3QWUA

Putative atp-dependent dna ligase from aquifex aeolicus.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
366
structure length
366
Chain Sequence
ISPELVKEALKKKKVRSEEAFGLEYLRFNDDYKDIPRGTAIFKDFIIWGYPHIGRIFLLETGLREQFEAPFWVEEKVDGYNTRIFKYGDNYYALSRGGFICPFTTDRLPDLIDLRILDENPDLVICAEVAGPENPYIEESPPYVKEDVQLFVFDFMKKNEQGFLSQEEKMELIEKYNLPHVEILGRFTASEEGIKKIKEILKRFNEEGREGVVFKEDSERNKRAKYITSYANLMDIKTNAKNMLQLPPEYYTNRILRLVLFMYEEGLKTTEHLYEELGRAFIDGLFQAIEQFEKEHKVYKTFTCKFRKKENAIALLELLSKTSKHIQVKERRLEKEGDYWRLEFDKVFLNMTGLLGHLLSGGIVYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Putative ATP-dependent DNA ligase from Aquifex aeolicus.
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords DNA ligase
total genus 116
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18330 Lig_C Ligase Pab1020 C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.320 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3qwuA01
3.30.70.2160 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qwuA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3qwuA02
1V9PA 4EFEA 5DISC 1CKNA 2Q2TA 3W5OA 4UCOA 5FPOA 3RTXA 3GJXB 4CC5A 4EEQA 4PZ6A 1XDNA 3BA8A 5D1OA 1DGSA 3BA9A 3BABA 2HIVA 5FPRA 3W1BA 1TAEA 1TA8A 3GB8B 4EFBA 2Q2UA 3NBZB 3L2PA 2HVRA 1P16A 3VNNA 3KYHC 3UQ8A 1B04A 2CFMA 4UCRA 3TY5A 4CC6A 2OWOA 4DRFA 4UCVA 5D1PA 4LH6A 1FVIA 1CKNB 4UCTA 4PZ7A 3QWUA 4UFZA 1CKMA 3TY8A 3BAAA 2HVQA 3TY9A 4E6NA 1CKOA 3GDEA 1A0IA 4PZ8A 3JSLA 3NBYB 3JSNA 4LH7A 3PN1A 3NC0B 3RR5A 3W1GA 4GLXA 4UCSA 1VS0A 5D1OB 4EQ5A 1P8LA 1S68A 4UCUA 3S24A 2HVSA 2VUGA 1XK5A 2HIXA 1X9NA
chains in the Genus database with same CATH superfamily
4AUKA 1NSKL 1HL6A 3S1MI 3KTQA 2GPSA 1V3ZA 3GB8B 1TMMA 5HQMA 4I1TA 5CYMB 2DH7A 1LXJA 3TNVA 4K2XA 1VFJA 3PV8A 2CJXB 4X65J 1N48A 5IT9b 2H5IB 3AAWB 3D9XA 3TX8A 3N6RA 5L8RC 3L3CA 3ZTRA 3GJQB 4O3SA 2RU3A 1HNXF 2YPZA 3AY0A 3CMQA 2A2DA 1FDNA 3S1RI 4KQZA 3W60A 1VQM1 3IBFB 3S1QI 2PO4A 3BR9A 4X66F 3WWJA 5E3PA 4DI6A 3I5BA 4M5HA 3EVWA 4PPDA 3U7JA 3Q83A 1HBUB 4WFAQ 2WTFA 4C11B 2LYVA 1VQ5S 1FA0A 4CCHA 3THTA 1XBWA 5HVFA 3RB6A 2UXDJ 4RJVA 3JYTA 2HS3A 3W1YC 1F1BB 4NZNA 3I96A 2I2YA 4EEQA 3OBIA 3IR7B 4YQWA 3M8ZA 3RZOI 2W1BA 1KTQA 2VBZA 1U1QA 3VAMA 3G8TA 2J8SA 3V6DB 1S59A 1JLAB 3PYGA 2VKRA 3M8QB 2F63A 1B64A 4LRBA 3VVTA 2O67A 1BD6A 1HBOB 2AEMA 5HBMB 2XS7A 4KPCA 2KXFA 1IKWB 1UKUA 3SCLE 1YJWZ 1WKLA 2IM3A 2GIQA 5JVGQ 2K7JA 3BKUA 2CNVA 2OD4A 3I5AA 3UE2A 2LCWA 3DI6B 1OPIA 1H7WA 2KHCA 3T9AA 2YKOA 5LM7E 5K2MA 2YY3A 2RIQA 4QPTA 4Q44A 3TR5A 4IRCA 2F1FA 1RTJA 1PBUA 4DLKA 2QEX1 3VMHA 1YTYA 4AL7A 4ZN3A 4JI4F 2EBEA 5CM2M 3FCWA 3CMES 1ZB8A 3W2VB 1KKHA 1TL7B 3RB3A 1NHKL 4M5NA 4S0MA 3B4MA 2I87A 2N82B 1QLNA 3M4OI 2YWVA 4NMXA 2OSRA 3MF5A 3KYHC 2R7SA 4TV8F 4CC6A 3DRRA 4XDDA 2DNHA 3OTDA 2HRYA 1RTDA 4ECRA 5I60A 3NNCA 2ZFHA 2MXYA 5HMYA 3DLGB 4ANDA 3SZ2A 4Y7NI 2R7TA 1I50I 3FMBA 1IJFB 3PRDA 2ODTX 1TKTA 4TU9A 1N33J 4NMLA 3FKII 1TAQA 5KFXA 3HPOA 2HVQA 3G711 3BH6B 4M5DB 3FQLA 4O3PA 4MH8A 2RT9A 1EIYB 3PDNA 4HR7A 1CKNA 5T7LA 4DWIA 3BSOA 2Z0GA 2OTJ1 3PJWA 5IV3A 3G9CA 2OLWA 1IKVA 3QJPA 1NKCA 3L4BC 2YWWA 9ATCB 2A1HA 2HNYA 1LWXA 3D2LA 2QTWA 2DNPA 4OZNA 1KD11 3V4IA 3CXCY 1PYTA 1QAXA 2L41A 2QO3A 2YX7A 1Q7YT 3BSNA 4PQUA 4HNUA 4RBTA 1K9M2 3TUJC 3MZIA 4KKOB 4DK1A 4R0EA 1TWAI 4OZ3A 4IR9A 1CQMA 2MKJA 5J1PA 2X51A 2Y3YA 1RA7A 4RCNA 5K8MA 2Q43A 2DB1A 3WX8A 4OYWA 3GTPI 1U4BA 2V2ZA 3HCXA 3G87A 3P45B 2E9RX 4QIGA 5DS7A 1VRTB 1FK9A 1T3OA 3IXQA 2DNYA 3G4SS 1DV2A 3FZ2A 3E2EA 2EEYA 5B0DA 3DGVA 1REVA 4LJMA 1YIJ1 3R8YA 3OFEA 3B6BA 2BJ9A 1S97A 4FYDA 2V94A 2HFVA 3N79A 4ECSA 4C8MA 1VBHA 1X9SA 4IWYA 4ZQIA 1RBLA 2B4OA 2RS8A 3U1MA 1QAJA 5I42B 1T11A 4Y65A 3K5MA 3K7RA 2V63A 3LO3A 3TVYA 3JAMb 2JL9A 4NX9A 4ES2A 3GFYA 2V8HA 4RUAA 4C5AA 4XAKA 4KFBA 4ZJLA 3GTJI 4IFYB 2E9ZA 5J1EA 4LBPA 3CCJZ 3TINA 2H48B 1GGOA 3HHKA 1REVB 2I5JB 1UPMB 5KFVA 2FJAB 3NCPA 3M6WA 2M7SA 1IBCB 1M5SA 3KK2B 2B5JA 1T05A 3ENVA 1QYPA 1HNXJ 1S9GB 1A0IA 2CNOB 3QT6A 4ED0A 4FFOA 3R7BB 4A3BI 3KDNA 3S7RA 2HAIA 1U24A 4N7TA 1QXFA 4CDIA 1T9VA 4AQYJ 3G8SA 4JI4J 3PACA 4CO1A 4O82A 3MMCB 4ZOSA 1UA0A 1W96A 5A6PA 1VMBA 2VG7B 3HJFA 4ED5A 4NYOA 4A3FI 4UF4A 4IOBA 2P8IA 2LEAA 2Q6CA 3D2WA 2R2SA 2RF2B 2CQDA 4CQ1A 5RUBA 5HROB 3DOLA 4LIRA 4JI2J 3LP0A 2DY9A 1NZAA 1S4EA 2AYDA 1WELA 4EBCA 2GQSA 5HANA 3JTOA 1RKJA 1TUVA 2R84A 3NAIA 2HYIB 3IRXB 2J8AA 2IRXA 2E1RA 3K59A 5K3WA 5F8NA 2QYGA 1FJCA 3D9BA 2MJNA 5CR5A 2CZVC 2N7CA 4TYBA 3VCDA 3HLUA 2HHFB 4ZPCA 3U55A 3W66A 3PRVA 2AMCB 4U7UK 3OSPA 2NCKL 2QFJA 2EJ3A 2GGPA 2PIIA 1Q4RA 1V9PA 2CQGA 3S14I 1DAXA 1HNVB 3BSAA 3CDUA 4YJ3F 4EYHB 5D77A 1CJKA 4JI8F 3GR1A 1OMSA 2XSFA 4IQMA 4Q7AA 5KFCA 1F2GA 4QIVA 1N6QA 2VF1A 4DFKA 1W2BY 1VRQC 4J9NA 4QPXA 5IT4A 1S1TA 2M88A 1OYEA 3G6E1 1S48A 3ZZTA 1K1QA 1HR0J 2EIYA 3UCGA 3K5NA 2CQHA 3NCQA 4Y2AA 3GJRB 4CIOA 2XWYA 3QRRA 1HQEA 2WW8A 3ENWA 1BQNB 1WR2A 1Y1VS 2IPOB 3ZZYA 3GFZA 1XDNA 1KQKA 4ELTA 2K7KA 4NCBA 4O83A 3NS6A 1SFOI 5LJ3Y 5KFMA 2AYMA 1FXRA 1VQP1 3LP2B 2OPQA 1RU1A 3DRSB 4FN5A 1VS0A 3DCAA 2QMXA 2CJYB 4OYOA 2IIHA 5C24A 1UVJA 4O84A 3MOZA 4K4XA 3AHPA 1FRXA 2CWXA 2DHGA 1XR5A 2E1AA 3GV8B 1FWKA 2FZKB 5M2UA 2FPHX 3LWLA 3JXOA 3ET6B 4RW8A 1VJWA 1AUSL 2W6QA 2WBMA 2VQDA 4FDFA 4WZQA 2AEJA 5DDQC 4WWSA 2BANA 4ED2A 2IJFA 3T5HA 2AKLA 3PW7A 1S72Z 5L1IA 2OKQA 3KUHA 4I64A 1C4AA 4CNZA 4DL5A 3CCQZ 3DLLQ 3KJVB 2YNGA 4O3NA 3W63A 4P7VA 1T7PA 4M63A 3OL6A 2OPQB 3U9TA 3SMZA 4KGMA 4JYAJ 1LWCA 4ES1A 4C5BA 3MI7X 2YWGA 3GKQA 4NASA 2LDIA 4J90A 2X1AA 5AJ3F 4MIBA 1GH8A 1VQ41 3KOAA 3OTEA 2PMWA 3TAQA 1HR0F 1X5TA 3S8SA 1IR0A 1UVKA 5IWAF 2B0GA 4ENOA 3M32A 1NSQA 3UW1A 1VQ8S 4BWJA 2BA9A 1X5OA 2KH9A 1E4EA 1JDEA 3E51A 4DR2J 1ZS6A 1HI1A 1NKEA 1GMWA 1WC5A 4CE5A 1BE4A 4DV5J 3TUZC 4IO9Q 3KK1B 2FDNA 4K5SA 4O44A 4EK2A 3GR0A 3FRYA 2JEFA 2HQ3A 4ECUA 1A3GA 1NSPA 4DIMA 1UWBB 1MROB 4NLPA 3CCJ1 1SV5B 1PC4A 1K731 2UVUA 3W1BA 1K47A 3NS5A 3NNHA 5A2QU 2QA41 3CC4Z 4DN9A 2G2YA 3HOYI 1JLBB 4RW4A 1T03A 3OW2Y 3UD5A 4P2FA 2GQCA 4ED7A 4ZVHA 4OZ0A 2V8PA 3SDEA 1EP4B 4ZDNA 1TZ0A 4XO0A 5KFSA 4CHIA 3KMQA 2MKCA 3CGIA 2FC8A 3KJFB 3NGRA 1FJGJ 1QSYA 4JI3F 2RKIA 1SQEA 3GLKA 2HVRA 3D6WA 2OWOA 4YUDA 3N6MA 3DDIA 3TY8A 2UVWA 4RU2A 2QLWA 1VQ5Z 3MWDA 3CMAZ 3CVKA 1NAQA 3VOTA 1R89A 3BREA 1N5SA 5D15A 2VPQA 2HS0A 5IM0A 2MGZB 4DL7A 4OYIA 3WHIA 4RNNA 2VFVA 1VQN1 3G96A 2H1YA 4RVFA 4TLRA 3UCUP 2BM0A 2LVWA 3SEOA 4BBYA 1CQIB 5C42B 1YWXA 2LMIA 1RT1B 2A10A 3QJLA 4B9MA 4Z2XA 4LF6J 5HJYA 2R7VA 3MR3A 1I94J 1NDLA 4LH7A 1S6OA 3HMJG 5DQIA 1NDPA 2ZC3A 4AXIA 4LFBF 4EBDA 3NBPB 4F4KA 1C4CA 2P9EA 3CCUZ 2GS8A 2VR1A 5IT9Y 2DNQA 2BJ7A 3AXKA 3VQSA 2HVIA 2CVEA 3C14A 3JS9A 2ZUGA 3HSDA 2CNQA 1TV6A 3KHHA 1RT6B 1Y1WI 4CTAA 1DARA 3AB4B 5K20B 3PHTA 3HHLA 4PG5A 1S0NA 1EARA 4L6V3 2ADCA 4HT5A 1YJ91 1WF0A 1QY7A 5T67A 3PW4A 1U6FA 3QFFA 2W4PA 4J9LA 2KT5A 3MD3A 4MONA 3HSZA 2OMOA 3ZZRA 1U1OA 1KBRA 3P8BB 1M90T 1JLLB 4MD7A 3H42A 1SVDA 1VR6A 5KFDA 3GLJA 4A3EI 1F5CA 3OLBA 1P8GA 3NRBA 1R0BG 2IMWP 1P27B 3QWPA 2AYBA 2B9YA 4ANCA 5A8RB 1DY3A 3JSBA 1H2VZ 5KKNB 2YKNA 4J9RA 3DHXA 4K0KJ 2W2PP 5LJ5Y 1C30A 1J2VA 1QSLA 1B7FA 1QDUB 3CCLZ 4FFNA 5IFMA 1N5YB 2YQ3A 3CC4S 3OXGA 3FEZA 4KHMA 3QWUA 1B6SA 1LW2B 3PFEA 3NH8A 5J2MB 3QT5A 2AD9A 3DLJA 2ZWPA 3HHDA 3J80f 1RA6A 1IBLJ 1KD12 2CDRB 2B8PA 1FD2A 2JMOA 4CYUA 3NGDA 3OHBA 4LH6A 8AT1B 4CMFA 4PG8A 3MMBB 1KJ9A 2QGFB 1RO2A 2FHJD 2CG8A 4OI6A 5J2NB 2A2CA 2YX1A 4U8VA 1YJTA 3I4HX 2HHQA 3TW7A 3ETMA 4ZP6A 4P73A 1TWCI 3LPEA 3TJ8A 4NBDA 2R7OA 5T6BA 2KU7A 2J7KA 2YTCA 5C2CA 3CMAS 2MSSA 4B9NA 1JXVA 1OSCA 3T1AA 4BS2A 3Q8QB 4V19J 3TANA 5EWEA 1U2FA 4RNMA 4N47A 1Z1ZA 3CCSZ 4FYYB 4LF1A 4NEYA 2KXNB 3RBZA 4GKJJ 1QM9A 3KUGA 1AFJA 2ZEJA 2VG6B 5J2NA 4E2YA 2ZJRQ 5HQLA 3UQ8A 1VC5A 3CJQA 4JI6F 1HNIB 2X7IA 1S1VB 3EGWB 2J9GA 4GLXA 3AJDA 1TL3B 2GA7A 2ZHOA 4FPIA 4BBSI 3BO4A 5KFBA 1I2LA 3V81B 2AYEA 5JVHQ 4NOZA 5E3AA 2FY1A 2XGQA 2YYAA 1GMVA 4JV1A 2DNMA 3EVOA 3QIDA 2GQRA 4ID8A 5BWVA 3UN2A 4YDXA 3GTLI 5BJRA 3MM8A 2M4MA 4OHXA 2KI7B 1Q8IA 2IDEA 1JWHC 4X4RA 4PWDB 1UEUA 4F4WA 4DR4J 2Q6BA 2ZH5A 1Q81T 3QSIA 5ETKA 4USVA 2DXFA 3HVAA 1VQYA 4RLEA 3PXGa 3GE9A 3KLGA 3MEGA 2UZAA 2JHEA 1VQ8Z 4X62F 4LSLA 5G0RB 1U1MA 1S99A 1S1XA 2J0WA 2XB2D 4FNIA 3FK4A 4CP5A 1WDTA 1KJ8A 3NCRA 3CCMS 4LRAA 2ZBIA 1NBEB 3M9OB 4UZBA 2V5AA 2YVSA 3CC7S 3T5JA 2V8VA 2GZOA 4RVHA 1TVRB 2WSEC 3LWBA 2IA0A 2OOXB 1PC5A 1GMWD 4ZA1A 1SC3B 3H4BA 1I51B 2B4UA 2ZGIA 1FFWB 3E8OA 2QL9B 1S10A 5T14A 1H6KX 1Q862 1X9MA 1XMOF 1QVFZ 3QAEA 1Y3JA 3DFEA 2D74B 2PE8A 1P16A 5F0WA 4NBEA 1S0VA 3VV2B 2Y8WA 2J7UA 4F50A 3BYPA 3KYLA 4NI2B 3GJTB 2CADA 3CJ5A 2XYPB 3V4IB 4N77A 1D9FA 4E4TA 4B02A 2YBVA 2R7LA 1C1CA 1TV6B 3DNCA 4LF9F 3QGGA 1ZYQA 4QCLA 1MSWD 2QA4S 2P0AA 2R8KA 2LA6A 3H0GI 1B4SA 4KJIA 2H85A 1S1WA 2XEXA 4X4VA 5CM0A 2GPWA 3K58A 2IP4A 3KLHA 2AHOB 5D4PA 1FDOA 4O23A 2CPYA 4E31A 3ELHA 3HOUI 4BLGA 2Y1LB 2HAFA 1TKTB 4I2PB 2PA3A 2E1MC 1G2WA 2HLUA 1AUVA 2QMUB 4ECXA 2DHSA 5EGYA 2YXLA 1G4CA 5GMEA 2HHHF 2YRXA 4FS1A 2WVDA 5KOXA 4LF2A 4QIFA 3A8IA 1AYEA 2CQPA 4M5KA 1RTIA 3GTKI 3M4XA 1OJ4A 3AOBA 1NRKA 1D0EA 4KT0C 5KFUA 4LSNA 1VQMZ 3UZBA 4CLFA 2COGA 2E7WA 1WJ2A 1JJ4A 2B43A 4I6WA 4K6NA 1FFGB 4LT6A 1WG4A 2D3UA 3GSIA 3NXZA 1HWUA 4OX9J 4DPTA 4IH5A 1ZPVA 1EX8A 2W03A 1USPA 2W24A 3JTPA 3IGNA 2R87A 4P72A 2IZ4A 2QA2A 1NJXA 2AZ1A 3PX0A 3RW6A 2KPIA 1LWFA 1H2UX 4OI2A 2DABA 5LP6F 4ALZA 3U9SA 2MHNA 2MKSA 4ECZA 4ELUA 4JP8A 2H5JB 2VG6A 3KLFB 3GTOI 4FF2A 1NK8A 1YSJA 5I5WA 1VGYA 4B3TF 1C3OA 4AE5A 4ZPDA 2G0IA 4A8MP 4FFPA 3QT7A 4YDDB 1CJKB 3MM6A 4TN2A 4RNHA 1R7IA 3DTGA 1C2PA 2D3OR 2IAJB 2UV8G 3KG4A 4HI2A 4IHJF 2ZDPA 3IR5B 3D54A 1UA1A 1IYEA 4KYZA 2NVTI 3T1YF 4OV1A 2AJ4A 1M902 2CQIA 1ZA1B 1VQNZ 3ZZUA 1XR6A 2DHAA 1Q79A 3ZO7A 4OYAA 4BC9A 1RTIB 1VRUB 3TAMA 3W8PA 5I3PA 1Q78A 4FBUA 1JDBB 1FESA 3C8YA 2FD2A 2C2EA 2XM3A 4ECYA 2HFNA 1HIYA 1EP4A 1NP6A 2BX6A 3ENAA 2ZH6A 2HG8A 4NL5A 3PO4A 5EWFA 3CJKB 2BJ3A 4I4BA 2AGPA 1YKWA 2M70A 3SYZA 3IO1A 1RHQB 4USJC 1NLKL 2G2OA 3SSRA 1Z03A 1SJQA 2RVJA 3NOCA 1VRUA 3VZHA 2R7KA 2IZ3A 4FFRA 2QN6B 1QVFY 4DV0F 2LXUA 3Q8UA 1FWPA 3PVXA 2VFTA 5D3GB 2XLKA 2FJWA 1I6JA 4P9SA 1G6BA 4CC5A 3EMTA 3V6JA 5EZYF 3JYTB 3CD5A 1OIAA 4F4ZA 3VNNA 5KS8A 1WKKA 1DTTA 3CD61 3H2LA 2P9CA 4NXMF 3J80b 2VJUA 5B0EA 3VGVA 5ETMA 3BQ1A 3G6VA 1Q812 3T9NA 4DX7A 1YIJZ 4MXUA 4H4OB 1TA8A 2APOA 3ET6A 4NA1A 2YWHA 4CMDA 1HI0P 3DGPA 2QIFA 2BW7A 2KXHA 2CNKB 2ZHAA 2VPXB 3HBLA 1S68A 2XC9A 3BGUA 1X4DA 3CJ2A 1A6LA 2YWKA 1Z2PX 3PX6A 2COJA 3DGPB 1UVLA 4EO6A 5CD4H 3BBBA 2DIVA 4DV1F 4PRFA 4HHHA 4DG1A 1HKAA 1RTHA 2DISA 3JB9k 2P6TA 4DR1J 4NBBA 1KOHA 8RUCA 1YJRA 1CLFA 4JI2F 1HQEB 2HHXA 2FJEB 3G82A 4NEZA 1WC6A 2ILYA 1B99A 4Y34A 5SZTA 1D9AA 1FE4A 2B9EA 1KN6A 2ZE2B 5D4OA 1TKZA 4HH4A 3NS7B 4LF4F 3EZUA 4IIJF 3GV5B 3QT8A 2PSZA 5HO4A 1NB7A 1TKZB 4ECTA 5IXUA 2NXCA 3A4TA 2ZM6F 4G3IA 2UUWA 1NJZA 5GADU 3GTMS 4L76A 1NEEA 3JZ6A 5KFNA 1RWKB 1R8AA 1ZPWX 2VPWA 1SKRA 2YZLA 2YKAA 3ISNC 2HWIA 1ZM9A 1I94F 5CCMA 1YJW1 2YQ1A 2HSEB 3N8DA 1UEVA 1UWBA 1FO1A 4K5RA 2DGVA 2ABJA 1CKOA 4F0HA 3KLIA 4O7VA 3BF4A 2GTIA 3MEDB 4TM5A 1XC9A 3W65A 4GRSA 4Z7CA 1YX2A 4FYXB 4OJGA 2GLTA 5DGIA 2NU6B 3GIDA 2EWHA 1HFEL 1JLQA 4EG0A 5JMNA 4OYZA 3CJ0A 1VBKA 4KGZB 1RUSA 2F9DA 2HQCA 3AQPA 1VQ81 3DDNA 4JOUA 3K5LA 4OYMA 3CCV1 3H40A 3FGVA 5FJ4A 2W04A 4UOGA 2E44A 4DR7J 4U67Q 3I4PA 3RR5A 3TW0A 2CPZA 3GTGI 2LQ9A 4ZVPB 2HVZA 3HKZA 1VHIA 5ETNA 4DF8A 2CPJA 3C19A 4RNOA 3KLHB 3NWGA 3Q86A 4KV8A 1XWLA 3BDPA 1RJJA 1RHMB 3TZZA 1CE8A 4A3II 1YI2Z 5IP9I 4UW2A 4B08A 1IKXA 4NYZA 1WHVA 2OD6A 5CHCB 3QBCA 2E7XA 2JJ4D 3GWCA 3PM9A 3FQQA 3NBZB 2F4FA 2NZ4A 1WOSA 3DRPB 4DPWA 1PJ5A 4Y6IA 2BANB 4TNOA 4IFYA 2ZJPQ 1HHQA 1Q8KA 3NKYA 1FDIA 3OUYB 2K3KA 3Q1KA 1NMEB 1T02A 3I55S 4P2MA 4NBAA 1Q7Y1 3SSQA 2RAQA 2E5LJ 4J9OA 4NLRA 4RW8B 3DLEA 2IHR1 4DS5A 2B51A 2V2VA 3GU0A 1IR1A 4G65A 4C3MA 2CQ2A 1HWJA 1K73T 4O86A 2NPIA 4X4SA 5KFFA 4CKEA 1RCOB 3U50C 5FDLA 2M52A 2V9KA 1N54B 1ELOA 4A8WA 4GVBB 5DDPC 3WO0A 3C14B 4O4RA 4A8QA 4M5LA 1FEEA 2Q66A 1EJ7L 1RWVB 1PILA 4WHXA 3W8GA 5CAAA 5IS2A 3IS9A 1VQOZ 3VAGA 4DQSA 1DL6A 2VQEF 1NM2A 2HK3A 3GIRA 3J81U 4HLBA 3RB4A 3C66A 4Y8VB 1SIWB 1L3UA 3ZNUA 4NI2A 3QMQA 1HBOA 5J1EB 5E41A 1NU4A 4WZMA 3G8CA 4RW9A 2WVFA 1E6YA 1CJVA 1RT7A 3EEDA 4X4UA 3TZXA 2YADA 3NLCA 1N32F 4DDFA 2Z58B 5KFPA 1O8BA 2Z4PA 1FI4A 4CH1A 3FSIA 1VQOS 4PBCA 1T36A 1VQ91 6AT1B 5A76A 2R9LA 4UUGA 5HI7A 3BGRB 4QIEA 5ETLA 2XNRA 3CMA1 1D1UA 3W5YA 3P96A 2F9JA 3EVMA 5C3EI 2HKEA 3W2VA 1NH8A 2DNLA 1F9EB 2A6MA 2BKOA 2KFZA 2CYYA 3TA0A 3RRGA 3IS9B 3UR3C 1KD1T 1CVJA 3FJ2A 4AFFA 4YY3F 4WYWA 2PA8D 2MQLA 4I69A 1M0SA 3NBYB 4IG0A 2EW9A 2ZD1A 3IAM9 1X9WA 3VPBA 3CJ4A 4ZPVR 5AXNA 1YRTA 3ZZZA 4KH1B 4CLKA 2UVRA 3H4DA 2RRNA 1PAEX 3GIJA 4WE1B 2VQFJ 1UJ6A 2EG1A 4ID5A 3HHNB 1T94A 1M901 2O3DA 1M5PC 3P5BP 2FLNA 2G13A 3Q2SC 4RUHA 4BDPA 2WSCC 5BR8J 5DG8A 1RT3B 2RNEA 1WSRA 3JZIA 2FZGB 3HF5A 5LOVF 4EFAC 3I5CA 4HKQA 3KNGA 2DNKA 2QRDB 3CSKA 4Y2IA 1CJTB 4HH1A 2JNJA 2VOOA 1WHYA 2JFDA 4G6VB 5BYAA 2SCUB 2N7YA 1YIT1 4R25A 4WIIA 1WIIA 4UY85 3N9UC 2B5JB 1T05B 1KONA 2M5YA 2FJVA 1K83I 3LOUA 2PK7A 1S1UB 1E4EB 3NBPA 3D1QA 3HT5A 4E2ZA 3BKTA 5E2QA 3J80U 4K2JA 2IC3B 2BOPA 1MWZA 2QRCB 3QPIA 2AKWB 4HVZA 3N6NA 3IRXA 1R31A 1I6HI 2LFVA 3R3TA 4DL2A 1RTZA 1XN9A 1M5HA 3CC71 3W9HA 3BGLA 4KB7A 4C11A 5HMZA 2R7UA 2CIMA 1M1HA 4Y3CA 3IWNC 2RU9A 2D3O1 4DR6J 2V50A 4BY7I 1SJ3P 1Q16B 4HGYA 4YB6A 2VJVA 3PIOQ 3K8WA 1BXRA 4K50A 3QGIA 2DYAA 4X6AI 4B3OB 2HQFA 3G6XA 4EO8A 5MLCV 3BQ0A 3TY9A 1PYSB 3PW0A 4DX6A 1JWWA 1N52B 3TE5B 1V5VA 2CQBA 3O2IA 4ZLNA 3CIMA 1C0TA 1KP6A 3ILIA 2W7AA 3CTRA 1JLEB 2HDKA 2VQEJ 5I5SA 3T9BA 3K7AI 2IBKA 2UXBF 4ZPBA 3BKFA 3MMJA 4TV9F 3CJ3A 2DGTA 5KFGA 1JLGB 2Q2TA 2ADBA 1VQ7Z 5HMXA 4B9UA 4O4GB 3W2WB 4LF4J 5KFQA 2KFNA 4DV2F 3VA7A 2DNOA 3Q8YA 2GCFA 1N34F 3GB0A 1S721 2HU9A 2CNLB 4YR0A 3G6ES 4X4OA 2XY6A 3KK2A 1UWAA 4HHUA 1DBDA 1TAEA 2Q2UA 1RZMA 2ASLA 3OFHA 1WORA 3VMIA 4HEA9 4ECWA 4WFNQ 1F0XA 4ZP7A 3CO9A 3LA0A 1WNEA 2L9DA 2KYXA 3IBWA 4DR6F 1T9XA 1BQMA 3A1YG 2ZJQQ 2JIOA 3LGHA 2CPIA 2LKZA 1X3ZA 1WOOA 2WVBA 2RF2A 2VL1A 5CA5A 1NHUA 2WCXA 4EGLA 2XGPA 1X0PA 3CD6Z 3EPGA 2L08A 2B56A 2KO1A 3BABA 2DR7A 1N36F 2HGNA 3OPKA 3HOZI 2H65B 2Q4ZA 2VHGA 3FC9A 4MIWA 3PZPA 5IC6B 3MCNA 5KFZA 3ZTSA 3TEHB 4L1KA 3JRXA 3DRYA 1RWUA 4YP3A 3OUZA 1M1GA 3LAKA 2YKQA 1SXLA 3HZEA 1ZZNA 2W4CA 2IM1A 3UDCA 2ALYB 1PGZA 3K57A 1YJWS 5C8YF 3R5HA 2FJBB 3CCLS 5L9NA 2FGCA 1IKWA 2ATLA 2YL2A 2UV8A 1DV1A 1SKSA 4C3KA 3G86A 3G2XA 4WFBQ 2XMVA 1T95A 4UZCA 3TQTA 4QU7A 2OTJS 1K8AT 4M5MA 5L1KA 2ABYA 3W64A 1SV5A 2HZCA 4DQYB 1RAFB 2JEJA 1K44A 4ME6A 3I0SA 5DLFA 1CKNB 1WC1A 2OZKA 5BWWA 5L1JA 1CS4B 4F02A 1N4LA 1Q861 3RG6A 5A2QY 2QB5A 2VG7A 1ZH5A 2OMLA 2CZ9A 4O4LF 3T5KA 2B8QA 3IG1A 4WP8A 5F8GA 4JB8B 4DUTA 2EFPA 1LOUA 1U0HB 2FB0A 1F9FA 4A8XA 3CDEA 3SV4A 2HQGA 1V3SA 3Q8PB 1T9TA 3DOLB 2KZZA 3MEGB 2RRBA 3OVSA 2VASA 4CO4A 3BPDA 4NA2A 3EGNA 4LFCF 3WBZA 4WFZA 4R8UB 3J80Y 1ZTWA 3C16B 1X4FA 3T3FA 4IH7A 1HBMB 2R4FA 4IOCQ 2DK2A 2IAJA 2GO8A 4USWA 5L38A 4NCAA 4OHZA 3WZ0A 5B08A 1S6QB 1RISA 3UDEA 3H5XA 5J2TF 4A8YA 4RW6A 4FKYA 5D78A 5EDWA 4LFCJ 2BQUA 1M6VA 1VIOA 2ZDQA 2V4QA 2CXEA 3TYTA 2NYHA 3AX6A 4CLTA 1SCUB 2HF1A 4HR2A 2EBGA 2WRMA 4CLZA 1FVIA 1PX2A 2R8JA 5KT4A 2SXLA 2FVCA 2H51B 3G4SZ 4DQRA 5LYJF 1YQHA 5C1PA 1K1SA 3QAUA 5LT5A 3BO3A 3EGZA 3QYYA 3O5TB 5CABA 3GG0A 3I55Z 2W6MA 1PKUA 3DLKB 4O4GA 2IBOA 1F5AA 4QW9A 4P52A 2JVOA 1T9WA 2NSCA 2Y0SA 1RLDA 4NXMJ 4F26A 1OWXA 2NXEA 4WTYA 2B63I 4R8UA 3J7YU 3CDWA 3LALA 4ED1A 4DG1B 2PD1A 5FIIA 5I5XA 3K17A 2BZ2A 4OLPA 4MV4A 1FRKA 2DRDA 4NZ7A 1X8DA 4C8NA 2RJZA 2RB7A 1WDDA 2JA5I 5LMNJ 1X7VA 4KAIA 3SFGA 3RAMA 3VB9A 3QSYB 1I2KA 2IRYA 3QRPA 4DV6J 4RWXA 1VDHA 3AD9C 1YDLA 1TFIA 3M05A 4WJBA 2OIHA 4JI5J 4NBFA 2ZC4A 4WP3A 1MG7A 5C25B 2RUSA 1WZNA 4LVOP 2QA4Z 2W9CB 1QAYA 1VQ6Z 3T9FA 3ZTPA 5IZHA 3OFGA 3K0JA 1TL3A 3ZZ0A 1LWEA 1CC7A 3SXLA 3FRZA 4QR1A 3F44A 2IJRA 4C3LA 2CJQA 4IOAQ 2NQPA 2CPDA 3DKDA 1Q5YA 3G8DA 3CB4A 1NK0A 3P4UB 4NH1C 2Y1JA 4PZ8A 3H0PA 3W9JA 1GSHA 3NGSA 3DI6A 1UEKA 1XQIA 3IM8A 3S15I 3G6YA 4J9SA 2GU2A 2XZDB 1VQ51 1YBAA 4IZOA 4DL6A 4O3OA 4ECQA 2XLIA 1B70B 1RNIA 2V69A 3HFVA 1M1K2 4DR5F 1H74A 2VOPA 3QQMA 5G0RA 2GJ2A 5LMNF 1VQMS 2WSFC 1SBRA 2YKPA 5DDRC 3S01A 5F8JA 4TY8A 2XYHB 1DQAA 1BQMB 4DZDA 2UVVA 3W3SA 4PWWA 4QR0A 3PKMA 3AB2B 3D5MA 5KFAA 1S76D 3AW8A 5IOLA 1TQLA 1AZSB 2Z2YB 1HBUA 4C5CA 2PFDA 2HIYA 2IM0A 2MB0B 1U1LA 1YHQZ 3CJSA 4QYRA 4HQ6A 3K8VA 4EGJA 3UR0A 3BZQA 3M8YA 2E5LF 3DYAA 5FR9A 3MMAB 2HGMA 3LP1A 2BJ8A 3G71Z 3VPDA 2E7ZA 3N4WA 3VGUA 2DRAA 2Y1RI 1XMQJ 4IFVA 4TUYF 4UOHA 5DMXA 1RWNB 4U95A 2D7SA 3JAMY 3HB9A 2LXFA 2WOMB 3DLGA 1S6QA 3OW2Z 3BO2A 2O4HA 2HVDA 4ZN1A 1I7LA 1RQ0A 2DGUA 2QL7B 1S7HA 1R3NA 4XPCA 2ERRA 2HS4A 1SUQB 1DTQA 3M6XA 1P8LA 4MD9A 5KX5F 3THPA 4ZVFA 2N3LA 3CD6S 2VPZA 2KRBA 2KL8A 2XMAA 1RAIB 3KG1A 3FQKA 2FUG9 2WAQA 2MLXA 2BABA 1UW9A 2J9DA 2JEIA 2I1RA 3C46A 5DGHA 1WEZA 2PN6A 3CCVS 1GX6A 3NNAA 2IA6A 2MQ8A 4Q2MA 2Y1IA 1OY8A 4LQ9A 4DZ6A 1YJ9S 3VAHA 3I4MI 1S1TB 4NOHA 2ATCB 5I3UA 1BQXA 2F8MA 3IG1B 1TKXB 5IM0B 4M95A 3GDEA 4ZVTB 3CCMZ 5KFLA 2C2OB 4YFUA 3TO8A 3D1OA 3MEEA 1HW9A 3FEYB 3KLIB 1FT8A 5CAEB 1B0PA 4CYUB 2NU9B 4USTA 3E01B 4KRWA 4ED4A 2HQDA 3CDBA 2KG1A 5J2MA 3PW5A 1S1UA 1B0VA 2EK1A 3HJVA 2QSWA 3H3VJ 5IYZF 2YNIA 1T03B 4DR7F 5DGAA 4JI6J 1AUDA 2MKKA 2K1RB 3WQPA 1RWPB 2XS2A 4DPXA 1ZTTA 4YOEA 2WK4A 5DG7A 4DFJA 2LIYA 2K8GA 3S2HI 5IT0A 2HGWA 2JEGA 4OI0A 2MYFA 2DE5A 1UJ4A 3NMAA 5GMDA 3KIFA 2VDHA 1KDNA 2V67A 3AOAA 3R7SB 2JSXA 2C00A 5CE8A 4JI5F 4DCOB 4YB8B 1ACMB 4CT8A 3FNNA 1BMQB 3MMCA 3PEHA 4C8ZA 4F4AA 3RJMB 4X4TA 1CULA 2JIQA 2HURA 1FXDA 2HFUA 1N5QA 3PEJA 3OW2R 3SQGA 2EG2A 3M32B 4W90B 4X2BA 1P1TA 4KGXB 4Y52I 4A3GI 5T7LB 3ITHB 4KY3A 1QJHA 4ZLPA 3RW7A 2JR6A 1Y5LB 1U25A 3OR1B 3D28A 2JIRA 4KGVB 4FFLA 4CTAB 1TL1B 1LWFB 4HN2A 4HDHA 3J7YI 1JLAA 3GQCA 1U0SA 4MK9A 1JKJB 5L39A 3MWEA 3NL0A 3QO9B 2VU5A 2KI2A 1HWLA 2BE7D 1Y3KA 2FLLA 1MMLA 2WOMA 5C5JA 4B3MF 2ALZA 1J5EJ 2GVZA 4EMDA 2HGXA 1RT7B 3VALA 2RDIA 2O66A 4UFZA 2I8CA 4RO0A 1ZM2A 2C2DA 1X4AA 3AOCA 3PN1A 1YJUA 4O3RA 1RWXB 5D3GA 2HHUA 3MMAA 2D3ZA 2LQBA 3TA2A 1Z2NX 5LA6F 3MTJA 2PI4A 3B78A 2V8KA 3Q8SB 4E2XA 1YJNS 5I3UB 1JNRB 1TMJA 3T41A 3CWJA 3LWMA 4MMOA 2DNZA 4KHRA 2YNHA 4WP9A 3KAJA 1ZM4A 1NK5A 3K5HA 1SL1A 1SL0A 1V3RA 4M8LA 2F4OA 1FKOA 3W9IA 4NLGA 1N0VC 1KFSA 4MA5A 1ZAWA 3NWRA 1YLXA 2GNKA 2Y4RA 4NCGA 2BE2B 5FDLB 4WPAA 5F8MA 3KLEB 3V6DA 5J2QA 1TWFI 2ASJA 2J0QD 4G1PA 1S9EB 2JA6I 3GYGA 1N6QB 2EFNA 1WTFA 3TUPA 3RUPA 1XIQA 3BB5A 1K9MT 4ILLA 2FVQA 1NPKA 2YNGB 1HNVA 1RU2A 2FP4B 2I8EA 1A0OB 5ETSA 1MWYA 2CA9A 3EJMA 1CJUB 3MFIA 3LP1B 1I1GA 1Q95G 1GXTA 3AQOA 2R8HA 5HBMA 2VA3A 2IDLA 1JK9B 5K14B 3VVUA 1Z2OX 2CNNB 5DAAA 4LFBJ 1UP1A 4NRTA 4LF7J 5LSOA 3MPDA 2MHEA 2AEFA 4ZVUB 2ZE2A 4NZ6A 2JUBA 1DJ0A 2W8LA 4DFMA 2BJ1A 1MNEA 1GSOA 3M2UB 2XY7A 1LXNA 1SJ4P 2GHPA 1KVKA 2GX8A 5CZVA 1L3SA 1SC6A 3M2RB 3VMMA 4Q0BA 1K8A2 4C0BA 4LRFA 4LFAJ 1QUVA 4E2FB 3CDAA 1CQNA 4MA0A 2XLJA 3HD1A 2M8DB 4USHA 2GAHC 2FJXA 2BRKA 2J6AA 4HACA 2R2TA 3MPYA 4E0DA 5EHHA 2XULA 2OEKA 5ETRA 2VONA 2FPIB 1FX4A 2BE2A 4AL6A 2JA8I 1B04A 3OTCA 1NK7A 1UJ5A 1FRMA 3CW2C 3L7UA 3MM7B 4GKKJ 4YMEA 1N32J 3AXMA 4PZVA 2UXCJ 2VFUA 3EZ5A 1HHTP 4EFEA 4P6QA 4C9DA 1RSCA 1SUQA 2HNZB 2MZQA 3DXSX 1Q16A 2OEJA 1UTAA 5IT9f 2NLWA 2W6PA 1HQUB 3R5FA 3S24A 3DRXA 5CYJA 2KM8C 4X64J 3DLBA 3KJVA 2OTLZ 3DMJB 4CLYA 1YITS 4EGQA 2DBBA 2YKMA 2KFYA 4ZI7F 4BBRI 2XNQA 3BR8A 4JI7F 4OZLA 3MUMP 1VQ61 3BAAA 3EXYA 2A3JA 3M2VB 3BDEA 2X5RA 2MPUA 2HWTA 3ULHA 3PO3I 3R6GB 3DRSA 1NNDA 4FS2A 4J5OA 4I2QA 2NUHA 1P9QC 3TW6A 1XK8A 3GTQI 3MPWA 5GONF 4QSHA 3S6EA 2DR9A 3PNIA 4F25A 3L09A 3MM9B 1T0TV 2W2QP 1RB0A 3R6LB 1OQ6A 2OEMA 1C1CB 2VPYB 3DU6A 3S1TA 4RBUA 2W6NA 4UOFA 2AV5A 3KIHA 3KNAA 4X62J 2EPIA 4UT4A 2IVMA 3AH6A 2VPXA 2AJ1A 3BYRA 3BM7A 4UCVA 1PIEA 5A0YA 4MV1A 4PZ7A 4JI0F 2L3MA 4M1KA 5B0AA 3H59A 2HIXA 3MTKA 4K59A 2HFZA 3AD7C 2XZWA 1TFYA 1J27A 1KS2A 5GADI 2V4RA 5D0RA 3FFIB 1P1LA 2C42A 2JH3A 1R8BA 2VQFF 3KG0A 3HDSA 2RQKA 1S9FA 4J9KA 1FHTA 2HVEA 2QLFB 5GAHI 3BA8A 3I56Z 2W6OA 4IRDA 2OJ3A 2DNGA 1ZZFA 2M0GB 4URQU 3DOMA 2CJKA 2BJDA 4JV2A 3A12A 4QWEA 1SIZA 4I55F 3BGFA 3T6JA 5F0UA 3FCHA 1WF1A 2NUUG 2UUBJ 1RAHB 5BXIA 4HTIA 3T1HF 1OBDA 3BG1B 2QLVB 4NFRA 3KJQB 5GVQA 1T8EA 3CD7A 4A8FA 3RU0A 3D6TB 2WW4A 4ZPTR 6FD1A 5A6WA 4L3KA 4DSKA 1A9NB 5FPOA 5C42A 2R7XA 4FXWA 1S1WB 1VBZA 2OFGX 3CCQS 1NK6A 3J81Y 3JZFA 2V8JA 4KPYA 1OPZA 5FLXb 3EDRB 3TP2A 4NB9A 1RYSA 5F9NA 2L48A 3SSSA 4ERDA 1FVSA 2P6SA 2XO6A 1SC4B 4LIWA 3QGPA 5B09A 2XO7A 2R8GA 3UCZP 3PJXA 3R5DA 5BWTA 3GILA 2JC1A 2GVDB 5LL6d 1VQPS 2QT7A 1KLMB 5BWXA 2DGWA 4XX0B 1YRUA 3HVTB 1VJQA 2ZM6J 3CULA 4YHHJ 2QLJB 1Z02A 2QSFA 3NGUA 4AQYF 5D6GA 3CIZA 2DITA 4PUOA 4OHYA 1UVMA 5DQHA 1WC3A 4UCOA 3A8JA 3C15B 1S5ZA 1HNZJ 1SL2A 1JLFB 1SI9A 2RKIB 5JXSA 2ZZNA 1C0UB 1JNZB 4NLSA 4UCSA 4PXEA 3CJ8A 3WDOA 1XK5A 1XJWB 3HOVI 3IA0A 2QKDA 4DR1F 2YQ0A 3PR4A 1UAWA 4PABA 4TVIA 3LF0A 3UDVA 4DCJB 4TQRA 1S7IA 5BYBA 1EKPA 2E2JI 2W70A 5E3QA 1IQZA 2LEPA 3DHWC 4LSNB 4ZLJA 1U45A 5B0CA 1BC6A 3O1LA 4YJ2F 4M5GA 3GTYX 3NH4A 1FTRA 3UN3A 5DGBA 2J0SD 3EE3A 5KFEA 2KT3A 4F8RA 3J7AN 3NFZA 2HQIA 1TK5A 3MCSA 2H3EB 3IR7A 1VIXA 5HP1B 4ZKAA 5F9LA 3WIVA 3ZZOA 2XBPA 1S77D 1VQ4S 3PIPQ 3I561 4EEYA 3PO5A 4O81A 4CH0S 4LR9A 3M1VA 4PPZA 2I0XA 1RWWB 3OD2A 3FBCA 1WW9A 1S6UA 3Q87A 1TUWA 1VQ9S 1D9DA 2FHKA 3O44A 2CUYA 4ZHQF 3IWXA 1ZBTA 2DGQA 3JRWA 3VZIA 3S1NI 3VGTA 5KFOA 5HSPA 3I6PA 4Z7YA 2NXJA 1FE0A 4DLEA 2WAQD 1WUUA 3FUYA 3D68A 4C0OC 2QYCA 2JVRA 2GJIA 2ZHBA 2UUCJ 3C2PA 3E3XA 2ZBPA 2BBEA 2X0SA 2KDOA 3QIPA 2DR8A 1NJWA 2AX1A 2MQPA 3TVKA 2VG5A 1FJEB 2XI3A 5KG2A 2C1EB 4TQSA 1VC0A 1IKVB 2ROEA 4NXNF 2DY1A 3OXFA 1FNMA 1IKYB 3D3BJ 4DL0C 3DRRB 3FBFA 5GAGU 4ZCKA 2RRAA 3N6LA 3M30A 4KO0B 3MZLB 1VQ4Z 4WU2A 4ZVQB 3D0IE 3IMQJ 1SJFA 3CNQP 3T1YJ 3Q22A 2R7QA 2KKHA 3PW2A 1FDDA 4MJKA 3HZGA 1O5JA 2ILZA 1U6BA 3LTOA 3F3PC 2ZH2A 3W62A 2FJDB 3MURP 4F0MA 1LQ9A 5U47A 2AGOA 4OIXA 4F2RA 2Q1LA 2DGOA 4YAKB 2C3UA 3LP0B 4WYLA 1DFDA 2JFKA 3CC21 2QREB 1YHQ1 4QWCA 4M5IA 2OELA 1PCAA 1S6PA 4HTJA 2W9AA 1VI7A 1AUXA 3FZBA 4O0NA 1LW0A 4CM2A 2F4VF 1KT8A 3IX0A 3ETHA 2C3MA 3MMBA 4EUVA 3K5PA 4Q45A 3TA1A 3NOGA 4PWDA 2IMOA 4MD8A 3DU5A 4ZIVA 2DH9A 2E5GA 4J9UE 4O3QA 4NRUA 4CKBA 1TFWA 5KFTA 2AJ0A 1GQEA 3HHEA 1TKDA 2E9HA 5BWUA 1MN9A 4P2XA 1RT5A 4MTPA 1GSAA 3OUUA 2UUBF 2LFUA 1APSA 4NBHA 4K7QA 2J6SA 4UQTA 4DR2F 2HGLA 5K9FA 4PG7A 1F5BA 4DV2J 3NC0B 1VOMA 4EWTA 1GMUA 2J9CA 4MIAA 4X4NA 4G1QB 2AJ2A 1EB0A 2FGOA 4A3JI 3A3NB 4NLOA 4C98A 3POTB 3OFFA 4QYZJ 3CCWA 4NLQA 3NEKA 4QYZK 1RCXB 1S9EA 3NAHA 3HX9A 2YH1A 3V2UC 2HNDB 4OHVA 3RBXA 2XG8A 1BUXA 2PMHA 4JXUA 3RUBL 2ZH9A 2HZAA 3R9RA 5LMUF 3R5CA 1YJ7A 4ZPWR 3MM7A 2V2QA 2W7OA 1KHVA 2B7CB 4DOZA 3ILOA 4H4KA 2QC3A 4LF8F 3HKZD 3CME1 2Q51A 1EHIA 4LF5F 2COLA 2ZNZA 2OP5A 2J7WA 2I3CA 2C2RA 4USKA 5G4DA 4A46A 3IFUA 4M0JA 2XHWA 4HL9A 4HT7A 3HHLB 4DSLA 1FDBA 2YX4A 1DTTB 2V34A 4C8KA 3DOKB 5D0HA 2J9DE 5CXTA 5D1PA 4QWAA 4OZ1A 2JDJA 2LQ8A 3KUEA 2QRRA 4EU0A 3CEDA 3RRKA 1PYOB 3H20A 2UUCF 4NLWA 4I0WA 4RW7B 1FFSB 2NYIA 1A9XA 4IFVB 1YIJS 2YPYA 3EICA 3MGJA 4RVDA 3OL7A 4DV5F 1IJEB 1UETA 2CQ0A 3QLHB 4CI0B 2PN1A 3EGVA 3CUNA 3MEKA 1XEZA 2V3VA 1Z4UA 1I5OB 1NPPA 3ITHA 5I5VA 1NXIA 2CZGA 3UFXB 3TWZA 2CDQA 4ED8A 2YNFA 4QW8A 5JVLA 2GIRA 2GMHA 3OTOJ 1VISA 2KTQA 4GKKF 2WONA 3OL9A 3WNZA 2E66A 3FSXA 1L3VA 2EGTA 2R7RA 5BMVF 3CCS1 1RQFA 3FCVA 4MFBB 3L7PA 3OR2A 1TUGB 4TLQA 5HLFB 4ETZA 1GXUA 5LXTF 4MK8A 3I9ZA 2V2KA 1ZH1A 4DV4J 3C16A 5HLFA 2IM2A 1UMJA 1LW0B 3H90A 1XNQF 3L7OA 1LKZA 1S57A 3CCL1 5ETOA 4IG0B 4FVMA 4QTTA 1N88A 3I82A 2AQ4A 2RE1A 1Y10A 3VF0B 2FYXA 5K5MA 3T99A 1C1BA 3SDEB 3LQVA 4O7LA 1R0CB 4URSA 3VTIA 1KUTA 4O4JF 4ZCIA 3B54A 2BW2A 1BXNA 4DRFA 2DO4A 1S7MA 5KG0A 1PAUB 3M8QA 5KOWA 2V8IA 2RQMA 3OT9A 1CS4A 3U1LA 4O7YA 1RWMB 3O8WA 1TP7A 2DPJA 1GLVA 4RPFA 2IRUA 5M2PA 3ZZPA 3AA8A 2WHOA 4CLPA 2MTLA 3OLAA 4F4YA 5KAKA 3OTOF 3I0RA 3LW5C 4D3HA 2JIMA 3UI3A 1KQSZ 3OJSA 4FPRA 1SQGA 3MDFA 4LUBA 4C97A 2V4JB 4O0IA 1HPZA 3DTFA 1VK8A 2E5IA 2XHCA 2RILA 1G3OA 1Y9OA 3NUAA 5CYQB 1RP5A 4X4PA 3KALA 4LMZA 2W8KA 4M9UA 3RAQA 4AYBA 1YK9A 4DX8H 1W2BZ 1IBLF 1QF8A 2BV3A 1JKHB 3G82B 3LGMA 1LEOA 3HT3A 1HYSB 4K8RA 3MR6A 3LGNA 4A3LI 4F0KA 2LQJA 3BPSP 5FLXf 2YRWA 3PKYA 2W9BA 4A48A 5EUHA 3AT1B 3O3LA 2DXDA 2E7VA 4HNTA 1F2HA 2GHVC 1D09B 3DN9A 3KDOA 1NZ8A 5DQGA 1W2IA 4KGKA 4UCUA 1N33F 5A0YB 5F3ZA 2D9OA 4X4QA 4KE5A 4PYDA 2G2ZA 3MECA 5KFHA 1YZ6A 1KSPA 2J0XA 4L72B 2RHSB 2G1DA 2ZZTA 5EX3A 2RDDA 2O01C 1VBXA 2AIRB 5LMUJ 3K5OA 3BG5A 3CF5Q 4O7WA 1R8CA 5A8WA 1WI8A 2CJAA 2ROGA 2V6AA 4IG3B 5ITHA 3HD2A 4MKYA 3C6TB 4NLDA 3JQKA 2ZH1A 3HP6A 1GXLA 3VWSA 1LWEB 3P5JB 2HJWA 3M30B 1K9M1 3R5GA 2FLOA 1NJI1 2BQRA 3US5A 5E3RA 1HBNB 4ZITA 1M5OC 3CCQ1 1RT2B 1RTHB 4LF9J 1KJJA 2E2HI 1IOWA 1CQJB 4HI1A 2XCPA 2M2BA 2VC0A 5JJBA 4O2AF 3GIKA 2EFQA 3T4NB 2UXCF 2ZNYA 2B4PA 3ZXWA 3CPWY 2HHTA 3NH5A 2N3OA 3X3UA 1ZB9A 2ZOMA 3CCTA 3M8SA 3M6VA 4O7SA 1RAAB 1YI21 1Q8LA 2CQ1A 1KBLA 1QVGR 1SB6A 4I56A 5CYMA 3MR2A 1S79A 1QD1A 5L9XA 4LFAF 4CWBA 2NVQI 4A93I 3BV8A 2UXDF 3BSCA 3VHQA 1FD8A 3KFWX 4IH6A 4YAJB 4ZP8A 5C1OA 3IN5A 1HBNA 4WCEQ 3BGRA 3CCES 1R8PA 4X66J 3W2WA 3T9DA 4RX6A 2A0FB 2IY5B 2HNYB 4OI4A 2Z04A 1WC4A 5C24B 3HI9A 2KM8B 1UFKA 1W93A 4J9MA 5J2PB 4OYBA 2MZSA 2R86A 3DLEB 3ZFVA 3LUYA 2CZ4A 3PCOB 2E5JA 3LP2A 3HFKA 3MWBA 4C7QA 4WKYA 1F9HA 2YNFB 3V4MA 2ASDA 4U8YA 3JTNA 2MZJA 3J7A4 4X65F 4DUZF 1H38A 1Q0NA 3ETJA 2VIHA 1I7NA 2HWHA 1QAIA 1TWHI 2B4VA 2KZMA 3E5NA 3HM9A 2G0JA 2Y0SD 3ICLA 1X31C 3TAPA 1SH2A 1Y7PA 3TQEA 2MQMA 1OS5A 1URRA 2JWNA 3CCVZ 3AJ1A 2VUMI 5HN0A 5KFIA 3EYZA 5KFYA 2OAUA 2J76E 4JUZA 4WKRA 3MPVA 3DAAA 1RACB 4M94A 3KLEA 4DGLA 1VBYA 1HA1A 2MGZA 1X4GA 3PHEA 2B6AB 3UD4P 4E30A 4EWCA 3R27A 1I1KA 2DCLA 2QMWA 4MKAA 5KG1A 1SH0A 1FKOB 3DF7A 4XDCA 4Q4DA 2YU9I 1VLAA 3J7ZT 2D69A 4H4OA 4P7TA 3M3YI 1KC81 2GAGC 2OPPA 5IV4A 4PG6A 4H4MA 2AWZA 1U1PA 5K14A 2JA7I 1N5YA 2F4VJ 3HVWA 3AFGA 3MCOA 3H2VE 4FZVA 3NG8A 3MAQA 4MV7A 3SCKE 4DEZA 4K4TA 2YKNB 1HNZF 4I68A 4CRJA 4EFBA 4RW6B 2W01A 2FHMA 3CXCR 4DS4A 4A3KI 4QTUA 5HVGA 1FERA 2RPRA 5JQGF 3CCSS 1L1OC 5J2PA 1VLOA 4EI2A 2VV5A 2JLGA 1K0VA 4NLTA 2MZ1A 1EETB 4IQXA 1JLCA 3SGIA 3CPWR 2Z2ZA 4ZOLF 3ONQA 4HYKA 3BGOP 4DR5J 4RUBA 1IQTA 2DPIA 2E9TA 1X4HA 3HFZB 2VKZG 7FD1A 1Q822 1TELA 1H7XA 4LREA 5E33A 1ITPA 3GCXP 4ELVA 2OO4A 2V8DA 2QFIA 2FHOB 4K4SA 2QL5B 1EKVA 1RTDB 4C8LA 1N56A 1W26A 1PJ6A 2V58A 2K5RA 3ILJA 4NZOA 1SQFA 4I2PA 3IWLA 1K0TA 2EI5A 4OL8A 2VBWA 3UFCX 2VBXA 4RL1A 3RV4A 3U27A 2QA4G 4ZP9A 2NU8B 3ADAC 1RT4B 1GEHA 3PFOA 4WIQA 3A8EA 2YWEA 1S12A 4ZS6A 2BJEA 4MAKA 1XR7A 3TZYA 2OTL1 1RLYA 2XMKA 1U7LA 2KT2A 3LP8A 1X0TA 4DUYF 1FEHA 1T9UA 1BWVA 3SQOP 2F7VA 3PJ9A 4B9TA 2YS7A 4QR2A 5ETQA 1YJNZ 1WRVA 4XYLB 3OR1A 3U54A 1AA1B 1Y5NB 1WWHA 1Q8BA 2R3VA 4DQNA 1VQ9Z 1FK9B 2E29A 5D0GA 4ZHRA 5M2RA 1USPB 1L3KA 1V6HA 1YJN1 3D1HA 4I2QB 3NGKA 4Q8FA 1Y0HA 4OJHA 4Y2CA 2GHWA 2HLTA 4ICLA 2DZDA 4KR0B 1XMBA 1PG5B 3I551 4F3OA 1DGSA 1QTMA 2Q7DA 2DIUA 1F6TA 4USUA 4Q43A 3HO8A 2XMTA 3HSGA 2ZAEB 2NR0A 1FRHA 2DRBA 1SH3A 1TL7A 5HAOA 2O1PA 3R23A 1DQ9A 3H98A 2DNRA 2KVIA 1HW8A 2POKA 2ACYA 2WZ1A 4N8OA 1XERA 1S1XB 4IUFA 3Q2TC 1VQPZ 3D0GE 3FMWA 3PO2I 2EFOA 1BHNA 4ID5B 5HMWA 1RADB 2EKNA 1L3TA 1H73A 1MU2A 2PMZD 1RI7A 4OZJA 4CLWA 4GO5X 3CPWZ 1RE1B 4R0JA 1VKZA 3K3PA 4DV4F 2V5HG 5C44I 4OZ5A 5DJBA 4U7CA 5KT5A 3QZ7A 5H1SV 3ISZA 1YG0A 4A8OA 3WO1A 5D4LA 4YHHF 3HVRA 2BACA 1KTVA 4CM0A 2QA1A 3H5SA 2COIA 2DKOB 4JV0A 5CA1F 2HW3A 3WWIA 1JJ2R 3JSNA 4DL3A 3M1VB 4I7FA 4C0HA 4O44B 2BEFA 2BYCA 4DPYA 4N8NA 2AJFE 1KOOA 1M1K1 3CC2Z 2U2FA 3QO9A 3JAMU 2EC0A 3AD8C 4NPOA 3UPFA 1VQLZ 3X1LB 4WXOA 3ORQA 4FU0A 3KXDA 1IWAA 4UY8T 2A1BA 2CVIA 1RAEB 2YW2A 3MAAB 1IBMJ 2XSJA 2GQ2A 5DZ6A 3UYYA 2M3DA 3FQMA 1NJYA 4KFBB 1WHWA 2XMMA 4JI7J 4FYVB 3PFFA 1N8R1 3H8YA 4OMFG 4WU3A 2R7MA 3MOJB 2DWCA 4JI0J 4IDKA 2MQNA 4NYPA 2C2KB 5A2Qb 2B7BB 3SNOA 1ICEB 4F3MA 1OSDA 3D4JA 2ZDGA 1NCLA 3VTNA 2D9PA 5J2QB 1BNCA 5KT7A 1U1NA 3ISND 1KEKA 5BYQA 3TX0A 1BQNA 2PEBA 2BR0A 4O7TA 4E98A 2UUTA 4ZPAA 2VB6A 4R5PA 2GMJA 2JS4A 4YBZB 1TL5A 2XSJB 2ZZMA 2K3RA 1HWKA 1VRTA 1B0TA 3G71S 3M2UA 4PR6A 2ZD1B 1RO4A 1WEYA 3MM5B 4ICLB 2ZOFA 2IC3A 1U47A 2ZVSA 2MMYA 3QATA 4LSZB 1YVFA 1G7CB 1NJI2 5CCLA 3GFHA 2XI2A 4F7VA 3ZNJ1 2DAAA 2AT1B 5LSRA 1ROFA 2Y0BB 3N01A 4RWWA 1KLNA 2LA4A 5C4XI 5DM6Q 4JV5F 3G4S1 1X4EA 5IC4B 1PJ7A 2EJ0A 5KT2A 1H2TZ 3TY5A 4DBQA 2QF7A 2CJBA 2J6TA 3KJNB 4Y0FA 3HXMA 3CCEZ 4C4WA 4H54A 2O53A 2MQQA 2WONB 3R2CJ 5F8IA 2DHHA 4QQBA 4CLLA 4DF4A 1IR2A 2MY8A 1MN7A 2DXEA 4BY1I 2OOYB 3UNYA 3CCRS 1WI6A 4A3MI 4O7RA 4GKJF 4E33A 1HBMA 3MUVP 4M5DA 1K8A1 5IP7I 2JZ5A 3LPYA 4PWUA 3LH2S 1RGVA 3L95X 4KSEB 3BA9A 4ILRA 2BXJA 2P2CB 2QR1B 2ZBCA 2HBQB 1S0OA 2Z30B 2FLPA 4A8KA 3V6KA 2BJOA 2YNHB 1VC6A 3GPAA 2MJUA 3BH7B 2DE6A 5BPFA 4FXDA 1AB8A 3RTXA 2HFOA 1DLOA 1YGYA 4WXWA 3ZTOA 4B3SF 2F8HA 5I47A 1D3WA 1U8SA 4LF8J 4CO2A 3TJAA 4ZVOB 3BN4A 3KWMA 1N34J 2AX0A 1JKHA 1XNQJ 4LF7F 4MH4A 4LSLB 2XY5A 1X4CA 2C2NA 2GFFA 2WVEA 4DV7F 2R2UA 2R93I 3GFXA 4Q5VA 3T19A 5CYQA 2W71A 2W7PA 4KHPJ 4JI1F 4USIA 1ET0A 2RUGA 2HRTA 4OLOA 5DETA 3GONA 1WD6A 4Z37A 4XZ3B 3W5XA 5I5UA 2L9NA 3CCRZ 4ZVEA 2Z2LA 4CNYA 4KBIA 4BCAA 2X3DA 3BG0B 3JSMB 4PQAA 2L9WA 3TIIA 3ILLA 1PFTA 2ZITA 2YZGA 3QZ8A 1KFDA 2DEJA 2F65A 1J5EF 4KIAA 1RYRA 2DR5A 5I5TA 1CC8A 3L2PA 2W25A 2GJFA 2XMWA 4B17A 1FCAA 4NXNJ 2NSBA 2GMLA 2P3YA 2OGUA 1GFWB 2D1CA 4NCGB 2DJWA 2LQ5A 1OY9A 4PYAA 1ZOTA 2WYOA 1FKAF 2DHXA 2X1BA 1R6YA 3RZAA 4NBCA 3RZDI 5DG9A 4L73A 2GV1A 3P5TL 2LLZA 1HQ2A 1R27B 4DLGA 3PYDA 2MKYA 1V5IB 2H9ZA 4ES3A 4GC6A 4OJ3A 3HHLC 4B3RF 4ECVA 2OUGA 4NYEA 1KRLA 3OR2B 4O4IF 4PXDA 4BC7A 1SKWA 3GTMI 3HHLD 2AGQA 1REGX 4N41A 2P5VA 1UPPA 4YS2A 4F04B 3QJJA 5KFJA 4DV3F 3J81f 4RV9A 2U1AA 1P9YA 4NLVA 4DFPA 1X5PA 4FXVA 2JLEA 1JIHA 3TOQA 1MMNA 5D4NA 3FDSA 3W5ZA 1NO8A 2ASYA 4WBNF 3QLHA 4DN0A 3GJSB 4E6NA 4DV7J 1SKUB 1X3WA 3I07A 1E6VA 3GG1A 4C6AA 2JNYA 2F3JA 3SQGB 2HNZA 2WBRA 4HGZA 2E5HA 2VC1A 3T9ZA 3DDKA 1TU0B 3CCE1 2QEXS 5EWGA 1JLQB 1AZSA 4ZK7M 1FJ7A 2CKWA 1M1KT 4YY3J 2DEIA 1GX5A 4OYXA 2FVRA 1RAJA 1Y00A 3AA9A 4AYBD 1NH7A 4CKCA 1HMVB 5HQ8A 1EETA 4YN3B 3GYNA 1TK8A 3JQJA 2NXUA 3MUTP 4K4ZA 4N5SA 2QLXA 2W9BB 5A8KA 5JUMA 5AT1B 1KTAA 3PG9A 2G0CA 3TUIC 4RUCA 5E5NA 2HHVA 3M8WA 4DQIA 1UC8A 2LP4A 3FSYA 1NUIA 3TI0A 3RAXA 3QQCD 1KQFB 4FF1A 1EQMA 3GCFA 5AE2A 1YUKA 2HPUA 3I9V9 1EKSA 4J9QA 4H4MB 2YNIB 4AD6A 3R5BA 4HACB 1IN0A 3EM1A 4CL1A 2G2KA 1TTHB 2WB1A 3VAJA 4KV8B 4J91A 2OPRB 4TVAB 4Y2KA 1U1RA 1H3DA 1P6TA 2PFFB 1N5VA 1VQ71 3M2RA 2FPGB 1ZAUA 2V68A 3I0RB 1WTBA 2DGSA 1RWOB 1XMQF 1N8R2 2B6AA 5AE3A 2DLNA 1TR0A 5CH7B 4FF4A 2KJVA 4AL5A 1TL4A 1AA6A 1LNQA 1OY6A 4TYAA 4NA3A 4OQJA 1R0AB 3GZ7A 1RDRA 2PT0A 1CSJA 1M0WA 1RTJB 1SCJB 2CFMA 2W2NP 3W7BA 1JLEA 5L46A 4IDKB 3T5LA 4FFMA 2VG5B 4XK8C 3M8PA 4C8YA 3N5FA 3BEGB 4QJVA 3SIPB 3KK3A 4MV6A 2H4WB 1SIWA 1EKRA 2V59A 1CJUA 1QE1B 4IYQA 2BE9B 4DU8A 2OLSA 2XMJA 4QU6A 1FNXH 1UZHA 1Q7LB 4USMA 1VLYA 1BGXT 2KJWA 1SPBP 5E3CA 3MONA 5AJ3J 1O6XA 2HIQA 1UZDA 2QX0A 1NUEA 1BWEA 3H5UA 2EFGA 3RBDA 2MKIA 1NDKA 1VHFA 3MXHP 1UVNA 4NZMA 2UP1A 4PUOB 4U7UD 1GTEA 4PAAA 1JLCB 2XMUA 4DQQA 3I56S 1H98A 1VQ7S 3M9MB 3GIMA 2GGPB 3BBCA 5IQQA 1BY9A 2LDYA 5JVDF 2OPRA 3U1NA 1KC7A 2OTLS 4URGA 3T9EA 3EDQB 1DAAA 1CJVB 2HHSA 1WCMI 3Q89A 2DH8A 1URNA 3UVJA 1U49A 3QIPB 1IVZA 2DTJA 3K89A 3G6EZ 2ZDHA 4Q2LA 2VDIA 2G4BA 4IO1A 5DRKA 1MWQA 1KC8T 3T1HJ 3BN7A 2J9EA 1QVFR 2A6OA 3WWHA 3M8PB 2B9WA 4DX5A 2HK2A 3TRGA 1MROA 2NREA 3Q8VA 4K4VA 2MY7A 4NE9C 3THVA 3H5YA 3J7A1 2FY8A 4P2SA 3CMEZ 2YH0A 3R5JB 3RYLA 1MW7A 1X0FA 4DXLA 4C2MA 5FNVF 2ZUAA 4A3DI 2KG0A 4NLYA 4HNVA 3SBMA 1KR4A 1KQSR 2RIJA 2VZ9A 2UUAJ 4GVLA 1K732 2H4YB 4FNHA 3LUSA 7FDRA 5F41A 3QFWA 2X1FA 5ETTA 4IR1A 1DRZA 4MRIA 3TDHB 1KNZA 3RTVA 2HIVA 3H7HB 1G1XA 4D3GA 3OL8A 4DL4A 5I3QA 2OSQA 2HMIA 4UQGA 4ILMA 1Q811 3GP9A 5KT3A 4NBGA 2PDAA 3S2DI 3MM8B 1FRIA 4QZVB 4NB8A 4RKUC 2IVFB 1QSSA 3SCJE 1HNWJ 5GMKa 2OFHX 2JRSA 1FNOA 2MSTA 1PK8A 3V4SA 5HP1A 5A8KB 3R2DJ 3D67A 2HHFA 3D6MB 2QJ3A 1D8ZA 4LBIA 4P74A 3CXCZ 1Y1VI 2QE5A 4ANEA 3H25A 2GTHA 1UW4A 1Y8CA 2IYIA 3Q0AA 3S17I 4EBEA 2UU9J 4WE1A 1IM6A 1TL1A 4FYWB 5FD1A 2VH7A 3BACA 2K1RA 5E0OA 1U48A 1Q821 2C2ZB 2JC0A 3IC1A 2JX2A 4DV1J 3CCZA 1G2EA 1M5VC 2QLBB 5T41A 1HI8A 4RNFA 3UZOA 5GAEU 3IM9A 4MYTA 1QTNB 4X64F 2DNNA 2DR6A 1RHUB 1Z2LA 1IYDA 4ETXA 3DOMB 5L1LA 4TXSA 5HATA 1PBAA 3D7SB 3MM5A 1U02A 1LV5A 1VBGA 1IXKA 2M9KA 1U0HA 1IBKF 2EC2A 2KYZA 2VFSA 4YB7A 4XPEA 4B3MJ 3PO3S 5I4MA 4R5PB 3IAS9 4YB5A 2N4CA 2DCUB 2ZWOA 1WJ9A 4EYIB 2HRUA 4DV6F 1RAOA 1VQLS 4BWMA 3JAMf 4HH0A 1FDAA 4PCQA 2FVSA 3M7VA 3MHYA 2GVZB 5MAOA 3I4NI 3DC2A 1FRLA 1EUCB 3CC2S 2R85A 4DMZA 3GIIA 3BQ2A 3KLFA 1Q7Y2 2G9OA 2C3YA 3A8KA 1U6ZA 1I3OB 1VQL1 4LR8A 4EQ5A 5C4JI 3AODA 3QGHA 2I6WA 1LK7A 1FKPA 1FRJA 1JJHA 5H9EJ 1VQSA 1WOPA 2Z2MA 4KH0B 4UUWA 3RGIA 5CQGA 2CG4A 4XTTA 1KHWA 3P49B 3U0GA 3POTA 4UUXA 1C0UA 2GIFA 1DHMA 3V81A 2Y9HA 4AXJA 1X4BA 1VQ6S 1FXLA 4DJBA 2XWXA 3NDJA 1IM4A 1JX4A 1XNRF 3SFUA 3M6UA 5FLMI 2AF6A 4NWBA 3U02A 5F8LA 1H0HB 2CPXA 5AE1A 1RO0A 1DLOB 3GJXB 5C25A 1AXQA 4PZ6A 1NSAA 2HGSA 2VA2A 3IGVA 1Q5VA 1LQLA 4ED3A 3OTBA 2IYGA 2RQCA 4DSIA 3CEBA 4F2SA 3CCJS 1ZAXA 2X3GA 3QRQA 3IF8A 4J9VA 2HBRB 2C2MB 2R8IA 5EN1A 5IT9U 3FBBA 3Q24A 3OUYA 5HK4A 3F56A 4NLXA 3KHRA 2EFVA 1HHSA 1N5TA 3MAAA 3P6YC 1NKBA 3FVYA 4IRKA 2YS6A 4WF9Q 3UVJB 5LL6f 3MM9A 1U2CA 2HBZB 4L74A 3DM2B 5HROA 1RKIA 2RD5C 2F5GA 3UNGC 4MKVA 3PR5B 2PBZA 4L3NA 3NP5A 4IWXA 4RBVA 1Z01A 2Z02A 2Z56B 2AJQA 4DU7A 2QEXZ 4OX9F 4CLSA 3DMJA 5B0GA 3MAHA 4MK7A 4PKDB 1TKXA 4J37A 3TJ9A 5BYRA 1XNRJ 3GSDA 3I87A 1WEXA 3SV3A 2ZDOA 2BVZA 2J5AA 4IG3A 4V1Ak 4B9VA 1Y11A 3PYFA 4X84A 3K5IA 1YRXA 2V9WA 2V0NA 2OPSB 3D66A 3JQMA 2XYGB 1IOVA 2ZH8A 2YKMB 1LFPA 3PRBA 4RR5A 3TEKA 4A4JA 1NHVA 1TAUA 2RBLA 3UD3P 4RU9A 1DTQB 3VQTA 2ZOGA 1WACA 5HVHA 4YR3A 1S6PB 4ITSA 3NDIA 3A3OB 1IBMF 4MV3A 1U26A 1KRPA 4ZIWA 4RW9B 3EUNA 3A13A 2XQCA 2CJ9A 1Q1KA 4YB1P 3OQ2A 2QV6A 4Q0BB 3RBEA 2I38A 2QZ8A 1FJGF 2VPWB 2ZBQA 2QK4A 2AYGA 3MJFA 5DISC 1UFLA 2JLFA 4UTGA 2CAJA 1S0MA 2BDPA 2DIKA 2CRLA 2OTJZ 3R1LA 5H80A 4WFXA 2NPFA 2XD4A 4ED6A 1ZAVA 1M0TA 5A8WB 3F73A 4JV5J 1SJRA 2W4DA 2LEXA 1FVQA 3UWTA 1F3VA 3V6HA 4QWDA 1R9TI 3CE8A 1N0UA 4G1QA 2EVZA 4QIWD 5HNEA 3QFHA 1SJ1A 3RR8A 4E8UA 3GMGA 4F36A 4MV8A 1RHRB 1IUJA 2R6MA 3I0SB 4XIUA 2P28A 1S1VA 2K2PA 3F41A 1PO6A 1RXOB 2CPHA 4RW7A 3OJUA 5HL7Q 2UUAF 1RLCL 4DQPA 1XTZA 2BMBA 4TU7A 1GNKA 4FP9A 1GAOA 4O7ZA 3HOXI 4O4HF 1N8RT 2DVIA 5ADZA 1CBKA 3GV7B 4LRDA 4W4MA 3RB0A 3B82A 3HOWI 2H5EA 1QVGY 2QG9B 2HMIB 3SE7A 1JXLA 5GAHU 4I6AA 1AT1B 2OPSA 1KLMA 1YUAA 2HVHA 3T6BA 2HHHJ 1A7GE 2CWKA 2M8HA 1A48A 5IWAJ 1ULZA 4TKTA 3VMGA 1RT4A 3VGSA 4KKOA 3RFCA 3VPCA 2Y8YA 2UU9F 2F8EX 3UO0A 4FE2A 1JB0C 4IKAA 4GC7A 2CPEA 1UVIA 3H2UB 4BHQA 3I12A 4JYAF 4ZCMA 5DDOC 5B0BA 1KQSY 5DO2A 2XZTB 4MT1A 4RS4A 2R2RA 1HNWF 5J2UF 2IVYA 4ZHRB 4DAAA 5KT6A 4RZRA 5CD4A 2ZH7A 2K3IA 2AU0A 1JJCB 2LU2A 4YR2A 2BQ3A 3LULA 1CJTA 3QNWB 1FKPB 2HEKA 3DYAB 4CO5A 1A0GA 2NZCA 3JSLA 3ETOA 1ULRA 2ZH4A 4RZQA 3CSWA 3D6FB 2E2II 2KVQE 3M8RA 2E1CA 1Q86T 2MLZA 5F8HA 3OVBA 5I42A 2WB1D 1RHKB 3DLHA 4M5JA 3CO0P 5THWA 4DR3J 1KC82 1RBAA 2RT3A 3FEXB 4W98A 2RQ4A 2XTJP 3PYEA 4U9RA 2J6UA 4HHJA 4QWBA 1KJQA 4ZLLA 2ROPA 1PSDA 2M6NA 3DLKA 3HVTA 1CKMA 4UOCA 2Q79A 3L9ZA 1TWGI 2RHQB 5KG5A 2CPFA 4DSFA 2B3TB 4FKXA 3MFHA 3R5XA 5CA0F 1S9GA 3WIUA 2UXBJ 2BOAA 2I9SA 2WB4A 4ATNA 3SCIE 2R92I 3ZC4A 4CZCA 2I5JA 4B3OA 4CO3A 4DV3J 3DRPA 3F0NA 3BS9A 1WSVA 3Q2OA 5AXMA 2RHBA 2NAPA 1CG2A 2LU1A 3UDLA 5AN9F 3N28A 2HZVA 3V5RA 4UCTA 2XCLA 5GAGI 1R0AA 4JI8J 1LWCB 1B3TA 3B8HA 2IV2X 4EZ9A 1GK8A 3E01A 2D41A 4N76A 5K8OA 3C15A 4OYPA 1QVGZ 4FGRA 4QBUA 3WX4A 5BWRA 1UC9A 2C3OA 2Z8QA 4HDGA 1FWLA 3CCU1 3T9CA 2KRRA 4P75A 3KMSA 1ML8A 1XMOJ 4OX6A 8ATCB 3IR6B 1HQUA 4I50F 1U8WA 3M9NB 1U1KA 1NDCA 2MLYA 4WK1A 2PC6A 5DZ7A 1NK4A 1J5OB 1DURA 1C0TB 1RK8A 4XX2A 4OI3A 2FTRA 3CCUS 4Y00A 3TARA 3K2YA 4K4UA 1I3QI 4NLUA 2V8GA 1F3FA 3CCR1 1Z2ZA 3EERA 3HKWA 5B7WA 3N5BA 2VPZB 1KVIA 4DCPB 4XYMB 3HULA 4U6PA 1R8HA 1GT8A 4A47A 3R1HA 4LF5J 1FTCA 2VBYA 3PTWA 5EX0A 3J81b 2HVSA 5AXLA 3IRWP 4Q4CA 3TAMB 5K8NA 1MMDA 4DR4F 1RT2A 4J9PA 5BR8F 3D3CJ 1VQKS 7AT1B 2BUNA 2GO9A 5H9EK 3ORRA 3PY8A 2KB2A 3CJKA 2KN4A 2YZMA 2BKNA 2MQOA 2ACMA 3MR5A 2V45A 1J5OA 4P10A 5BYSA 1JJ2Y 2HFSA 2G1HA 3KLVA 5LOQA 2HG4A 4Y2MA 4AT1B 2ZBRA 5FPRA 3HT0A 1JMTA 2GC8A 1HD0A 1CS0A 3R97A 2OH2A 3A3PB 1S49A 3VAIA 3TVZA 4LBHA 4Q8EA 5H9FJ 2LECA 3MECB 1DZ5A 3P3DA 1EZZB 2M48A 2W9CA 2HBYB 3MEEB 4CLUA 2PVPA 4OHWA 1RT3A 1VS3A 3W5OA 3KHGA 1N2FA 5LSLA 4DPOA 4F67A 4OX7A 3KHLA 5JH7F 1SC1B 4P71A 4KTQA 2FZCB 4JBCA 1RT5B 1HLWA 2LXIA 1H72C 3DM2A 2RS2A 3EX7B 4A3CI 4OZ2A 3CQZI 3OVAA 2OI2A 5KFWA 1ZETA 4F4XA 1UL3A 3OHAA 3LANA 4K4WA 3KK3B 3J81j 2KHDA 3RRHA 3W1GA 4F3QA 1OQ3A 3TZWA 5I5YA 4ZVGA 3TQ1A 2DT9A 2HHPA 4DSEA 2P9GA 6FDRA 4ZMMA 4TNUA 2E1PA 1Y5IB 4LR7A 2AW0A 1HWIA 2RMLA 1LFWA 3F3FC 1IWGA 3FBEA 1R6VA 1D8YA 1RT6A 4DSJA 5FLXU 3CCM1 5CZXA 3S16I 2R7ZI 1U2RA 1EHWA 2K06A 1JXEA 1B6RA 2O5DA 4PG4A 5ETVA 3B4DA 4B9SA 1S72S 3T7AA 1NPRA 4H4KC 2MEWA 2ZVIA 1U09A 2R42A 4FVCA 1RAGB 1KEEA 3LAMA 5T64A 3DXBA 3G8QA 1W7WA 2CNUA 3EXCX 5D0EA 3UN5A 1EUDB 3C6UA 3I32A 3R9LA 2XCAA 3KREA 1QE1A 3HK2A 1W25A 2JIPA 1YJ9Z 1EYZA 5HV6A 2W6ZA 5KFRA 3Q23A 4KC5A 3KAKA 3LQSA 5FLXY 3T54A 5HJXA 4JI1J 4KHPF 1WG1A 1E6YB 1YJVA 1YHQS 1JLFA 4ZJQA 1VQO1 1CULB 3CC41 1X9NA 3W61A 4WK3A 3V4ZA 5D1OA 2FC9A 2ZKUA 3Q8RB 3CJTA 5B0FA 1TVRA 3KK1A 2W2OP 3NY0A 3RV3A 3GCWP 2B9XA 3MD1A 1ZM3A 4I6YA 3D0HE 1MU2B 1M5KC 2AP6A 3SI8A 5KG6A 2DGXA 2RDJA 3CT9A 4C48A 1N36J 5KG7A 3N0VA 2PMZA 2BM1A 3GYXB 4GMKA 1HARA 2C28A 1AROP 3C6TA 5E7OB 1LW2A 2MZTA 5C2GA 2CQ3A 2XS5A 3EPIA 2BKPA 2FPPB 1DIKA 9RUBA 1EAYC 2A18A 4WBFA 3CC7Z 1HPZB 2Q3PA 5JQWA 1JLBA 1VYAA 4RVGA 4DUZJ 3KKFA 1EQ0A 4KO0A 1CPZA 4I7FB 4UCRA 4DHVA 2BRLA 1IKXB 4C8OA 5F3TA 2OHDA 2CFXA 1Q82T 4DPUA 1JQGA 2FIUA 5KG3A 2GW8A 1MLAA 1W2BR 4PXCA 2NU7B 2VD3A 1HD1A 3VR1A 4W92B 2JOQA 5H9FK 2ZKTA 4GO7X 1YITZ 3RR7A 2X1GA 1KWMA 4V19X 1WC0A 1Y4ZB 2MZRA 3VAKA 4LF6F 3UQSA 3BJYA 1T9YA 4B3SJ 1HMVA 2RH3A 3DOKA 4K4YA 2YWFA 1KVJA 4U96A 3EWGA 4ZCLA 1CEZA 1EZ1A 2MDAA 1HNIA 1F60B 4PXBA 4OFZA 2NS1B 5DLGA 5K8PA 1C1BB 1RT1A 1ZA2B 2GVDA 2OPPB 1AW0A 3CJRA 3D6HB 1O0PA 3JSYA 2NVXI 4A8SA 4NZ0A 1BLUA 2H54B 1X5SA 1L5UA 2DE7A 4CT9A 3HO1A 1V9OA 2CQCA 2PM9A 4J7CA 3IP0A 1JLGA 1JJ2Z 3MEDA 3CD0A 5KTQA 1HYSA 3I31A 5D1OB 1WKJA 2VUGA 4MV9A 5AXKA 2EK6A 3MM6B 1UCNA 4ZVSB 1IBKJ 5DM7Q 4B3RJ 3OXLA 4CO0A 4O7NA 2LEBA 4LQ3A 4L75A 3KLGB 2IJNA 5LXRA 3JSMA 2RSQA 4TU8A 4MYUA 2FVPA 2C22A 2EJ2A 2HHWA 1I1LA 1YZ7A 4LRCA 4G1IA 4E32A 3C6UB 2DO0A 3AJ2A 1FX2A 1VCTA 3O6QA 4OX8A 5E25A 1T3NA 4TY9A 4ZVRB 5J1NA 2PGCA 4FF3A 2R7NA 2MKHA 3R5AA 1OYDA 1S4FA 1TK0A 3NGTA 2FQQB 4MKBA 3M2VA 2VODA 5KFKA 4JI3J 3OSNA 1OBGA 1RHJB 4ZJOA 4GVBA 2GQQA 4S1TA 1OO0B 3C3LA 4YEAA 3ENQA 3WC0A 5A2Qf 1EKFA 2R7WA 4O2BF 1UFWA 1IKYA 2WVCA 4ER8A 3IBCB 1WG5A 2W2MP 3JSRA 2IFXA 5HBRB 5D8DA 4QOTA 2VFRA 3ESWA 2N4DA 4WTOB 2YZNA 5LXYA 3R7NB 4DV0J 4OI1A 2R82A 1VQKZ 4FBTA 2DD8S 4EZ6A 4PQUB 4N56A 3ZTQA 1B7YB 2EXUA 1NK9A 4RW4B 4Y28C 4E2WA 3WC2A 3FFIA 2I80A 3TEGA 1NB2A 1DQ8A 2EKYA 3MR7A 1AFIA 4PEOA 1NJIT 1YBTA 4MFBA 4K0KF 1VQNS 4DR3F 1X60A 1RABB 1Q53A 2NVYI 1GTHA 2FB9A 4GLWA 5C7PA 5CB4F 5KG4A 3J7Z5 4DUYJ 1YBUA 4LVNP 4B9LA 2ZH3A 1RBOB 5GAEI 1VQK1 2VICA 2C3PA 3MCMA 3MPUB 2VPYA 3EZOA 3HSJA 5BPHA 1I1MA 3OV7A 1YI2S 1KQGB 5D8HB 2PEHA 5IQ6A 4OV6A 2PI5A 1KJIA 2NUAB 1E6VB 2F40A 1R43A 2VF3A 4MAMA 4OJ1A 3PX4A 3MZKB 2V4JA 4B3TJ 1LK5A 5SUHA 3TIGA 2F4MA 4I67A 3BBFA 4BXXI 1QUPA 2Z57B 1FF2A 1WF2A 2AZ3A 4WFYA 3FKBA 4TY8B 1VK3A 3IFEA 3NMRA 4CH7A 2NXNA 4I4TF 5A8RA 2FHJA 5ETPA 2HNDA 1P9NA 1WHXA 2CQ4A 3VAFA 1O51A
chains in the Genus database with same CATH topology
4AUKA 3GILA 2FVRA 1RAJA 1HL6A 3S1MI 1Y00A 3KTQA 2JC1A 3AA9A 4OJGA 5LL6d 4AYBD 1NH7A 1VQPS 1V3ZA 3GB8B 1HMVB 2QT7A 5HQ8A 4I1TA 1KLMB 2EWHA 1HFEL 5CYMB 1JLQA 1EETA 2DH7A 2DGWA 1LXJA 3TNVA 1YRUA 3HVTB 3CULA 4K2XA 3GYNA 3CJ0A 3RRGA 1VFJA 3PV8A 1Z02A 2QSFA 1N48A 1TK8A 5IT9b 2NXUA 3MUTP 3AAWB 2F9DA 4AQYF 5D6GA 3AQPA 3CIZA 1VQ81 2DITA 3DDNA 4K4ZA 4N5SA 4PUOA 4JOUA 3K5LA 4OHYA 3D9XA 3CCV1 2QLXA 5DQHA 1UVMA 2W9BB 5A8KA 5JUMA 4UCOA 3TX8A 5L8RC 3L3CA 3H40A 4O3SA 2G0CA 3TUIC 4RUCA 2RU3A 3FGVA 1HNXF 5FJ4A 2W04A 3AY0A 1SL2A 5E5NA 2HHVA 1JLFB 1SI9A 4DQIA 2RKIB 2A2DA 2E44A 1FDNA 3S1RI 4KQZA 5JXSA 1VQM1 2ZZNA 1C0UB 4U67Q 3S1QI 3FSYA 3I4PA 3TW0A 1NUIA 2CPZA 1JNZB 4NLSA 2PO4A 3TI0A 3GTGI 4UCSA 3RAXA 3BR9A 4X66F 4PXEA 3WDOA 2LQ9A 1KQFB 1XK5A 4FF1A 3HOVI 3IA0A 2QKDA 5E3PA 4DR1F 2HVZA 3I5BA 3PR4A 3HKZA 4RNOA 3GCFA 1UAWA 2CPJA 3KLHB 4DF8A 5AE2A 1YUKA 3NWGA 2HPUA 3I9V9 4PPDA 3U7JA 4J9QA 1HBUB 3LF0A 4H4MB 4WFAQ 2WTFA 2YNIB 4C11B 2LYVA 4TQRA 3R5BA 1FA0A 1VQ5S 3THTA 4KV8A 4CCHA 1XBWA 2E2JI 3RB6A 1IN0A 4CL1A 1XWLA 2G2KA 3JYTA 2HS3A 5E3QA 1IQZA 3BDPA 1RJJA 2LEPA 3DHWC 2WB1A 4LSNB 3VAJA 4A3II 4KV8B 1YI2Z 5IP9I 2OPRB 4UW2A 5B0CA 1U45A 3O1LA 1BC6A 3I96A 4B08A 3NH4A 1IKXA 1FTRA 4NYZA 4Y2KA 1WHVA 1U1RA 2I2YA 1H3DA 1P6TA 4EEQA 5DGBA 2OD6A 5CHCB 3OBIA 2J0SD 2E7XA 3IR7B 2JJ4D 3GWCA 2PFFB 3PM9A 4YQWA 1N5VA 3FQQA 1VQ71 3M2RA 3RZOI 3NBZB 5KFEA 2KT3A 4F8RA 3NFZA 2NZ4A 3DRPB 1KTQA 4Y6IA 2BANB 3I0RB 2HQIA 1WTBA 2DGSA 2VBZA 3MCSA 1U1QA 4TNOA 1TK5A 1XMQF 1N8R2 1VIXA 4IFYA 3VAMA 5HP1B 2B6AA 2ZJPQ 5AE3A 3G8TA 4ZKAA 3NKYA 3V6DB 5F9LA 2K3KA 1TR0A 5CH7B 3ZZOA 3OUYB 4FF4A 2KJVA 1JLAB 2XBPA 1S77D 4AL5A 1TL4A 1T02A 1VQ4S 2VKRA