3QWUA

Putative atp-dependent dna ligase from aquifex aeolicus.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
366
structure length
366
Chain Sequence
b'ISPELVKEALKKKKVRSEEAFGLEYLRFNDDYKDIPRGTAIFKDFIIWGYPHIGRIFLLETGLREQFEAPFWVEEKVDGYNTRIFKYGDNYYALSRGGFICPFTTDRLPDLIDLRILDENPDLVICAEVAGPENPYIEESPPYVKEDVQLFVFDFMKKNEQGFLSQEEKMELIEKYNLPHVEILGRFTASEEGIKKIKEILKRFNEEGREGVVFKEDSERNKRAKYITSYANLMDIKTNAKNMLQLPPEYYTNRILRLVLFMYEEGLKTTEHLYEELGRAFIDGLFQAIEQFEKEHKVYKTFTCKFRKKENAIALLELLSKTSKHIQVKERRLEKEGDYWRLEFDKVFLNMTGLLGHLLSGGIVYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Putative ATP-dependent DNA ligase from Aquifex aeolicus.
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 116
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09414 RNA_ligase RNA ligase
A PF18330 Lig_C Ligase Pab1020 C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.320 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3qwuA01
3.30.70.2160 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qwuA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3qwuA02
3RTXA 3UQ8A 1VS0A 2CFMA 2Q2TA 3QWUA 3W1GA 3NC0B 3GJXB 4GLXA 4CC5A 4EQ5A 2HIVA 2HVQA 4UCOA 1FVIA 3JSLA 3BA8A 4UCSA 1P8LA 5D1OB 1CKMA 5D1OA 5FPRA 5FPOA 2HVSA 1XDNA 1XK5A 2VUGA 5D1PA 3KYHC 4PZ8A 3BABA 1CKNB 1P16A 4LH6A 3RR5A 3NBYB 1CKNA 2OWOA 4PZ6A 4LH7A 3TY5A 3GDEA 1DGSA 1X9NA 4EEQA 1S68A 4UCUA 4EFBA 2Q2UA 3TY9A 3TY8A 1TAEA 4E6NA 4UCRA 4UFZA 1V9PA 1CKOA 1A0IA 2HIXA 4PZ7A 3BAAA 3PN1A 3S24A 3GB8B 4EFEA 4UCTA 3L2PA 3JSNA 3W1BA 5DISC 1B04A 3NBZB 4DRFA 3W5OA 4CC6A 2HVRA 4UCVA 1TA8A 3BA9A 3VNNA
chains in the Genus database with same CATH superfamily
3M8ZA 4DJBA 4OLPA 2GGPB 4JI7F 1FXLA 2CADA 5BR8F 4MYUA 2L9DA 3NC0B 4KHRA 3K5HA 4ECYA 1RKIA 4OX9F 2LIYA 3G82A 3R6GB 4K4TA 2N7CA 4M95A 4ZVGA 2COJA 2YVSA 4ZPVR 4Y2CA 4ZVFA 2FZKB 5HANA 1VQ6Z 1SIZA 5CQGA 3DOKA 4JV2A 2AYMA 1VLAA 2DPJA 1UTAA 5KFSA 3DTFA 1P8GA 3GTOI 1M0TA 4KC5A 2IA6A 1SB6A 3HHLB 3JXOA 1FJCA 1N5YA 3C16A 2VD3A 1RTJB 3PEJA 1CBKA 7FD1A 1CS4A 1WKLA 3Q86A 5JXSA 5M2RA 3CCSS 3WNZA 1LWFB 2YKNA 2BOAA 2DGSA 1C30A 4LF8J 2ILYA 3CB4A 4JYAJ 1JLAB 2IFXA 3PDNA 3BB5A 2B8QA 2MZTA 3IGNA 2K7JA 3IN5A 3M6WA 2ASLA 2N7YA 1GT8A 2NU8B 2GU2A 2QTWA 3U1NA 3PJXA 2JOQA 3WC2A 3FSIA 1P9NA 1RBLA 1FKPA 3NNHA 1G2EA 4M5MA 3I56S 3UPFA 3TINA 2LQ8A 1T9XA 1IBCB 2C2RA 2AD9A 4N76A 1F1BB 2Z2MA 1T9WA 4WFZA 3GZ7A 1QYPA 2DR6A 4Y8VB 3ZNUA 4O7TA 3CW2C 4EYIB 4LF8F 1RT4A 1TKXB 2ZBIA 1RBOB 3QYYA 1WF2A 4OJ3A 4JYAF 3CD5A 3FSXA 3M9OB 2IMWP 4K7QA 2GLTA 2KJWA 1IN0A 7FDRA 4ZDNA 2MZ1A 4CQ1A 5D0GA 2B5JA 2C42A 2YZGA 3OVAA 2G9OA 4PBCA 4DZDA 4ZK7M 1WIIA 2MKJA 3FSYA 5A6PA 2VDHA 4ZOLF 4PZ7A 4DQIA 3SFUA 1WTBA 1RT1A 2LU1A 1ET0A 1DQ9A 3V2UC 5F3ZA 1M6VA 3M6UA 2XB2D 2OFGX 1Y0HA 3PX6A 4CLFA 4O4HF 3I0RA 3O5TB 3SDEA 4FF1A 1YITZ 2HQFA 4P71A 4QIWD 2HGXA 3C14B 2XGPA 3GIKA 4NLPA 1M5PC 5GAEU 3LPYA 3R5DA 1VQ71 3FFIA 5B0FA 2BRLA 4I2QB 2LQ5A 3VPBA 3W8PA 2D1CA 1CJVA 4DR4J 2IZ3A 1BNCA 4Q43A 3IBWA 4RW6B 2VBZA 2C3PA 4PABA 3TIGA 4AFFA 1CKNB 4J91A 1RLDA 4BBSI 2ZH4A 3W63A 1KTAA 1HW9A 3VGSA 2JMOA 5CB4F 2HFOA 2KFNA 3OFFA 4B08A 3IMQJ 3WIUA 1Q7YT 4PXDA 5H9FJ 2NR0A 2HBQB 3UI3A 1JWHC 2B9XA 3ESWA 1M1K2 3HSDA 4DSIA 4O7VA 2GVDB 2Y0SA 4ZIVA 3OBIA 4TLRA 1N36J 4FKYA 4NFRA 3G6YA 5C7PA 3TYTA 2OEKA 4J90A 1HNZF 2VHGA 2W25A 3DOLB 4JI2J 2EC2A 3SYZA 3KJFB 4B17A 2IM2A 4KGXB 4NBGA 2BYCA 3BGOP 4X4UA 2ABJA 3I96A 2WB1A 2RQMA 1VQ5Z 3S1NI 4M5DB 2I8EA 1U0HA 2HG4A 1O8BA 1FTCA 5HV6A 4A3FI 4FVCA 2ASJA 3IWLA 1VQ91 3KKFA 1N36F 4PWDB 2HGSA 1WF1A 1RT5A 4F4YA 1VQ6S 4FYDA 1JWWA 2FHJD 4NOZA 4JI2F 3PXGa 4Y3CA 1YJWZ 3JQKA 4PKDB 2LEXA 2F65A 4C97A 1U47A 1DL6A 3ENAA 5GONF 1IBLJ 5A8WA 3C8YA 3LTOA 2FLNA 4YEAA 3S1RI 1RTIB 3DLJA 1HFEL 2V8KA 2DAAA 4DZ6A 1N6QB 1RA6A 1KQFB 4K2XA 3A3PB 2V94A 1YHQ1 3MCNA 3OFHA 5A8RA 3L2PA 3A3NB 4K59A 2O53A 3T5HA 4IOCQ 3TUPA 3EMTA 2IY5B 2WONA 2HVRA 1RHMB 3IRXB 1TA8A 5LL6f 1D3WA 5F0WA 3H2LA 2W9AA 1VC0A 3JSYA 1IBLF 2QLFB 3CDBA 3ZXWA 1QTNB 1HQUA 1SQGA 4YB6A 3RZOI 5LYJF 2V0NA 1S0MA 1RP5A 1S1XB 3W2VB 5DM6Q 3HBLA 2LA4A 2XI3A 2DZDA 2ZDOA 4NLRA 2YKPA 1YX2A 3PKMA 1PYOB 1VBZA 4GVBB 4K4WA 2COIA 2FDNA 4JV5F 1G2WA 1HMVB 2YRXA 1BE4A 2J0QD 1YVFA 2CQ2A 3P6YC 4DU7A 1MROB 4LREA 4DV2J 2KFYA 3VALA 4PXBA 4ZP6A 4RX6A 3K7RA 5I42B 3ZC4A 2DNKA 3MOJB 3GG0A 4DL3A 2VFRA 4C8LA 3NS5A 4DL6A 2HFZA 1T3OA 2WZ1A 3QGHA 3AD8C 2MQMA 1TL7B 4HNUA 4NLGA 2ZH2A 1F2HA 4FVMA 2VJVA 2H54B 1YITS 4KO0A 1XIQA 4DV2F 3TR5A 1JLLB 5L1JA 1YWXA 1ZTTA 1UPMB 1EARA 3QPIA 2VC0A 3SMZA 3HK2A 1KC82 1RTDA 1Y3KA 2XSJA 3FVYA 5KFVA 1S49A 3DRPA 2NVTI 2K1RA 1TWGI 3QRPA 1S76D 5KG5A 1FJ7A 3VF0B 1JLCB 1KFDA 3G71Z 3JB9k 1KTVA 2H9ZA 1URRA 1IXKA 1Q79A 2RUSA 4M63A 5CABA 3U1MA 4USKA 1HYSB 4NLVA 2D7SA 3K5NA 2ZH1A 1NP6A 5I4MA 2BVZA 2XNRA 2O01C 5E5NA 2ZDGA 1PJ7A 2CQHA 3IAM9 1Q0NA 2C22A 2E5LJ 4UOCA 5KT4A 2ZDPA 3M7VA 3H98A 1JLGA 2YW2A 3DGPA 2MKKA 1FX2A 2QLJB 5G0RB 1XC9A 1MMNA 2LVWA 2GO9A 2QLXA 2QRCB 3NWRA 4ZP7A 4Y2KA 1M1KT 1OY6A 3IG1B 1KQSZ 2OOXB 3I55Z 2GA7A 4NA3A 2R8KA 1EYZA 1XR6A 1TL4A 2V67A 1JLFA 1TK5A 3MJFA 5K8PA 2FPIB 1IWAA 1VQ5S 2R8HA 3MWDA 2R7XA 2HAFA 3V4MA 2E5LF 2Q66A 5KAKA 2HQDA 4I67A 4UT4A 1KOOA 1NK4A 1SC3B 4M0JA 1SC6A 4O7SA 3ZTRA 2DY1A 1VIOA 4IKAA 3X3UA 2OLWA 2GNKA 2FZGB 1YJWS 5EWFA 1IVZA 2CPIA 4DLEA 1SKWA 1GXTA 2OPQB 2VJUA 2PO4A 3T1YJ 2CQBA 4IRKA 2BQRA 3GTMS 2YKMB 5AE2A 3OTOJ 2BQUA 4J9PA 2YNIB 5FLXf 1SCJB 3V6DB 1ZH5A 2LECA 4IFYB 4E2ZA 1Z2LA 3ILLA 6FD1A 2Y1RI 5A6WA 4A4JA 1D9AA 4KFBA 3BSOA 5C1PA 4ECZA 4YAJB 3VQSA 5ETMA 1VISA 4H4KA 5I5VA 3UDVA 3T6BA 4ES3A 4WIQA 1QSSA 4FXVA 2OD4A 4DLKA 2DGOA 2P6TA 3RRHA 2UXDJ 1RWVB 1N33J 4E32A 1X9WA 2F8HA 2OFHX 1C0UB 4DF8A 3OTOF 4NLWA 5DMXA 4ANDA 3B54A 4Z37A 4UCVA 3RB0A 4AL7A 4ECUA 2P8IA 4NBFA 3HKWA 3VOTA 5FLXb 2G0JA 4C8ZA 1JLQA 2QF7A 4OHXA 1P9YA 5KG4A 5T6BA 2ZBPA 3SIPB 3TIIA 1I1KA 1GTEA 4O86A 2J9GA 4Q0BB 4PEOA 2UXDF 1LW2A 1GTHA 4MMOA 2LEPA 2DVIA 3POTA 3QAEA 2V2KA 2F9DA 3CE8A 4LSZB 4B02A 2DPIA 1H3DA 5HVHA 2RU9A 1FDIA 2BE2B 1N0VC 2BBEA 3DLEB 4ZPWR 5D0RA 3OR2A 3CCL1 5KFIA 2JIMA 2RKIB 4ZHRB 1XJWB 2QA41 2MDAA 3RAMA 4TU7A 2OMOA 2F4OA 5BWWA 3HOVI 4UCRA 1AFJA 4DX7A 3JQMA 4RWWA 3MCOA 2EG1A 4CKBA 2VQEJ 5H1SV 1VRTA 4MT1A 4F4XA 2JVRA 5ITHA 2MQ8A 3QWPA 2RU3A 2CQ4A 2WBMA 3M30A 3RZAA 1U8SA 4RPFA 3K3PA 2V3VA 1X5TA 2V69A 2HHUA 3O6QA 2Z2ZA 4JV0A 2B63I 4LFBJ 3QBCA 5JH7F 1VQP1 3MR5A 2VV5A 4M5JA 4HNVA 2EEYA 1AZSB 3UDLA 3V81A 4MKBA 5H9FK 2XG8A 1WZNA 5DETA 1KC8T 2X1AA 2XCPA 3PEHA 1QDUB 3G71S 1YQHA 2VQEF 2ALYB 3CJ8A 2M70A 1M902 4A8WA 4RW7A 2ERRA 1QJHA 2O5DA 3HSGA 1Y00A 1N56A 3FRYA 1RZMA 2RVJA 4U96A 4TQSA 4EUVA 1S1WA 3LUYA 2YNGB 5J2MB 3JYTA 3PCOB 3UCZP 3CO9A 2KVQE 1A3GA 1S68A 1JIHA 1AYEA 1TK8A 3EICA 8AT1B 2ZFHA 3TY9A 2BACA 3BBFA 4DS4A 4ID5A 2P9GA 2EPIA 3I55S 4P75A 4ZVRB 4QWDA 3RRGA 2PEBA 3KK2B 4QCLA 2R7TA 5HL7Q 2MXYA 3VPCA 3DDIA 3MAHA 1W25A 4LBPA 3EVWA 3N6NA 3D3CJ 2W9CA 2RS2A 3KTQA 1TR0A 3DLLQ 4B9TA 5KFTA 3NNCA 2Q3PA 1R43A 1XNQJ 4KV8B 2ZE2B 4F04B 1DHMA 1WI6A 5MAOA 2OSRA 2UUTA 3WO1A 2IBKA 3PO4A 3W64A 2IC3B 4J9UE 3LUSA 2R7SA 1WOSA 4NBBA 2YBVA 2JA7I 3RB4A 1W2IA 2V4JB 2AJ1A 2H5EA 2CNNB 1WG1A 3I12A 3ENQA 4C8YA 2VC1A 3AY0A 1PAUB 3TDHB 3KHRA 3HO1A 4E2WA 2R7RA 2BZ2A 3EGWB 4FPIA 1XNQF 2DR5A 5IWAF 3AD9C 5D6GA 2WAQA 4CO3A 2HK3A 1UKUA 4EEQA 3QAUA 4EFBA 3MURP 2ZOMA 1FKOB 3TEGA 5I5YA 3MR6A 1RLCL 2KH9A 2Z2LA 2DE5A 4IH5A 4USTA 5E3CA 1T03A 1V3ZA 1TKTB 3ET6A 1OBGA 4GO7X 1GMUA 1RAIB 2Y0SD 4R8UB 5A0YA 2M0GB 1PIEA 3OUYB 4AE5A 3MM9B 4URGA 2B9EA 1RWPB 3ZZYA 3HULA 3AJ2A 5U47A 2I5JB 4NLOA 1OPIA 1SQFA 4FF3A 2YQ3A 1BLUA 1IKVA 1R6VA 1LWCB 2DNPA 2R7WA 3PYEA 4HEA9 3CC71 3NFZA 1REVA 2HIYA 2GMLA 2K8GA 2Y8WA 1GX5A 3DLHA 3LP2A 1MU2A 1LW0B 1U1RA 3CXCZ 2NXUA 2U1AA 1GAOA 3MZKB 3IF8A 2J9DE 2QKDA 1GXUA 4NMLA 1TL3B 1QVGR 1RUSA 2QX0A 3CD61 3GYXB 1R3NA 2V5AA 3VWSA 4NI2B 1YK9A 1OS5A 3PW7A 2R8IA 1VQ8Z 2DHHA 3PO3S 5E2QA 1X4FA 4ENOA 4HR7A 4EMDA 1CG2A 3SNOA 3PN1A 1HD0A 3KALA 4MFBA 4QOTA 4MIWA 2WOMA 1RADB 2AV5A 2JZ5A 4A8OA 1V3RA 4FFNA 3NGDA 2F9JA 3AFGA 2R7LA 2XWYA 1R6YA 5CCMA 4YN3B 5HAOA 3OLAA 1U7LA 2B4OA 4DV1J 1FCAA 1XEZA 2M6NA 1KQSY 3OW2Z 2ACYA 3LPEA 3BR9A 4F3OA 1WUUA 4MTPA 2OOYB 3IBFB 2YRWA 2G13A 2YX4A 4OHWA 5IQ6A 2DCLA 2KTQA 1U1MA 4RW4B 4F0KA 1O6XA 4Q44A 3KHHA 1S4FA 5I5UA 3DF7A 1LOUA 5FNVF 5LMNJ 1U0SA 4Y52I 2C2DA 1JLBA 3PX4A 3S2DI 4PG7A 4DV1F 4JI1J 2BR0A 3F3PC 3AW8A 2CZ9A 1K731 1X4GA 3SGIA 2WBRA 3MM6B 4ED1A 2PN1A 1KVKA 1H72C 3BH6B 5JJBA 4GVLA 4LFCJ 4I2PA 2B7CB 4DL2A 4NCBA 4A8QA 4CO1A 3J7YI 1NDCA 3LP1A 3M32A 3D5MA 1U48A 4M5GA 4ZI7F 3S17I 3BYPA 4ED4A 3HVTB 1I94J 3GTYX 4MKAA 4JI1F 2VKZG 5D15A 1XBWA 2RQKA 2AYGA 3MTJA 3RBXA 2PA3A 3GTMI 3BSAA 4NCGB 5KT3A 3C14A 1QAIA 4OZLA 5CAEB 1XQIA 3N6MA 4DCJB 4LFCF 5I3PA 1PX2A 2JDJA 1CVJA 3HO8A 1Y10A 4IG3B 1XDNA 2CAJA 3ICLA 3GG1A 3D7SB 3GFYA 1ZH1A 5THWA 1I94F 4RW6A 3ETOA 4Y2AA 2XSFA 4K0KJ 3FEXB 2HPUA 1CKNA 4DV7J 2YQ0A 3ZTOA 1ZPVA 2FGOA 2W7AA 1PILA 2FTRA 3KHLA 3UFXB 4JB8B 3SV3A 3CCJZ 1HNVB 2HFNA 1UVLA 5CYJA 4WBFA 3TAMA 5C24B 3T9CA 4LMZA 4FXDA 1WORA 1Y3JA 3D6WA 5KFNA 3BAAA 1NH7A 5CYQB 5J1EB 2GVDA 4O44B 2EFVA 1TWHI 4HI1A 4CO5A 2W24A 1YJUA 3FBBA 4K0KF 3DOLA 4ED7A 2VPXA 2OZKA 3QLHB 2VUMI 4DV7F 4W92B 4Q7AA 3V4IB 4O7RA 3D2LA 2WVDA 2J6UA 1LQLA 2K2PA 1VQN1 1DQ8A 2EK6A 3E01B 1MWQA 3ZZRA 3UYYA 2DH7A 4E0DA 4KGVB 2CPEA 3QFWA 4P72A 2DABA 2ZBCA 5KFBA 4ILLA 3O2IA 1BQMA 2YWEA 4I6YA 5F8JA 2E2JI 2FJDB 1U09A 1LXJA 3DLGB 3G8TA 1PKUA 1JMTA 3BGRB 4PWDA 3A4TA 3CCS1 1RT2B 1UVMA 3AODA 3DGVA 4FNIA 5L9XA 1X4AA 2QZ8A 4A3GI 4ZN3A 3LP0B 1T95A 3CTRA 3UN5A 2D3ZA 1VQ8S 1HBOA 4ATNA 4FS2A 4AYBA 5EN1A 2N3OA 1LWEB 3D28A 2J6SA 1KRLA 2FLPA 5I5SA 3PHTA 2V6AA 4CLSA 1RAJA 3IR5B 1FRKA 3QGGA 1RTIA 4CLPA 3BGFA 1CLFA 4DUYJ 3I561 4FZVA 2BXJA 4PXEA 2R7NA 2BJ1A 3S24A 2J5AA 4CIOA 3T1HJ 1YJVA 2YYAA 2Z0GA 4QTUA 4IOAQ 1EAYC 5AXMA 4LRCA 2VIHA 1GK8A 5BPFA 4HTJA 3G8QA 3IRXA 3ZZUA 3D68A 4LSNB 3CT9A 3CC4Z 5D0EA 2VOPA 1Q821 3CJ4A 5D0HA 4F3QA 4IDKA 1T8EA 2RT3A 3UR3C 4FU0A 3J81U 4DR6J 3P8BB 2QRRA 3W2VA 1RHRB 2VODA 4J9QA 3T1HF 4O4LF 2A1HA 2X0SA 3BQ1A 2RBLA 2AP6A 2RJZA 3BABA 4W98A 2COLA 4GVBA 3GCXP 2RT9A 5MLCV 4ALZA 4QYZJ 1HMVA 4DV3J 2J6AA 3MUVP 3ETMA 2XY6A 1MROA 2HMIB 3L7UA 3CUNA 3GR0A 2XC9A 4LQ9A 1HHTP 3OTDA 1U6BA 1KUTA 3B78A 2WW8A 4YJ2F 1TUWA 1RABB 5I42A 5KT6A 2VU5A 1VLYA 2ZNYA 1FRHA 3U02A 5SUHA 2I80A 2QN6B 3P5JB 2IRXA 3NS6A 4UCTA 3J80U 3I87A 1TL7A 4IG0A 2DNYA 2KL8A 3JSMB 5KFCA 4OI6A 2FC8A 1PC4A 4DV3F 3CPWR 2OTJZ 2DLNA 3M2UA 4ZJLA 2AWZA 1S1TB 5B09A 4F02A 3MMBB 3Q8PB 2HVEA 1OSCA 4QBUA 1U8WA 1B64A 5C4XI 2L9NA 3I9ZA 4FFPA 4EBCA 5JQWA 5B0BA 2ZWPA 2EFGA 1KC7A 4HR2A 4B3SJ 1HWUA 5DM7Q 1BXRA 1KTQA 4QIVA 1YJTA 4LH6A 4RNNA 3KIFA 2FJXA 2XMUA 1HYSA 1BQNB 3CCJS 3CXCY 4PWUA 1NJZA 3SCIE 3CJ0A 3E5NA 2IDEA 4E31A 3QZ7A 1W96A 4V19X 1WHXA 1U49A 3QIPB 3T4NB 2HYIB 2HVIA 3LWLA 1N8R1 2XMJA 5G0RA 3I5CA 3MMCB 3UD5A 2YY3A 2Z56B 3MM5B 2A3JA 3VGUA 3AB2B 3K7AI 4OYZA 4PPDA 3IG1A 4XZ3B 2RILA 5J2NA 3H42A 3EM1A 2WVCA 2MKIA 1YI2Z 2VBWA 4FNHA 1VQ61 4YHHF 1NKEA 2QSFA 4NYEA 3TA0A 1VQSA 4H4KC 1W7WA 3MECB 3EGNA 1S6PB 2CVEA 2HVHA 3RB3A 1VQ4Z 2HNYB 1M5HA 3MEKA 4XK8C 1U4BA 4M94A 2MSSA 5LJ5Y 1DTTA 2CZGA 5D3GA 4QIEA 5F0UA 2FJVA 3OW2Y 3THTA 3LWMA 3HOZI 3PO3I 2VUGA 2G2KA 3CJTA 3CJ3A 2OPQA 4RU9A 4NYPA 3VPDA 1WF0A 3WIVA 5KG2A 2C2ZB 1F5BA 3MR7A 1S1VB 1UETA 2V8VA 5G4DA 2YKMA 3MMAB 5J2QB 2FC9A 1L5UA 4LH7A 1CJTB 2OH2A 2MZRA 4CHIA 2GAGC 3RV3A 1WDDA 4J9OA 4R0EA 4I4BA 2JIOA 2BV3A 1CJUB 1HWKA 3W3SA 4NOHA 3PJWA 4TYBA 1K8A1 2AU0A 1FE0A 1B70B 5KFRA 1X4DA 1FVQA 1I7LA 5KT7A 2Z2YB 2V5HG 4GKKJ 3U54A 2CZ4A 1TMJA 3PFOA 4ECQA 4DSFA 2YADA 1VQMZ 4TNOA 3JAMY 2E1PA 4Y34A 2ZGIA 1ROFA 1WACA 4GC7A 3FC9A 2ZUGA 5CZVA 1ZM2A 3KJVB 3CC4S 2GJIA 3NXZA 4RWXA 2RAQA 2MPUA 1SPBP 3IS9B 2QSWA 4YOEA 2D9PA 5ETLA 2HGWA 4MV7A 2A2DA 1WRVA 1HWJA 3NKYA 2RD5C 3TW0A 3WDOA 1ZA2B 1NK5A 2YWGA 1UWBB 1JX4A 1TQLA 1OY8A 4HYKA 2W03A 3AA8A 4O3NA 3T9DA 4CKEA 2XS5A 2IAJA 2R82A 3DI6B 1MN9A 4WFBQ 1H7XA 4QQBA 5GMKa 4I64A 3VB9A 4S0MA 4ZPCA 1WC5A 2V8JA 3Q2OA 1CQJB 1RYSA 2A6OA 2V8IA 1KBLA 1YIT1 1VQKZ 5HP1A 3TP2A 1NDPA 4OHZA 4ZHRA 1FJEB 3TO8A 1FDDA 4RNOA 1H0HB 5IP7I 3AAWB 2DISA 1GLVA 4Y0FA 3K0JA 1YJNS 3JRWA 2XZDB 1SUQB 3C2PA 4A3LI 2WHOA 3CDEA 1QAJA 2C3YA 1B99A 1N0UA 5GADI 2KI7B 4F4KA 1D1UA 3MPYA 2I9SA 3W60A 2OTJS 4B3MF 3QJLA 3BQ0A 1FWKA 3UDEA 1FRXA 2I1RA 2BX6A 3RRKA 1RCOB 1KWMA 5B0CA 5KFDA 4RUHA 4DEZA 3ELHA 4Q8EA 2FY8A 1QM9A 4DQQA 1NB7A 1HNIB 4ERDA 2NQPA 3D54A 4LVOP 3NL0A 2NVXI 4EBDA 1AZSA 4AQYJ 4O0NA 1NBEB 2GZOA 1CJKA 2HNDA 1T05B 3H0PA 1Q16B 3EVMA 4E2FB 3P45B 1GMWA 2OTLZ 1H73A 3HVRA 1X4EA 2BOPA 2F3JA 4X4VA 1HBNB 2H3EB 3I82A 2CJQA 4HNTA 2LCWA 3TY5A 1VC6A 1VQ51 5J2MA 4NL5A 3D1OA 4TM5A 2GVZB 2CPJA 2VDIA 4AQYF 2MLYA 1TELA 2DHGA 1B0TA 1A9XA 4NB8A 3THPA 5EX3A 1YI2S 3IFEA 1TAQA 3MPWA 2VBXA 4RW8B 3CCVZ 5KKNB 1UEUA 1YJW1 1TP7A 2ZZNA 4K4SA 3DMJA 5L1IA 4ECRA 1Q1KA 2GMJA 2DCUB 1I1LA 2AEFA 2OPPA 3QRRA 2OIHA 2G2ZA 2ZE2A 4C3KA 2N4CA 2IC3A 1B4SA 2RNEA 1DTQA 2GPSA 2JA5I 4EYHB 3KXDA 1QVFR 5DRKA 4I69A 4NZMA 3HOUI 2M2BA 2VR1A 3UW1A 2VA2A 2R8JA 3N5FA 1Z03A 4KIAA 2E5IA 1USPB 3KNGA 2UXBJ 4PZ6A 3OTCA 1U1NA 4L3NA 4C2MA 3DOMB 4OI0A 3VCDA 5IYZF 3N4WA 1O0PA 2CDQA 2JEFA 4UCUA 4AXJA 5A2QU 2HHTA 1NDLA 3MGJA 2W04A 1KBRA 1NK7A 3OTBA 3H40A 1X5SA 3GYGA 1DV2A 2V63A 1VQMS 3VQTA 4F50A 2FQQB 3H20A 4EZ9A 1M5VC 2B0GA 2KT5A 3O1LA 1RSCA 4O82A 2R87A 2DD8S 3K57A 3LQVA 3NWGA 1YJ9S 2UXBF 3HHLC 2E1CA 3OUYA 3MM9A 3PIPQ 1NZ8A 4QYZK 4N5SA 3RR8A 4RO0A 5HBMB 4M1KA 2M8DB 4CM0A 1K9M2 3H0GI 3OXFA 2RSQA 2I5JA 3TJ9A 3KG4A 3C46A 3DRYA 4DPXA 1U1PA 3AHPA 3CJRA 4NRUA 4C8KA 2DGUA 4OI3A 3GJXB 1LWCA 2HIVA 1JLEA 2OP5A 5A8KB 4K4VA 3VAKA 1RK8A 2W6PA 1X4HA 1UZDA 1DJ0A 1K47A 3MEGB 5HLFB 1LW0A 2CWXA 5E3AA 4E8UA 1IKXB 2HGNA 1K44A 3V5RA 4ILRA 5B0GA 4ZVPB 4IFVB 1WG5A 1VQKS 1U1LA 2VKRA 2Z02A 3LQSA 3M6VA 1ACMB 3S1TA 2QL5B 4AYBD 3CMAZ 3MHYA 4JI8J 3OSNA 1Y11A 3F3FC 3KLGA 5EGYA 1HL6A 4DN9A 4MV4A 2NLWA 3DRSB 2R2RA 4Q4DA 3D0GE 3MZIA 4LRAA 3ZZTA 5AJ3F 3WQPA 3G711 1EUCB 4O4JF 5E3RA 2D74B 1EKRA 5FDLB 2FUG9 4M5IA 3X1LB 1WCMI 4OL8A 4IR1A 2HZVA 1EKVA 4NZNA 5F8IA 1XMOJ 3K89A 2RH3A 1IR2A 1P1LA 3MM8A 1L3KA 1Q862 4JI8F 1VS0A 4A8SA 3BPDA 1KOHA 1YTYA 2HVQA 1T7PA 4TUYF 4G1QB 1VQOZ 2HURA 4M5LA 2LQJA 3KK1B 5E41A 2MKHA 2OTLS 2PE8A 3DM2B 4A3CI 1WHWA 3EZUA 4H4OB 2ABYA 4IQMA 3MAAB 1RT7B 2XCAA 4DV5J 2ACMA 1X8DA 3PVXA 2HVZA 4OJHA 3GE9A 1VHIA 3B82A 4MJKA 1H2UX 3QO9B 3CCUZ 1VBXA 4N8NA 1NDKA 5BJRA 4OV6A 4CNYA 1CE8A 3J7Z5 3BH7B 1MMDA 3CCVS 1EB0A 4HH4A 3MZLB 1VLOA 3GYNA 4O7YA 1HBUB 2DNLA 3BREA 1WNEA 3EWGA 1R27B 5BYQA 3HVTA 3HVAA 4LF2A 1UEKA 4OZ5A 2HK2A 1EZ1A 4USVA 5IFMA 4R5PB 2GTHA 1SJ1A 3M05A 5J2PB 2J0WA 3HDSA 1S9EA 4NCGA 1VMBA 1XNRJ 4EQ5A 3HJFA 2Y4RA 1FFSB 4TV8F 3L4BC 1FK9B 1TV6B 5CD4A 2OEMA 3H2UB 2FB0A 4DR7J 4IG3A 2ALZA 2PMWA 1BMQB 1FTRA 3PTWA 4G65A 3R6LB 3A8KA 5FJ4A 3FQQA 1Q4RA 1S9GA 2AJ0A 4A93I 2PN6A 4KHMA 1I1GA 3ITHA 1RTHB 3GJSB 3MPVA 1XNRF 5EX0A 1W2BY 3Q83A 1X0PA 2GPWA 4ZCLA 4F25A 5C24A 5LSRA 2V50A 2R93I 1SCUB 1WOOA 4GKJJ 5IV3A 3OR1A 3M8PB 2VG5B 5CYQA 5J1EA 4O3SA 1SC4B 4O44A 2DNQA 1OWXA 3HOWI 2AKLA 4LF9J 1FESA 3GILA 3QLHA 3LGNA 1K83I 3V4IA 2HRTA 1RQ0A 2UV8A 2VFTA 1K9MT 2QFIA 4B3OB 2PI4A 3F0NA 1PBAA 1F3VA 2AT1B 4ETZA 3FJ2A 3HT5A 2XTJP 4GKJF 1AUXA 3GU0A 4B9UA 2XD4A 2QEXZ 4X4OA 4QR2A 4JI3J 3DLGA 3HT3A 3EYZA 3ENVA 2IJNA 4O2BF 5JUMA 1O51A 1F0XA 1NKBA 2M88A 1OYEA 4LF9F 1KLMA 4HTIA 4RUBA 1KSPA 2B8PA 2FHMA 4BC9A 2IP4A 1KEKA 4I6WA 3M9MB 5D8HB 5LMUJ 1N32J 3CMAS 4KPCA 1ZM3A 1VFJA 1EP4A 1FRJA 4ZP9A 3ZZZA 2CPDA 1IJEB 3HKZD 3CF5Q 3CCWA 3VV2B 4MA5A 4QIFA 4DS5A 5F8HA 5IM0B 1S57A 1UFKA 2EFPA 2FLOA 4RUCA 3DN9A 3BBBA 4JI3F 2AX0A 3KUGA 2Z04A 4V19J 1BC6A 1AROP 1UJ6A 3UD4P 3D3BJ 2FD2A 1K1QA 3C15A 2BJ9A 1SKUB 4DX6A 4YP3A 1PSDA 3MR2A 5LMUF 2C2MB 1AUVA 5IT4A 2JSXA 2ZITA 5HI7A 4ICLB 3H5YA 3TQTA 4Y28C 1VQOS 1M5OC 2YNHB 2GTIA 2JUBA 1QLNA 4U9RA 4OI4A 4FYYB 5KFXA 2Y9HA 4DX5A 2HHSA 5C8YF 3G4SZ 2BMBA 3CJ5A 4M8LA 1KS2A 3CCMZ 5KG1A 5CCLA 3MD1A 3TI0A 5KFFA 1NPPA 4DSEA 2DRBA 4HKQA 3CCUS 2E9HA 4A3KI 1DY3A 4XPCA 4O7NA 4DPOA 3NOCA 2O1PA 2ZEJA 3W2WA 2WSEC 1J5OB 1LXNA 1Y8CA 4MONA 3N6RA 1TAEA 2VPZA 3PW0A 2CNKB 2RPRA 1RU1A 2CNLB 1IKWA 4ZLPA 3FNNA 4M9UA 2J8AA 3N9UC 5L46A 1IBKJ 2AYEA 4DPWA 5DS7A 1Y9OA 1KHVA 5EZYF 4I50F 1IR0A 3OVBA 1J27A 3JSMA 3M4XA 3BG0B 3KDOA 1TKZB 5K14A 3B4MA 3SCLE 2ODTX 5DQIA 2UP1A 2YZNA 5EHHA 1S1TA 1GQEA 3MMBA 3CWJA 4CLWA 1JQGA 2RS8A 3D1QA 1YBTA 1MSWD 4RLEA 3NH4A 1LKZA 2XI2A 1L3SA 4M5KA 4ZLLA 4DLGA 3QJPA 2HEKA 1N5VA 1IBKF 1TMMA 4X65F 3LANA 2DK2A 4UF4A 5HQ8A 3MOZA 3H2VE 2BA9A 4TLQA 1IKYB 1GMWD 1NSQA 5DDRC 2VQFJ 4J9LA 4EG0A 1M901 4HH1A 3KUHA 3LGHA 2DT9A 2HGLA 3V4ZA 2A10A 4FFOA 3QIPA 2M8HA 4S1TA 1HA1A 5BYSA 2GS8A 3MMCA 5HMXA 3MM5A 1B7FA 2HKEA 5LJ3Y 1Q8LA 5AXKA 4DQNA 2SXLA 2DWCA 1CQIB 3TWZA 4UUXA 5BPHA 2QLVB 4RL1A 2VQFF 3EXYA 3CQZI 1GSAA 2E9TA 4DMZA 4WXOA 2IYGA 1E6VB 3M8SA 3BN4A 3N5BA 4RR5A 3MECA 4F8RA 4E33A 1K1SA 1VQ81 4U95A 2HNYA 2DHAA 4LSLB 2E44A 2QEXS 3BA8A 3PR4A 1X9SA 2QJ3A 2KT2A 2Q6CA 4DHVA 3K8VA 3JTPA 3TUIC 3H5UA 4ZMMA 4YUDA 4HL9A 3S2HI 2E7ZA 2HVDA 2M5YA 2JX2A 1PBUA 5IV4A 1XTZA 2LXIA 1S1VA 5GAHI 2DNZA 1C0TA 1CJTA 1HBMB 5I3UB 4DSKA 2IVYA 2ZHOA 2IRYA 4YR2A 1JJ2Z 4DSLA 1Y1VS 1ZAXA 4PQUB 1FF2A 1WWHA 2QFJA 4P2XA 4ZIWA 4IH6A 3W7BA 5JMNA 1BGXT 3NBPB 4QZVB 2X7IA 1RWMB 5F9LA 5DG7A 4K4XA 4WE1B 2HJWA 4DL0C 2VPQA 3IO1A 2QC3A 1UFLA 3EPGA 3TUZC 4HI2A 3H3VJ 2W6QA 2FYXA 1R7IA 2OJ3A 2QLBB 3KJVA 3SSSA 2L08A 1RA7A 3PV8A 4MKYA 4DFKA 2DRAA 1T36A 1NUIA 3J7A1 1T9UA 2HFUA 4DFPA 3G4SS 1FD2A 3ISNC 1UWBA 4O83A 4LIRA 2YKOA 3CCMS 4WTOB 3NDJA 4DUTA 2IA0A 2KXNB 4QPTA 3ILOA 4UTGA 4ZA1A 4F36A 1JXEA 4USUA 3G6EZ 2CNVA 5CE8A 2F40A 4HGZA 1U1OA 1LEOA 2K3RA 3VR1A 1TU0B 3Q8RB 1GGOA 3VAHA 1QSYA 1RT3B 1PC5A 2XS2A 4USIA 1NH8A 3BV8A 2W2OP 3C19A 5KG7A 2CQGA 4G1IA 1CC7A 2HQGA 1TFWA 2MKCA 4F26A 3IFUA 2CJBA 3S01A 2Q79A 1C1CB 3GMGA 3M3YI 1SUQA 1HPZB 1SL2A 4JI5J 1X5OA 2KT3A 3R23A 2L48A 3WC0A 4EEYA 2ZOGA 1CS4B 2YU9I 2DRDA 2IJFA 3T5JA 3PYDA 3MONA 2CYYA 1X0FA 5KFJA 3T41A 3M8YA 4U8YA 3Q24A 1KJQA 2N82B 2EKNA 1VC5A 3PJ9A 3I31A 5RUBA 1IR1A 5KS8A 1TL1A 3CCJ1 1UCNA 1HNIA 2Y1LB 2DNGA 2B4UA 1NJWA 1IBMJ 1YSJA 2KN4A 1I3OB 1KN6A 5ETKA 4C8NA 2IV2X 4OYAA 1DLOA 5HROB 2ZVSA 2CWKA 3CVKA 2FJAB 4NA2A 4QTTA 1FKPB 4JI5F 1T05A 3SE7A 1XK5A 3CJSA 1Q16A 2OUGA 1SXLA 4OIXA 4P52A 3WWJA 2KZMA 3SI8A 3KJQB 1FERA 3UCGA 2ATLA 3FQLA 3HHKA 1GNKA 3PNIA 5DGBA 4PYAA 2ZH6A 4AL6A 5D77A 3K5IA 2LLZA 4CL1A 2K7KA 3QGIA 1IBMF 2N4DA 2FLLA 4K4UA 5GAEI 2HHQA 1IYEA 4QIGA 2P9CA 2MYFA 2YPZA 2R7MA 4RW8A 2Z4PA 4NZ7A 3BSCA 4ZPAA 1Z1ZA 2HHWA 3G6XA 4PZVA 3T99A 4DDFA 2Q2TA 2B56A 1HW8A 3I0RB 2HZCA 3SDEB 2ZDQA 4I56A 2ZH9A 4GC6A 4FFRA 4OZNA 4R25A 3PYGA 1S7MA 1R8BA 2XYPB 1PYSB 5I5XA 2OPRA 4ZCIA 3AD7C 2X5RA 1PYTA 3GCFA 3WO0A 1DBDA 2CJXB 3BEGB 2DNOA 1USPA 1CJVB 1HKAA 4DR4F 4Q45A 3H5SA 5JVHQ 3CC41 3DOMA 2MZSA 2KG1A 2J7KA 1UL3A 2Y3YA 3U27A 3BACA 1L1OC 1WW9A 5CYMA 1RTZA 3OHAA 1Z2PX 1HWIA 3G9CA 1VBKA 1HLWA 3OSPA 1RWNB 2MY8A 1U1QA 1JDBB 1X0TA 2HG8A 3VAIA 1Y5NB 3R5FA 3WX8A 4CLUA 4TN2A 1UWAA 3GJQB 2XGQA 1ZAVA 2CRLA 3BGLA 2H4WB 2ZVIA 3A8IA 5HBMA 4NCAA 2C3OA 2UU9J 1X9MA 4ZN1A 2RDDA 3KLEA 1SIWB 1D9FA 2QO3A 1EQMA 2I6WA 4DFMA 2RRAA 4P73A 3A8EA 5FPRA 4W90B 3VTNA 1TWCI 1SV5A 1FX4A 3RYLA 1QVGZ 3MDFA 5HK4A 2BM0A 3DU6A 3G6ES 4X4TA 2MLXA 4QJVA 1IKXA 1CPZA 2VPWB 3NMRA 4W4MA 2O67A 5B08A 3BZQA 3U1LA 2OTJ1 1CEZA 2V2QA 4BC7A 2PMHA 2UU9F 1U26A 5C25A 2MLZA 4K5RA 2Q2UA 4L76A 2KHDA 1OJ4A 3CCZA 4NH1C 4NXNJ 4P6QA 3C6UB 4CLLA 4N8OA 2WSCC 2IPOB 4IUFA 4RJVA 3JAMf 3LULA 4OI1A 5KFKA 3N0VA 3FBEA 4Y2MA 3K5OA 4NZOA 2GAHC 4LF7J 5FDLA 4A3JI 2Y0BB 3NAHA 2CVIA 4P9SA 4CO2A 4O4IF 5IQQA 5KT2A 1I51B 3GTKI 5KX5F 2YH0A 5CZXA 2UUAJ 4KKOA 3NRBA 2HS4A 3ZTPA 1S0OA 4LF4J 2KYZA 4NLDA 4NXNF 2F4VJ 4PG5A 3U50C 4Y7NI 1OSDA 1VR6A 1HQEA 4MIBA 2UXCJ 4G1QA 1CKMA 2IZ4A 3KK1A 5HO4A 2JIRA 4MK8A 3CC2Z 3NAIA 1PJ6A 2WW4A 1QE1A 1Q81T 5B7WA 2AGOA 1OQ6A 3JAMb 1WEZA 4H4OA 1YI21 5HJYA 1RT7A 3N79A 2FVPA 3KK3B 3M9NB 5KT5A 2XMTA 2Z30B 5HMYA 4DV4J 1JKJB 1R0AB 3FQKA 2IHR1 2KI2A 2UUAF 4FBUA 2H5IB 3M1VB 2RB7A 1A6LA 2DR8A 3SFGA 3QO9A 1VQ41 4YQWA 4LF4F 4ZQIA 2F4VF 2NXEA 2DE6A 2R7QA 2UXCF 3LAMA 2J6TA 1TK0A 1HNWJ 3FEYB 3I9V9 1AFIA 4PUOA 4DL7A 4TY9A 1G1XA 3V6HA 4X4RA 1REGX 1JJ2Y 1QSLA 2H85A 2KU7A 1B04A 2JLFA 4WK1A 4RZRA 3W1YC 3KLFB 3GJRB 1HBUA 1H74A 4J5OA 1URNA 4J9NA 3S7RA 1WKJA 1U2CA 4IQXA 4LBHA 1RO2A 2CQ3A 2PEHA 4C6AA 3BDEA 5KFAA 2AIRB 2WVBA 4KO0B 2LXFA 4KBIA 4ZVTB 4YS2A 5J2PA 1YBAA 4CH0S 2QL7B 1FEHA 2PMZD 2QA4S 1LK5A 3MPDA 2XY5A 5CHCB 2V45A 4OX6A 3GIDA 1FK9A 1TV6A 2E5GA 4KH1B 2XSJB 4BY1I 2CQPA 1Y1VI 4CLTA 4GRSA 2BRKA 2J8SA 1V6HA 2K1RB 3PKYA 2BUNA 3CJKB 4KGZB 1OYDA 3QATA 2AJFE 1SVDA 2KG0A 3UO0A 5A76A 2O66A 4GLWA 1DFDA 5F8GA 3R5GA 2F4MA 4RVFA 4KPYA 4WPAA 1IQTA 3AJ1A 5F8NA 3CIMA 3CNQP 3FMWA 2JIPA 1KRPA 3CCRZ 3KLVA 2FB9A 1JLGB 3M8PA 3DGPB 1VRUB 2EIYA 3L7PA 3TZZA 1ZTWA 3EPIA 2W2MP 2YWHA 2PSZA 5IC6B 3FKII 1M5SA 4O3PA 2XMVA 1YRTA 3D6TB 3F44A 4L73A 4NWBA 2DXEA 2J7WA 1RAAB 2AZ3A 3W9JA 5BWVA 3FCHA 2JC1A 1VQK1 2V68A 3ILIA 4WKYA 1JLFB 2FJEB 2NU7B 1S6QA 4OHYA 5GMDA 4B3OA 2YKQA 2GQQA 1FVIA 4HVZA 3UZOA 3AA9A 4DR2J 2NVQI 2VICA 5D1OB 2H5JB 4HQ6A 2BJ3A 2J0SD 5DDOC 1RACB 5FLXU 3JRXA 4F7VA 2LQBA 4LIWA 5HVGA 1RDRA 1JJ4A 2B7BB 2YTCA 3M2RB 3ULHA 5KOXA 3DXBA 3SV4A 1KVIA 5C1OA 3HOXI 4UOFA 1W26A 2FHJA 5ETPA 4LR8A 1FFGB 1S72Z 4I7FB 4AUKA 3GB0A 4ED5A 2P5VA 3T1YF 4B9SA 2IM1A 3BDPA 3QSYB 2DHXA 1FI4A 2OAUA 3BYRA 1G3OA 3HCXA 3MF5A 5I60A 3CMEZ 4DR2F 3GKQA 1H7WA 4NLYA 2HQCA 1S10A 1S1UA 3Q0AA 4NMXA 3MEEA 4KGMA 2BJ7A 3PO2I 3KMSA 4KFBB 1BQXA 2H51B 3IM8A 4MIAA 2C1EB 3TVYA 2NSCA 4N77A 2F8EX 4WJBA 2OTL1 3MEDA 4CC6A 2HBYB 3GV8B 2W1BA 2U2FA 4U7UD 1ZB8A 2OPSB 2DO4A 4MAMA 2RRNA 5DLFA 3D6MB 3PW5A 2W4CA 1N33F 4ZS6A 1KD11 4A47A 3LALA 1VQLZ 1WDTA 2G0IA 3AJDA 4O2AF 2HU9A 1RAFB 3CC2S 3R9RA 5GAGU 4ECWA 3Q8UA 5J1NA 3A12A 1APSA 2LKZA 1JLQB 3H25A 4XTTA 3GWCA 2D3O1 2HW3A 3SSRA 3ENWA 3CCV1 2W2QP 5AE3A 3T9BA 3CEBA 2JNJA 2LU2A 1XMQJ 4OX8A 2V8DA 3MWBA 5DO2A 1LW2B 3KG1A 1X31C 2HQIA 1DGSA 4PCQA 3G86A 4KH0B 1T9VA 3R5HA 4CE5A 1OMSA 1K73T 5IS2A 1QUVA 1NK9A 2VH7A 1J5OA 5GMEA 2DH8A 4WZQA 2GMHA 4LRDA 1CQMA 4E98A 3CULA 4DWIA 4DU8A 5KFZA 5L1KA 3TEHB 4QR0A 5M2PA 1LQ9A 1VQNZ 4JI4J 3LO3A 4OZ3A 3OR2B 1FE4A 3R2DJ 1W2BR 4ANEA 3FGVA 2AJ2A 2P2CB 3CPWZ 1KEEA 1GH8A 4IRDA 1XN9A 4KY3A 2HRUA 1XMQF 2EBGA 4F4ZA 2BKPA 1Q811 1VRTB 4IRCA 3SQGB 1S97A 1TKZA 3RW7A 5AXNA 1YG0A 3SEOA 4HGYA 1SL1A 2F7VA 8ATCB 3M30B 5LL6d 1DV1A 3EZOA 2CZVC 2FHKA 2G1HA 3GTGI 2Q51A 2R92I 4MV8A 4LFBF 2EG2A 3GSDA 4JI4F 3LA0A 4JOUA 1ZAUA 3M2VB 1HI0P 1KJ8A 3AB4B 1P6TA 3D66A 2ZKUA 2AGQA 4NLSA 1OPZA 2W70A 4MD7A 3ISZA 1WOPA 1QVGY 5JVDF 1NB2A 4RW7B 5DDPC 1R0BG 1HHSA 1EQ0A 1VYAA 3H90A 1UC9A 1JKHB 4IOBA 2VOOA 5E0OA 1KVJA 3CCRS 4ZPDA 1FEEA 1S1WB 4QWBA 1N8R2 1EETA 3JYTB 1YJRA 2FJWA 5C2CA 3GIIA 5BWXA 2I38A 5KFHA 2MKYA 4I4TF 2YX1A 3BO4A 4YMEA 1FDNA 3W5OA 4OFZA 2E1MC 1PGZA 1LFPA 3VHQA 5GVQA 2NREA 4ZVHA 1ITPA 5K8NA 3UZBA 3TW7A 3M4OI 4P7TA 4Q5VA 2EW9A 2RF2B 1ULZA 4JI0J 2C00A 1HQ2A 4ZVOB 1GXLA 2W9CB 1NMEB 2ZD1B 3CMA1 3CGIA 2D3OR 2EJ2A 4URSA 5KFGA 2CJ9A 1RT6B 2QB5A 1OIAA 4OX7A 1C1BB 4KTQA 4X62J 4E2YA 2JEJA 2DKOB 4DI6A 3IR7A 5K5MA 2HVSA 2W6OA 3VTIA 1ZETA 1BWVA 1R8HA 2F63A 3P3DA 1SJ4P 4FPRA 2R7KA 1S72S 4DV6J 3OL6A 4X2BA 2KXHA 1O5JA 2CPYA 3HP6A 2JA6I 3NG8A 2MGZA 4MV1A 2ZBRA 4TU8A 4F0MA 1YDLA 1HR0J 4JI0F 4CTAA 3T7AA 3BPSP 3CMES 2W8LA 2QREB 2V9WA 1F9FA 1HBMA 2DGQA 4KSEB 4RKUC 5K9FA 3TUJC 4D3GA 1K8A2 1S7HA 3LF0A 4WZMA 3GTLI 3H8YA 1FJGJ 3T6JA 4X62F 4H54A 1VQO1 2E29A 4RBVA 2H48B 5JVLA 2XMWA 3QT6A 4LBIA 3HF5A 4CMDA 2W6NA 1CSJA 3EX7B 2WB1D 2HHFB 1NNDA 5HVFA 2VB6A 1ZZFA 2GGPA 3WBZA 5BR8J 3PG9A 4G6VB 3EZ5A 1T03B 1VQYA 4USMA 3ET6B 4OX9J 4Q2MA 1VQLS 1HR0F 2PC6A 5A0YB 2ZZTA 3BGUA 1RWXB 4NBEA 3EGZA 2IBOA 3CCU1 1NJI1 2C3MA 2K5RA 4BHQA 1Q82T 4CMFA 1WSVA 4IWYA 2JEGA 1FJGF 2BM1A 4L74A 1YZ6A 2Y8YA 2XMMA 1IKVB 5CR5A 3HHLA 4PZ8A 2XYGB 1REVB 3ADAC 1RTJA 3CSKA 3J81Y 2JWNA 3LP2B 1MU2B 2V34A 2JLGA 4BWJA 1M5KC 3MM7B 1LWFA 5D4OA 4DPUA 3I4NI 2CA9A 1RT3A 2E9RX 1VQNS 2A0FB 4ZVUB 3U9TA 5DZ6A 3DKDA 3W66A 1JLAA 2OEJA 2MZQA 1V9PA 1QF8A 5IT0A 2IVMA 1SH3A 2ZDHA 2MJNA 3ZZOA 1C1CA 5F9NA 4YFUA 1RCXB 4OMFG 1HPZA 5T67A 1VBYA 2ZHBA 4UOHA 3AH6A 1QD1A 2EC0A 4OYXA 3DLKB 4WCEQ 4CM2A 3P4UB 2DR7A 1WTFA 1FRIA 4MFBB 2Y1JA 4QWAA 3HSJA 3J80Y 2WOMB 5DAAA 4FBTA 2QK4A 4CWBA 3NGTA 1ULRA 3IAS9 2DNHA 1TKXA 4O7LA 3R5CA 2ZOFA 1OO0B 3RJMB 1RNIA 1GX6A 4CO0A 4NLXA 2EJ0A 1MW7A 2HBRB 1RWOB 5HROA 2YWKA 1Q861 1VK8A 2HWTA 2C2KB 1L3TA 2V2ZA 3BO2A 4V1Ak 4RCNA 5KFMA 3EEDA 2NAPA 5BYAA 3MMJA 1NCLA 1GMVA 2BKOA 4N41A 1Z02A 4LF1A 5LMNF 2HRYA 1JLBB 2RDIA 4WKRA 4YR0A 5HSPA 4L72B 1RE1B 2KM8B 1FNOA 2CQCA 5C5JA 1WEYA 1U1KA 5BMVF 1N8RT 2C3UA 2QEX1 3NGRA 2DGTA 2GIQA 3Q2SC 2YNFB 4J9KA 2X3GA 3HD2A 2DO0A 3KNAA 2AMCB 4I2PB 3IWNC 2CQDA 3LP1B 1NUEA 2DXFA 3M32B 1IWGA 4I2QA 4XX0B 4L3KA 2GQRA 2BDPA 1P27B 4ZCMA 1AA6A 5JQGF 1FNMA 2R7UA 2ASDA 2L9WA 4FFLA 1NRKA 1QVFZ 1PFTA 1Y7PA 3UQSA 3OXGA 3BG1B 3ETJA 4NEZA 1I1MA 4X64J 3R5XA 1WSRA 2I8CA 1SL0A 1WG4A 4MXUA 2PIIA 1FNXH 3NBYB 2DIVA 5DJBA 1NO8A 1KP6A 3O3LA 1BD6A 1N54B 3VMGA 1H2TZ 2UVUA 2AZ1A 1UVNA 2NCKL 2ROEA 1E6YB 4BBYA 3TZXA 2OMLA 4CLYA 2DYAA 3A8JA 2MQLA 1UEVA 1HNZJ 2IMOA 2PVPA 4AT1B 4EO8A 2XM3A 3AXMA 4HDHA 2CPXA 1K8AT 3PR5B 3KAKA 4QWEA 2ZHAA 3EERA 2Z58B 1RU2A 4X64F 2R85A 1XR5A 4RBTA 3G4S1 2BE7D 3TAMB 4EWCA 2DNRA 3IC1A 4M5DA 3W9IA 2HSEB 3FZBA 3WHIA 2NS1B 1IOVA 2A2CA 3KUEA 3CCM1 4F3MA 2LEAA 2HFVA 2V59A 4ES2A 3TE5B 2VFVA 5KG3A 4WF9Q 5I5TA 3I5AA 7AT1B 3CPWY 4O81A 4A46A 2VPXB 4CLKA 3IM9A 5K3WA 3HX9A 3TZYA 3OJUA 1SIWA 1IM6A 2IYIA 1YIJZ 1NLKL 1MWYA 2CJAA 3AQOA 4O4RA 2QA4G 1XMBA 1KR4A 3TA1A 1S6UA 3F41A 2MMYA 1AW0A 4KT0C 4KRWA 1BQMB 2LDIA 3KWMA 3TNVA 3D1HA 2VPWA 1N6QA 4HACB 3HFZB 3RUBL 1SKRA 2Q4ZA 2CJYB 4WK3A 4KE5A 3TA2A 4N56A 4ED6A 5DGAA 4L1KA 2POKA 2KB2A 3PACA 3ZZ0A 2ZKTA 2BANB 4KB7A 3R3TA 3HMJG 1HBOB 2R2SA 4NASA 2GW8A 3JZ6A 3C6UA 2EGTA 3DC2A 2RUGA 2ZJPQ 4IO9Q 1U2FA 2J9CA 4URQU 1EKPA 1EIYB 2YWVA 3DHWC 3KREA 4A8MP 3NDIA 1VK3A 1RB0A 4EK2A 4DR5J 3UN2A 4DUYF 1TVRB 2BJ8A 4ECSA 1N34J 3PRDA 2C2NA 1S1XA 1NJXA 1WJ2A 1Z2ZA 4OZ1A 2AYBA 4MV6A 2XLJA 2JJ4D 3RGIA 3SCKE 1ZM4A 1LK7A 2G4BA 3IP0A 2AW0A 1ZPWX 6AT1B 4JV5J 4CC5A 2W6MA 2VG7B 1ICEB 1KDNA 3R7BB 1Y5IB 2HWIA 3PHEA 4DBQA 1R8CA 5C4JI 3RBEA 4YY3J 1DURA 4IDKB 2F8MA 4RNFA 3RBDA 4DR5F 3R9LA 1S0NA 2ZM6J 2WTFA 1N34F 3NCQA 4DR6F 4P10A 3EDRB 3QFHA 3KK3A 4OI2A 1YJNZ 4A8XA 1FA0A 4OLOA 1X9NA 1R0AA 2E5JA 2W4PA 4C0BA 4EU0A 3M1VA 3NS7B 1OBDA 4MYTA 3TJAA 5CD4H 4C11B 3IXQA 3LWBA 2W8KA 5F3TA 1G4CA 1RHUB 1DARA 1R0CB 4YY3F 2QA1A 1M0WA 3BQ2A 2ZM6F 4EGQA 3VVTA 2XHWA 3KLFA 3CMQA 2OKQA 3BA9A 1EZZB 3EVOA 4A8FA 2XO6A 5J2TF 3BKFA 2W2NP 2ZC3A 1SH2A 4A3MI 4Z2XA 4FYVB 3VAMA 1CC8A 5M2UA 1JLCA 1QAYA 4IG0B 2DH9A 1Y1WI 2HGMA 4MAKA 4YAKB 2AJ4A 4HHUA 5L8RC 1MMLA 2B43A 3M2UB 4O23A 1P8LA 1V5IB 2YH1A 2GC8A 2G2YA 4AXIA 4CDIA 1Y4ZB 5HMZA 2WYOA 1IJFB 1RISA 5L1LA 5T7LB 1FO1A 3U55A 1X5PA 3HHDA 3H7HB 4DFJA 2CFXA 3F73A 2JC0A 3OPKA 5HJXA 3CJKA 3S15I 1YZ7A 1D9DA 3D2WA 4B3SF 2HS0A 3HXMA 3OUZA 2YZMA 1KLNA 2ATCB 4PQAA 3D4JA 1GSHA 3MAQA 2KVIA 4ED8A 2LMIA 2NYIA 2B51A 1WHYA 1CKOA 3DLBA 3S8SA 2MY7A 5A2QY 4PPZA 3IBCB 3KFWX 3PW2A 2QE5A 4RS4A 1VRUA 1MG7A 3QSIA 5E7OB 3G6E1 5CA5A 2VG6B 5J2NB 4DOZA 1NEEA 2R7VA 1TWFI 5CA0F 4IR9A 3CCQZ 4WFYA 5CM0A 4FYWB 2EFNA 3HPOA 1HNXJ 1YIJS 1RWWB 3IA0A 4UCSA 5JVGQ 4OYWA 2YNIA 2HZAA 5D1OA 2ADBA 3V6DA 2YXLA 2QMWA 4IFYA 1WC0A 4IH7A 3KYHC 4DXLA 1DTTB 1RXOB 1X7VA 3ZTSA 1UA1A 2WAQD 2E2II 5D3GB 2VL1A 3RUPA 3PIOQ 1Q7Y1 3NNAA 3BO3A 3M2RA 1SC1B 5B0EA 1U45A 1RWKB 3UR0A 3VMMA 4ES1A 1FFWB 3KMQA 4OQJA 4I7FA 4ECTA 3O44A 9RUBA 1Q5VA 1HNXF 2CQIA 4FP9A 2NUHA 1C0UA 3LP8A 5AT1B 2QMXA 1H98A 1JXLA 3U7JA 1YJ9Z 3ZTQA 5ETOA 3R97A 4YB8B 3PFFA 2LFUA 2IVFB 1AT1B 2B6AB 3B6BA 4UQTA 4CH1A 1RO0A 3T5KA 3SXLA 5HMWA 2QYCA 3UVJB 3R1LA 4H4MB 1JNZB 4TVAB 4GKKF 2OHDA 1JJ2R 3P96A 3MFHA 2OPSA 2HBZB 1V3SA 1X3WA 3H4BA 4Q0BA 3DNCA 3LGMA 1UA0A 1VHFA 1ELOA 1VRQC 1F9HA 3RG6A 3UNGC 4A48A 5K8MA 2ROGA 2Q1LA 4C5CA 2H65B 2BE2A 1JB0C 3T19A 3DLEA 5H9EJ 1FT8A 2WVEA 2HLUA 2ZNZA 4LRFA 3V6KA 2OLSA 3RTVA 3GIJA 2RKIA 2FPPB 2V4RA 4NBAA 1S7IA 4TYAA 2NUUG 3HHLD 1QVFY 2CPZA 5ETRA 2G0CA 2IAJB 2PT0A 2LP4A 3FDSA 3OVSA 2BJOA 1FXRA 2HS3A 2R8GA 1S59A 5IT9Y 1X4CA 3OHBA 4ZVQB 4DX8H 1G7CB 4WYWA 3CCEZ 2PK7A 3MXHP 3JZFA 2J0XA 3KIHA 5HP1B 3QT8A 1MLAA 2XY7A 4BDPA 5ADZA 2XZWA 3SQOP 1VJWA 2VQDA 3Q1KA 2H4YB 2J9DA 2RRBA 1LWXA 1S12A 4A3BI 4U8VA 4QSHA 3NGKA 3SQGA 4C98A 1TAUA 5LXYA 4E30A 5CAAA 3ZZPA 1B7YB 4TXSA 1ZOTA 4NLQA 1VS3A 2W7OA 2C2OB 5E3PA 1MN7A 3AOBA 2JR6A 2EJ3A 2LDYA 3CDAA 3K5LA 3J7AN 1A48A 1RYRA 4M5HA 2RE1A 5K20B 2YNGA 3THVA 3M2VA 3C6TB 4RZQA 1RWUA 3Q87A 4HDGA 3RR7A 5KFUA 2OWOA 2GFFA 2ADCA 1CJKB 2HNDB 4KGKA 2W4DA 3A1YG 2DE7A 4LRBA 4NRTA 3KK2A 4DL5A 3TAQA 3I32A 1VBHA 1GEHA 2GHPA 1XK8A 3G8SA 3PZPA 3T9NA 5EWGA 4UZBA 1E4EB 4U7CA 2V8GA 1FKAF 1BY9A 4P2FA 4E6NA 5KG6A 2VA3A 4XYLB 5EUHA 2C28A 5LP6F 1JKHA 4RW9B 3SZ2A 4I1TA 2KZZA 4OYPA 4KV8A 4ELTA 4J9RA 2DB1A 5BXIA 4ITSA 2CPFA 1S48A 3TX8A 1C3OA 4IO1A 4I0WA 3JQJA 3DYAB 1I3QI 3KLIB 1KONA 3VZHA 4ILMA 1TFYA 4Q2LA 4NYZA 2JEIA 3Q8VA 3CCQS 3RFCA 2V4JA 2GQCA 2QLWA 3UN3A 4NXMJ 4BBRI 5HN0A 4UY8T 2RF2A 3UNYA 4TVIA 1S79A 3DMJB 2P28A 4LJMA 2GJ2A 2ZD1A 3NCPA 3PM9A 4BLGA 1RHQB 4OJ1A 4DR3J 4NA1A 1RT6A 4OZ0A 2OPPB 1C1BA 4RUAA 5KFOA 5IWAJ 4RU2A 1VJQA 1K0TA 3T1AA 4C3LA 1QXFA 1DTQB 2UUBJ 3D6HB 3CSWA 1FKOA 4F2RA 2W7PA 2ROPA 2R7OA 1NZAA 4NBCA 2MQQA 1UZHA 4OYMA 3TARA 4OJGA 2DBBA 1A9NB 2QRDB 1TKTA 2FGCA 3OTEA 2MTLA 4NXMF 4WWSA 3QT7A 4R8UA 3NGUA 1Z4UA 1M1K1 3VAGA 3KG0A 4Y2IA 2CNOB 2HHHJ 5B0AA 4DR3F 1NK8A 5KOWA 1A0IA 2G1DA 3CDWA 3VGVA 3JSNA 1U2RA 4FN5A 3CC21 2XQCA 2UUBF 2HHFA 2FVCA 3T9ZA 3M8QB 5ETVA 2M48A 3VMHA 5J2UF 3HD1A 2KDOA 2PA8D 2ILZA 4QU6A 1TL3A 1N52B 2HHHF 4FKXA 1ZYQA 2CQ1A 5DGHA 5LT5A 1SJRA 1UW9A 4WYLA 2KRRA 4NI2A 1TWAI 1U02A 2OO4A 2VPYB 3RW6A 3DCAA 2WK4A 2MZJA 1JLEB 1AA1B 4FGRA 2P3YA 3U9SA 3W5XA 3TVZA 1I2LA 4QW9A 4IWXA 5I5WA 1ZAWA 2B4VA 3FMBA 1KJJA 4DIMA 4DPYA 4ME6A 3CCES 1R9TI 3MM7A 4ZJOA 2DGXA 3Q2TC 1U6ZA 3GV5B 3IR6B 1DAXA 1NHKL 1UVJA 3PYFA 2DNMA 4GMKA 2K3KA 5KFLA 3JZIA 3PFEA 3KLGB 4K2JA 3GQCA 1TZ0A 4JP8A 3HB9A 3Q8YA 2ZBQA 2YQ1A 1D8ZA 1S0VA 1YJ7A 3RBZA 1NPRA 3DLKA 2YWFA 4RW4A 3D67A 1DRZA 3I551 2JL9A 2DJWA 1EHIA 4G3IA 4ZVEA 5IT9U 4UY85 1S6OA 1XMOF 1DIKA 3QQMA 3DXSX 2VASA 3MM8B 1OQ3A 3CCR1 3MM6A 6FDRA 3HHEA 3S1QI 4B9MA 2F4FA 4YDDB 3OLBA 3QGPA 1NU4A 3GP9A 4EGLA 4PG4A 4NBDA 2JS4A 2DEJA 4DAAA 1FWLA 3D0HE 3O8WA 1J5EJ 3GJTB 1M90T 1FDAA 2X51A 4NZ0A 4DV5F 1SJFA 1CULB 2CIMA 3K2YA 2V2VA 4QYRA 2MHEA 1C2PA 2FVQA 2HIXA 2WB4A 2EFOA 1UVKA 3R27A 2ZWOA 4BWMA 3BM7A 1MWZA 2YNFA 2EWHA 3GIMA 4O3OA 2NVYI 3DRRB 4LR7A 3DU5A 3GLJA 2NUAB 2E1AA 1RLYA 1S721 4P2MA 3W8GA 1SH0A 3NGSA 2FVRA 1KC81 1J5EF 2JA8I 2KXFA 4MKVA 3W62A 2P0AA 4B9NA 2Y1IA 1ZS6A 3J7YU 4UCOA 2A6MA 2NSBA 4PG8A 1VBGA 3CME1 3HHNB 5IP9I 1ZBTA 4UUWA 2JFDA 1WR2A 5L9NA 5FLMI 3VMIA 4DR1J 1S9EB 4ELVA 1HNVA 3DRXA 1SJ3P 3RR5A 2MHNA 3CJ2A 1SFOI 2CQ0A 4PR6A 4QW8A 3MCSA 3L3CA 3I4PA 2HLTA 2KPIA 3QQCD 4DF4A 3LH2S 2VONA 4DR7F 3TANA 4ZITA 4MRIA 1E6YA 2DHSA 1VQL1 2M4MA 3SSQA 1GSOA 4ZKAA 4FFMA 4EFAC 1S9GB 1JJHA 3OFEA 2DIUA 3ITHB 2RIQA 1RGVA 2J7UA 3E01A 3GONA 1BHNA 4DR1F 5H9EK 5ETTA 4XIUA 4IHJF 1WHVA 1KQSR 2XMAA 1KHWA 2ZC4A 3OR1B 4X84A 3IGVA 2YL2A 2FVSA 2WSFC 2W9BB 2HFSA 3UWTA 3I6PA 3BGRA 4PWWA 4A3EI 2GV1A 3AXKA 1RT2A 2XLIA 8RUCA 4R0JA 1M0SA 3LP0A 1RJJA 3US5A 1UAWA 2DGVA 1L3VA 3GPAA 4KYZA 4N7TA 3PRBA 1LWEA 1YRXA 2DITA 1RAOA 3Q8SB 3L09A 3FRZA 1ML8A 3I0SB 4EI2A 3BG5A 3ORQA 2R2TA 3EE3A 1YRUA 4EZ6A 4OHVA 1NSKL 4K5SA 4HACA 1UFWA 5EWEA 4DGLA 3KJNB 4MK7A 2VFUA 1KKHA 3FBCA 5C42B 4CI0B 4ZHQF 1VQ7Z 1KLMB 3HZEA 3A13A 4RNHA 4CNZA 4C7QA 2BANA 1N32F 4I55F 3NCRA 3GIRA 1EP4B 4LSNA 5IZHA 5LOVF 2APOA 2J9EA 5BYRA 4OZJA 3RU0A 2BJDA 1IM4A 2IJRA 5DQHA 3KOAA 3C3LA 4CH7A 2JIQA 1TVRA 1B6SA 2E1RA 4RBUA 2MQPA 4B9VA 3CD0A 2KHCA 3FK4A 2MQOA 1EX8A 4NLTA 4PYDA 2I3CA 3C15B 4K6NA 2XMKA 1YBUA 2VG7A 2HAIA 4FE2A 4DG1B 1KJIA 2HMIA 2FY1A 4B3RJ 1N5SA 1I2KA 4KR0B 3J81f 4C8MA 4CKCA 4ER8A 4DQPA 2CNUA 4ETXA 1AXQA 4A8KA 3G96A 1C4CA 4ZLJA 3KLHB 4EWTA 3OL9A 1TFIA 4DQYB 1B3TA 2GIFA 3VVUA 3MUTP 1RO4A 3VGTA 1VQ9Z 3BN7A 3DDKA 4NPOA 1RKJA 3T9AA 4Q4CA 3ISND 4UUGA 4C11A 2O4HA 2NU6B 3W2WB 5HQMA 4B3RF 4TV9F 1RAGB 3K8WA 2VPZB 3NEKA 5DZ7A 3UD3P 5BYBA 2BQ3A 1IKWB 3J81b 3LAKA 3P5TL 3OUUA 2RQCA 2QR1B 1Z01A 2HNZB 4DCPB 3NH8A 3J80f 3N01A 5IC4B 3OD2A 4CYUB 2PI5A 1I5OB 4ELUA 2C2EA 5D4NA 5K14B 1YHQZ 2LXUA 1BQNA 2V8HA 1IOWA 2BE9B 2ZH7A 3Q89A 3N6LA 3OT9A 3PX0A 3GCWP 4JV1A 2YZLA 5ETQA 3FZ2A 1D8YA 4LFAJ 1LV5A 4DUZJ 5T7LA 4HHHA 3WWHA 1K0VA 3D9XA 2YX7A 5AE1A 3M8RA 4FF4A 2V58A 3UDCA 4F4WA 3NH5A 3H4DA 4ECXA 3J80b 4F0HA 2AJQA 4K50A 2X3DA 4PG6A 4CT9A 4O3RA 3R1HA 2UZAA 3G8CA 4BCAA 4YHHJ 1BUXA 2M52A 5IXUA 3IX0A 1PJ5A 2Q6BA 1YLXA 1H2VZ 1U6FA 3TJ8A 1S6PA 4BXXI 4LFAF 3OV7A 4DUZF 1B0VA 2R84A 2F1FA 3MPUB 5DLGA 3ONQA 1S9FA 2OI2A 2KFZA 1I6JA 4NBHA 3AOCA 3P49B 4ZOSA 2RHBA 2GQSA 2KYXA 2VG6A 1I6HI 1LFWA 2ZH5A 4ZVSB 2FPGB 2CFMA 2KJVA 4Y6IA 4X4PA 1PK8A 4U7UK 2VFSA 2AYDA 3JTNA 3L7OA 2LEBA 4A8YA 4C5AA 1HIYA 2NYHA 3MMAA 5J2QA 3EDQB 4O3QA 5B0DA 5T14A 1JK9B 5FPOA 4O4GB 1A0OB 3H59A 1CS0A 2I0XA 3L95X 3UE2A 1CJUA 1AB8A 1KQKA 2AEJA 5I3QA 3T9FA 3EGVA 3GFZA 3NLCA 3I5BA 4TNUA 3TZWA 1T02A 4EO6A 4I6AA 1VQ7S 3MCMA 5BWRA 1X3ZA 4G1PA 1TKDA 1SQEA 3MI7X 2R7ZI 3DTGA 5HBRB 4E2XA 4MH4A 1WD6A 1C0TB 5KFQA 3IS9A 3HKZA 1HHQA 2D3UA 3TOQA 4UOGA 3OFGA 2B6AA 4TY8B 2CG4A 4WP8A 1I7NA 1Q8IA 2E9ZA 5CM2M 3UVJA 1H6KX 2UVRA 4H4MA 3QNWB 2CKWA 4J9SA 2EI5A 1QUPA 5E33A 4IZOA 1KD12 4D3HA 2HDKA 2JNYA 1YGYA 3DI6A 3T9EA 4QR1A 2UVWA 3I07A 3QWUA 1WI8A 1NJYA 4WP9A 4C8OA 3G82B 5E25A 1V5VA 1FDBA 5K8OA 4K8RA 2D9OA 3OL7A 4RVDA 5CA1F 4ANCA 4AD6A 4B9LA 4CZCA 1VI7A 3CXCR 3HM9A 3DOKB 2DR9A 4LF5J 2CG8A 4WU2A 1TUGB 2DY9A 3TQ1A 3W9HA 4CO4A 2R6MA 4ED2A 4JXUA 1N5YB 1J2VA 3C16B 4TU9A 2WVFA 2V8PA 3TEKA 4XPEA 3MD3A 1VQ9S 5F41A 1FHTA 4A3DI 4X4NA 3R5AA 3TY8A 1XR7A 2RMLA 3KDNA 2AHOB 2BW2A 3R8YA 3TVKA 4B3MJ 1S99A 5DGIA 1W2BZ 1VIXA 4UFZA 2Z57B 2YKNB 2YPYA 3GFHA 4K4ZA 3A3OB 1F3FA 4CT8A 1H38A 5FD1A 4C5BA 1HD1A 3W1BA 1UVIA 2QGFB 2FJBB 1FRLA 4LF5F 3NBZB 3CEDA 4C0OC 4EGJA 4ZCKA 2NZ4A 3B8HA 4O7ZA 1Q812 5FIIA 5J1PA 3E3XA 3P5BP 4B3TJ 4QWCA 2XYHB 5BWTA 1UPPA 3OW2R 1YHQS 3W1GA 5ETSA 5LM7E 1WC3A 2R9LA 2QT7A 1YUKA 3DFEA 1JXVA 1HBNA 5GADU 4J37A 1U24A 1RT4B 2XZTB 1WELA 1TL1B 2QL9B 3K5PA 4I68A 4MV9A 3C6TA 3K59A 2X1GA 3VZIA 2GVZA 4HT7A 2X1BA 4QPXA 5LSLA 1DLOB 3HFVA 1R31A 2HHVA 1F2GA 4O7WA 3GDEA 1JNRB 2B5JB 4B3TF 2HWHA 4WU3A 5LOQA 3BF4A 5HNEA 2DIKA 2NU9B 3NP5A 1E4EA 5LSOA 2AKWB 3KYLA 5IOLA 1RT1B 1YIJ1 1R89A 2JLEA 3CIZA 4RW9A 2IM0A 1UC8A 1WEXA 2B9WA 3F56A 3FQMA 4P7VA 5BWUA 4YBZB 1RHKB 3OXLA 3CO0P 3BKTA 3DYAA 3KLIA 3T54A 3FCVA 3CCLZ 4LUBA 4TKTA 4YDXA 2PD1A 5HATA 3QIDA 2QA4Z 3UQ8A 3ZNJ1 4C0HA 5EDWA 1EKSA 4X6AI 3W5ZA 3FFIB 1W93A 2VBYA 3FKBA 3PO5A 3VA7A 1QY7A 1KJ9A 2UVVA 4UQGA 1VQ4S 3QRQA 1AUSL 4FYXB 1NM2A 4YJ3F 3D6FB 5H80A 1HARA 2LQ9A 1N2FA 1FD8A 1FWPA 2MKSA 1NHVA 3E8OA 1PO6A 4Z7CA 4KJIA 4X4QA 3HVWA 3FEZA 5FLXY 4L6V3 4U67Q 3AQPA 1VQPZ 5AXLA 1A0GA 3NMAA 3E51A 2OPRB 5C2GA 2I87A 2NXCA 4XYMB 4RNMA 2ZZMA 4CP5A 3RZDI 2LA6A 4MD9A 5D4PA 1VOMA 4N47A 4PRFA 5A2Qf 3FBFA 3T3FA 2ZAEB 4EFEA 1X60A 3MUMP 3MFIA 2A1BA 2B4PA 2CUYA 1I50I 2PFDA 2PM9A 5CYMB 1TL5A 1EJ7L 1KFSA 1PAEX 2CDRB 2XNQA 1VGYA 4DRFA 3MR3A 3J7ZT 3N28A 2RHQB 5A8KA 1A7GE 3M8QA 4YR3A 5KFWA 3BKUA 3MEGA 5HLFA 1N4LA 1YJN1 1D09B 1U0HB 5KFYA 4USJC 2DEIA 2RIJA 1KD1T 1SKSA 1S77D 4MA0A 1N5TA 3S6EA 1NJI2 1FXDA 1OY9A 2BW7A 5ETNA 4IFVA 5F8MA 2V9KA 1RT5B 1P1TA 4C9DA 1RI7A 4U6PA 1RAHB 5A2Qb 3KLEB 3PRVA 2VPYA 2XBPA 2A18A 4LF6J 2XCLA 4OYIA 2M7SA 1UP1A 4O0IA 3CCTA 2P6SA 1SV5B 2P9EA 2HHXA 3DRSA 3JS9A 4P74A 5A8WB 3R7NB 5HQLA 2JRSA 4ZPBA 2M3DA 5AJ3J 3ORRA 3JAMU 2CJKA 2BJEA 2FIUA 2MQNA 2PDAA 5A8RB 3DHXA 1SBRA 5C25B 3U0GA 2FHOB 2KRBA 1IQZA 2JFKA 2B3TB 3LW5C 4EBEA 2WONB 5L39A 2IM3A 4LF6F 3KHGA 5KFPA 2JVOA 3J7A4 4DQSA 1HQUB 5C3EI 4AL5A 3J81j 4ZPTR 3RB6A 2KM8C 5AN9F 3QT5A 1L3UA 3DM2A 3ETHA 4BY7I 2NXNA 4QU7A 4WFXA 3OL8A 4LF7F 1HWLA 1WKKA 3MAAA 9ATCB 1JJCB 3RAQA 2YS6A 2BKNA 3TRGA 1NK0A 1K732 3W65A 4DN0A 4KKOB 2K06A 1UMJA 2ZJQQ 3BJYA 1F6TA 1N88A 2VF1A 3HJVA 4WFAQ 2MEWA 1HQEB 2UV8G 2HQ3A 4M5NA 3QZ8A 3OJSA 2NXJA 2GQ2A 5LA6F 1QE1B 2H1YA 2XEXA 2AEMA 5IT9f 3CC7Z 3CCQ1 2E7VA 2ZH3A 2CXEA 1G6BA 2OSQA 5I47A 1SI9A 2OELA 3GV7B 5D78A 4RV9A 2GHWA 1CULA 3HI9A 4DV4F 3V4SA 3M8WA 2KKHA 3V6JA 2COGA 4LR9A 2CNQA 1T9TA 1KNZA 2Q43A 2MB0B 4R5PA 2X1FA 4X4SA 4DK1A 4OYOA 4DQRA 1T3NA 4X66J 2RDJA 3CD6Z 3CCLS 1Q8BA 1HI1A 2PGCA 1HNWF 1Q53A 4JI6J 1Q95G 3QMQA 4F2SA 3VNNA 2XLKA 4PUOB 2R3VA 4NX9A 3DRRA 1RTDB 4FXWA 4DCOB 1VQM1 3JSBA 4Y65A 3DRPB 3DDNA 5IT9b 2FZCB 4C48A 4MD8A 3BR8A 1DZ5A 4A3II 1S4EA 2R2UA 3AT1B 1YJ91 4JBCA 2VZ9A 2D69A 2W2PP 1FVSA 5LXRA 4X66F 2EBEA 4LVNP 3TQEA 1RTHA 1Q78A 3RAXA 4CCHA 1FRMA 4HHJA 1VQPS 2DTJA 4JI6F 2K3IA 4FS1A 2FPHX 3R7SB 1R8PA 2QG9B 1RHJB 1PG5B 2HF1A 2EKYA 2M9KA 1T94A 2VG5A 3S14I 4CLZA 3FCWA 1N5QA 5KG0A 2AGPA 3N8DA 1F9EB 1Y5LB 2RHSB 1WC4A 3NOGA 3CDUA 3JTOA 1IUJA 2EVZA 4NYOA 4HLBA 4NEYA 2YWWA 1KT8A 4FDFA 3PY8A 3I4MI 4NB9A 1T0TV 4KQZA 3EXCX 3H5XA 1MNEA 3UCUP 4J7CA 3R2CJ 2QA2A 1WC6A 1B0PA 2GIRA 4UW2A 3LOUA 2FP4B 1Q7LB 1ZA1B 3RTXA 2QYGA 2RQ4A 2UUWA 4KHPJ 2Z8QA 2W9BA 3R5BA 5D4LA 4NE9C 3ZFVA 3DAAA 4ZP8A 2KO1A 4WIIA 4CRJA 1NJIT 3CCE1 4IIJF 4DSJA 3HLUA 3L9ZA 4C3MA 3CD7A 3AX6A 2E5HA 4ZJQA 1S6QB 5F8LA 4JUZA 3I4HX 2IDLA 4WP3A 1DAAA 5DDQC 3I0SA 2EFQA 5IM0A 3G8DA 4KHPF 3GTJI 3SCJE 1ZB9A 5FR9A 1Z2OX 1RBAA 5C42A 1Q8KA 3VAJA 1VDHA 2PFFB 1RQFA 2MJUA 3Q22A 1T9YA 3CJQA 4NZ6A 5T41A 3HSZA 2LYVA 2LFVA 5GAGI 4Z7YA 3JSRA 1Q822 4ICLA 2IRUA 4P2SA 3UFCX 1UJ5A 2QIFA 2F5GA 2GHVC 2OGUA 1S1UB 4OV1A 3SBMA 4Y00A 2YNHA 2ZJRQ 3MEEB 2XHCA 3EJMA 3QJJA 2R86A 2E7WA 3S1MI 1D0EA 1NKCA 4NLUA 1YKWA 5T64A 3MEDB 3IWXA 2GX8A 3JSLA 4WTYA 3D0IE 2NPIA 4DPTA 1EHWA 1VCTA 2BABA 1GFWB 4BS2A 3TW6A 2NZCA 1B6RA 3GFXA 3POTB 4DG1A 3Q8QB 2R4FA 3KAJA 2ZUAA 2W01A 1BWEA 2EXUA 3W61A 4ED0A 1P16A 2W71A 1Q86T 3W5YA 1NSPA 3K5MA 1DQAA 4ECVA 4YB5A 4KAIA 2EK1A 1KQGB 3HFKA 1F60B 3CC7S 2N3LA 1C4AA 2DXDA 1UW4A 3HOYI 3D9BA 2AF6A 3KLHA 3BS9A 3QFFA 3AOAA 2UUCJ 4J9MA 1WC1A 2XULA 3G87A 1ZZNA 1AUDA 3MWEA 1F5CA 2QMUB 4O84A 2DNNA 3S16I 1UJ4A 2WCXA 3GSIA 4E4TA 3CCSZ 3CD6S 1V9OA 1YUAA 3C66A 5DISC 2B9YA 3E2EA 4Q8FA 4RVHA 2XWXA 5L38A 2L3MA 4F67A 2CPHA 4TQRA 1TTHB 2YKAA 3NUAA 1ZM9A 4X65J 3V81B 2HNZA 4MK9A 4WFNQ 1QTMA 4CYUA 2UUCF 1N48A 4GLXA 2O3DA 4IYQA 1IKYA 3GLKA 3I56Z 3WZ0A 5DG8A 3RV4A 2ASYA 4OZ2A 3TX0A 1NK6A 4WHXA 3BSNA 2PMZA 1EUDB 5C44I 1VKZA 4FF2A 1NPKA 2NPFA 1NAQA 1NSAA 4DV0J 4USWA 2GO8A 1U25A 5E3QA 3K17A 5KFEA 4XO0A 2PBZA 5K2MA 4LQ3A 4ID5B 4XDDA 3GTPI 2ZH8A 5D8DA 2IIHA 3K58A 4ED3A 1Q5YA 3GTQI 3PW4A 1F5AA 2WRMA 3HT0A 1P9QC 2E66A 4WXWA 2V4QA 3GB8B 4RVGA 1SJQA 1HI8A 1WJ9A 1E6VA 4UZCA 4USHA 3IRWP 2SCUB 2OD6A 2HIQA 1NXIA 4LSLA 3NY0A 1EETB 4DV0F 2BEFA 1XERA 2JHEA 3ILJA 1EKFA 1M1HA 3R5JB 3Q23A 5DQGA 3VAFA 4XAKA 3FUYA 1Z2NX 4YB1P 2HHPA 4HT5A 3WX4A 3EUNA 4K4YA 1IYDA 4YB7A 3T5LA 4LT6A 1FDOA 1T11A 2VF3A 1RAEB 2E2HI 3OQ2A 2XS7A 2Q7DA 3GR1A 5D1PA 5I3UA 1QAXA 2J76E 4O4GA 2L41A 3G6VA 2MSTA 4HN2A 4XX2A 1XWLA 2GCFA 1NHUA 3MTKA 2JH3A 3G2XA 4PQUA 4WBNF 3B4DA 1Q7Y2 2AX1A 5SZTA 3IR7B 1M1GA 5KTQA 5LXTF 2R42A 4MH8A 1JDEA 4PXCA 5DG9A 2E7XA 2D41A 3NBPA 1X4BA 2W6ZA 4DL4A 4JI7J 1CQNA 4DV6F 4ID8A 1PCAA 2XO7A 4WE1A 3WWIA 4XDCA 1BXNA 2MGZB 4ZLNA 2GJFA 2I2YA 2AQ4A 2YS7A 4PAAA 4CTAB 4J9VA 1S5ZA 2QV6A 5CXTA 3ZO7A 4GO5X 3M6XA 4OYBA 2G2OA 4L75A 1TUVA 4TY8A 3TAPA 5GAHU 4C4WA 4MV3A 3HZGA 4HH0A 3BBCA 5CH7B 1K9M1 1R8AA 4F4AA 1LNQA 2DGWA
chains in the Genus database with same CATH topology
3MECB 4RW4A 1RO2A 2CQ3A 2PEHA 1DRZA 4DJBA 3EGNA 1S6PB 2CVEA 3I551 2HVHA 3RB3A 1VQ4Z 2HNYB 2JL9A 4OLPA 2DJWA 1M5HA 2GGPB 3MEKA 3BDEA 4XK8C 1U4BA 5KFAA 4JI7F 4M94A 4KO0B 2LXFA 4MYUA 5BR8F 2L9DA 4G3IA 4KBIA 4ZVEA 2MSSA 5LJ5Y 1DTTA 4UY85 3NC0B 5J2PA 1YBAA 4CH0S 5D3GA 1S6OA 1XMOF 1FEHA 4KHRA 4ECYA 1RKIA 4OX9F 2PMZD 2LIYA 4QIEA 3DXSX 5F0UA 1LK5A 2QA4S 2FJVA 2VASA 2XY5A 3OW2Y 4K4TA 2N7CA 4M95A 5CHCB 3THTA 3MM8B 3LWMA 3HOZI 4OX6A 1OQ3A 4ZVGA 3PO3I 1FK9A 1TV6A 2YVSA 2VUGA 2G2KA 3CCR1 4ZPVR 4Y2CA 2E5GA 2XSJB 3MM6A 4ZVFA 6FDRA 3CJ3A 4BY1I 3S1QI 2CQPA 2OPQA 1Y1VI 3HHEA 4B9MA 1VQ6Z 2BRKA 4NYPA 4YDDB 4RU9A 1WF0A 5KG2A 1SIZA 5CQGA 1F5BA 3OLBA 3QGPA 1NU4A 3DOKA 4EGLA 1S1VB 1V6HA 1UETA 2K1RB 2AYMA 1VLAA 2BUNA 2V8VA 2YKMA 3MMAB 5G4DA 5J2QB 3CJKB 2DPJA 5KFSA 4NBDA 1P8GA 2FC9A 2JS4A 1L5UA 4LH7A 3GTOI 2OH2A 2MZRA 2AJFE 4KC5A 2IA6A 1SB6A 2KG0A 4J9OA 3HHLB 3D0HE 3O8WA 2O66A 4I4BA 4R0EA 1FJCA 1N5YA 2BV3A 2VD3A 1HWKA 3W3SA 4NOHA 3PJWA 1DFDA 5F8GA 1RTJB 3PEJA 4TYBA 1M90T 1K8A1 1FDAA 2X51A 4NZ0A 7FD1A 4DV5F 2AU0A 1SJFA 1FE0A 2CIMA 3K2YA 1X4DA 5KFRA 2F4MA 4RVFA 4KPYA 1FVQA 5KT7A 4QYRA 2MHEA 2V5HG 5JXSA 1C2PA 5M2RA 3AJ1A 1IQTA 2CZ4A 3CCSS 2FVQA 3CIMA 5F8NA 2HIXA 3PFOA 2WB4A 1LWFB 2YKNA 2EFOA 1UVKA 3FMWA 3R27A 4ECQA 2DGSA 1KRPA 3CCRZ 3KLVA 4DSFA 4BWMA 1JLGB 2ILYA 2YADA 3M8PA 3BM7A 1VQMZ 4TNOA 3JAMY 4Y34A 3CB4A 1VRUB 1ROFA 1WACA 3L7PA 1MWZA 4GC7A 1ZTWA 3EPIA 2YNFA 1JLAB 2IFXA 2ZUGA 2EWHA 5CZVA 2YWHA 3PDNA 3BB5A 2PSZA 2MZTA 1ZM2A 3KJVB 3IGNA 2GJIA 2K7JA 3GIMA 3M6WA 4O3OA 3IN5A 3CC4S 2NVYI 3FKII 1M5SA 2N7YA 4O3PA 4RWXA 2ASLA 2XMVA 1GT8A 1YRTA 3DRRB 2MPUA 3DU5A 3IS9B 2GU2A 3F44A 2QSWA 4NWBA 3U1NA 4YOEA 2J7WA