNA 4WIIA 3NMAA 3MPDA 1FXRA 3MAHA 2HHUA 3DTGA 1M5OC 1S72S 3CUNA 3OTOF 3UQSA 4EU0A 4ZS6A 2QEX1 5F0WA 1B0VA 3AFGA 1PO6A 1YIJZ 4OFZA 2FHKA 1JDBB 3FQLA 1FFWB 3Q8QB 3PNIA 3MTKA 2YL2A 3OW2Z 3R5GA 4KPCA 3JSMB 3HKZA 2DXFA 4RVDA 3RBZA 4B3OA 1QVGZ 4WP8A 2HURA 2LEBA 5J2NA 4NMXA 1N33J 3LO3A 4LF7F 5HBRB 3U0GA 2KTQA 5ETMA 3RZDI 3J81Y 3P5BP 3A4TA 1VQSA 1FDOA 4ECUA 1F9EB 4NXNF 2IVMA 3ZTPA 1GXUA 1VDHA 5J1PA 3K0JA 1QE1A 2BVZA 1IKVA 2UXBF 3FFIB 1FO1A 2B9WA 4AL7A 1TL3B 1RT6B 2QZ8A 1H2TZ 1YZ7A 4B02A 4DSEA 4WP9A 5I42A 1HD1A 3QSIA 4NEYA 1I5OB 2R7ZI 3SNOA 4PWDB 3OBIA 2MGZB 2KT3A 1VQ6Z 3V4IB 3IWNC 1UVMA 1MROB 1FNOA 1WORA 5DDPC 1NSQA 4QYZK 4O7LA 1VRTB 4DL5A 2MQOA 2VF1A 1TL7B 3S1RI 4DQPA 4MD8A 2WB1D 4YB8B 1TKTB 3SSRA 4DL6A 1NH8A 2AJ2A 2DGTA 1VQNZ 3F0NA 5L1IA 4CKCA 1HIYA 4CH1A 3AX6A 4ED0A 4OI0A 2DGSA 3THTA 3HDSA 1MMDA 2IVYA 4F25A 2Q43A 2G0JA 3BEGB 2JVOA 3TJ8A 2DRAA 3DU5A 5KFYA 5A8KB 2HQ3A 1OMSA 1S1TB 4L6V3 3RW6A 5JVGQ 3M8YA 1BE4A 1CJVB 3HPOA 1BHNA 1HPZB 2G0CA 4NA2A 1P27B 2G9OA 2V4JA 5KG7A 2DNQA 2W24A 3P4UB 3HHLC 4R8UB 1MG7A 1IBKJ 2OLSA 1K8AT 1S99A 5L8RC 4EEYA 1KQGB 5H80A 2BZ2A 3Q87A 1YJTA 2COLA 4QW9A 1RKIA 5EZYF 2VA2A 3BN4A 2E9TA 2E1CA 4DV4F 3ENVA 5IFMA 1FEEA 5D8DA 3FQMA 2R42A 2YKMA 1WKKA 4ELTA 1O5JA 3JTNA 2XO6A 2CDRB 5BR8J 2CXEA 3DLGB 1TAUA 2F8HA 1VC5A 1PX2A 4JOUA 2QLVB 3J7AN 1KHWA 5F8JA 4Q4CA 3CULA 5A8RB 3W5XA 3OR2A 5AE1A 1QY7A 4PQUA 1OS5A 4NBCA 3AQPA 1VQMS 4CLKA 2JMOA 3DLHA 1TL1A 2FB0A 2XMWA 4HKQA 5C1OA 5IT9Y 2VPXA 2DE7A 1M5KC 5ETPA 2B8PA 2V69A 3BBCA 4YR0A 4X65F 3G6ES 2G4BA 4FFPA 2ALZA 1HNVA 1RLCL 4J9VA 1U2RA 5JVDF 1SV5B 1M1GA 4Y2CA 3MWBA 4DQNA 2B51A 4ZP7A 2J0XA 4FFLA 5HANA 1TKDA 1LW2A 4B9UA 3CD0A 4HH1A 1F5AA 4OJHA 2JEIA 3VNNA 4RW6B 3I0RB 1U0HA 3BSCA 3UVJA 4C5BA 2BX6A 3O8WA 4RW9A 1TWGI 5GAGU 1PSDA 4O4LF 5E2QA 3BF4A 2FHJA 1T05A 2SCUB 2Y9HA 4L1KA 3ISND 1WWHA 3AOAA 3MAQA 2UXDF 3FQKA 1VBHA 1AFIA 4S0MA 2LU1A 3N28A 2MSTA 3DMJB 1IKXB 4B3SF 2CQHA 1NXIA 1DTTB 3EGNA 4P72A 2RBLA 4EBCA 4F04B 4M5MA 2KL8A 4NXMF 3MURP 1HWJA 3OFHA 4OYZA 2D9PA 5FIIA 2O01C 1NP6A 2JIQA 4QQBA 3CMA1 6FDRA 4UCOA 2YVSA 4NBEA 4KGXB 2VJUA 4KFBB 2DAAA 1EHIA 2DHGA 4DV0J 5K5MA 2F4FA 4DUZJ 2NXNA 4MONA 1SVDA 3BSNA 3VTNA 3CB4A 5E41A 2R3VA 2OPRB 4IG3A 2HAIA 2ACYA 3BZQA 1SL0A 2GV1A 4C97A 1Q82T 4URGA 2LEAA 4B3RJ 3F44A 1PK8A 4WFXA 3QNWB 4HL9A 2Z58B 2VA3A 1Q862 1W26A 4ANCA 1KLNA 2BV3A 1FK9A 4FYWB 1VBXA 4RW4B 2RIJA 1HBMA 4DCOB 5DGAA 2NYIA 1JXVA 3AHPA 5EN1A 2CFXA 1VQYA 3QIPB 4DR7J 1PFTA 2AKWB 3QWUA 5HP1B 2R85A 3VB9A 2HWIA 2UVUA 4ZIWA 4IDKB 1ZA2B 4BC9A 4ED2A 4OV1A 4Y2AA 5GAEU 1CJTB 3TX0A 3CCLS 1NMEB 1TVRB 4KGVB 1B64A 1JLCA 1C3OA 4O81A 4YB7A 4QIFA 4RW8B 3T6BA 2Q51A 2P2CB 4IH7A 4GMKA 2QRDB 2PK7A 4ZPAA 1R89A 4J90A 3MR7A 5FJ4A 3QT8A 4QWDA 5FNVF 3I6PA 2KJWA 1CQJB 3FVYA 5D78A 2HNYA 2CPFA 5C7PA 2DRDA 3W64A 4DV1J 1RE1B 3TAMB 4JI3F 2RT9A 4DGLA 2MHEA 1F9HA 2F8MA 3HOXI 1I7NA 3O5TB 3AOCA 1Q861 3JQMA 4NLVA 3IBFB 3TAQA 4K6NA 1KNZA 4A3EI 3D6WA 2R8HA 1B0TA 4JB8B 1EZ1A 1H72C 4DR3J 4C9DA 5L46A 4DWIA 1M90T 4K4ZA 2QFIA 3KLGB 2PMHA 2N4CA 4D3GA 1FD2A 3C66A 1HNIA 5B0EA 2QLFB 1QAXA 3M2VB 4O44A 4FVCA 3POTA 2RILA 1MWQA 1HI0P 3R5AA 1K0TA 2KYZA 2DY1A 2GIQA 3IFEA 2VPYB 3IAS9 3T7AA 2R93I 1TK0A 3HSZA 4Y6IA 5BYRA 4MYTA 3JTOA 1IM6A 3V6DB 3WC2A 4KV8A 3VGVA 4PR6A 3WZ0A 5B0DA 3W2WA 3L9ZA 3PZPA 2MQ8A 1OPZA 1ZPVA 3KLHA 4O82A 4OI6A 2RRBA 4FF1A 3VPDA 4P7VA 2CPJA 4G1PA 1DRZA 4TYAA 4HT7A 3TZXA 1X7VA 3W66A 1YIT1 4EGJA 3TEHB 4ZVFA 4IYQA 1NUEA 1XEZA 1GX5A 2LQ8A 3PO5A 2YWEA 4ZPBA 1SUQB 1BMQB 2JC0A 4ZVQB 2HHQA 4Y2MA 2W8LA 3RB6A 4AL5A 4NZ0A 3I551 2NPIA 5CA0F 3LGHA 1KD11 1RP5A 1NK9A 1SJRA 4TU9A 2J0QD 3KUGA 1S9EB 3TAPA 1S6OA 3VMGA 1BWEA 3JSRA 5KFVA 1V9PA 1HQ2A 1IOVA 2JUBA 1A0GA 4ZK7M 4EZ9A 2FYXA 3OL8A 3H90A 2FPPB 3X3UA 3OLAA 1CQIB 1R8PA 4Z2XA 2BQRA 1KLMB 2BKPA 4FPIA 3EZOA 2P9CA 2GS8A 2VG5A 2HQGA 3M1VA 3MONA 1NBEB 3CDBA 1X31C 4CWBA 2CA9A 2GCFA 2XHWA 5I3UB 2X51A 3DDIA 3CF5Q 3CMES 3P8BB 1CJUB 1EP4A 2AYMA 1Q79A 3CD6S 4TY9A 1XJWB 4AYBD 1CULB 1RWNB 5GAHU 1FDAA 4X64F 3RUBL 4IOAQ 4OX6A 4K2XA 4NLXA 2MZ1A 3OLBA 5EUHA 1N6QB 1WKLA 2DIKA 2QK4A 1YRTA 3KJVB 4JI6J 4O4HF 1JLFB 4CYUA 2VOOA 2Z2MA 5J2NB 3DDNA 1IQTA 2V9KA 1RBAA 3C8YA 4TY8B 2JLGA 2X5RA 2W2OP 6FD1A 2K1RA 1YWXA 4I2QB 1U0SA 4DZDA 1WI6A 4JI7F 1Z2PX 1LOUA 1S1XA 4KSEB 3UR3C 3MF5A 2ZD1B 1JKHA 1YBTA 2BJOA 3UDEA 3OJUA 4K4YA 1NJZA 5AXKA 1HW9A 4O7RA 5DETA 3DOKA 4DFJA 1VK8A 3J80U 4DOZA 3AW8A 3VGTA 3O44A 2I5JB 2BDPA 5I5SA 3BA9A 3KJQB 2M48A 3I32A 2JVRA 2FJWA 2IAJB 3A8IA 2Q2UA 2HU9A 2CVEA 3I56S 2GVZA 2YZLA 3QWPA 1AYEA 1VBGA 3SSQA 1CSJA 1VIXA 2IRYA 2CPXA 1TP7A 2K7JA 3C15B 2KI7B 1VQOZ 3UR0A 2QKDA 3K7AI 4RX6A 1VQL1 2WVFA 2ZE2B 2ZZMA 3G8CA 4C3LA 4A93I 2L41A 1NJYA 2V8IA 4MIAA 1VQ7S 1YHQ1 3RGIA 2HNZB 3MCMA 1TL4A 1UEUA 3MM5A 5DO2A 1Z03A 2V9WA 2E1PA 1C30A 4NH1C 4LRBA 2CNOB 3MMBB 3D1QA 2VICA 1S49A 1RU2A 3JSBA 2MKSA 1FDNA 1UFKA 1F5BA 1ZZFA 1MWYA 2RHQB 3GLJA 3JRWA 2ZH1A 3N6NA 3BO4A 1DJ0A 3KDNA 2A6OA 4B9NA 1H2VZ 2GTHA 2E9HA 5C24B 2V4JB 3J81U 2CUYA 4L72B 4USKA 1Q53A 3Q22A 2XO7A 3OTEA 3H2VE 2YWHA 1GT8A 4ZVGA 5D8HB 1DURA 5F0UA 2VC1A 3MZLB 2Q4ZA 4O3NA 1J5EF 3OSPA 2OFGX 4USUA 4I0WA 3SCKE 4QU7A 4DFMA 1QF8A 3VGSA 3CJKB 1NSPA 1RK8A 3DLBA 2JIPA 1KONA 5JVLA 1DQ9A 3TZYA 4ZQIA 3HZGA 2QB5A 2H65B 2DGQA 3BG0B 2J9DA 3MEEB 4C48A 3CO9A 2W9CB 4DR2F 1RT7B 1TKZA 2AEMA 2A2CA 4NRTA 2D9OA 2DNLA 2JOQA 1Q0NA 2NU7B 4ED4A 2JEJA 2ASYA 5FR9A 3TIIA 1G1XA 1ZH5A 3MI7X 2VQEF 2ASDA 4LFCF 1FJCA 3R7NB 1X9WA 1SQGA 3HVRA 4ZVPB 1HWLA 4C8OA 2OTLS 1V6HA 2LECA 1YG0A 4B3MJ 1Y1VI 4DUYF 2YY3A 2WOMA 2E5GA 4CDIA 1WTBA 2XY7A 1WC0A 1Y4ZB 4ZVSB 3CIZA 1FCAA 4LIWA 2UXCJ 2XI2A 3BPDA 4URQU 1PC5A 4JI4F 1K9M2 2RQMA 1VK3A 4OI1A 5C4JI 2DLNA 3DLEB 1N0UA 4HTIA 5IV4A 1N36F 4WE1B 1A9NB 1X8DA 2AIRB 2FLLA 3MZIA 2VG6B 4C2MA 2VFRA 4XZ3B 1S0VA 5HK4A 1RWOB 2ACMA 2FP4B 2CJ9A 5GONF 2XWXA 5KG3A 1Q7LB 5IWAF 2VDIA 1U49A 2IFXA 1E6YA 1YSJA 3D0GE 4LBPA 1JNZB 1PBAA 4B3TJ 3HVAA 3U50C 1RAOA 2V2QA 1X0TA 4NZ6A 3PR5B 1YBUA 2IRXA 1K732 3DN9A 3VMHA 3D9BA 1H98A 3OFGA 1EETB 3QT5A 1UTAA 2JZ5A 1RO2A 2BRKA 4DQYB 5KTQA 4LSLB 4LJMA 5D1OA 1VQLZ 4X4SA 4LSNA 2Y8WA 1EUCB 1QVFY 3IWXA 4ZJLA 5AN9F 3AB2B 5DGBA 3KK3A 4QYZJ 1GTEA 2CJKA 4FN5A 5KFIA 4QZVB 4FXVA 5LXTF 3I9V9 1MNEA 5C44I 5KFTA 3VWSA 3GILA 4HNVA 1K9M1 2BE7D 3FCHA 4OYIA 4HGYA 2M8HA 3KXDA 2MHNA 4RUCA 1T9WA 4LFBF 3FUYA 4CLTA 4MV4A 2AP6A 2KH9A 3H5SA 1RLYA 1LFPA 3O3LA 1LK5A 3S2DI 3GIJA 4CC5A 2O3DA 5ITHA 1S76D 3DM2A 5CQGA 3EVMA 3W5YA 2GU2A 2ZWOA 1C4CA 2AX1A 4H4KC 2MPUA 3PHEA 4KKOA 1U1NA 2CZVC 4ECTA 4G1QA 3MFIA 3VAKA 2HQCA 2HS4A 4OX9J 5KFLA 3GTKI 5ADZA 3DI6A 1IBMJ 3W8GA 2CZGA 3QQMA 1LNQA 3FSXA 3BSAA 4RNFA 2FY8A 4DV2J 4MIBA 4PG4A 2XCLA 1REVA 1IKWB 3NLCA 2PN1A 3QMQA 5CZXA 1S68A 2W6MA 1W2BY 5A2Qb 4E2YA 1BXNA 5DG8A 3JTPA 2B4UA 1KRLA 4RUHA 4OL8A 5BYBA 2BE2B 1XMQJ 2H54B 1BWVA 3PFEA 3CDWA 1U1MA 4KAIA 3CTRA 3UO0A 2GMJA 3PYEA 3OT9A 3R5BA 3J7A4 1PKUA 2P3YA 4QTTA 1RTHB 3DYAB 5J2MB 1RHQB 1O8BA 3UE2A 4FBTA 1CVJA 5JVHQ 3I4MI 2YKPA 3JAMf 2W6QA 3AB4B 2ZVSA 1K73T 3HHEA 3ETHA 3U1MA 1KBLA 1R8CA 3IRXB 2KO1A 2BJ1A 2DB1A 5D0GA 4MV8A 5KG5A 4MRIA 1OY9A 3OXGA 3T9AA 3R7BB 4O3OA 3W3SA 2BACA 4UUGA 5FLXf 4O3QA 2XMKA 2IVFB 2B63I 5K20B 4WWSA 3MM7A 2GQRA 1KDNA 2XMMA 1RWPB 2F3JA 4MYUA 1IWGA 2FUG9 3T9ZA 2CJYB 4A8XA 3TW6A 2HGXA 4IR9A 3MPWA 1XNQF 4EFAC 1FRHA 1S77D 2VR1A 3CCQS 2FB9A 2G2KA 1QTMA 1OSDA 3HOZI 1DL6A 2EFQA 2G1HA 3JXOA 3OHAA 4M5GA 2XLKA 4PZ8A 2DGVA 4LF6J 2HHTA 3B82A 4IR1A 2PT0A 3NC0B 4U67Q 1FXLA 3MAAB 3I4NI 2KHDA 1HL6A 3SCJE 4MFBB 2CQPA 3KMSA 3CC71 4NLQA 3EZUA 2AYEA 4PPDA 5L39A 3I12A 4RNOA 3LP1B 3MMCA 1C1CA 2EJ3A 4O0NA 2DHXA 2AJ4A 2A2DA 2RF2A 4P2MA 3MEKA 4WIQA 2CNUA 3NP5A 9RUBA 3JQKA 4TVAB 4PG8A 2WW4A 1Q4RA 1TWHI 3CW2C 3VTIA 1MSWD 5GADI 2OFHX 2M52A 2QO3A 1UKUA 1RADB 3EDQB 3WWIA 1FT8A 1A0IA 4EEQA 4NOHA 2YH1A 1VQ4S 3P3DA 2IDLA 1CPZA 1X4FA 2GO9A 1VISA 1CKMA 2JL9A 3AD9C 3FDSA 1CS4B 5T14A 1WZNA 1YJW1 2GGPA 3BO2A 1LW0B 4KYZA 1S6PB 1S7MA 2RJZA 2CG4A 5CH7B 1USPA 1U09A 1GK8A 2YKQA 3VAIA 4RZQA 2M2BA 4GO7X 4BDPA 2X1BA 3JAMU 3HSJA 1ZH1A 4Y8VB 3U1LA 2GVDB 3HLUA 5KFDA 4TVIA 3OVAA 2Q7DA 2BMBA 4MD7A 4NLSA 1M1HA 3RTXA 5FLXU 5C8YF 3SDEB 2D3OR 3BA8A 5K14A 1EX8A 1P16A 1KEKA 4J9UE 3GR0A 3AD8C 2YKNA 1SJ4P 4Y65A 4E0DA 3KLIA 2J6SA 2QMUB 4F0KA 3IR5B 1R8BA 1CG2A 3OVSA 1PG5B 2HK2A 2YPYA 1MMLA 1N5VA 1VQ8S 4QR1A 4GKKF 2A18A 3ZZRA 2DNPA 1LWFB 2ADBA 1N2FA 1X5TA 4CH0S 1UP1A 1RTJA 3IS9A 3E2EA 2QLJB 1Q81T 3I87A 1N5YA 2AGPA 5D6GA 3TZZA 4AUKA 4FU0A 2NXUA 1RT3B 3NH8A 4NXNJ 3TX8A 1B99A 3EMTA 3CWJA 4RO0A 1DLOA 2CWKA 1ZA1B 2HGNA 3IG1A 4MV7A 3UYYA 4Q8FA 1RTDB 1BC6A 1YVFA 2AF6A 2Y1LB 4O3SA 3U7JA 4O2AF 1JKJB 3TNVA 3A3OB 4UCVA 2Z2ZA 1AUXA 2DGXA 5HL7Q 4O84A 3G87A 2OPQA 5KFUA 1E6VA 1HW8A 1ZM3A 3CC7Z 1RT1A 2XULA 3MM5B 1KC8T 1C0UB 1HQEB 3N6RA 1FHTA 3HT0A 2HVHA 2EC0A 4WKRA 3LGNA 3CSKA 2POKA 1FESA 4DR4J 2RQKA 3HULA 4TU7A 3LTOA 5KFAA 4HTJA 2C28A 3KMQA 4YB6A 1BQNB 4ZPTR 1DAXA 3ENAA 4C3KA 4WTOB 2UUTA 3WNZA 3UDCA 3CC4S 4XPCA 3DTFA 5JH7F 2RRNA 2R7SA 2F40A 4KO0B 3VOTA 3F56A 5KOXA 4OI4A 4UY85 3R5FA 4JV1A 3SQGB 5B0BA 2HHPA 3PRVA 4IG0A 4DR1F 5G0RA 5J2UF 5CCMA 3W60A 5B08A 5C25A 3PYGA 4ECQA 1FRLA 2MZJA 5LP6F 4FFRA 4F4KA 4NLWA 2DHSA 3T9BA 4P2XA 4UZCA 4YB1P 3MEDB 3AXMA 2Q2TA 4LRDA 4N47A 4L74A 2DGWA 1P9QC 4USMA 2RNEA 3RV4A 2A0FB 4ZLNA 2A1BA 4HHUA 2J8SA 1GMWD 2FC9A 1L3UA 3EVOA 3OUYA 3KG1A 5KFNA 1CQNA 3ZXWA 1WD6A 4AD6A 2RU3A 4X4VA 5LM7E 5D15A 2JNYA 1S7IA 4DL3A 5D3GA 2IM0A 3DDKA 2D1CA 4X65J 1Z4UA 4RL1A 1TELA 3IBCB 1GEHA 3N4WA 2DYAA 2QFJA 3TANA 1P8LA 5K8NA 3HVWA 1EYZA 2J5AA 1D0EA 1S79A 4I56A 3IR7A 4MA0A 1NU4A 1S97A 1NM2A 3LP8A 2VKRA 5KS8A 2I1RA 1VCTA 2ASJA 3PR4A 2MY8A 1D9AA 4PG7A 5GMEA 1ZBTA 2K3IA 2QL7B 1DQAA 3Q0AA 4F0HA 2QLBB 4TV8F 3I31A 3PCOB 4C8LA 2UXDJ 1IM4A 2M0GB 5LL6d 5GMKa 2B4PA 2MLXA 4JV5F 1HR0J 1XIQA 4Q5VA 4NZOA 1I50I 3N5FA 3GIKA 4JYAJ 4F36A 4LSNB 3TA1A 4A3FI 1UVIA 3D54A 4NBHA 3QZ8A 5HSPA 1ZAUA 1GSAA 3VQTA 1RT4A 2NLWA 3DAAA 1TKXB 5C1PA 4Q4DA 3CC2Z 3KTQA 2XMTA 4UUWA 3D9XA 1Y5IB 3QSYB 3HHNB 4CMFA 3HM9A 2O1PA 5KFOA 3D6TB 4HR2A 5C42B 1GNKA 3C6UA 1G2WA 2KG0A 3R27A 3HFZB 2NCKL 3SFUA 3CCU1 4G65A 1MN7A 3CCRS 1EQ0A 2HGLA 2ILYA 1LV5A 4RWXA 5HN0A 1JLGA 2Q3PA 1FKOA 3D1HA 4JI1F 2VBWA 3OV7A 4W4MA 4U96A 1AA6A 1G7CB 5DM7Q 2OTJZ 1TK5A 5T7LA 2WAQD 2Q1LA 4J91A 3BDEA 2IMWP 4B9VA 1C4AA 1N48A 1HNXJ 4NA1A 3M30B 1YUAA 3QT7A 5KT6A 1AT1B 5CM2M 4RW7B 2F8EX 3AD7C 1NRKA 5LXRA 1I51B 2FC8A 3JB9k 1GGOA 1X4EA 2HQDA 2E5LJ 4QWCA 1S0OA 1HHTP 1H3DA 3KHLA 1I2KA 2OEKA 3KIHA 3ILLA 5MAOA 3H4DA 1WHYA 4XYLB 3RRGA 3G86A 1JLEA 2KXHA 2HS3A 4CL1A 2HHFA 3IR6B 2DPJA 2PE8A 4ZCLA 2JX2A 4QIWD 2V58A 1D1UA 4E8UA 3IWLA 4DR5F 1UETA 4CO0A 2JHEA 5DRKA 2VDHA 2LFVA 4ZHRB 2WRMA 3NNHA 5DGIA 3M8QB 3MD3A 1IVZA 3W63A 4ES3A 2ILZA 5A8WA 3E01A 1TAEA 1WEYA 2NS1B 5F3TA 4JI3J 3GTPI 3QFFA 1S6UA 2ZFHA 4RLEA 4LF4F 3CCJ1 4H4MA 3R6GB 2HHHJ 2YU9I 1RYRA 4NCGA 1YJNS 2XI3A 4DPXA 1OWXA 2WONB 1Y10A 3QLHB 2DR5A 3CCMS 3W2VA 4MV1A 2Z57B 3T9FA 2J9EA 4ICLA 3FBFA 3IN5A 2BABA 5EHHA 1BUXA 1NKEA 4FFNA 4YR2A 5BJRA 1RCXB 4WK1A 1KEEA 3M05A 4RZRA 1N0VC 2CQGA 1GAOA 1O51A 2FHMA 3GJRB 3M2RA 4TLRA 2HFNA 3LQVA 3ENWA 1MU2B 1UVKA 3GCXP 2V34A 4A8OA 2QL5B 3FCWA 2I3CA 1KN6A 3N0VA 4ATNA 1FVQA 2DPIA 2V2VA 4WBNF 5BWXA 4O7SA 1VQNS 1Y5LB 4NI2B 2LIYA 3HKZD 2KU7A 2KZMA 3QBCA 3ET6A 1P9YA 4RUBA 1SB6A 5KFJA 3Q8SB 2KXNB 2VBXA 1DTQA 4I50F 3TJ9A 1TMMA 3RAQA 4X66F 3ISNC 2V68A 1C1BA 1TUWA 5DAAA 1CEZA 3WWHA 2R82A 3NAIA 3MM6A 2GMLA 3DKDA 2NXJA 2F5GA 3RU0A 1CQMA 3D28A 3NAHA 2D3UA 4RNMA 5E5NA 2DH8A 2W2MP 3A8KA 2GGPB 3K7RA 3BYRA 1SH0A 2VOPA 3B8HA 3W9HA 2RB7A 2IA6A 2YS6A 2GTIA 5ETSA 2FVSA 4PUOB 3LP0B 3L09A 4QWBA 1MN9A 3D0IE 5DQIA 4RS4A 1TL5A 1R0CB 1RWUA 3OL6A 2I9SA 3G4SS 1WF1A 1JDEA 4YHHJ 1EHWA 1BNCA 1N8R1 4OI2A 2QEXS 2ZDPA 5K14B 3CJQA 2ZNZA 2J9DE 2CQ2A 3D6FB 3BO3A 2RIQA 2DVIA 4ZVEA 1RT5B 1JB0C 4DR6J 4AE5A 3EEDA 1VJQA 4NBGA 2HZCA 5GAHI 1Y3KA 4RVFA 5HATA 4LBHA 3BM7A 1VLYA 2OPSA 2Z8QA 1NDPA 1S1UB 3Q2TC 1KHVA 3CCJZ 5D4NA 4M5LA 5CCLA 3OPKA 3A3PB 3W9JA 2JFKA 4YAKB 3DU6A 5CZVA 4BBSI 1YLXA 2XBPA 4K2JA 2MZTA 2E2II 1UJ5A 5HJYA 3ILOA 2B5JA 3FCVA 4R5PB 1FJ7A 2E1RA 3CNQP 1CC8A 1SC1B 5BWVA 2MQPA 2M70A 4FYVB 1BQMA 1VRUB 5CYJA 3IG1B 1A0OB 1WEXA 3QPIA 3EGZA 1U25A 4MKBA 9ATCB 2H4WB 3CCTA 4LF2A 3QO9B 2D69A 1M1K1 3EX7B 2W4DA 3WX8A 3KK1A 4IO9Q 4NRUA 3NCRA 1M5VC 1QVFR 1PJ7A 3LP2B 4OHVA 5IM0B 2DEJA 1P1TA 4JI0F 2CQCA 5JQGF 3LWBA 4E32A 3WC0A 5KFHA 1VBYA 3KWMA 2HBYB 4I1TA 3IMQJ 4I7FB 3JSYA 3ZZOA 2R4FA 2DXEA 4I2PB 2ZC4A 4MJKA 5ETOA 4CT9A 1F3FA 4ZVOB 2WTFA 3U55A 2KDOA 4TN2A 4UUXA 4O4GB 5ETRA 5HMXA 1S4EA 3NGSA 1V3RA 4EBEA 5LJ5Y 2WK4A 1NJIT 5ETVA 2DR7A 1NPRA 3R9RA 4ED1A 2WSEC 2W03A 3QJJA 1VQMZ 2LXFA 1ZTWA 1E4EB 4RJVA 5E3RA 5BPFA 1U1LA 2JA8I 2CQ3A 4ZJQA 2RSQA 3PJWA 2FZCB 3FEZA 4H4OA 2W9BA 1R43A 3HSDA 2P6SA 2HZVA 4WFBQ 3ADAC 4WP3A 1GQEA 5H9EJ 3QGIA 3FSIA 3CJ8A 2VV5A 1OQ6A 2EK6A 2XZWA 3LH2S 2ZJRQ 3EERA 2IZ4A 4N76A 1A9XA 4DX6A 2DT9A 1T9VA 4GLWA 4USIA 1WSRA 2HK3A 2AKLA 4ELVA 4LF8F 2EKNA 2COGA 1X4HA 1W2BR 3L3CA 4ILMA 2FHJD 3T3FA 3KYHC 2MJNA 2B8QA 2OO4A 2MY7A 4CO5A 3M8SA 3SZ2A 2W6NA 2MLYA 3MOZA 4GLXA 1ACMB 4F02A 4L76A 5LSOA 1Z2NX 2GLTA 1TUGB 4GC7A 3NWRA 2RKIA 4P10A 1X3ZA 1WELA 2RPRA 1IBLF 1AUDA 4N77A 2KFNA 1I1LA 3ORRA 4DN9A 3R3TA 1V3ZA 2VQDA 1SL1A 1NZAA 1V5VA 5AXMA 2QSFA 1VFJA 4DR2J 3GJXB 3ONQA 2HQIA 3Q23A 5I4MA 4DPUA 4IFVA 2W2QP 3G711 1UMJA 2HSEB 5EX3A 2G2YA 4CRJA 4AT1B 3CJ4A 3Q1KA 2VQEJ 4O7ZA 2GO8A 1N32F 2X7IA 2FDNA 2G2OA 4LFCJ 4O7WA 4FS1A 5BYSA 3DCAA 2VIHA 2HVEA 2MKJA 3GCFA 4DX8H 3HFKA 3I4HX 4YDDB 4M5HA 1JLQA 2YNIA 4J9NA 3UZOA 5EWGA 1KKHA 4E2ZA 2CNNB 3R9LA 3JSNA 4HACB 2FTRA 5LL6f 5T41A 1UA0A 1N5QA 2NSCA 3EWGA 4CMDA 1YK9A 5FDLB 4PXCA 1H38A 1NPPA 4RVGA 1N36J 2W2NP 3UN2A 4I64A 4RR5A 4OHWA 2HVRA 4DG1A 1GX6A 2VFTA 4CZCA 3L7PA 2RH3A 3DOMB 4Z7CA 3CMQA 3GQCA 2U1AA 4C98A 1N88A 2B6AB 2P8IA 3M8PA 1ZTTA 5RUBA 2VQFF 2QC3A 3KIFA 1DAAA 1G3OA 1FVSA 1NUIA 2QRCB 4C6AA 2JRSA 3MM9B 8AT1B 2AT1B 4O4JF 2VH7A 2R2RA 1S9FA 1Z02A 4W90B 3CCLZ 3LPEA 3LAKA 2HPUA 3CEDA 2OELA 2EFGA 3G8QA 3O2IA 3VAHA 3S1TA 1X0PA 3D68A 3K89A 1LWEA 3HK2A 3AOBA 2GC8A 4GC6A 2QA1A 1FDBA 1TMJA 4TQSA 3CMAS 4OYBA 5IV3A 1VHIA 4NYEA 2YXLA 3ULHA 2GPSA 3W9IA 4IWYA 4GVLA 1W25A 1QAJA 1WACA 3C19A 1RHKB 3JZFA 4WTYA 1N33F 1FXDA 2V67A 5A6PA 1Q5VA 4ALZA 2J6UA 2UVRA 2HFZA 4IRKA 1UC9A 4UT4A 2RS2A 4QIVA 1URNA 2ZDHA 2CPIA 1RT2B 3CCZA 4X4UA 1Q7YT 5F8MA 1FJGJ 2NPFA 2IY5B 5T7LB 2CJQA 4A8SA 2VG7A 4E31A 1S1WB 4Y28C 2J7KA 3BGLA 3ZC4A 3CCVS 3HO1A 3DGPA 3FGVA 4K8RA 3H7HB 2ALYB 1WR2A 4PZ7A 5HMWA 4K5SA 1IN0A 3CJ2A 3F41A 3F73A 1KJ9A 1GSHA 2MLZA 1YQHA 3CIMA 2O67A 1YIJ1 3UDVA 3PO3I 3GP9A 4R25A 4F4AA 1L5UA 2HWHA 5LA6F 4P7TA 4B9MA 4ZLPA 2EKYA 3LALA 2VL1A 3PXGa 3FBEA 5KFWA 2AGQA 1Q16A 2GIRA 1ZAWA 4FP9A 1JLBA 1PAUB 4JI8J 2V94A 3JAMb 3OTCA 2PMWA 4GVBA 2B9XA 1FNXH 1SJFA 2A6MA 3BABA 3T6JA 5F8GA 2XWYA 4CLYA 1PILA 4JV2A 2FVQA 4IOBA 4N8NA 3GIDA 4A3MI 1T11A 4G6VB 3UNGC 5FLXb 2XMAA 2YQ3A 1PBUA 2E66A 1U1PA 3RB3A 1QTNB 2COIA 4A3BI 1V5IB 4QSHA 4CM0A 3TQEA 5THWA 4ED7A 3HOUI 2R7XA 2PC6A 1QSYA 2YNGA 4LR9A 1LK7A 3TARA 2V8PA 2JS4A 2M7SA 3OR1A 1VQ61 2HBQB 4ZCMA 2E7WA 3U02A 1IBKF 3QJPA 2VKZG 1NK4A 3LGMA 3DOLB 3VAMA 1AZSA 1IWAA 1TTHB 4WU3A 1SQFA 2JIMA 3ORQA 1TV6B 2N4DA 3FEXB 2HF1A 4NBDA 1I7LA 2RT3A 2EW9A 3DRXA 2DNOA 3ZZTA 4MXUA 3GG0A 4QPXA 1XNQJ 2OUGA 3RRKA 1K0VA 4U9RA 2C3OA 1TQLA 3KAJA 2C2NA 3G82A 3T1HF 4ELUA 2ZH2A 2V45A 3MECA 5GADU 1I3OB 2ZM6F 3CMEZ 4UF4A 4HN2A 1ZB9A 1FF2A 3M2UA 1YJUA 3QQCD 2AMCB 3W5ZA 3KUHA 2CKWA 1SQEA 3BG5A 7AT1B 1V3SA 3ET6B 2I2YA 2ZGIA 2FZKB 2BOAA 1SKRA 2KRRA 4I67A 1YDLA 1S6QB 3DRPB 4ZPDA 2Y3YA 4Y2IA 5M2PA 3M6UA 5F8LA 4ECXA 1YITS 5KG1A 2A1HA 2XSJA 5HROA 5EX0A 1IR1A 4LH7A 3SYZA 1TFIA 4NLGA 3ZZ0A 3Q24A 5DZ6A 4OJGA 3FRYA 3R6LB 2C2RA 2M9KA 2B4OA 1FKPA 1R9TI 2MKCA 4DUTA 1YJ91 2JSXA 3I55S 2G2ZA 2BXJA 3DRSB 1VC6A 3JYTB 3H5UA 2RAQA 2KI2A 4MTPA 2OD4A 3RW7A 2NAPA 4M5DA 3ITHA 3N5BA 5AE3A 5F9NA 1K8A2 3JZIA 2XMJA 4ILLA 1HQUB 2D7SA 4WCEQ 4XIUA 4FFOA 2X0SA 1OIAA 4IKAA 2FHOB 5KG6A 3LA0A 3S16I 1NSAA 2NSBA 3DLKA 4J9PA 4IQMA 2EIYA 2QLWA 4ITSA 2W2PP 4DJBA 4USTA 1AUSL 2BQUA 4M5IA 3MMJA 1JQGA 4KQZA 3I9ZA 3S14I 4L3NA 3FQQA 2VU5A 4DV0F 1VHFA 4DUZF 3KK2B 4DK1A 1V9OA 1VQ7Z 4Q44A 3LUSA 2RUGA 3NG8A 1U47A 1LWCA 1X4CA 1VI7A 2DH7A 3OSNA 2RQ4A 4CLLA 3VAFA 1T9YA 2I87A 4R0EA 2IHR1 4A47A 4LRFA 3MTJA 3T4NB 1RTIB 3PX4A 2H5IB 5E33A 3LF0A 4GKKJ 5AXNA 4R0JA 4XDDA 2CJAA 1HYSA 1HMVB 4ED6A 3TW0A 4Q2LA 1LXJA 4LIRA 3NH4A 5A0YA 3TW7A 2BBEA 4DIMA 4DQQA 3L2PA 1K8A1 4NYOA 1DY3A 4RBVA 5KFRA 1HARA 3CJ5A 2QTWA 4M5NA 1BLUA 2R7NA 3EICA 1WCMI 4XYMB 4MKAA 4Q0BA 3VGUA 4UW2A 2DD8S 4OQJA 1RZMA 3Q8UA 4PG5A 2DR9A 4DS4A 2B7CB 1VJWA 3RUPA 4HH0A 1HI1A 3D0HE 1AW0A 5LYJF 1R0AB 4CTAA 2APOA 4PEOA 3HF5A 2AGOA 4N8OA 1N54B 4PBCA 1VQLS 4JBCA 4O4RA 3K5OA 3EPGA 2BANB 4DL4A 4KJIA 4NYZA 2LA4A 1X9NA 4P73A 1YHQS 3VHQA 3G2XA 5L9XA 1U2FA 1N5SA 1NDLA 1X5SA 1FJEB 3Q2SC 4M95A 3UWTA 5BYAA 4X4NA 5I5VA 3T5JA 1EB0A 2W9BB 1I94J 3UZBA 2A10A 2UVVA 2ZBIA 5J1EA 3M6VA 4DR3F 4ECVA 2DE5A 2X1AA 4GKJJ 3BR8A 1D09B 2BKNA 3BH6B 4Y0FA 5L1JA 1YJ9Z 1IQZA 2CG8A 2AQ4A 1W93A 3T99A 2HS0A 1Q822 2HWTA 4DV5F 4TM5A 1S9GA 4Y00A 3C2PA 1WG4A 2LXIA 1JWWA 1WC1A 1UWAA 3V4MA 3KLFB 3PO3S 2ZOGA 4F4ZA 4DR1J 5A2QY 3KDOA 1PAEX 2HMIA 4YMEA 2IM1A 1U1QA 4EGLA 1GXTA 3HMJG 1TK8A 1BGXT 1HBOA 1IXKA 1T3OA 2MKYA 5J2QA 1CKOA 2CPZA 3QGPA 3NBPB 3KLEA 3GIMA 1WG1A 1UWBB 2DTJA 1QUPA 3MEGA 1JXEA 2YX1A 1KQFB 4BWMA 2ZC3A 2R8KA 1UPMB 3OHBA 4O86A 4CP5A 3HT5A 1KRPA 3RR7A 1T03A 2ZH4A 2GA7A 1FRKA 4A3KI 4OLOA 2B0GA 3IA0A 1FA0A 3GLKA 4XTTA 2ZUGA 2YNIB 2KHCA 4NFRA 3U1NA 4CNYA 2LQJA 5HMYA 1QVGR 5FD1A 2WB4A 1Q821 2WVDA 5D4OA 3SCLE 2WSFC 3PW7A 1WSVA 3PFFA 1YJ7A 3M9OB 1W2BZ 2V50A 3GDEA 2C2EA 4DG1B 1VRQC 4OZ0A 3OUZA 1J5OA 4YOEA 1C0TA 2F9JA 4ZVHA 1WJ2A 3HHLA 4ID5A 1M902 1JNRB 5M2UA 2DHAA 4ZCKA 2YZMA 2R86A 4OZ1A 2ZBCA 1SIWB 4KR0B 2BJEA 4IUFA 1UW9A 4AL6A 1NO8A 4GO5X 3CGIA 3BGRA 1JLAB 3I07A 3MPYA 4EK2A 2M6NA 4DRFA 4C11A 2QN6B 5D0EA 2DIUA 5C4XI 2GFFA 3S1QI 2EJ2A 3ZFVA 3D2LA 5BMVF 2BUNA 4FKYA 3UNYA 1R27B 3HX9A 4JI6F 4KC5A 1YRUA 2O4HA 4M0JA 2DEIA 4OJ1A 4OZNA 1X4DA 1K83I 4KH0B 3BPSP 1SFOI 4J37A 2XLIA 4AXJA 1CJKB 2D41A 3JSMA 3K58A 2EFNA 4DL2A 3FKII 3CCS1 5B0CA 4XX2A 1P9NA 3LULA 3DLJA 4CHIA 4H54A 2VG7B 3I0SB 2HIVA 4JI1J 5AJ3J 1ML8A 4KGZB 1ZAVA 3MM8B 3WQPA 1M901 3ETJA 5DISC 2JH3A 2R8JA 1ZZNA 2HNDB 2KKHA 2UZAA 5J2PB 3BREA 4O7VA 2HZAA 5A6WA 2RHBA 3FFIA 1H7XA 2YW2A 4RNNA 2IC3B 4YAJB 4NPOA 4DF8A 3UCUP 2JEGA 1RT6A 2IYGA 4WZQA 1EKRA 1NCLA 3W1YC 3IRWP 2I8EA 1EIYB 4PWDA 1UJ4A 3T1YF 2MGZA 4Q43A 2WBRA 4BC7A 1RHRB 4A8YA 3V4IA 3H0GI 3C16B 2JIOA 4U7UD 3OD2A 1MROA 2V8JA 1S1VB 2EFVA 3F3PC 4USVA 1F3VA 3KLVA 2PEHA 5LOVF 3X1LB 3I4PA 4PXBA 1VRTA 2HW3A 2DK2A 5FPRA 3PVXA 4A8KA 1TL7A 2VFVA 4N5SA 3K5NA 1TKTA 1OSCA 2K7KA 1EKPA 1S0NA 3M3YI 5K8MA 1FDIA 2R7RA 2WVCA 3T54A 4RPFA 3C14B 1K47A 3A13A 4DSJA 4O7NA 4EMDA 2Z56B 2G0IA 4U95A 1ROFA 1QLNA 2PI5A 3TY8A 2KT2A 3NGKA 3M7VA 3C6TB 1R7IA 4C4WA 4UOHA 5IS2A 2MZQA 1FFSB 1NK7A 2VONA 5A8KA 4LF4J 3QT6A 3R5XA 4ZP8A 1U1OA 2GJIA 1S1TA 1ULRA 1RHMB 3H5XA 3T5KA 1VQ4Z 1RTZA 3D67A 1CJVA 1HPZA 4LQ3A 3EYZA 1KVIA 5HBMB 1N34F 4YS2A 4R8UA 2ZUAA 1Y9OA 3Q8YA 1JJ2Z 2GIFA 3QGHA 4HVZA 4F3QA 3TDHB 1VQO1 2VPWB 3G96A 1XMOJ 2XCPA 4HGZA 3J80f 2OSQA 1CKNB 2BKOA 1YI21 4CI0B 4RUAA 4K4XA 2K3KA 3FK4A 4PKDB 2Y0SA 4HHHA 2HRYA 5CYQA 4BLGA 4OJ3A 5D77A 1T95A 1KOOA 5H1SV 3TIGA 1TA8A 3NOCA 1NAQA 2YNHA 2AYGA 3NCPA 3RTVA 3GTGI 2KRBA 1RGVA 1K1SA 1I1KA 3EE3A 2VZ9A 2I38A 3VA7A 1RQ0A 5HAOA 3CC7S 2JJ4D 3E3XA 2OP5A 2IM3A 3DHWC 4Y7NI 4RWWA 3JS9A 1GMUA 5A8RA 4IWXA 4LRCA 4FNHA 1JJ4A 3NNCA 1UEKA 3A8EA 4MAKA 2CRLA 3CCSZ 5KKNB 4KT0C 5ETLA 2F4VF 2OPPB 1SV5A 3MPVA 1RACB 4IOCQ 3AA8A 3VQSA 3GFYA 4NLUA 2PM9A 4F0MA 5JMNA 4I6YA 1HNWF 1DV1A 3GKQA 4RW6A 3I0RA 3QAEA 2OMOA 2AV5A 2ZDGA 3FBCA 3IAM9 1YJWS 2UUCJ 3A3NB 4LH6A 3J81f 2B9YA 3Q83A 2EBEA 1HBUA 3TP2A 2K3RA 4PXEA 1UVLA 2YPZA 1IJFB 1RISA 3MOJB 1WRVA 3UCZP 2GHWA 2CPEA 1T7PA 1XMBA 3MJFA 3BSOA 1WOPA 4B3OB 2OEJA 5K3WA 4ZKAA 5K2MA 4DSKA 3DMJA 1IKXA 2ZJQQ 4DLEA 4KY3A 3L7UA 4WF9Q 5IZHA 2UUBJ 3CDAA 3GYGA 4DBQA 5J1NA 4DLKA 2RHSB 2GNKA 1ZM2A 1KBRA 5CHCB 4C8MA 2LQBA 5HQMA 3FRZA 3NCQA 1M0TA 1QE1B 4KFBA 1IKVB 2YKOA 5BPHA 3U9TA 1NJWA 3TVZA 1GMWA 4QR0A 2W7OA 2P0AA 3MR3A 3T1AA 3NGUA 5D4LA 2N3LA 4AQYF 1NB2A 3MUTP 3T9CA 3B6BA 4ER8A 5I42B 3GU0A 3PIOQ 4ETZA 1U24A 3BDPA 2OPRA 3S15I 1VGYA 1NKBA 3IP0A 2YX7A 4PZ6A 1X4AA 3RG6A 5IP7I 2RU9A 2V59A 4MK8A 3TOQA 1OQ3A 4OX9F 1KS2A 5F9LA 3FZ2A 1IBMF 1J27A 3P45B 1VLOA 2HVIA 4HI2A 5FLMI 2AD9A 4RW4A 3WO0A 2QA41 4CO3A 2ZHBA 3H8YA 1KOHA 4DN0A 3BKUA 2QYCA 4NA3A 3QIPA 1YI2Z 2QJ3A 5HP1A 2E2HI 2B43A 4Y3CA 2H5EA 4DU8A 3MD1A 4IDKA 2PEBA 3HBLA 4FYDA 1U8SA 3T19A 2A3JA 2RS8A 1KSPA 1CJTA 1SJQA 1O0PA 1IKYA 4X4QA 2DNNA 2W71A 2BM1A 5LMNJ 1Q1KA 4MD9A 2ERRA 4RVHA 5E3QA 3H20A 1T02A 2DKOB 1XMQF 2XS2A 2QR1B 2ATLA 4MAMA 4F3MA 1PJ5A 1NKCA 3KKFA 2C2ZB 5IC4B 2XM3A 4LFAF 2PSZA 3NRBA 4PZVA 1B3TA 5GMDA 2YH0A 1FRXA 4Y52I 1RU1A 3Q89A 3TAMA 5HNEA 1REGX 3IXQA 3OFEA 2LP4A 2CYYA 3K2YA 2H5JB 2IJNA 3HB9A 4NZMA 3AJ1A 3VAGA 4URSA 3ZTQA 1YJN1 4ILRA 1VYAA 5BXIA 1VQP1 5IT9f 3VV2B 1SJ1A 3S8SA 1ZETA 2YKMB 4YQWA 1LFWA 4F7VA 4RU2A 3GFHA 1A7GE 3BN7A 2ABJA 4E2XA 1B0PA 2J7UA 3KLGA 2RDIA 3UD4P 3CPWY 5KX5F 4OHZA 1UJ6A 2HMIB 1AFJA 5T6BA 3OR2B 4PQUB 4JI2J 3M2VA 1RO0A 4F50A 4E6NA 1YRXA 1TL1B 4MK7A 1EKSA 2O66A 4X62F 2VPXB 3SV4A 1M5SA 2UUWA 4LT6A 2XS5A 3N6LA 3H40A 2MKHA 1UL3A 3RAMA 5HQ8A 1IBLJ 2VPYA 4ZMMA 1HNVB 1YTYA 2CNLB 1Q78A 3V6DA 3PJ9A 4I68A 1NPKA 4KHMA 2IRUA 1RBLA 3MWEA 2RD5C 1S57A 2YWGA 5DDOC 1VQKS 2F9DA 1LW2B 2RE1A 2V6AA 2GW8A 2QG9B 2JEFA 3HOVI 3PKMA 2YWVA 2IIHA 1U0HB 1N32J 2Y1RI 3KG0A 1DBDA 3UVJB 3CCWA 4RW9B 2HQFA 2R7MA 3BGFA 4J9MA 3CJTA 1OY8A 4MV6A 4PRFA 5KFMA 3PRBA 1T05B 2OH2A 4PAAA 1DIKA 2H1YA 2J8AA 3CCRZ 1FKAF 4DX7A 4HI1A 1U1RA 2FJBB 1NSKL 2Y4RA 1UW4A 4OZ5A 2C3PA 1VKZA 4LR7A 3E51A 2UU9J 4KHPJ 2DY9A 3RB0A 4XDCA 3TO8A 1T9TA 2PFDA 4P2SA 4Q7AA 2FZGB 1EQMA 2CDQA 2V8DA 2R9LA 1KP6A 1YZ6A 3FJ2A 3LAMA 2CQBA 1IR2A 2QA4Z 4QPTA 1S9EA 4RKUC 4BXXI 2MQNA 3S7RA 4KIAA 1HD0A 2HIXA 5CD4A 2JA6I 1N56A 4UY8T 1SKSA 2XY6A 2PMZA 1FWPA 3PO4A 2VODA 4DSIA 1KLMA 1TU0B 2VQFJ 3TUJC 4A48A 2LLZA 4B9SA 3W7BA 2C2DA 3GJSB 4YY3F 4IG3B 1YJRA 1F0XA 3DRRA 4OHYA 4K59A 3G4S1 5I3UA 5IT9U 2EC2A 1CJUA 4YP3A 1U6ZA 1I6HI 1P1LA 4CIOA 2FLOA 4FFMA 1CULA 4AXIA 4BY7I 2CWXA 3S1NI 1N52B 4C0BA 1FK9B 1JXLA 2DR8A 1XDNA 1N6QA 1X4BA 1H73A 3KNAA 4F8RA 3KJVA 2E9RX 1HBMB 1JLFA 5IQ6A 2KPIA 2MSSA 2WVEA 4FF2A 1AA1B 4TY8A 3CCUS 2C1EB 3VMIA 2XMVA 2N3OA 4PYDA 1K731 2MQLA 4I2QA 2NU6B 1VQ51 3DRYA 1YJNZ 1RA6A 2XTJP 5I60A 1PJ6A 1VQPZ 2ZD1A 2J0SD 4DPYA 4B9TA 4YUDA 1CE8A 3SFGA 1JLCB 5I5TA 1KQSY 2LYVA 1L3TA 3GWCA 3ZTRA 5E25A 3MCOA 2M5YA 4UQGA 1AUVA 3CCMZ 3RB4A 2HIYA 1Y00A 5KFZA 2W6PA 3HD2A 2I5JA 2QE5A 4EO8A 2GPWA 2ASLA 1EAYC 5CM0A 2R92I 2IAJA 1KJJA 3QRQA 3F3FC 2WCXA 2HNYB 2MTLA 2WYOA 1WEZA 2MYFA 3I5CA 3UD5A 5KG4A 4DV7J 2NZ4A 3M6WA 4WFNQ 4DAAA 3C15A 1RAGB 1ITPA 2KN4A 1XR6A 2ZE2A 3K5PA 2WSCC 1VR6A 1EKVA 2YWFA 4A8FA 3AJ2A 2BW7A 1WDDA 2WVBA 2E5HA 2ZH3A 4G3IA 2HNZA 4NOZA 4F67A 4DR4F 3SBMA 2NVXI 2ZOFA 2BJ8A 3QIDA 2OD6A 1C2PA 3MMBA 3K8VA 1HNIB 3CCJS 2XLJA 2Q66A 3FZBA 4IH6A 1PYTA 1XNRF 4O44B 3BQ1A 3WIUA 3POTB 2ZEJA 4ZDNA 4A46A 4FGRA 5B0GA 1B70B 3BG1B 2FGCA 5K9FA 5C24A 4X84A 1OBDA 2Z2YB 2Z02A 3N6MA 4OX7A 2R2TA 3CCES 1Q812 4KV8B 2CZ4A 3W2WB 4M63A 4H4KA 3DLLQ 3KLHB 3IO1A 3GTMS 2XYHB 3NGDA 1HA1A 3HSGA 1F6TA 1AB8A 4I69A 4RU9A 1FRMA 2HFSA 4RNHA 3FMBA 1A3GA 2HLUA 3CJKA 4OYMA 2DJWA 4A8WA 5CYQB 2EPIA 1SC4B 2KYXA 5H9EK 3NH5A 3BKTA 4YFUA 3MEEA 2YNHB 2PGCA 3HVTA 2W9CA 3T1HJ 3OFFA 1RT7A 3G4SZ 1ZM9A 4LF5J 1FVIA 5D0RA 3VR1A 1RI7A 2ZM6J 2HVQA 2DNGA 2PD1A 2DH9A 2IZ3A 2QEXZ 4ZHQF 2CQDA 3GONA 3PACA 2V4QA 1WW9A 3B4MA 4JI5J 3ZZZA 2KXFA 5H9FJ 3PV8A 2NQPA 3S24A 2J6TA 4M8LA 1KC82 3HXMA 2ZWPA 1YBAA 3CDEA 4F26A 4HLBA 2P6TA 2V8VA 5E3PA 1VQ5Z 2XSFA 1Q811 2P28A 2HVZA 2VG5B 3P49B 5HVFA 2X1FA 3OJSA 3M1VB 2FJDB 3KFWX 1SCJB 3ZZYA 1GXLA 1ZPWX 4O3RA 3DLEA 4WE1A 3GTLI 1U7LA 1JWHC 1EP4B 2EG2A 1CLFA 2B4VA 2FJAB 2VG6A 1WNEA 1M0WA 3GE9A 1HBUB 3L95X 2P9EA 3V81A 1NH7A 4ECYA 3E5NA 4NBFA 3R23A 2F7VA 3OTOJ 4X4TA 1F2GA 1LWXA 2HHVA 2KG1A 1F1BB 1GH8A 4CYUB 4I4BA 1HR0F 2EBGA 4KGMA 1W96A 1FFGB 1HNZF 3UD3P 2QMXA 3MFHA 2DNKA 4JYAF 1X5OA 3HO8A 2K1RB 1EETA 2R7KA 2HGWA 2UP1A 2V5AA 4NLPA 1RAJA 4U8YA 3HZEA 4LSLA 5DMXA 1S1XB 4V19X 1JKHB 4LF7J 4ZJOA 4TKTA 5BWUA 2YRXA 1KC81 2KFZA 3DOKB 5DQGA 2F4MA 1NK5A 4RV9A 1Y8CA 2NZCA 3FBBA 5D1PA 2W7AA 2YWKA 3WDOA 2UXBJ 3J7YI 1YGYA 3CXCY 3PW4A 2DXDA 1LQ9A 3G6XA 1XK5A 2GVZB 4BWJA 3CEBA 7FDRA 1WI8A 4WHXA 2MQQA 2HFOA 5JQWA 1ICEB 2UVWA 3E8OA 5K8PA 3K57A 1WF2A 5KFGA 1HNXF 3CCV1 2FVPA 3C3LA 5L1LA 5T67A 1APSA 1DGSA 2E5LF 1B7YB 2NUUG 1I1MA 1M0SA 1CC7A 3K17A 2MJUA 3CC21 1A48A 2MDAA 1IKYB 2F65A 4DQSA 4HHJA 3RZAA 4CC6A 2X3GA 1IKWA 2XZDB 2V5HG 4XO0A 1RB0A 2W4PA 3MMAA 3V4ZA 5HV6A 3H98A 3UFXB 1R31A 5KFSA 1TZ0A 2XNQA 2UV8G 1GTHA 2BE2A 3OTDA 2FGOA 4EI2A 2OTJ1 1YX2A 3ZNUA 4YJ3F 2DGUA 3Q8RB 1T0TV 2DCUB 3U27A 4F2RA 2NVYI 5DJBA 4JXUA 3OQ2A 2HHHF 5KT7A 4Q45A 4CLSA 4ZN1A 1RTHA 3DYAA 2VC0A 5J2MA 1OO0B 4UOCA 4A3GI 4YN3B 1Y5NB 1OBGA 2YWWA 2DZDA 4J9OA 2HGMA 4NLYA 3IRXA 1DFDA 5HI7A 1VQ91 1TKZB 5B0FA 3MCNA 4BHQA 4DV4J 2YTCA 2ZHAA 2ZOMA 3WIVA 1QSLA 4CKBA 4DV5J 5KOWA 4DFKA 4KGKA 3PN1A 3V6KA 4WK3A 1NB7A 3TQ1A 3GTQI 3ENQA 3O6QA 3GPAA 4CH7A 1KD12 3VZHA 3TY5A 5KT5A 3DC2A 2R7TA 4LVOP 3JAMY 1RUSA 3NL0A 2WOMB 4EG0A 2FQQB 3G8DA 2J9CA 4CLZA 3SI8A 4YEAA 3NXZA 3DXSX 3EGWB 5FLXY 1IBCB 2C42A 1R0BG 2GZOA 3S17I 4USWA 3CMAZ 3RFCA 1Q86T 3G71S 3MAAA 4USJC 3NBZB 5E7OB 3MWDA 4IFYA 4MFBA 2DIVA 2ODTX 1Z01A 4ZPVR 3BBBA 3NKYA 4PWUA 4U7CA 3MPUB 3LP1A 2FLPA 1NEEA 1WTFA 1T36A 3DFEA 3UN5A 2UUAF 4KPYA 3PJXA 1N5TA 2YZNA 1E6YB 1RAFB 3ZO7A 2AX0A 2EEYA 3S6EA 3CJ0A 2ZKUA 3UI3A 3WO1A 2R7UA 4O0IA 2LEPA 2YQ1A 2OJ3A 1BY9A 1XERA 5DLFA 2QX0A 3PY8A 2VPQA 3BGOP 1RWKB 4B3SJ 4P71A 3QJLA 1VBKA 1X60A 3CCVZ 2E5IA 1R8HA 5M2RA 5DG9A 1H0HB 5D1OB 1FRJA 3BV8A 1S721 4LMZA 5I3QA 3MGJA 1CS4A 4NXMJ 3T9NA 1RCOB 3VALA 1B6RA 4OV6A 3OXFA 4YB5A 3KK3B 4M5KA 1LW0A 1S6PA 5D0HA 4YBZB 1U02A 3HHDA 1OYEA 3CDUA 3FSYA 4HQ6A 4OMFG 1WDTA 3DRRB 4PWWA 1G4CA 4LREA 4OYOA 4YHHF 2EK1A 1RHUB 1OY6A 3W65A 3OUUA 1YJVA 4B08A 2GVDA 4Z37A 2DO4A 4E98A 3R1LA 4OZLA 2HIQA 3WBZA 4CLPA 3DM2B 3SDEA 1FX2A 4DR6F 3DHXA 1UA1A 2HVDA 4NBAA 1TWCI 4KKOB 2DNHA 3QFWA 4ETXA 2PBZA 4G1QB 2L48A 3GSDA 5AE2A 4FVMA 4CO2A 3GJTB 3CVKA 3DI6B 4LVNP 1KD1T 1Q8BA 2LDYA 1TWAI 4PPZA 1PIEA 2LFUA 4DCPB 4ZLJA 1M5PC 2JA7I 3FKBA 3GJQB 1QD1A 3L7OA 3K5MA 4I4TF 1KVJA 4DV3F 1RSCA 1UFLA 4M5JA 1Y3JA 2K5RA 1LWFA 1U6BA 2CQ0A 4LSZB 1REVB 5HVHA 2IM2A 1WHVA 4MK9A 3VCDA 1RYSA 4X4PA 1VQ9Z 3D6HB 5JXSA 2OHDA 1NLKL 4OYXA 2RDJA 2V8KA 4A4JA 1RT3A 4QIGA 2ROGA 4MA5A 2YNFA 4ECSA 2K2PA 3AT1B 2MEWA 2Y0BB 3P5JB 2W70A 3L4BC 1UCNA 4DZ6A 3T9DA 5C2CA 1RTDA 3LUYA 5SUHA 1MLAA 2HAFA 1YIJS 4TYBA 2XZTB 4P9SA 3Q8PB 3R2DJ 3D3BJ 4NMLA 1SKWA 4CT8A 3T1YJ 4DEZA 1RO4A 2ROEA 5CAAA 1MW7A 3MUVP 1U2CA 2C2KB 2IPOB 2IYIA 3B54A 1BD6A 3LOUA 4DSLA 3QRRA 2XC9A 3KG4A 2Q79A 1O6XA 1RAIB 2AJQA 4UCTA 4M94A 2R7LA 4DXLA 2DABA 1P8GA 3UFCX 3DNCA 4WFYA 3K3PA 5KFKA 4TU8A 1DARA 2C3YA 2DISA 4DPWA 3MM7B 2C3MA 3J7ZT 3P96A 1C0UA 4Z7YA 3HJFA 4HNTA 4OYPA 1HQEA 1SXLA 3R97A 1YITZ 1KJ8A 2GQQA 2ZH9A 4QW8A 3OW2Y 2E7XA 3GMGA 4J9LA 2VD3A 2C2MB 5D4PA 2BJ3A 3J80b 1QVGY 2XNRA 1KUTA 4EGQA 2N7CA 3PEJA 3A1YG 1BQNA 3NDJA 1VQ6S 3NWGA 4E33A 2EI5A 1WHXA 4F4YA 3I55Z 4JV0A 4EO6A 3PX6A 2DBBA 2QSWA 3LWMA 1UVNA 2KB2A 4KO0A 3ICLA 5KFFA 5L1KA 3D5MA 3UCGA 2D3O1 2GHPA 5T64A 1N34J 2ZBQA 5F8NA 4QTUA 2MKKA 1S72Z 3G9CA 1RJJA 3SQGA 2IBOA 2R84A 2WB1A 4FNIA 2I8CA 4K50A 3KREA 3MMCB 1C1CB 1Q8KA 5GVQA 1R6YA 1T94A 1VQM1 3N79A 3HVTB 1SC6A 2HLTA 3KUEA 2RF2B 3GYXB 4XPEA 2C3UA 4E2FB 4EFEA 3I96A 3LANA 3G6E1 2W1BA 4CO4A 3MEDA 4MV3A 3THPA 3VPBA 4KTQA 4FDFA 2YBVA 2GJFA 3JRXA 4USHA 2KJVA 3QZ7A 4K0KF 1F2HA 4J7CA 3IFUA 1RKJA 3NGTA 2EG1A 1UC8A 5CB4F 1NJI2 2OWOA 1ZOTA 3Q2OA 2IBKA 3J81b 4TXSA 3ZZUA 4N41A 3HI9A 4L3KA 2B7BB 3TUIC 3CPWR 1USPB 4O2BF 3MXHP 2Z30B 3FNNA 2QIFA 3DGVA 3M8WA 2C2OB 2HRUA 2CQ4A 2F4VJ 1QXFA 1YJ9S 2HG4A 4IQXA 4NLDA 2AZ3A 1HWUA 1Y7PA 4WKYA 5ETNA 1RXOB 1KT8A 1QM9A 3V81B 2FD2A 1HNWJ 1XR7A 2BM0A 1UFWA 2VUMI 3PHTA 4UTGA 4QR2A 5KAKA 4FS2A 6AT1B 2YKNB 3AQOA 4X64J 3BACA 3KLIB 4QWEA 4IRCA 3GB0A 1TWFI 3D7SB 4C5CA 1YKWA 2HG8A 1RAAB 4FPRA 2N82B 4L73A 1SH3A 2NYHA 2E7ZA 3ZNJ1 2W8KA 1KTVA 4TQRA 1L3KA 1KVKA 1RTJB 3IS9B 3CSWA 2CQIA 5DQHA 1VS3A 1N5YB 4ANDA 2XGQA 4OYAA 4ANEA 3RV3A 1NJI1 1TKXA 3IM9A 2FPHX 1U4BA 4JI7J 1YHQZ 2V0NA 3B78A 2YX4A 4NZ7A 5CD4H 1HWIA 3H4BA 3AXKA 3PRDA 1RWWB 1DLOB 1Z2OX 2R7OA 2QL9B 5IYZF 2EWHA 3PG9A 3M32A 2P5VA 4OIXA 5LSLA 2WBMA 1PCAA 2KFYA 4LF9F 3ZZPA 4AQYJ 5C42A 1NHKL 4L75A 2CPYA 1FJGF 2LQ5A 1SBRA 3ILJA 4MH4A 2MZSA 2Y1JA 2QLXA 5DLGA 3DXBA 3CCL1 2HFVA 1D8ZA 4KE5A 3QGGA 3V5RA 5LMUF 1X4GA 2OPQB 2E29A 2Q6CA 4KHRA 1E6VB 4P6QA 3RBDA 4CCHA 1RT1B 2R2UA 1G6BA 2YKAA 3M30A 4NCBA 4RW7A 3OXLA 1U6FA 4MIWA 3SE7A 3S2HI 3V2UC 2O53A 2LEXA 3H2LA 2Z4PA 4JI8F 1K9MT 3MMAB 4CO1A 3G6EZ 2V3VA 4A8QA 2JC1A 2R8IA 2GAGC 2I80A 5LSRA 4TNOA 3R2CJ 3AH6A 4KRWA 4MV9A 5IT9b 3ISZA 3KAKA 2E7VA 3VAJA 5IC6B 5AXLA 3GZ7A 1KQSR 4ZHRA 1UVJA 1W2IA 2LMIA 1RNIA 3GSIA 3T41A 2Y8YA 4LFAJ 3M8QA 5KT3A 4IG0B 5G0RB 2ZH8A 3M9NB 4A3JI 1P6TA 2E9ZA 2HDKA 2GQ2A 3QFHA 1J5EJ 1F60B 4FYYB 2MKIA 1G2EA 5C25B 1U26A 4TNUA 4FE2A 4ZPWR 2WONA 3EM1A 3HHLD 4UCRA 3QLHA 1Q7Y2 2G1DA 2J6AA 2B56A 3D6MB 3K5HA 3HHKA 1Z2LA 2LU2A 2QA2A 1JMTA 3H2UB 4EBDA 3KJNB 3KOAA 3NS5A 4C3MA 1SIZA 4DV6F 2OLWA 4Y34A 4CKEA 4ME6A 4DX5A 3M4XA 3N01A 4OLPA 3OUYB 1NHUA 5LXYA 1QDUB 2G13A 5IT4A 4F4WA 4RBUA 5FPOA 2Z0GA 4X62J 3MCSA 5D3GB 1MU2A 2HHWA 4DUYJ 5CR5A 4ED5A 1HWKA 4K7QA 3H25A 2QV6A 2EGTA 3UN3A 1RWMB 4IO1A 4NZNA 3KYLA 3TR5A 1SL2A 1U8WA 2FLNA 4UOFA 4IFYB 1JIHA 1XQIA 1VLAA 4JI4J 5BWWA 5B0AA 4NI2A 1S59A 2XMUA 1SPBP 5L9NA 3IR7B 1PYOB 4NB9A 2ZVIA 1FERA 4UZBA 3RRHA 2Q6BA 4E2WA 3VMMA 3EVWA 3TINA 1TFWA 5I47A 2RMLA 5IWAJ 4FBUA 2XQCA 1T3NA 4F4XA 1Q7Y1 1VMBA 4UFZA 2VJVA 2DO0A 4C8NA 2KM8B 2HHXA 4IIJF 3TEGA 4DHVA 2L9WA 3NNAA 3SMZA 3BJYA 3SSSA 3CME1 1U45A 4FF3A 4OYWA 5EWEA 5HMZA 3CD61 1RT4B 4NEZA 5IP9I 4UOGA 2QREB 3GR1A 5C5JA 3J7Z5 3AA9A 5DDQC 1KJIA 2AHOB 4WBFA 2LQ9A 2J7WA 4PUOA 3LP0A 3T9EA 4HT5A 4WU2A 3C6UB 2VBYA 4ERDA 1OYDA 1SJ3P 1QUVA 4YY3J 4JP8A 1X9MA 4DPOA 3RBXA 1TFYA 2YYAA 1JLGB 3QYYA 4LFBJ 1FKOB 2GQSA 3TA2A 3V4SA 2GAHC 1Q8LA 2AJ0A 3HKWA 3GIRA 1ULZA 1JJ2Y 1Y1VS 2OZKA 4A3DI 3IGVA 1S4FA 4J5OA 1RT5A 2HEKA 3CJSA 3UW1A 2LCWA 2ZKTA 4U6PA 3M9MB 3CCSS 2N7YA 2OIHA 4LR8A 1WOSA 5CA1F 4RBTA 1N4LA 2ZHOA 2IJFA 1MMNA 4V1Ak 1S1UA 3IGNA 2WHOA 2DNMA 4PYAA 3P5TL 3I561 4X6AI 4CQ1A 2HVSA 2ZAEB 4EWCA 2LKZA 4R5PA 2YNFB 3RBEA 1WC4A 2DR6A 1JLEB 1VRUA 5I5YA 3R5DA 2OOXB 2HHFB 1I2LA 1FWLA 1M5HA 4K4TA 3QO9A 2PI4A 5CA5A 2AW0A 4WPAA 3M4OI 2Y0SD 4DU7A 2XY5A 5IM0A 3LP2A 1B04A 4DI6A 4AYBA 3PKYA 1VQ71 3ILIA 5DZ7A 5A8WB 3E01B 4MMOA 5CXTA 3H59A 2BRLA 2QRRA 5CYMA 2CADA 1L3SA 4I7FA 2MB0B 2I6WA 3T5HA 4I2PA 2VBZA 2JFDA 3ZTSA 5SZTA 4H4MB 3M8RA 2QYGA 3CXCR 4U7UK 2X3DA 2FJVA 4NCGB 4OZJA 3CO0P 4CNZA 5DS7A 2E5JA 2R87A 2CNQA 4QBUA 5HJXA 4NYPA 2UV8A 4O4GA 2FY1A 4EUVA 4DL0C 4NCAA 1JJHA 1I94F 1EKFA 3HCXA 2QT7A 2CJBA 2VB6A 3NUAA 4F2SA 2MMYA 1OJ4A 1E4EA 3M6XA 3W2VB 2ZH7A 2OEMA 4ICLB 2NVTI 4ECZA 2DITA 4MH8A 3EPIA 5F3ZA 4GKJF 2NXCA 4HEA9 2NU8B 4NL5A 3OL9A 3M2RB 1XNRJ 3HOYI 2W9AA 2QMWA 2KM8C 3H0PA 1WIIA 1WC5A 1FE0A 2NU9B 5BR8F 2XGPA 3S01A 2O5DA 4DPTA 4NBBA 4D3HA 1RQFA 1TUVA 1YJWZ 3CD6Z 1VQOS 2ZZNA 3SIPB 2FJXA 3W8PA 2HKEA 4LUBA 5E3AA 4ZIVA 1H2UX 1H74A 1YI2S 4K4UA 1S7HA 2CPHA 4DF4A 1CBKA 4DSFA 1H6KX 2DHHA 3W1GA 2PDAA 4IRDA 4P75A 2OTL1 1S48A 4PCQA 1DTQB 1IOWA 1ELOA 1KR4A 4W98A 1VS0A 4KBIA 3S1MI 2H48B 3ELHA 1AROP 1C1BB 4QWAA 1VOMA 2L3MA 2VASA 4NE9C 3PW5A 2NR0A 2ZJPQ 2PN6A 3MM6B 1H7WA 1ZYQA 3V6HA 2PVPA 1VQK1 3PO2I 3TUZC 2H85A 1GFWB 1RLDA 1X3WA 4NX9A 5LT5A 5IXUA 2YQ0A 1BXRA 2CNKB 5B09A 3FEYB 2M4MA 4YDXA 3IC1A 3K59A 4ECRA 2VFSA 1NNDA 2JDJA 5KG2A 2OAUA 1UZDA 1T8EA 1FTCA 2Z2LA 4ECWA 4HACA 1NK6A 4HYKA 3I56Z 3ZTOA 3HFVA 1WKJA 2F63A 3EUNA 5FDLA 2COJA 2RQCA 3LQSA 4FXWA 2YZGA 1ET0A 2CJXB 3R7SB 5E3CA 2W04A 3ETMA 3DOMA 5AT1B 1D8YA 1R3NA 1IJEB 2B6AA 3K5LA 3J7A1 2KZZA 1EARA 5GAGI 1L1OC 3TQTA 3J7YU 3I82A 1T9XA 5IOLA 4CLFA 4XX0B 3MM9A 2BR0A 4N56A 4HR7A 2OPSB 1HNZJ 2JLFA 1QSSA 3TVYA 5ETTA 4E30A 3RZOI 4B3RF 2IMOA 4DS5A 3R5CA 2ZH5A 5IQQA 2B5JB 3CJRA 1ZS6A 4BBRI 1FDDA 1SI9A 4BCAA 1RBOB 3SXLA 5JUMA 3R1HA 1WHWA 1DV2A 1BQMB 3NEKA 1FI4A 3M32B 3CPWZ 2OSRA 4FF4A 3US5A 2E2JI 2VUGA 3TZWA 2J0WA 1K1QA 1NDCA 3KK1B 4DR7F 4ZA1A 2AJFE 3CD5A 4MKYA 4YR3A 1RABB 3H42A 3AJDA 2FJEB 5ETKA 4DLGA 4ED8A 5AJ3F 1WJ9A 2VPZA 4OHXA 1RT2A 1S12A 3R8YA 3D2WA 4Q2MA 1S0MA 3RJMB 4ZI7F 3GIIA 1S1WA 5HLFA 3FMWA 2W25A 2IDEA 2QA4S 1IYDA 3GG1A 1TAQA 4RCNA 2LDIA 1XC9A 3RYLA 1IYEA 1WF0A 3QAUA 3NGRA 2X1GA 3VF0B 1UPPA 3CJ3A 3I5AA 2ZH6A 4OX8A 1X0FA 2IV2X 1Y1WI 3D1OA 3EXCX 4BS2A 1EZZB 4DV1F 5J2TF 2OTLZ 4TLQA 2RRAA 1URRA 5ETQA 5DDRC 1I3QI 3H3VJ 4H4OB 3GV8B 3LPYA 4ZVTB 2Z04A 5GAEI 2XYGB 2GJ2A 4X4RA 2CNVA 4DL7A 3RAXA 3BH7B 2AWZA 1VQKZ 2GQCA 5CABA 5KFEA 3C46A 2CAJA 2HRTA 3G8SA 1Q95G 3HD1A 3Q8VA 2F1FA 1QVFZ 3NFZA 1FNMA 5KFXA 4ED3A 3BKFA 1GSOA 4A3II 3K8WA 4P2FA 1KTQA 3P6YC 1KFDA 1B6SA 3UPFA 1UAWA 1VQPS 3CCQ1 3ESWA 2RKIB 3O1LA 1NK0A 4ID8A 4TUYF 4EYHB 4F3OA 4DDFA 5C2GA 3PTWA 3CCE1 3DOLA 2H3EB 1KFSA 1W7WA 3PW0A 1XMOF 2SXLA 4IFVB 2BW2A 4U8VA 1TV6A 4NLRA 2PMZD 3EZ5A 2WW8A 4C5AA 4Q8EA 3W61A 3WWJA 3SCIE 1RWXB 3MUMP 2CQ1A 1K44A 1HBNA 2L08A 4CLWA 3SQOP 1EUDB 3BYPA 1Q8IA 1XTZA 4EZ6A 1AXQA 4Y2KA 1VIOA 4QU6A 3VVUA 1JLQB 2IA0A 3OW2R 4FZVA 4ZP9A 3GCWP 3AAWB 1Y11A 2ZZTA 2DRBA 5U47A 1KQSZ 2LA6A 3GYNA 3T5LA 3EDRB 4C8KA 3OTBA 3NY0A 4XK8C 2OOYB 3MR5A 4NLTA 3TUPA 1N8R2 1S6QA 3DRPA 1VQ41 5KT2A 2FIUA 5KFBA 2AYBA 3N8DA 3CCUZ 4W92B 1XN9A 3M8PB 5BWTA 1FD8A 4C0OC 4JUZA 2UUAJ 1SCUB 5LJ3Y 3IM8A 1ZB8A 5DG7A 3CE8A 1QAIA 2J76E 4J9RA 2EFOA 4B17A 2ZBPA 1X5PA 2UUCF 4O4IF 1LWEB 3DRSA 3PYFA 3JYTA 2ADCA 4JV5J 2W6OA 5DM6Q 5H9FK 3EXYA 3B4DA 2JNJA 2CZ9A 2ABYA 3TJAA 4FYXB 4NLOA 2DWCA 5L38A 2E1MC 3G6YA 2R2SA 1HQUA 1M1K2 1FRIA 1HFEL 4ZOLF 1RDRA 4PG6A 2UUBF 3TI0A 2CIMA 3R5JB 1XR5A 2OMLA 4WFZA 1LKZA 3MDFA 1Q5YA 3G6VA 1DHMA 2XHCA 3TYTA 4ZN3A 1VQ81 3SV3A 4DMZA 1NDKA 5HQLA 4DQIA 1SH2A 1OPIA 2MZRA 4J9SA 3GFXA 3HOWI 4OZ2A 2KVQE 3GV5B 3KK2A 4K4VA 1MWZA 2B3TB 1UZHA 1KQKA 3W62A 3DGPB 5EGYA 3KNGA 1RAHB 3TEKA 5KT4A 3ETOA 4EWTA 3D3CJ 1PC4A 3BS9A 1TL3A 2XS7A 2XG8A 3KALA 4WYLA 1WOOA 1VQ5S 2V63A 3GFZA 4OI3A 2EXUA 1RTIA 4C8ZA 2XD4A 3CCQZ 1HKAA 4DV3J 2PO4A 5C3EI 1LEOA 4P74A 5HO4A 1HMVA 3KHRA 1Q16B 3CCEZ 2NVQI 2WZ1A 2JIRA 3DF7A 4V19J 2V8GA 1CS0A 1JLBB 2H51B 2ZDQA 4P52A 4ZLLA 1KC7A 1RWVB 2L9NA 4GVBB 2R7WA 2W6ZA 2B9EA 5K8OA 2CPDA 4C7QA 1N8RT 1XWLA 4IZOA 2K06A 3PW2A 3UQ8A 2C00A 3IBWA 1BQXA 2BQ3A 4DR5J 5CYMB 5KFCA 3SEOA 5F8HA 2EVZA 3M8ZA 1TR0A 4CE5A 3W5OA 2AEJA 5IT0A 4X4OA 5LMNF 2VFUA 5BYQA 4M1KA 1R0AA 4WFAQ 1NHVA 3A12A 2GHVC 2KVIA 1X9SA 4CM2A 2YNGB 3BQ2A 3GTJI 4A8MP 3VPCA 2I0XA 1I1GA 3BB5A 3OR1B 1GLVA 5BWRA 4UQTA 2E44A 2BANA 4I55F 2XEXA 3A8JA 2MQMA 4QYRA 1RA7A 2IP4A 3CC41 4UCUA 1AZSB 2Y1IA 4QCLA 3JQJA 3G8TA 1FEHA 4M9UA 4LRAA 3GV7B 3PM9A 3RR8A 1M1KT 3BQ0A 4DFPA 2NREA 2ATCB 1S10A 3BAAA 2AEFA 4K5RA 4ZVRB 1VBZA 2HGSA 3CT9A 2EFPA 3G82B 4NWBA 4J9KA 2XCAA 2V4RA 3RR5A 5KG0A 1FTRA 2AYDA 4I6WA 3MECB 3NS6A 3H5YA 3GB8B 3M2UB 2V2KA 3DLGA 5F8IA 4JI2F 3MR2A 1HI8A 3KLFA 3IF8A 2R8GA 4B3MF 2HJWA 1QAYA 2DNRA 1NK8A 4QOTA 4X2BA 4KH1B 3CXCZ 1D3WA 1M6VA 2CFMA 3NOGA 2XSJB 5HROB 3HT3A 2UXCF 2VF3A 2NXEA 3N9UC 1RHJB 3NBPA 3PIPQ 3AODA 2DGOA 1VQ8Z 1KTAA 1UWBA 1FKPB 2YADA 2W4CA 3KJFB 2R7QA 3VZIA 4BY1I 4X66J 4C0HA 4IH5A 1GMVA 4ZP6A 3CQZI 1NJXA 4K0KJ 5B7WA 2LXUA 4GRSA 2KT5A 3K5IA 3MR6A 4G1IA 3TWZA 5JJBA 3KHHA 4M5DB 3ITHB 3AY0A 4DQRA 1WC6A 3GTOI 4O3PA 2OGUA 3NDIA 2DNZA 1D9DA 2BJDA 2F4OA 4B3TF 2FVCA 4FXDA 2M88A 2UU9F 3HP6A 4BBYA 4KHPF 4J9QA 2RVJA 3SGIA 2JR6A 3GTYX 3DLKB 8RUCA 2D74B 3MHYA 3PDNA 1DZ5A 4O7YA 2HFUA 1DTTA 1HHSA 4DCJB 3QATA 2BJ7A 4XAKA 1B4SA 7FD1A 2U2FA 5I3PA 4ZCIA 1SIWA 1LWCB 4UCSA 3TY9A 1SKUB 5I5UA 4LQ9A 3U54A 2IJRA 1JLAA 1FE4A 2QA4G 3NS7B 3CD7A 3TVKA 3CCR1 2L9DA 2XYPB 3TA0A 4MKVA 4PXDA 1HYSB 2DCLA 3W1BA 5EWFA 4WZMA 3TE5B 5A0YB 3CC4Z 2PFFB 2YS7A 1WC3A 1JK9B 2BJ9A 1I6JA 2BOPA 2LVWA 3LW5C 1EJ7L 1KJQA 2ZBRA 4HDHA 3D66A 1CJKA 1DQ8A 3R5HA 2P9GA 4N7TA 3I5BA
chains in the Genus database with same CATH topology
2M2BA 2E1AA 1UWBB 1Z2ZA 4TU8A 1DARA 4GO7X 2C3YA 4BDPA 2DISA 2DTJA 3MM7B 4S1TA 2X1BA 2C3MA 3J7ZT 1QUPA 3GTMI 1C0UA 3MEGA 2VPZB 3P96A 1JXEA 1ZH1A 2YX1A 1HQEA 1KQFB 4BWMA 1SXLA 3U1LA 4DV2F 2ZC3A 3LWLA 1YITZ 2R8KA 2GQQA 3OHBA 3HLUA 2ZH9A 4EYIB 4AFFA 5KFDA 1U48A 4QW8A 3OW2Y 3OVAA 1KRPA 2E7XA 3GMGA 3RR7A 3I0SA 4J9LA 1T03A 2VD3A 2ZH4A 4A3LI 2GA7A 4MD7A 2R7VA 4NLSA 5D4PA 1FRKA 4A3KI 5HLFB 3RTXA 2FVRA 4OLOA 3J80b 2B0GA 3IA0A 3SDEB 1QVGY 2D3OR 2JWNA 2XNRA 4CTAB 3MM8A 1FA0A 2N7CA 1QJHA 1TVRA 3BA8A 2ZUGA 4EQ5A 5K14A 3PEJA 3A1YG 2YNIB 1BQNA 2KHCA 1ZAXA 4PQAA 2HNDA 3NDJA 5J2PA 1VQ6S 1P16A 3NWGA 4E33A 2EI5A 1KEKA 1WHXA 4NFRA 3U1NA 4CNYA 3GR0A 4F4YA 2LQJA 2YKNA 5HMYA 2R6MA 1SJ4P 1PGZA 3I55Z 4RW8A 1QVGR 2IC3A 4JV0A 5FD1A 4Y65A 4EO6A 3PX6A 4E0DA 2BA9A 2DBBA 2WB4A 1Q821 3KLIA 5D4OA 3SCLE 2J6SA 2QSWA 2WSFC 1J2VA 3PW7A 1JJ2R 3LWMA 3IR5B 1R8BA 1UVNA 2KB2A 4KO0A 3ICLA 5KFFA 5L1KA 3D5MA 3UCGA 2ZDOA 2GHPA 3M9OB 1CG2A 5T64A 3CC2S 2BYCA 3OVSA 1W2BZ 5F8NA 4QTUA 5EDWA 2MKKA 2C2EA 1S72Z 5G4DA 3PX0A 3GDEA 4DV7F 1MMLA 1N5VA 1RJJA 1VQ8S 3G9CA 3JSLA 4QR1A 4GKKF 2A18A 3SQGA 4DG1B 3ZZRA 2DNPA 1LWFB 2ADBA 1N2FA 1X5TA 4OZ0A 2IBOA 1UP1A 1RTJA 3IS9A 4CH0S 3OVBA 3E2EA 1J5OA 1Q81T 2WB1A 3I87A 4YOEA 4FNIA 1N5YA 4K50A 2DE6A 1C0TA 2F9JA 4WJBA 4ZVHA 5D6GA 2AGPA 4AUKA 3MMCB 1C1CB 3NBYB 5GVQA 3HHLA 4ID5A 3UDLA 1R6YA 1S1VA 1T94A 4A3CI 1M902 4HDGA 2NXUA 1RT3B 3NH8A 1JNRB 5M2UA 1VQM1 3N79A 5J1EB 3HVTB 3TX8A 1SC6A 2HLTA 2DHAA 4ZCKA 5A2Qf 2AU0A 2RF2B 1VC0A 3G71Z 3GYXB 1L3VA 4XPEA 4OZ1A 2C3UA 2ZBCA 1SIWB 3CWJA 4KR0B 1DLOA 4EFEA 5KFQA 4K4WA 2HGNA 1IUJA 3IG1A 4WYWA 3I96A 3LANA 2BJEA 3G6E1 4IUFA 1Y0HA 2ROPA 4QJVA 4AL6A 4CO4A 1NO8A