3QWVA

Crystal structure of histone lysine methyltransferase smyd2 in complex with the cofactor product adohcy
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
430
structure length
430
Chain Sequence
b'AEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVLGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKYLEFPDHSSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECRECTTKDKDKAKVEVRKLSSPPQAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASMWLKLGRLYMGLENKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SET and MYND domain-containing protein 2
publication title Crystal structures of histone and p53 methyltransferase SmyD2 reveal a conformational flexibility of the autoinhibitory C-terminal domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 143
structure length 430
sequence length 430
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3qwvA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3qwvA01
5JJ7A 1YA0A 2UWJG 3M58A 3WXXA 5A6CA 3O48A 3KMJA 2C0LA 2XGMA 1MT6A 1ZKKA 2PZIA 4BWRA 4N2QA 3Q49B 2G46A 3OOIA 3JYSA 3DB5A 3MEKA 3ZHEA 5CCMA 1IHGA 4YNDA 2FF4A 3CBOA 3CKBA 1KLXA 5C1DA 5CHEE 2HR2A 3MO5A 2Q7FA 4WNGA 5LCWJ 1NA0A 4RG9A 4NVQA 5CCLA 4J0UA 3SWCA 2R5SA 3RO2A 2QFCA 2VQ2A 5G04C 3ZPJA 3CVPA 3CKCA 2VSYA 2VGYA 2XEVA 3MV2B 5BNWA 1ML9A 5JINA 3TAXA 2VGXB 3RJWA 3F9WA 1FCHA 4APOA 4JDSA 4AM9A 2LSUA 2XGOA 4YPUA 1Y8MA 3LY8A 1B89A 2HO1A 4BUPA 5TTFA 5JJTA 4N3BA 2UY1B 3EDTB 3F9XA 4XI0A 5F6KC 3CV0A 3RO3A 3GW4A 4N5CA 4J83A 3GYZA 3BO5A 3OXLA 3RU0A 4QEPA 4GYWA 4JL0A 4O6FA 1MVXA 4LDGA 2QPWA 4WNFA 4GZ6A 5HQ8A 4IJDA 5F6LA 2PQNA 5ARFA 5G05J 2W5ZA 3S7BA 2BQZA 3HYMB 4B94A 2JV0A 4NJ5A 4QEOA 3VV0A 2PQRA 3IEGA 1HH8A 4G26A 4NRHB 4J8OA 4UQYA 3KS2A 3Q15A 2AVPA 3F9ZA 3SZ7A 4KXKB 3TG4A 2FI7A 3LY7A 4J7FA 3AS8A 3MKRA 4U07A 3FPDA 3CEQA 3LYAA 3CBPA 2VSNA 4IJ8A 4HOSA 2Y4TA 5LCWC 1TJCA 2I6HA 3Q5MA 4HOTA 3S7DA 4F3VA 4U04A 3M57A 2IFUA 3ESKA 3VTYA 3QWVA 5T0KA 3FFLA 3CVNA 5TEGA 2IF4A 1XNFA 3KD7A 4CGVA 1QZ2A 3ULQA 3RKVA 3M53A 5LSXA 3M54A 1N3JA 4JLGA 3TGOA 3ZHEB 1ELRA 3CK9A 1W3BA 4UI9K 2KCLA 4C1QA 3FWVA 5JJ6A 5F5EA 3CVLA 2L6JA 4J8FA 5FJYA 4AY6A 3KMAA 5CPRB 3S8PA 4RG6A 3ZN3A 3TG5A 1MVHA 2RFIA 4RZ0A 3UQ3A 1ZBPA 4GA1A 1KT0A 3CK8A 2FEZA 4GA2A 5ARGA 3KMTA 2OOEA 4N39A 3BEEA 4JHRA 3PE4A 3QOUA 3QWWA 5FZQA 2VGXA 4HOQA 5F59A 5D0QD 5G05C 4JA9A 2FO7A 2WQHA 5DIZA 4A1SA 4GYYA 5EX0A 4GA0A 4HORA 4AY5A 3MO2A 4Y6WA 4BTBA 5D0OD 3LKUA 4LEUA 1KT1A 3NF1A 2C2LA 4I9CA 4O30A 2UY1A 4I9EA 2WPVA 2F69A 4GPKA 2ONDA 3K9IA 3QDNA 3LCAA 2LNIA 3M59A 1HXIA 4Z4PA 4MI0A 3IHXA 2KCKA 4YNMA 2MHKA 4NQ0A 3RAYA 1QQEA 2XCBA 2P58C 4EQFA 3MV3B 3SF4A 3M55A 2HYZA 3E4BA 5FTPA 4UQZA 5EX3A 4H12A 5AYWD 4BT8A 4G2VA 3AS5A 5FT9A 1N6AA 5FZRA 2NC9A 4N3CA 2PL2A 4J8DA 5AYFA 4XIFA 1HZ4A 3CVQA 5EKQD 3QWPA 4YVOA 4U0SA 4G24A 2Y4UA 3QKYA 3ZGQA 4AIFA 3DALA 1MUFA 3ASDA 4AU7A 2XPIA 3M5AA 3UPVA 4GCOA 3ASHA 3RJVA 1IYGA 3LPZA 5JJ0A 3KAEA 4I2WA 2E2EA 2R3AA 3GZ1A 3Q4AB 4N3AA 3AS4A 5LSZA 4U0ZA 2V5FA 3RIBA 4CDRA 2O8JA 4QENA 4GCNA 4Y6CA 4XI9A 4BTAA 3URZA 4WUYA 2IGQA 4IN3B 4UQXA 4H7YA 3UUXA 5KJKA 5T0MA 1O9SA 4J7IA 4G23A 3M56A 1ZU2A 4GYOA 4W9RA 4E47A 4YVQC 3VUZA 4WNDA 4G25A 3MA5A 1NA3A 4KYOB 5KJMA 3OXGA 2W5YA 1ELWA 3PDNA 5JIYA 2YQ8A 4U0UA 1A17A 5BW8C 4N2SA 5KJLA 1E96B 4I1AA 4UI9C 3MO0A 4FMUA 3S7FA 3SW9A 3CBMA 2KCVA 2JLBA 2FBNA 4G1TA 3S7JA 5M72A 4KBQA 2YHCA 2C0MA 5G04J 3PE3A 4YPEA 3R9AB 3HNAA 2XGSA 2KC7A 4MI5A 3ZFWA 4YNPA 3OXFA 5EG2A 4CGWA 1PEGA 2DBAA 3U4TA 5DBKA 4I2ZA 4BT9A 1NZNA 5T5GA 3F9YA 4ME2A 3VTXA 1OUVA 2J9QA 5FZSA 3ASGA 3U3WA 5BT1A 3N71A 4UI9J 4HOUA 1P5QA 1H3IA 4I51A 3Q47B 5KJNA 2BUGA 5TH7A 1PC2A 3OS5A 1WAO1 1WM5A 4GZ5A 3ASFA 3GZ2A 4GZ3A 4H7XA 2XCCA 3CK7A 3FP3A 3RQ4A 3LY9A 1N6CA 2KATA 5HI7A 3EP0A 4J8EA 4ABNA 3OPEA 5JHNA 2VYIA 5A7DB 4I17A 2LSVA 4WNEA 1XQHA 4JA7A 4YPAA 2GW1A 3K5KA
chains in the Genus database with same CATH superfamily
3M58A 3WXXA 5CEDB 2C0LA 3U66A 4LNUD 1D8DA 1NFIE 2ILRA 3OOIA 4C48B 5T4YA 3PUJA 3L54A 3FTYA 4YNDA 3G2TA 3QAQA 3CBOA 2P9UG 3CKBA 3TL5A 3AG3E 3FUIA 3ZXSA 2CG3A 4MRUA 4U7EB 4NVQA 4FADA 3RO2A 2VQ2A 1SZAA 1U3CA 5G04C 5J90A 1LD8A 3CKCA 1U2VG 4HNAD 3MV2B 5BNWA 4AOFA 3PZ2A 1LTXA 4RQIA 4J6IA 3HXFA 2XGOA 2QC9A 4JD2G 4JVSA 4HI9A 4N3BA 1U3DA 5FQ8A 3FU5A 3CV0A 3TXMA 4TUMA 4BX8A 2P9IG 4JL0A 1NL4A 4GZ6A 4IJDA 2PQNA 5G05J 2W5ZA 3HYMB 3EHQA 4ACLA 3LJNA 2BF0X 3IEGA 4HI8A 1AP7A 4J8OA 4HFGA 3HVEA 4K5CA 2EQXA 3SZ7A 1E7UA 3V79K 2P9KG 4TXRA 1BI8B 3FPDA 4MBGA 4DLOA 2WQ6A 3DEPA 3CBPA 4HOSA 3SBSA 2WQ7A 2Y4TA 4JEUA 4ANVA 1N52A 4BFRA 4O1PA 2X3MA 2CG2A 4U04A 2WXOA 5EIDA 2M63A 3VTYA 1SA4A 1MJ0A 4U8YD 2B0OE 4CCAA 1QZ2A 3M53A 4I1MA 5LSXA 3M54A 1UJKA 2YNQA 3TGOA 3ZHEB 3UT8A 1W3BA 4JXTA 4C1QA 3CHOA 4A3TA 2A5EA 2J8SD 3CVLA 3O4ZA 3JQ1A 2ZGGA 4RG6A 3FUEA 2ZXWE 1ZBPA 5KCMA 3R9MA 2OOEA 3BEEA 4HLEA 4G8KA 5FZQA 4PDXA 4APFA 1H2UA 2A5UA 3MJWA 2I1JA 4XKBA 5G05C 2XQ0A 4ANUA 2WQHA 5ENTD 5DIZA 2IQCA 2H6GA 1H2TC 3T5XA 2IONA 4GYYA 3Q73A 2XS8A 5D0OD 4LEUA 1O1TA 3ESLA 1KT1A 3EJNA 2C2LA 4I9CA 4B8CB 1TYQG 4I9EA 2F69A 4GPKA 3K9IA 3UKUG 3VLEA 1SA5A 1S0PA 1E90A 1DVPA 4CRWA 4K0RA 2P9SG 2GROB 4E6HA 1O1SA 1JWFA 1QQEA 4C0EA 4GTPA 1IQRA 3BG1B 4DJAA 4DX6D 5CECB 3E4BA 2DVWA 2DYSE 3Q9UC 4YDEA 1H19A 2F8XK 1OCOE 1FT2A 3CR3A 2KXPC 2OVFA 3CVWA 1N9AA 2NC9A 5ENQD 2PL2A 1JCQA 5T3RA 2VTBA 4XIFA 3CVQA 2PM7A 3C3RA 5EKQD 4YVOA 3RRNB 3P1UA 4AIFA 2Y69E 1QYMA 2RKKA 3TWSA 4J7WA 1EF1C 3SI5A 3BU8A 2R59A 4PS7A 2XZTG 3UPVA 4GCOA 2EILE 2B6CA 5JJ0A 4I2WA 2R3AA 4U8HA 3AS4A 3FUDA 3L17A 5LSZA 3ZKJA 4CDRA 3CHMA 4GCNA 4Y6CA 3PRZA 4WUYA 3NAWA 4EZKA 1EDUA 4H7YA 5KJKA 5C2YA 5T0MA 3TWUA 3FY4A 3ML9A 3DSXA 4L2YA 3CIAA 3HXCA 2GRMA 5LFAA 4GYOA 2KZTA 1OWPA 1TNZA 3EIQC 3MKQA 4GZCA 2AXUA 1Z6TA 2X6KA 3KEZA 4WNDA 1NA3A 3EUVA 2NYJA 3OXGA 2XS1A 3FUKA 3X2QE 1H0AA 2ZU6B 1TN6A 5BW8C 1HX8A 2QYJA 4FMUA 1N95A 2V5QC 3EHNA 3G2VA 2JLBA 5M72A 4IRUA 5J08A 4ILGA 4JHKA 3R9AB 3AG2E 1YCSB 5B1AE 2IU1A 3BG0B 3QARA 4YDYA 3Q75A 4LNBA 2ETAA 4CGWA 3UM0A 2DBAA 2WXGA 4OVUA 4BT9A 5T5GA 3VTXA 2J9QA 1UN9A 5BXOA 3U3WA 5BT1A 1BD8A 2I1KA 4UI9J 1H3IA 1LF8A 3HVEB 5TH7A 1WM5A 4GZ5A 4EPZA 3HXEA 5LP0A 2EIKE 3ASFA 4GZ3A 1N54A 4XE0A 5ITZF 1N6CA 2WXLA 5G2NA 3FU6A 4YDOA 3MZLB 2VYIA 2KBXA 4F1PA 3EIJA 1JPLA 5AQBA 3RRMB 3SFXA 4ATGA 4ANXA 4JA7A 5JJ7A 1YA0A 2UWJG 4ZFHA 3O48A 4KT6B 1MT6A 3V30A 2CHXA 4ILHB 1D9SA 3ZU7B 5B3SE 5AQ9A 3R7QA 3MEKA 3ZHEA 1PAQA 5JMND 3BQOA 4TXQA 3PNLB 3C5RA 3APFA 2Q7FA 4EBAG 4WNGA 3G2SA 4L23A 3E32A 1NA0A 5ENPD 5EYLA 3FHEA 4ZHBA 1UN8A 4HVBA 2AXZA 4AP2A 3CVXA 2XEVA 2L0TB 3JXJA 3DSTA 3FEXA 5ENRD 3RJWA 2P9NG 2BKGA 4APOA 2Y3AA 4LNGA 4AM9A 4YPUA 4GZDA 3APCA 3LY8A 1B89A 2HO1A 2IO3C 2IY0C 5HRYA 3B7UX 5AQ7A 3FU0A 5JJTA 1FT1A 3J5PA 3F9XA 2GRPB 3GW4A 3NOGD 4KZCA 4N5CA 4FHJA 2CHZA 3B7TA 4O1OA 4O6FA 4B8AA 1MVXA 3DSUA 3EU5A 4L2LA 1SZ9A 2ZISA 5HQ8A 3CHRA 2I9CA 3S7BA 3SBTB 3VLDA 3Q9NC 4A55A 4B94A 2Y1LE 3VV0A 4EZJA 3ISMC 4BEPA 1TNOA 4DX2A 4UQYA 3KS2A 4PH4B 1K8KG 3C3QA 4C0MA 3L82A 3TG4A 3LY7A 3UKRG 2VTBB 3OTNA 3T9KA 3LYAA 4WWNA 4QFVA 2VSNA 3QC1A 1TNBA 3Q5MA 3B7SA 3IHYA 2R17C 4TV3A 4K03A 2RFMA 1YYHA 4J8SA 4I1OB 4ATZD 3T8MA 1JUQA 2J4BA 2E0IA 2EIME 2WXIA 3CK9A 4UI9K 2KCLA 4YDWA 5JJ6A 2L6BA 4J8FA 5CPRB 4BSZB 3TWWA 4OAUC 3S8PA 2IEJA 3ZN3A 3ONLA 2MYOA 4G8LA 3UQ3A 4CZ2D 3APDA 3C72A 4IYPA 1O1RA 3CK8A 4KZ0A 4XZ4A 1KPSB 3IHVA 4N39A 1MX6A 2KZTB 3QWWA 3UIPC 3MKQB 2VGXA 4ILIA 2XENA 5F59A 2YINA 5CMWA 2XZDG 3RSEG 5FQ6A 5EX0A 4AY5A 4FULA 4Y6WA 3MO2A 2DYRE 4FU3A 4TUUA 1TEZA 4M7CA 4A1GA 1Z3XA 2EIJE 3NF1A 4O30A 2UY1A 2WPVA 2WXNA 1FPPA 3UM1A 4Z4PA 4KVMA 3C3OA 1N4QA 3PEUB 2KCKA 4YNMA 2CFUA 2R05A 2IJGX 4NQ0A 5CERB 3RAYA 3DSWA 2QY7A 2OVBA 3CVYA 1JWGA 2HYZA 4I6JA 5AYWD 1RW2A 4G2VA 1N11A 5FT9A 4JZYA 1K1AA 4GMRA 4URKA 5G55A 2P2CP 3J5QB 3QKYA 4OAVB 5ENOD 3ASDA 2XPIA 3DPDA 3RJVA 2E2EA 1VDYA 3U9WA 4CDMA 3B7RL 3Q4AB 1IHBA 4JPSA 5D66A 4U0ZA 3RIBA 3DXMG 4CT0A 5AENA 5BUZA 2XHEA 2P9PG 2HM8A 1UW4B 1E7VA 4IN3B 1IKND 4GAAA 2WXJA 3DSVA 4DUIA 4DX5D 1O9SA 5HS0A 4GB9A 4N5QA 1GW6A 3UX4A 3DPYA 3ONKA 5BXUA 4W9RA 3ENEA 2LO6A 3FH8A 2AW6A 4E47A 4YVQC 4CEMA 3VUZA 3MA5A 2X6FA 2IOSA 5KNHD 4ACKA 1X81A 3DBSA 3FUHA 5JIYA 4HS2A 4KMOA 1UOHA 5CBNA 2XEEA 3L13A 3ZVVA 3MO0A 3CHPA 2WMNA 2J07A 3CBMA 4WAFA 2KCVA 4G1TA 1MYOA 2YHCA 4EBAA 5B1BE 3HNAA 2XGSA 3D9MA 3ZFWA 1OCZE 4YNPA 2V0PA 1SVXA 1N94A 1HU3A 4RVBA 5DBKA 5EDSA 1NZNA 1MX2A 2DZNA 3D9PA 4JW1A 2BKKB 3N71A 5KJNA 3OS5A 1WAO1 2WXQA 3U64A 3MX3A 2XCCA 4EECA 3FUMA 3ZYLA 5HI7A 3QB2A 3OPEA 4J8EA 4GMJA 5JHNA 4I17A 4IULA 3SFYA 2GW1A 3K5KA 1KZPA 4AXHA 4HB5A 4A63B 1ZKKA 4GMLA 4BWRA 3E33A 1HG2A 3Q49B 4BY6A 5FWQA 4AEZC 2IOLA 5ANRA 3JYSA 3ZEFA 3DB5A 2LXLA 3AU5A 3FUJA 4HLLA 5CCMA 1HE8A 3Q78A 1KLXA 5C1DA 3AU4A 3E34A 5CHEE 2HR2A 5EN5D 2PNNA 2X6HA 3BUAA 3PUKA 4XX5A 3HRAA 5LCWJ 4Q94A 4B93B 5CCLA 2NXPA 4J0UA 2PM6A 4E85A 3SWCA 2F0YA 3LDZA 3ZPJA 3CVPA 2VSYA 3JCKC 3DWLG 3EHMA 2EINE 3PZ4A 4HRLA 5JINA 3PS6A 2VGXB 3CVVA 1TN8A 5ENSD 1WDYA 3LVRE 3UT7A 2LSUA 2VSXE 5KBAA 4LG6A 3ULEG 4JB8P 3I4GA 5JHBA 4BUPA 1OY3D 4R7LA 1QBQA 2WM9A 3ML8A 2UY1B 2XPZA 3D9OA 3FTVA 3B7BA 3ABKE 4XI0A 5D2MC 1ELKA 4L7TA 4F53A 4CYMD 4J83A 4ANWA 4X8QA 3GYZA 3BO5A 3OXLA 4QEPA 4GYWA 1HO8A 2A4ZA 4P29A 3Q7FA 4G11A 3WG7E 5A23A 2ETBA 3I5PA 5ARFA 5CBOA 3AJIA 3UINC 4QEOA 3AG1E 1HH8A 4G26A 2RG8A 1H2VC 3IXEA 1YMPA 4GTSA 1O5MA 2AVPA 1OWLA 4KXKB 2CFZA 4XEIG 3CVUA 3DEOA 2FI7A 3SQVA 3AS8A 4U07A 3CEQA 3T5VA 3LS8A 4DK5A 4IJ8A 5LCWC 1TJCA 4HOTA 4CDNA 4TRQA 3S7DA 4F3VA 3M57A 2WXFA 2IFUA 3CHQA 3E30A 2V4LA 3QWVA 5T0KA 3FFLA 5TEGA 2IF4A 2R2LA 3HXBA 3KD7A 4CGVA 3ULQA 3RKVA 3L6AA 1BU9A 3TWVA 4HQDA 3ASOE 4GTMA 4XKCA 1N3JA 4JLGA 1ELRA 2RFAA 1MZCA 1TJFA 3FWVA 5F5EA 1OWOA 4DI4A 1V54E 2L6JA 4AY6A 3KMAA 4MKTA 1MHQA 1HG5A 3CQGB 4AVXA 1MVHA 4RZ0A 4I43A 2WXRA 3LJ3A 4GA1A 1KT0A 3DXKG 2FEZA 3FTXA 5ARGA 4RLYA 5LOZA 3KSLA 1Y6IA 1Z3YA 2P9LG 4PUCA 1TNYA 4JC8A 1H6PA 4HOQA 2H6IA 1LD7A 3HDXA 2FO7A 1UJJA 5ENNA 4I6EA 1K3ZD 2AJAA 4A1SA 1OT8A 1N4SA 4GA0A 4Q96A 2VGEA 3LKUA 1H6KA 4LERA 4U95D 2ONDA 3UM3A 3LCAA 3M59A 1HXIA 3JUIA 4MI0A 5AARA 3D9HA 2ZGDA 3FH7A 3ZIMA 2J08A 3FUNA 2XCBA 2ZIRA 1V55E 3UXGA 4EQFA 3MV3B 3SF4A 2NSZA 4UUCA 5AJLA 5AQAA 4BT8A 5E75A 3AS5A 4BERA 1S63A 3ZW3A 3SY2A 4NACA 3ZYKA 2J4DA 3SNXA 5AYFA 1E8WA 3G2UA 4K5BA 1E8ZA 1HZ4A 3NQPA 4U0SA 3SFZA 2Y4UA 3HXDA 2OCCE 2LAHA 3L9TA 3DALA 1MUFA 3TWRA 1BPOA 3CLJA 1BI7B 4UWLA 4FA6A 2WXKA 1FVFA 2KM4A 5KWDA 4N3AA 3Q7AA 3G2WA 1ZB1A 2QYUA 2V5FA 2WXMA 4F7AA 2O8JA 4KVOA 4NURA 4XI9A 1KZOA 3FTWA 1HFAA 3FEYA 5FINA 2F8YA 2IGQA 1BLXB 3UUXA 3CHSA 4WWPA 4J7IA 4EZLA 1EPUA 1TNUA 1HF8A 2AWIA 1ZU2A 3ABME 5FIOA 3SD5A 2WXPA 3CSFA 4G25A 4QQIA 3JUEA 3QNKA 2X38A 1A17A 4I1AA 3AAAC 2IO2C 3SW9A 3MCXA 2FBNA 3S7JA 4BX9A 2C0MA 4BSXA 3PE3A 2WVIA 5ANLA 3AG4E 4MI5A 3FU3A 1N0QA 1L5JA 5EG2A 1PEGA 4V3IA 5JA4D 2DIWA 2X6IA 4I2ZA 3W9FA 1EYHA 4ME2A 4TXPA 1OUVA 3KSQA 2LXMA 4LCTA 4CT4A 4I51A 4HBDA 3Q47B 3D3MA 3JXIA 4GU5A 2QZAA 3GZ2A 3RAUA 4A3VA 4H7XA 3RQ4A 3LY9A 1X5BA 2KATA 2J49A 4K5AB 2DWZA 3V2OA 3ZYMA 4F6RD 1AWCB 1K1BA 3D9LA 1XQHA 4YPAA 5A6CA 3KMJA 4DX7D 2V8SE 2XGMA 2R03A 4LSZE 2AXVA 2PZIA 2CHWA 4N2QA 3I3NA 4OYSA 1DNPA 2G46A 5LX8A 3NZUA 4GTQA 4GTOA 1OWMA 2WXHA 1IHGA 3S2AA 2FF4A 4HRMB 4OVVA 3T8KA 4RSYA 1JCSA 4UWFA 4DX1A 3MO5A 3UI2A 4B0ZA 3NBNB 1PY1A 4AJWA 4RG9A 3ZNGA 5EIBE 2JEKA 2R5SA 2QFCA 1HS6A 2H6FA 3PZ3A 3FTZA 2VGYA 1E8XA 2XPYA 5H7PA 1N0RA 4MS6A 1ML9A 3TAXA 1RZ4A 4O60A 3F9WA 1FCHA 2HE0A 3D9IA 5BV1A 4JDSA 1TR4A 2GRRB 3ZRHA 5FQ7A 3P2BA 4HXIA 3QJZA 4PS3A 3IBEA 1Y8MA 4FLHA 2BTDA 5TTFA 1WG0A 1NI1A 3PZ1A 1OXJA 2XEHA 3EDTB 5F6KC 3RO3A 3L16A 3RU0A 3SO8A 2VSOE 3D9NA 3CGHA 4M3OA 4LDGA 3B95A 2QPWA 2X6JA 5AN8A 4J8YA 4WNFA 1UG3A 5F6LA 5BPPA 2BQZA 4GTTA 2JV0A 4NJ5A 2PQRA 4NRHB 4U96D 3Q15A 2VJ8A 2LUHA 3F9ZA 4NIKA 3SGHA 2F37A 4J7FA 3MKRA 2MOWA 3CQCB 5AJDA 3LXUX 2V4HC 2GRNB 2OEWA 3ZXPA 2I6HA 3EHRA 3L08A 5BV0A 4WWOA 3FUFA 3UTMA 1NP7A 1MQSA 3ESKA 4BESA 3TWQA 3CVNA 4I6GA 4U8VD 3PNTB 5FQ4A 5JHAA 1XNFA 3C98A 1Q2ZA 3JQ0A 3E37A 1MX4A 1SW6A 2H6HA 3I4RB 4D10C 4FC8A 5AIJA 1SQMA 3Q79A 2WMOA 4B89A 4DI3A 5FJYA 4L1BA 1OCCE 3SHFA 1IXVA 3NOCD 3W9GA 3TG5A 2RFIA 3NB2A 3IV0A 5EILA 5CMYA 1H6OA 5HKPA 4GA2A 3KMTA 4FLBA 2FULA 3UMVA 4JHRA 3PE4A 3QOUA 4MLPA 3UT4A 3V31A 5D0QD 4JA9A 2XRZA 4Z68A 2Y0BG 4DPRA 2ETCA 4HORA 4UWHA 4BTBA 3LVQE 3FDHA 5EYPF 4FP7A 2J09A 3QDNA 2LNIA 1N4PA 3F6QA 3D9JA 2OEVA 3IHXA 3PVLA 1DCQA 2MHKA 4HRNA 2DZOA 4FJZA 5KNGA 1E8YA 1A5EA 2P58C 2RD0A 3M55A 3ZUVB 4JEHA 2R02A 3FH5A 5FTPA 4UQZA 1DC2A 5EX3A 4H12A 3RK6A 1N4RA 1N6AA 5FZRA 4N3CA 2GRQB 3B13A 4J8DA 3DSSA 3MGBA 1JCRA 3QWPA 3DRAA 3R7RA 3TXNA 4G24A 3ZGQA 3VLFA 4GTRA 4FJYA 3RRUA 3PZDA 3OAWA 3GZSA 4FHKA 4AU7A 3M5AA 1XGWA 3NZSA 1Z5SC 2LAIA 3ASHA 1IYGA 3FTSA 3LPZA 1OCRE 3KAEA 3V2XA 5CEAA 2BEDA 3GZ1A 1WY6A 5T8IA 3IKOB 3PREA 2GGFA 5IY5E 2DCPA 1FVHA 4QENA 5E76A 1G3NB 4BTAA 3URZA 4UWGA 2XRYA 4UQXA 3PH0C 2GRLA 3QK0A 1DCEA 4Q69A 3TJPA 2JABA 4GPMA 4G23A 2I2OA 3PEVB 3UM2A 3CSTA 3M56A 3ZYQA 3FTUA 1INZA 4GTVA 4DLQA 4KYOB 3HIZA 3LEWA 4C9BB 1S70B 5KJMA 4UWKA 2L0IA 3HG0D 2W5YA 5CRUA 1ELWA 3PDNA 1OWNA 2MRIA 3TWTA 2YQ8A 4U0UA 4N2SA 5KJLA 3ULYA 1E96B 4EHMA 4UI9C 3ASNE 4PS8A 3S7FA 3MYVA 4KBQA 5AAOA 4LRZA 5G04J 2OV8A 4YPEA 3KEAA 3UIOC 4AV7A 2KC7A 3D9KA 3L22A 3HHMA 2FO1E 1TN7A 3OXFA 4L9PA 4U63A 4JHJA 2WB2A 3U4TA 1D8EA 3ABLE 4LUNU 3F9YA 5FZSA 3ASGA 4HOUA 1P5QA 3TWXA 2YHEA 4BETA 5CRVA 4F1SA 1QNFA 2BUGA 1PC2A 3FULA 2L9BA 1IQUA 3EU9A 3CK7A 3FP3A 1S64A 3EP0A 4ABNA 5A7DB 2LSVA 4WNEA 4DRXE
chains in the Genus database with same CATH topology
5JJ7A 1YA0A 2UWJG 3M58A 4AXHA 3WXXA 5A6CA 3O48A 3KMJA 2C0LA 4KT6B 2V8SE 2XGMA 3U66A 1MT6A 4DLQA 1ZKKA 2AXVA 2PZIA 4GMLA 2CHWA 2CHXA 4ILHB 4BWRA 4N2QA 3I3NA 1HG2A 1DNPA 4OYSA 3Q49B 2G46A 4BY6A 5FWQA 2ILRA 4AEZC 5LX8A 3NZUA 3OOIA 2IOLA 5ANRA 3JYSA 3R7QA 5T4YA 3ZEFA 3DB5A 3PUJA 1OWMA 3AU5A 3FUJA 3MEKA 1HE8A 1PAQA 2WXHA 1IHGA 3L54A 3ZHEA 3FTYA 4YNDA 5CCMA 3S2AA 3G2TA 2FF4A 3QAQA 3CBOA 3CKBA 1KLXA 5C1DA 3PNLB 3AU4A 4OVVA 3TL5A 3FUIA 4RSYA 5CHEE 4UWFA 2HR2A 3MO5A 3APFA 3ZXSA 2Q7FA 2X6HA 4EBAG 2CG3A 4WNGA 3G2SA 4MRUA 3PUKA 4B0ZA 4XX5A 4L23A 5LCWJ 1NA0A 1PY1A 4Q94A 4RG9A 4AJWA 4NVQA 5CCLA 2NXPA 4J0UA 2PM6A 4E85A 3SWCA 3FHEA 2JEKA 4FADA 2R5SA 3RO2A 2QFCA 2VQ2A 1SZAA 1UN8A 4HVBA 2AXZA 1HS6A 1U3CA 4AP2A 5G04C 3LDZA 3ZPJA 5J90A 3CVXA 3CVPA 3CKCA 2VSYA 3JCKC 3EHMA 3FTZA 2VGYA 2XEVA 1E8XA 2L0TB 2XPYA 3MV2B 5BNWA 4MS6A 1ML9A 4AOFA 5JINA 3PS6A 2VGXB 3FEXA 3TAXA 3CVVA 3RJWA 4J6IA 3F9WA 1FCHA 3D9IA 5BV1A 4APOA 2Y3AA 4JDSA 3LVRE 4AM9A 3UT7A 2LSUA 3ZRHA 2VSXE 2XGOA 5FQ7A 4YPUA 3P2BA 4HXIA 3QJZA 4PS3A 3IBEA 4GZDA 1Y8MA 4FLHA 3APCA 3LY8A 5JHBA 3I4GA 1B89A 2HO1A 4JVSA 4BUPA 2BTDA 4R7LA 3B7UX 5TTFA 2WM9A 3ML8A 3FU0A 5JJTA 4N3BA 1U3DA 2UY1B 2XPZA 3D9OA 5FQ8A 3FTVA 3EDTB 3FU5A 3F9XA 4XI0A 5F6KC 3CV0A 3TXMA 1ELKA 3RO3A 3GW4A 4L7TA 4KZCA 4N5CA 4FHJA 3L16A 4F53A 4J83A 4ANWA 2CHZA 3GYZA 4BX8A 3OXLA 3RU0A 3BO5A 4QEPA 4GYWA 2VSOE 1HO8A 3B7TA 3D9NA 4JL0A 3CGHA 2A4ZA 4M3OA 4O6FA 4B8AA 1MVXA 4LDGA 2QPWA 2X6JA 4P29A 4G11A 4L2LA 4WNFA 5A23A 1UG3A 4GZ6A 1SZ9A 5HQ8A 4IJDA 5F6LA 2PQNA 5BPPA 3CHRA 3I5PA 5ARFA 2I9CA 5G05J 3S7BA 3SBTB 2W5ZA 2BQZA 3HYMB 3VLDA 4ACLA 4A55A 4B94A 2JV0A 4NJ5A 4QEOA 3VV0A 2BF0X 2PQRA 3IEGA 1HH8A 4EZJA 4G26A 4MI5A 2RG8A 4NRHB 4J8OA 4HFGA 1H2VC 4UQYA 3KS2A 3Q15A 3HVEA 2AVPA 2VJ8A 4PH4B 3F9ZA 1OWLA 2EQXA 3SZ7A 4KXKB 4C0MA 1E7UA 2CFZA 3SGHA 3CVUA 3TG4A 2FI7A 3LY7A 4J7FA 2VTBB 3AS8A 3MKRA 3OTNA 2MOWA 4U07A 3FPDA 3CEQA 3LYAA 4WWNA 3CQCB 4DLOA 2WQ6A 4QFVA 5AJDA 3CBPA 3T5VA 3LS8A 3LXUX 2VSNA 4DK5A 4IJ8A 3QC1A 4HOSA 3SBSA 2WQ7A 2Y4TA 5LCWC 4JEUA 1TJCA 4ANVA 1N52A 2I6HA 3Q5MA 4HOTA 4CDNA 4BFRA 3L08A 4TRQA 2X3MA 3S7DA 4F3VA 3VUZA 2CG2A 5BV0A 3B7SA 3IHYA 4U04A 2WXOA 3FUFA 4WWOA 3M57A 1NP7A 2WXFA 2IFUA 2M63A 3CHQA 2R17C 1MQSA 3ESKA 2V4LA 3QWVA 3VTYA 5T0KA 4TV3A 4K03A 3FFLA 3CVNA 4I6GA 5TEGA 2IF4A 3PNTB 5FQ4A 5JHAA 1XNFA 3KD7A 4J8SA 4I1OB 4CCAA 4CGVA 1QZ2A 3ULQA 3RKVA 3C98A 3L6AA 3T8MA 1JUQA 3M53A 4I1MA 2J4BA 5LSXA 2E0IA 3JQ0A 3M54A 1UJKA 3I4RB 4XKCA 1N3JA 4JLGA 2YNQA 2WXIA 3TGOA 3ZHEB 1ELRA 3CK9A 3UT8A 1W3BA 4JXTA 2KCLA 4UI9K 4D10C 1TJFA 4C1QA 4FC8A 3FWVA 5AIJA 5JJ6A 3CHOA 5F5EA 1SQMA 4A3TA 1OWOA 4DI4A 2WMOA 3CVLA 3O4ZA 4B89A 2L6JA 4J8FA 4DI3A 5FJYA 4L1BA 4AY6A 3KMAA 5CPRB 4MKTA 3JQ1A 1MHQA 1HG5A 3SHFA 3S8PA 3CQGB 4RG6A 3ZN3A 3TG5A 3FUEA 4AVXA 1MVHA 2RFIA 4RZ0A 4I43A 3ONLA 2WXRA 3UQ3A 3LJ3A 3APDA 1ZBPA 3IV0A 4GA1A 1KT0A 4IYPA 5CMYA 3CK8A 2FEZA 4GA2A 3FTXA 4KZ0A 5ARGA 5KCMA 4XZ4A 3KMTA 2OOEA 4FLBA 5LOZA 3IHVA 2FULA 4N39A 3UMVA 1Y6IA 3BEEA 2KZTB 3PE4A 4JHRA 4HLEA 3QOUA 1Z3YA 3QWWA 3MKQB 4MLPA 4PUCA 4PDXA 5FZQA 4APFA 1H2UA 2A5UA 2VGXA 4ILIA 4JC8A 3MJWA 2I1JA 4HOQA 3UT4A 5F59A 4XKBA 5D0QD 5G05C 2YINA 2XQ0A 4JA9A 3HDXA 4ANUA 2FO7A 2WQHA 5CMWA 1UJJA 5DIZA 5ENNA 2XRZA 4I6EA 2IQCA 5FQ6A 4DPRA 1H2TC 3T5XA 4A1SA 2IONA 4GYYA 5EX0A 4GA0A 4HORA 4AY5A 4FULA 4Q96A 4Y6WA 4UWHA 3MO2A 4BTBA 4FU3A 5D0OD 4TUUA 1TEZA 3LKUA 4LEUA 3ESLA 3LVQE 1H6KA 1Z3XA 4A1GA 3FDHA 1KT1A 3NF1A 3EJNA 2C2LA 4FP7A 4I9CA 4O30A 4B8CB 4LERA 2J09A 2UY1A 2WPVA 4I9EA 2F69A 2WXNA 4GPKA 2ONDA 3K9IA 3QDNA 3VLEA 3LCAA 2LNIA 3M59A 1HXIA 1S0PA 3D9JA 1E90A 1DVPA 4KVMA 3JUIA 4Z4PA 4MI0A 3IHXA 3PVLA 3PEUB 2KCKA 4CRWA 3FH7A 4K0RA 4YNMA 2CFUA 3ZIMA 2IJGX 2MHKA 4NQ0A 3RAYA 4E6HA 1JWFA 2J08A 4FJZA 1E8YA 1QQEA 3FUNA 2QY7A 2OVBA 2XCBA 4C0EA 2P58C 3CVYA 2RD0A 3BG1B 1IQRA 3MV3B 1JWGA 3SF4A 4DJAA 4JEHA 4EQFA 3M55A 2NSZA 2HYZA 3FH5A 3E4BA 5FTPA 4UQZA 5EX3A 4H12A 5AJLA 1H19A 4I6JA 5AYWD 4BT8A 5E75A 4G2VA 3AS5A 3RK6A 3CR3A 5FT9A 2OVFA 1N6AA 3CVWA 3ZW3A 5FZRA 2NC9A 4NACA 4JZYA 3ZYKA 4N3CA 2J4DA 2PL2A 3B13A 3SNXA 4J8DA 5AYFA 1E8WA 3G2UA 5T3RA 4URKA 2VTBA 1E8ZA 4XIFA 1HZ4A 3CVQA 5G55A 2PM7A 3MGBA 3NQPA 5EKQD 3QWPA 4YVOA 3R7RA 3RRNB 4U0SA 3SFZA 4G24A 2Y4UA 3QKYA 3TXNA 2LAHA 3ZGQA 3VLFA 3P1UA 4AIFA 3DALA 4FJYA 3RRUA 3PZDA 1MUFA 3OAWA 3ASDA 1EF1C 3SI5A 1BPOA 3GZSA 4FHKA 4AU7A 2XPIA 3DPDA 2R59A 4PS7A 1XGWA 3M5AA 3NZSA 3UPVA 4GCOA 3CLJA 2LAIA 3ASHA 4UWLA 4FA6A 3RJVA 1IYGA 3FTSA 3LPZA 2WXKA 5JJ0A 3KAEA 4I2WA 1FVFA 2E2EA 2R3AA 2KM4A 3GZ1A 1VDYA 3U9WA 4CDMA 4U8HA 3B7RL 3Q4AB 3AS4A 4N3AA 3FUDA 1WY6A 3G2WA 3L17A 4JPSA 5T8IA 3IKOB 5LSZA 4U0ZA 3PREA 2V5FA 2WXMA 3RIBA 2GGFA 4CT0A 4F7AA 4CDRA 2O8JA 3CHMA 5AENA 5BUZA 2DCPA 4KVOA 2XHEA 1FVHA 4GCNA 4NURA 4QENA 5E76A 4Y6CA 4XI9A 2HM8A 4BTAA 3FTWA 3URZA 1HFAA 1UW4B 3FEYA 1E7VA 3PRZA 4UWGA 4WUYA 2XRYA 2IGQA 4IN3B 4UQXA 3PH0C 1EDUA 2GRLA 3QK0A 4EZKA 4H7YA 3UUXA 5KJKA 4GAAA 2WXJA 5C2YA 5T0MA 3CHSA 3FY4A 4Q69A 1O9SA 3ML9A 4WWPA 4J7IA 4GB9A 4EZLA 1GW6A 3TJPA 3CIAA 4L2YA 4G23A 3UX4A 2I2OA 1EPUA 2GRMA 1HF8A 3CSTA 3ONKA 3PEVB 5LFAA 3M56A 2AWIA 1ZU2A 3ZYQA 4GYOA 4W9RA 2KZTA 1OWPA 3EIQC 3ENEA 3FTUA 2LO6A 3FH8A 3MKQA 4GZCA 1INZA 2AW6A 2AXUA 4E47A 1Z6TA 2X6KA 4YVQC 3KEZA 4WNDA 3SD5A 2WXPA 3CSFA 3MA5A 1NA3A 4G25A 4KYOB 4CEMA 3HIZA 2X6FA 3LEWA 2IOSA 4C9BB 4ACKA 5KJMA 4UWKA 3DBSA 3QNKA 2L0IA 3OXGA 2W5YA 2X38A 3FUKA 1ELWA 3FUHA 3PDNA 5JIYA 1OWNA 2MRIA 2YQ8A 4HS2A 4U0UA 1A17A 1H0AA 2ZU6B 4KMOA 5BW8C 3L13A 4N2SA 5KJLA 1HX8A 1E96B 4I1AA 4UI9C 3ZVVA 3CHPA 3MO0A 2WMNA 4PS8A 4FMUA 3S7FA 2J07A 3MYVA 3SW9A 3EHNA 3CBMA 4WAFA 2KCVA 3G2VA 2JLBA 2FBNA 3MCXA 4G1TA 4IRUA 3S7JA 4KBQA 5M72A 2YHCA 4BX9A 4LRZA 2C0MA 5G04J 4EBAA 5J08A 4BSXA 4ILGA 3PE3A 4JHKA 2WVIA 5ANLA 2OV8A 4YPEA 3R9AB 4AV7A 3HNAA 2XGSA 2IU1A 2KC7A 3D9MA 3BG0B 3D9KA 3FU3A 3HHMA 3L22A 3QARA 3ZFWA 1L5JA 4YNPA 2V0PA 3OXFA 5EG2A 1HU3A 4U63A 4CGWA 4RVBA 1PEGA 4JHJA 2DBAA 2WB2A 4V3IA 3U4TA 2DIWA 2X6IA 4I2ZA 2WXGA 5DBKA 4OVUA 5EDSA 4BT9A 1EYHA 1NZNA 4LUNU 3D9PA 5T5GA 3F9YA 4JW1A 4ME2A 3VTXA 1OUVA 2J9QA 5FZSA 3ASGA 1UN9A 3U3WA 5BT1A 3N71A 2I1KA 4HOUA 4UI9J 1P5QA 4LCTA 4CT4A 2YHEA 4F1SA 1H3IA 4I51A 1LF8A 1QNFA 3HVEB 3Q47B 2BUGA 5KJNA 3D3MA 5TH7A 1PC2A 3OS5A 1WAO1 1WM5A 3FULA 2WXQA 3U64A 2L9BA 4GU5A 4GZ5A 4EPZA 5LP0A 3MX3A 3ASFA 3GZ2A 1IQUA 4GZ3A 1N54A 4A3VA 4H7XA 2XCCA 4XE0A 3CK7A 3FP3A 4EECA 3RQ4A 3LY9A 1X5BA 3FUMA 3ZYLA 2WXLA 1N6CA 2KATA 5G2NA 5HI7A 2J49A 3QB2A 3FU6A 4J8EA 4ABNA 3MZLB 4GMJA 3EP0A 3OPEA 5JHNA 2VYIA 5A7DB 3ZYMA 3EIJA 1JPLA 4ATGA 3RRMB 4ANXA 4I17A 2LSVA 4WNEA 3D9LA 4IULA 1XQHA 4JA7A 4YPAA 2GW1A 3K5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJ7 A;  1YA0 A;  2UWJ G;  3M58 A;  3WXX A;  5A6C A;  3O48 A;  3KMJ A;  2C0L A;  2XGM A;  1MT6 A;  1ZKK A;  2PZI A;  4BWR A;  4N2Q A;  3Q49 B;  2G46 A;  3OOI A;  3JYS A;  3DB5 A;  3MEK A;  3ZHE A;  5CCM A;  1IHG A;  4YND A;  2FF4 A;  3CBO A;  3CKB A;  1KLX A;  5C1D A;  5CHE E;  2HR2 A;  3MO5 A;  2Q7F A;  4WNG A;  5LCW J;  1NA0 A;  4RG9 A;  4NVQ A;  5CCL A;  4J0U A;  3SWC A;  2R5S A;  3RO2 A;  2QFC A;  2VQ2 A;  5G04 C;  3ZPJ A;  3CVP A;  3CKC A;  2VSY A;  2VGY A;  2XEV A;  3MV2 B;  5BNW A;  1ML9 A;  5JIN A;  3TAX A;  2VGX B;  3RJW A;  3F9W A;  1FCH A;  4APO A;  4JDS A;  4AM9 A;  2LSU A;  2XGO A;  4YPU A;  1Y8M A;  3LY8 A;  1B89 A;  2HO1 A;  4BUP A;  5TTF A;  5JJT A;  4N3B A;  2UY1 B;  3EDT B;  3F9X A;  4XI0 A;  5F6K C;  3CV0 A;  3RO3 A;  3GW4 A;  4N5C A;  4J83 A;  3GYZ A;  3BO5 A;  3OXL A;  3RU0 A;  4QEP A;  4GYW A;  4JL0 A;  4O6F A;  1MVX A;  4LDG A;  2QPW A;  4WNF A;  4GZ6 A;  5HQ8 A;  4IJD A;  5F6L A;  2PQN A;  5ARF A;  5G05 J;  2W5Z A;  3S7B A;  2BQZ A;  3HYM B;  4B94 A;  2JV0 A;  4NJ5 A;  4QEO A;  3VV0 A;  2PQR A;  3IEG A;  1HH8 A;  4G26 A;  4NRH B;  4J8O A;  4UQY A;  3KS2 A;  3Q15 A;  2AVP A;  3F9Z A;  3SZ7 A;  4KXK B;  3TG4 A;  2FI7 A;  3LY7 A;  4J7F A;  3AS8 A;  3MKR A;  4U07 A;  3FPD A;  3CEQ A;  3LYA A;  3CBP A;  2VSN A;  4IJ8 A;  4HOS A;  2Y4T A;  5LCW C;  1TJC A;  2I6H A;  3Q5M A;  4HOT A;  3S7D A;  4F3V A;  4U04 A;  3M57 A;  2IFU A;  3ESK A;  3VTY A;  3QWV A;  5T0K A;  3FFL A;  3CVN A;  5TEG A;  2IF4 A;  1XNF A;  3KD7 A;  4CGV A;  1QZ2 A;  3ULQ A;  3RKV A;  3M53 A;  5LSX A;  3M54 A;  1N3J A;  4JLG A;  3TGO A;  3ZHE B;  1ELR A;  3CK9 A;  1W3B A;  4UI9 K;  2KCL A;  4C1Q A;  3FWV A;  5JJ6 A;  5F5E A;  3CVL A;  2L6J A;  4J8F A;  5FJY A;  4AY6 A;  3KMA A;  5CPR B;  3S8P A;  4RG6 A;  3ZN3 A;  3TG5 A;  1MVH A;  2RFI A;  4RZ0 A;  3UQ3 A;  1ZBP A;  4GA1 A;  1KT0 A;  3CK8 A;  2FEZ A;  4GA2 A;  5ARG A;  3KMT A;  2OOE A;  4N39 A;  3BEE A;  4JHR A;  3PE4 A;  3QOU A;  3QWW A;  5FZQ A;  2VGX A;  4HOQ A;  5F59 A;  5D0Q D;  5G05 C;  4JA9 A;  2FO7 A;  2WQH A;  5DIZ A;  4A1S A;  4GYY A;  5EX0 A;  4GA0 A;  4HOR A;  4AY5 A;  3MO2 A;  4Y6W A;  4BTB A;  5D0O D;  3LKU A;  4LEU A;  1KT1 A;  3NF1 A;  2C2L A;  4I9C A;  4O30 A;  2UY1 A;  4I9E A;  2WPV A;  2F69 A;  4GPK A;  2OND A;  3K9I A;  3QDN A;  3LCA A;  2LNI A;  3M59 A;  1HXI A;  4Z4P A;  4MI0 A;  3IHX A;  2KCK A;  4YNM A;  2MHK A;  4NQ0 A;  3RAY A;  1QQE A;  2XCB A;  2P58 C;  4EQF A;  3MV3 B;  3SF4 A;  3M55 A;  2HYZ A;  3E4B A;  5FTP A;  4UQZ A;  5EX3 A;  4H12 A;  5AYW D;  4BT8 A;  4G2V A;  3AS5 A;  5FT9 A;  1N6A A;  5FZR A;  2NC9 A;  4N3C A;  2PL2 A;  4J8D A;  5AYF A;  4XIF A;  1HZ4 A;  3CVQ A;  5EKQ D;  3QWP A;  4YVO A;  4U0S A;  4G24 A;  2Y4U A;  3QKY A;  3ZGQ A;  4AIF A;  3DAL A;  1MUF A;  3ASD A;  4AU7 A;  2XPI A;  3M5A A;  3UPV A;  4GCO A;  3ASH A;  3RJV A;  1IYG A;  3LPZ A;  5JJ0 A;  3KAE A;  4I2W A;  2E2E A;  2R3A A;  3GZ1 A;  3Q4A B;  4N3A A;  3AS4 A;  5LSZ A;  4U0Z A;  2V5F A;  3RIB A;  4CDR A;  2O8J A;  4QEN A;  4GCN A;  4Y6C A;  4XI9 A;  4BTA A;  3URZ A;  4WUY A;  2IGQ A;  4IN3 B;  4UQX A;  4H7Y A;  3UUX A;  5KJK A;  5T0M A;  1O9S A;  4J7I A;  4G23 A;  3M56 A;  1ZU2 A;  4GYO A;  4W9R A;  4E47 A;  4YVQ C;  3VUZ A;  4WND A;  4G25 A;  3MA5 A;  1NA3 A;  4KYO B;  5KJM A;  3OXG A;  2W5Y A;  1ELW A;  3PDN A;  5JIY A;  2YQ8 A;  4U0U A;  1A17 A;  5BW8 C;  4N2S A;  5KJL A;  1E96 B;  4I1A A;  4UI9 C;  3MO0 A;  4FMU A;  3S7F A;  3SW9 A;  3CBM A;  2KCV A;  2JLB A;  2FBN A;  4G1T A;  3S7J A;  5M72 A;  4KBQ A;  2YHC A;  2C0M A;  5G04 J;  3PE3 A;  4YPE A;  3R9A B;  3HNA A;  2XGS A;  2KC7 A;  4MI5 A;  3ZFW A;  4YNP A;  3OXF A;  5EG2 A;  4CGW A;  1PEG A;  2DBA A;  3U4T A;  5DBK A;  4I2Z A;  4BT9 A;  1NZN A;  5T5G A;  3F9Y A;  4ME2 A;  3VTX A;  1OUV A;  2J9Q A;  5FZS A;  3ASG A;  3U3W A;  5BT1 A;  3N71 A;  4UI9 J;  4HOU A;  1P5Q A;  1H3I A;  4I51 A;  3Q47 B;  5KJN A;  2BUG A;  5TH7 A;  1PC2 A;  3OS5 A;  1WAO 1;  1WM5 A;  4GZ5 A;  3ASF A;  3GZ2 A;  4GZ3 A;  4H7X A;  2XCC A;  3CK7 A;  3FP3 A;  3RQ4 A;  3LY9 A;  1N6C A;  2KAT A;  5HI7 A;  3EP0 A;  4J8E A;  4ABN A;  3OPE A;  5JHN A;  2VYI A;  5A7D B;  4I17 A;  2LSV A;  4WNE A;  1XQH A;  4JA7 A;  4YPA A;  2GW1 A;  3K5K A; 
#chains in the Genus database with same CATH topology
 3M58 A;  3WXX A;  5CED B;  2C0L A;  3U66 A;  4LNU D;  1D8D A;  1NFI E;  2ILR A;  3OOI A;  4C48 B;  5T4Y A;  3PUJ A;  3L54 A;  3FTY A;  4YND A;  3G2T A;  3QAQ A;  3CBO A;  2P9U G;  3CKB A;  3TL5 A;  3AG3 E;  3FUI A;  3ZXS A;  2CG3 A;  4MRU A;  4U7E B;  4NVQ A;  4FAD A;  3RO2 A;  2VQ2 A;  1SZA A;  1U3C A;  5G04 C;  5J90 A;  1LD8 A;  3CKC A;  1U2V G;  4HNA D;  3MV2 B;  5BNW A;  4AOF A;  3PZ2 A;  1LTX A;  4RQI A;  4J6I A;  3HXF A;  2XGO A;  2QC9 A;  4JD2 G;  4JVS A;  4HI9 A;  4N3B A;  1U3D A;  5FQ8 A;  3FU5 A;  3CV0 A;  3TXM A;  4TUM A;  4BX8 A;  2P9I G;  4JL0 A;  1NL4 A;  4GZ6 A;  4IJD A;  2PQN A;  5G05 J;  2W5Z A;  3HYM B;  3EHQ A;  4ACL A;  3LJN A;  2BF0 X;  3IEG A;  4HI8 A;  1AP7 A;  4J8O A;  4HFG A;  3HVE A;  4K5C A;  2EQX A;  3SZ7 A;  1E7U A;  3V79 K;  2P9K G;  4TXR A;  1BI8 B;  3FPD A;  4MBG A;  4DLO A;  2WQ6 A;  3DEP A;  3CBP A;  4HOS A;  3SBS A;  2WQ7 A;  2Y4T A;  4JEU A;  4ANV A;  1N52 A;  4BFR A;  4O1P A;  2X3M A;  2CG2 A;  4U04 A;  2WXO A;  5EID A;  2M63 A;  3VTY A;  1SA4 A;  1MJ0 A;  4U8Y D;  2B0O E;  4CCA A;  1QZ2 A;  3M53 A;  4I1M A;  5LSX A;  3M54 A;  1UJK A;  2YNQ A;  3TGO A;  3ZHE B;  3UT8 A;  1W3B A;  4JXT A;  4C1Q A;  3CHO A;  4A3T A;  2A5E A;  2J8S D;  3CVL A;  3O4Z A;  3JQ1 A;  2ZGG A;  4RG6 A;  3FUE A;  2ZXW E;  1ZBP A;  5KCM A;  3R9M A;  2OOE A;  3BEE A;  4HLE A;  4G8K A;  5FZQ A;  4PDX A;  4APF A;  1H2U A;  2A5U A;  3MJW A;  2I1J A;  4XKB A;  5G05 C;  2XQ0 A;  4ANU A;  2WQH A;  5ENT D;  5DIZ A;  2IQC A;  2H6G A;  1H2T C;  3T5X A;  2ION A;  4GYY A;  3Q73 A;  2XS8 A;  5D0O D;  4LEU A;  1O1T A;  3ESL A;  1KT1 A;  3EJN A;  2C2L A;  4I9C A;  4B8C B;  1TYQ G;  4I9E A;  2F69 A;  4GPK A;  3K9I A;  3UKU G;  3VLE A;  1SA5 A;  1S0P A;  1E90 A;  1DVP A;  4CRW A;  4K0R A;  2P9S G;  2GRO B;  4E6H A;  1O1S A;  1JWF A;  1QQE A;  4C0E A;  4GTP A;  1IQR A;  3BG1 B;  4DJA A;  4DX6 D;  5CEC B;  3E4B A;  2DVW A;  2DYS E;  3Q9U C;  4YDE A;  1H19 A;  2F8X K;  1OCO E;  1FT2 A;  3CR3 A;  2KXP C;  2OVF A;  3CVW A;  1N9A A;  2NC9 A;  5ENQ D;  2PL2 A;  1JCQ A;  5T3R A;  2VTB A;  4XIF A;  3CVQ A;  2PM7 A;  3C3R A;  5EKQ D;  4YVO A;  3RRN B;  3P1U A;  4AIF A;  2Y69 E;  1QYM A;  2RKK A;  3TWS A;  4J7W A;  1EF1 C;  3SI5 A;  3BU8 A;  2R59 A;  4PS7 A;  2XZT G;  3UPV A;  4GCO A;  2EIL E;  2B6C A;  5JJ0 A;  4I2W A;  2R3A A;  4U8H A;  3AS4 A;  3FUD A;  3L17 A;  5LSZ A;  3ZKJ A;  4CDR A;  3CHM A;  4GCN A;  4Y6C A;  3PRZ A;  4WUY A;  3NAW A;  4EZK A;  1EDU A;  4H7Y A;  5KJK A;  5C2Y A;  5T0M A;  3TWU A;  3FY4 A;  3ML9 A;  3DSX A;  4L2Y A;  3CIA A;  3HXC A;  2GRM A;  5LFA A;  4GYO A;  2KZT A;  1OWP A;  1TNZ A;  3EIQ C;  3MKQ A;  4GZC A;  2AXU A;  1Z6T A;  2X6K A;  3KEZ A;  4WND A;  1NA3 A;  3EUV A;  2NYJ A;  3OXG A;  2XS1 A;  3FUK A;  3X2Q E;  1H0A A;  2ZU6 B;  1TN6 A;  5BW8 C;  1HX8 A;  2QYJ A;  4FMU A;  1N95 A;  2V5Q C;  3EHN A;  3G2V A;  2JLB A;  5M72 A;  4IRU A;  5J08 A;  4ILG A;  4JHK A;  3R9A B;  3AG2 E;  1YCS B;  5B1A E;  2IU1 A;  3BG0 B;  3QAR A;  4YDY A;  3Q75 A;  4LNB A;  2ETA A;  4CGW A;  3UM0 A;  2DBA A;  2WXG A;  4OVU A;  4BT9 A;  5T5G A;  3VTX A;  2J9Q A;  1UN9 A;  5BXO A;  3U3W A;  5BT1 A;  1BD8 A;  2I1K A;  4UI9 J;  1H3I A;  1LF8 A;  3HVE B;  5TH7 A;  1WM5 A;  4GZ5 A;  4EPZ A;  3HXE A;  5LP0 A;  2EIK E;  3ASF A;  4GZ3 A;  1N54 A;  4XE0 A;  5ITZ F;  1N6C A;  2WXL A;  5G2N A;  3FU6 A;  4YDO A;  3MZL B;  2VYI A;  2KBX A;  4F1P A;  3EIJ A;  1JPL A;  5AQB A;  3RRM B;  3SFX A;  4ATG A;  4ANX A;  4JA7 A;  5JJ7 A;  1YA0 A;  2UWJ G;  4ZFH A;  3O48 A;  4KT6 B;  1MT6 A;  3V30 A;  2CHX A;  4ILH B;  1D9S A;  3ZU7 B;  5B3S E;  5AQ9 A;  3R7Q A;  3MEK A;  3ZHE A;  1PAQ A;  5JMN D;  3BQO A;  4TXQ A;  3PNL B;  3C5R A;  3APF A;  2Q7F A;  4EBA G;  4WNG A;  3G2S A;  4L23 A;  3E32 A;  1NA0 A;  5ENP D;  5EYL A;  3FHE A;  4ZHB A;  1UN8 A;  4HVB A;  2AXZ A;  4AP2 A;  3CVX A;  2XEV A;  2L0T B;  3JXJ A;  3DST A;  3FEX A;  5ENR D;  3RJW A;  2P9N G;  2BKG A;  4APO A;  2Y3A A;  4LNG A;  4AM9 A;  4YPU A;  4GZD A;  3APC A;  3LY8 A;  1B89 A;  2HO1 A;  2IO3 C;  2IY0 C;  5HRY A;  3B7U X;  5AQ7 A;  3FU0 A;  5JJT A;  1FT1 A;  3J5P A;  3F9X A;  2GRP B;  3GW4 A;  3NOG D;  4KZC A;  4N5C A;  4FHJ A;  2CHZ A;  3B7T A;  4O1O A;  4O6F A;  4B8A A;  1MVX A;  3DSU A;  3EU5 A;  4L2L A;  1SZ9 A;  2ZIS A;  5HQ8 A;  3CHR A;  2I9C A;  3S7B A;  3SBT B;  3VLD A;  3Q9N C;  4A55 A;  4B94 A;  2Y1L E;  3VV0 A;  4EZJ A;  3ISM C;  4BEP A;  1TNO A;  4DX2 A;  4UQY A;  3KS2 A;  4PH4 B;  1K8K G;  3C3Q A;  4C0M A;  3L82 A;  3TG4 A;  3LY7 A;  3UKR G;  2VTB B;  3OTN A;  3T9K A;  3LYA A;  4WWN A;  4QFV A;  2VSN A;  3QC1 A;  1TNB A;  3Q5M A;  3B7S A;  3IHY A;  2R17 C;  4TV3 A;  4K03 A;  2RFM A;  1YYH A;  4J8S A;  4I1O B;  4ATZ D;  3T8M A;  1JUQ A;  2J4B A;  2E0I A;  2EIM E;  2WXI A;  3CK9 A;  4UI9 K;  2KCL A;  4YDW A;  5JJ6 A;  2L6B A;  4J8F A;  5CPR B;  4BSZ B;  3TWW A;  4OAU C;  3S8P A;  2IEJ A;  3ZN3 A;  3ONL A;  2MYO A;  4G8L A;  3UQ3 A;  4CZ2 D;  3APD A;  3C72 A;  4IYP A;  1O1R A;  3CK8 A;  4KZ0 A;  4XZ4 A;  1KPS B;  3IHV A;  4N39 A;  1MX6 A;  2KZT B;  3QWW A;  3UIP C;  3MKQ B;  2VGX A;  4ILI A;  2XEN A;  5F59 A;  2YIN A;  5CMW A;  2XZD G;  3RSE G;  5FQ6 A;  5EX0 A;  4AY5 A;  4FUL A;  4Y6W A;  3MO2 A;  2DYR E;  4FU3 A;  4TUU A;  1TEZ A;  4M7C A;  4A1G A;  1Z3X A;  2EIJ E;  3NF1 A;  4O30 A;  2UY1 A;  2WPV A;  2WXN A;  1FPP A;  3UM1 A;  4Z4P A;  4KVM A;  3C3O A;  1N4Q A;  3PEU B;  2KCK A;  4YNM A;  2CFU A;  2R05 A;  2IJG X;  4NQ0 A;  5CER B;  3RAY A;  3DSW A;  2QY7 A;  2OVB A;  3CVY A;  1JWG A;  2HYZ A;  4I6J A;  5AYW D;  1RW2 A;  4G2V A;  1N11 A;  5FT9 A;  4JZY A;  1K1A A;  4GMR A;  4URK A;  5G55 A;  2P2C P;  3J5Q B;  3QKY A;  4OAV B;  5ENO D;  3ASD A;  2XPI A;  3DPD A;  3RJV A;  2E2E A;  1VDY A;  3U9W A;  4CDM A;  3B7R L;  3Q4A B;  1IHB A;  4JPS A;  5D66 A;  4U0Z A;  3RIB A;  3DXM G;  4CT0 A;  5AEN A;  5BUZ A;  2XHE A;  2P9P G;  2HM8 A;  1UW4 B;  1E7V A;  4IN3 B;  1IKN D;  4GAA A;  2WXJ A;  3DSV A;  4DUI A;  4DX5 D;  1O9S A;  5HS0 A;  4GB9 A;  4N5Q A;  1GW6 A;  3UX4 A;  3DPY A;  3ONK A;  5BXU A;  4W9R A;  3ENE A;  2LO6 A;  3FH8 A;  2AW6 A;  4E47 A;  4YVQ C;  4CEM A;  3VUZ A;  3MA5 A;  2X6F A;  2IOS A;  5KNH D;  4ACK A;  1X81 A;  3DBS A;  3FUH A;  5JIY A;  4HS2 A;  4KMO A;  1UOH A;  5CBN A;  2XEE A;  3L13 A;  3ZVV A;  3MO0 A;  3CHP A;  2WMN A;  2J07 A;  3CBM A;  4WAF A;  2KCV A;  4G1T A;  1MYO A;  2YHC A;  4EBA A;  5B1B E;  3HNA A;  2XGS A;  3D9M A;  3ZFW A;  1OCZ E;  4YNP A;  2V0P A;  1SVX A;  1N94 A;  1HU3 A;  4RVB A;  5DBK A;  5EDS A;  1NZN A;  1MX2 A;  2DZN A;  3D9P A;  4JW1 A;  2BKK B;  3N71 A;  5KJN A;  3OS5 A;  1WAO 1;  2WXQ A;  3U64 A;  3MX3 A;  2XCC A;  4EEC A;  3FUM A;  3ZYL A;  5HI7 A;  3QB2 A;  3OPE A;  4J8E A;  4GMJ A;  5JHN A;  4I17 A;  4IUL A;  3SFY A;  2GW1 A;  3K5K A;  1KZP A;  4AXH A;  4HB5 A;  4A63 B;  1ZKK A;  4GML A;  4BWR A;  3E33 A;  1HG2 A;  3Q49 B;  4BY6 A;  5FWQ A;  4AEZ C;  2IOL A;  5ANR A;  3JYS A;  3ZEF A;  3DB5 A;  2LXL A;  3AU5 A;  3FUJ A;  4HLL A;  5CCM A;  1HE8 A;  3Q78 A;  1KLX A;  5C1D A;  3AU4 A;  3E34 A;  5CHE E;  2HR2 A;  5EN5 D;  2PNN A;  2X6H A;  3BUA A;  3PUK A;  4XX5 A;  3HRA A;  5LCW J;  4Q94 A;  4B93 B;  5CCL A;  2NXP A;  4J0U A;  2PM6 A;  4E85 A;  3SWC A;  2F0Y A;  3LDZ A;  3ZPJ A;  3CVP A;  2VSY A;  3JCK C;  3DWL G;  3EHM A;  2EIN E;  3PZ4 A;  4HRL A;  5JIN A;  3PS6 A;  2VGX B;  3CVV A;  1TN8 A;  5ENS D;  1WDY A;  3LVR E;  3UT7 A;  2LSU A;  2VSX E;  5KBA A;  4LG6 A;  3ULE G;  4JB8 P;  3I4G A;  5JHB A;  4BUP A;  1OY3 D;  4R7L A;  1QBQ A;  2WM9 A;  3ML8 A;  2UY1 B;  2XPZ A;  3D9O A;  3FTV A;  3B7B A;  3ABK E;  4XI0 A;  5D2M C;  1ELK A;  4L7T A;  4F53 A;  4CYM D;  4J83 A;  4ANW A;  4X8Q A;  3GYZ A;  3BO5 A;  3OXL A;  4QEP A;  4GYW A;  1HO8 A;  2A4Z A;  4P29 A;  3Q7F A;  4G11 A;  3WG7 E;  5A23 A;  2ETB A;  3I5P A;  5ARF A;  5CBO A;  3AJI A;  3UIN C;  4QEO A;  3AG1 E;  1HH8 A;  4G26 A;  2RG8 A;  1H2V C;  3IXE A;  1YMP A;  4GTS A;  1O5M A;  2AVP A;  1OWL A;  4KXK B;  2CFZ A;  4XEI G;  3CVU A;  3DEO A;  2FI7 A;  3SQV A;  3AS8 A;  4U07 A;  3CEQ A;  3T5V A;  3LS8 A;  4DK5 A;  4IJ8 A;  5LCW C;  1TJC A;  4HOT A;  4CDN A;  4TRQ A;  3S7D A;  4F3V A;  3M57 A;  2WXF A;  2IFU A;  3CHQ A;  3E30 A;  2V4L A;  3QWV A;  5T0K A;  3FFL A;  5TEG A;  2IF4 A;  2R2L A;  3HXB A;  3KD7 A;  4CGV A;  3ULQ A;  3RKV A;  3L6A A;  1BU9 A;  3TWV A;  4HQD A;  3ASO E;  4GTM A;  4XKC A;  1N3J A;  4JLG A;  1ELR A;  2RFA A;  1MZC A;  1TJF A;  3FWV A;  5F5E A;  1OWO A;  4DI4 A;  1V54 E;  2L6J A;  4AY6 A;  3KMA A;  4MKT A;  1MHQ A;  1HG5 A;  3CQG B;  4AVX A;  1MVH A;  4RZ0 A;  4I43 A;  2WXR A;  3LJ3 A;  4GA1 A;  1KT0 A;  3DXK G;  2FEZ A;  3FTX A;  5ARG A;  4RLY A;  5LOZ A;  3KSL A;  1Y6I A;  1Z3Y A;  2P9L G;  4PUC A;  1TNY A;  4JC8 A;  1H6P A;  4HOQ A;  2H6I A;  1LD7 A;  3HDX A;  2FO7 A;  1UJJ A;  5ENN A;  4I6E A;  1K3Z D;  2AJA A;  4A1S A;  1OT8 A;  1N4S A;  4GA0 A;  4Q96 A;  2VGE A;  3LKU A;  1H6K A;  4LER A;  4U95 D;  2OND A;  3UM3 A;  3LCA A;  3M59 A;  1HXI A;  3JUI A;  4MI0 A;  5AAR A;  3D9H A;  2ZGD A;  3FH7 A;  3ZIM A;  2J08 A;  3FUN A;  2XCB A;  2ZIR A;  1V55 E;  3UXG A;  4EQF A;  3MV3 B;  3SF4 A;  2NSZ A;  4UUC A;  5AJL A;  5AQA A;  4BT8 A;  5E75 A;  3AS5 A;  4BER A;  1S63 A;  3ZW3 A;  3SY2 A;  4NAC A;  3ZYK A;  2J4D A;  3SNX A;  5AYF A;  1E8W A;  3G2U A;  4K5B A;  1E8Z A;  1HZ4 A;  3NQP A;  4U0S A;  3SFZ A;  2Y4U A;  3HXD A;  2OCC E;  2LAH A;  3L9T A;  3DAL A;  1MUF A;  3TWR A;  1BPO A;  3CLJ A;  1BI7 B;  4UWL A;  4FA6 A;  2WXK A;  1FVF A;  2KM4 A;  5KWD A;  4N3A A;  3Q7A A;  3G2W A;  1ZB1 A;  2QYU A;  2V5F A;  2WXM A;  4F7A A;  2O8J A;  4KVO A;  4NUR A;  4XI9 A;  1KZO A;  3FTW A;  1HFA A;  3FEY A;  5FIN A;  2F8Y A;  2IGQ A;  1BLX B;  3UUX A;  3CHS A;  4WWP A;  4J7I A;  4EZL A;  1EPU A;  1TNU A;  1HF8 A;  2AWI A;  1ZU2 A;  3ABM E;  5FIO A;  3SD5 A;  2WXP A;  3CSF A;  4G25 A;  4QQI A;  3JUE A;  3QNK A;  2X38 A;  1A17 A;  4I1A A;  3AAA C;  2IO2 C;  3SW9 A;  3MCX A;  2FBN A;  3S7J A;  4BX9 A;  2C0M A;  4BSX A;  3PE3 A;  2WVI A;  5ANL A;  3AG4 E;  4MI5 A;  3FU3 A;  1N0Q A;  1L5J A;  5EG2 A;  1PEG A;  4V3I A;  5JA4 D;  2DIW A;  2X6I A;  4I2Z A;  3W9F A;  1EYH A;  4ME2 A;  4TXP A;  1OUV A;  3KSQ A;  2LXM A;  4LCT A;  4CT4 A;  4I51 A;  4HBD A;  3Q47 B;  3D3M A;  3JXI A;  4GU5 A;  2QZA A;  3GZ2 A;  3RAU A;  4A3V A;  4H7X A;  3RQ4 A;  3LY9 A;  1X5B A;  2KAT A;  2J49 A;  4K5A B;  2DWZ A;  3V2O A;  3ZYM A;  4F6R D;  1AWC B;  1K1B A;  3D9L A;  1XQH A;  4YPA A;  5A6C A;  3KMJ A;  4DX7 D;  2V8S E;  2XGM A;  2R03 A;  4LSZ E;  2AXV A;  2PZI A;  2CHW A;  4N2Q A;  3I3N A;  4OYS A;  1DNP A;  2G46 A;  5LX8 A;  3NZU A;  4GTQ A;  4GTO A;  1OWM A;  2WXH A;  1IHG A;  3S2A A;  2FF4 A;  4HRM B;  4OVV A;  3T8K A;  4RSY A;  1JCS A;  4UWF A;  4DX1 A;  3MO5 A;  3UI2 A;  4B0Z A;  3NBN B;  1PY1 A;  4AJW A;  4RG9 A;  3ZNG A;  5EIB E;  2JEK A;  2R5S A;  2QFC A;  1HS6 A;  2H6F A;  3PZ3 A;  3FTZ A;  2VGY A;  1E8X A;  2XPY A;  5H7P A;  1N0R A;  4MS6 A;  1ML9 A;  3TAX A;  1RZ4 A;  4O60 A;  3F9W A;  1FCH A;  2HE0 A;  3D9I A;  5BV1 A;  4JDS A;  1TR4 A;  2GRR B;  3ZRH A;  5FQ7 A;  3P2B A;  4HXI A;  3QJZ A;  4PS3 A;  3IBE A;  1Y8M A;  4FLH A;  2BTD A;  5TTF A;  1WG0 A;  1NI1 A;  3PZ1 A;  1OXJ A;  2XEH A;  3EDT B;  5F6K C;  3RO3 A;  3L16 A;  3RU0 A;  3SO8 A;  2VSO E;  3D9N A;  3CGH A;  4M3O A;  4LDG A;  3B95 A;  2QPW A;  2X6J A;  5AN8 A;  4J8Y A;  4WNF A;  1UG3 A;  5F6L A;  5BPP A;  2BQZ A;  4GTT A;  2JV0 A;  4NJ5 A;  2PQR A;  4NRH B;  4U96 D;  3Q15 A;  2VJ8 A;  2LUH A;  3F9Z A;  4NIK A;  3SGH A;  2F37 A;  4J7F A;  3MKR A;  2MOW A;  3CQC B;  5AJD A;  3LXU X;  2V4H C;  2GRN B;  2OEW A;  3ZXP A;  2I6H A;  3EHR A;  3L08 A;  5BV0 A;  4WWO A;  3FUF A;  3UTM A;  1NP7 A;  1MQS A;  3ESK A;  4BES A;  3TWQ A;  3CVN A;  4I6G A;  4U8V D;  3PNT B;  5FQ4 A;  5JHA A;  1XNF A;  3C98 A;  1Q2Z A;  3JQ0 A;  3E37 A;  1MX4 A;  1SW6 A;  2H6H A;  3I4R B;  4D10 C;  4FC8 A;  5AIJ A;  1SQM A;  3Q79 A;  2WMO A;  4B89 A;  4DI3 A;  5FJY A;  4L1B A;  1OCC E;  3SHF A;  1IXV A;  3NOC D;  3W9G A;  3TG5 A;  2RFI A;  3NB2 A;  3IV0 A;  5EIL A;  5CMY A;  1H6O A;  5HKP A;  4GA2 A;  3KMT A;  4FLB A;  2FUL A;  3UMV A;  4JHR A;  3PE4 A;  3QOU A;  4MLP A;  3UT4 A;  3V31 A;  5D0Q D;  4JA9 A;  2XRZ A;  4Z68 A;  2Y0B G;  4DPR A;  2ETC A;  4HOR A;  4UWH A;  4BTB A;  3LVQ E;  3FDH A;  5EYP F;  4FP7 A;  2J09 A;  3QDN A;  2LNI A;  1N4P A;  3F6Q A;  3D9J A;  2OEV A;  3IHX A;  3PVL A;  1DCQ A;  2MHK A;  4HRN A;  2DZO A;  4FJZ A;  5KNG A;  1E8Y A;  1A5E A;  2P58 C;  2RD0 A;  3M55 A;  3ZUV B;  4JEH A;  2R02 A;  3FH5 A;  5FTP A;  4UQZ A;  1DC2 A;  5EX3 A;  4H12 A;  3RK6 A;  1N4R A;  1N6A A;  5FZR A;  4N3C A;  2GRQ B;  3B13 A;  4J8D A;  3DSS A;  3MGB A;  1JCR A;  3QWP A;  3DRA A;  3R7R A;  3TXN A;  4G24 A;  3ZGQ A;  3VLF A;  4GTR A;  4FJY A;  3RRU A;  3PZD A;  3OAW A;  3GZS A;  4FHK A;  4AU7 A;  3M5A A;  1XGW A;  3NZS A;  1Z5S C;  2LAI A;  3ASH A;  1IYG A;  3FTS A;  3LPZ A;  1OCR E;  3KAE A;  3V2X A;  5CEA A;  2BED A;  3GZ1 A;  1WY6 A;  5T8I A;  3IKO B;  3PRE A;  2GGF A;  5IY5 E;  2DCP A;  1FVH A;  4QEN A;  5E76 A;  1G3N B;  4BTA A;  3URZ A;  4UWG A;  2XRY A;  4UQX A;  3PH0 C;  2GRL A;  3QK0 A;  1DCE A;  4Q69 A;  3TJP A;  2JAB A;  4GPM A;  4G23 A;  2I2O A;  3PEV B;  3UM2 A;  3CST A;  3M56 A;  3ZYQ A;  3FTU A;  1INZ A;  4GTV A;  4DLQ A;  4KYO B;  3HIZ A;  3LEW A;  4C9B B;  1S70 B;  5KJM A;  4UWK A;  2L0I A;  3HG0 D;  2W5Y A;  5CRU A;  1ELW A;  3PDN A;  1OWN A;  2MRI A;  3TWT A;  2YQ8 A;  4U0U A;  4N2S A;  5KJL A;  3ULY A;  1E96 B;  4EHM A;  4UI9 C;  3ASN E;  4PS8 A;  3S7F A;  3MYV A;  4KBQ A;  5AAO A;  4LRZ A;  5G04 J;  2OV8 A;  4YPE A;  3KEA A;  3UIO C;  4AV7 A;  2KC7 A;  3D9K A;  3L22 A;  3HHM A;  2FO1 E;  1TN7 A;  3OXF A;  4L9P A;  4U63 A;  4JHJ A;  2WB2 A;  3U4T A;  1D8E A;  3ABL E;  4LUN U;  3F9Y A;  5FZS A;  3ASG A;  4HOU A;  1P5Q A;  3TWX A;  2YHE A;  4BET A;  5CRV A;  4F1S A;  1QNF A;  2BUG A;  1PC2 A;  3FUL A;  2L9B A;  1IQU A;  3EU9 A;  3CK7 A;  3FP3 A;  1S64 A;  3EP0 A;  4ABN A;  5A7D B;  2LSV A;  4WNE A;  4DRX E; 
#chains in the Genus database with same CATH homology
 5JJ7 A;  1YA0 A;  2UWJ G;  3M58 A;  4AXH A;  3WXX A;  5A6C A;  3O48 A;  3KMJ A;  2C0L A;  4KT6 B;  2V8S E;  2XGM A;  3U66 A;  1MT6 A;  4DLQ A;  1ZKK A;  2AXV A;  2PZI A;  4GML A;  2CHW A;  2CHX A;  4ILH B;  4BWR A;  4N2Q A;  3I3N A;  1HG2 A;  1DNP A;  4OYS A;  3Q49 B;  2G46 A;  4BY6 A;  5FWQ A;  2ILR A;  4AEZ C;  5LX8 A;  3NZU A;  3OOI A;  2IOL A;  5ANR A;  3JYS A;  3R7Q A;  5T4Y A;  3ZEF A;  3DB5 A;  3PUJ A;  1OWM A;  3AU5 A;  3FUJ A;  3MEK A;  1HE8 A;  1PAQ A;  2WXH A;  1IHG A;  3L54 A;  3ZHE A;  3FTY A;  4YND A;  5CCM A;  3S2A A;  3G2T A;  2FF4 A;  3QAQ A;  3CBO A;  3CKB A;  1KLX A;  5C1D A;  3PNL B;  3AU4 A;  4OVV A;  3TL5 A;  3FUI A;  4RSY A;  5CHE E;  4UWF A;  2HR2 A;  3MO5 A;  3APF A;  3ZXS A;  2Q7F A;  2X6H A;  4EBA G;  2CG3 A;  4WNG A;  3G2S A;  4MRU A;  3PUK A;  4B0Z A;  4XX5 A;  4L23 A;  5LCW J;  1NA0 A;  1PY1 A;  4Q94 A;  4RG9 A;  4AJW A;  4NVQ A;  5CCL A;  2NXP A;  4J0U A;  2PM6 A;  4E85 A;  3SWC A;  3FHE A;  2JEK A;  4FAD A;  2R5S A;  3RO2 A;  2QFC A;  2VQ2 A;  1SZA A;  1UN8 A;  4HVB A;  2AXZ A;  1HS6 A;  1U3C A;  4AP2 A;  5G04 C;  3LDZ A;  3ZPJ A;  5J90 A;  3CVX A;  3CVP A;  3CKC A;  2VSY A;  3JCK C;  3EHM A;  3FTZ A;  2VGY A;  2XEV A;  1E8X A;  2L0T B;  2XPY A;  3MV2 B;  5BNW A;  4MS6 A;  1ML9 A;  4AOF A;  5JIN A;  3PS6 A;  2VGX B;  3FEX A;  3TAX A;  3CVV A;  3RJW A;  4J6I A;  3F9W A;  1FCH A;  3D9I A;  5BV1 A;  4APO A;  2Y3A A;  4JDS A;  3LVR E;  4AM9 A;  3UT7 A;  2LSU A;  3ZRH A;  2VSX E;  2XGO A;  5FQ7 A;  4YPU A;  3P2B A;  4HXI A;  3QJZ A;  4PS3 A;  3IBE A;  4GZD A;  1Y8M A;  4FLH A;  3APC A;  3LY8 A;  5JHB A;  3I4G A;  1B89 A;  2HO1 A;  4JVS A;  4BUP A;  2BTD A;  4R7L A;  3B7U X;  5TTF A;  2WM9 A;  3ML8 A;  3FU0 A;  5JJT A;  4N3B A;  1U3D A;  2UY1 B;  2XPZ A;  3D9O A;  5FQ8 A;  3FTV A;  3EDT B;  3FU5 A;  3F9X A;  4XI0 A;  5F6K C;  3CV0 A;  3TXM A;  1ELK A;  3RO3 A;  3GW4 A;  4L7T A;  4KZC A;  4N5C A;  4FHJ A;  3L16 A;  4F53 A;  4J83 A;  4ANW A;  2CHZ A;  3GYZ A;  4BX8 A;  3OXL A;  3RU0 A;  3BO5 A;  4QEP A;  4GYW A;  2VSO E;  1HO8 A;  3B7T A;  3D9N A;  4JL0 A;  3CGH A;  2A4Z A;  4M3O A;  4O6F A;  4B8A A;  1MVX A;  4LDG A;  2QPW A;  2X6J A;  4P29 A;  4G11 A;  4L2L A;  4WNF A;  5A23 A;  1UG3 A;  4GZ6 A;  1SZ9 A;  5HQ8 A;  4IJD A;  5F6L A;  2PQN A;  5BPP A;  3CHR A;  3I5P A;  5ARF A;  2I9C A;  5G05 J;  3S7B A;  3SBT B;  2W5Z A;  2BQZ A;  3HYM B;  3VLD A;  4ACL A;  4A55 A;  4B94 A;  2JV0 A;  4NJ5 A;  4QEO A;  3VV0 A;  2BF0 X;  2PQR A;  3IEG A;  1HH8 A;  4EZJ A;  4G26 A;  4MI5 A;  2RG8 A;  4NRH B;  4J8O A;  4HFG A;  1H2V C;  4UQY A;  3KS2 A;  3Q15 A;  3HVE A;  2AVP A;  2VJ8 A;  4PH4 B;  3F9Z A;  1OWL A;  2EQX A;  3SZ7 A;  4KXK B;  4C0M A;  1E7U A;  2CFZ A;  3SGH A;  3CVU A;  3TG4 A;  2FI7 A;  3LY7 A;  4J7F A;  2VTB B;  3AS8 A;  3MKR A;  3OTN A;  2MOW A;  4U07 A;  3FPD A;  3CEQ A;  3LYA A;  4WWN A;  3CQC B;  4DLO A;  2WQ6 A;  4QFV A;  5AJD A;  3CBP A;  3T5V A;  3LS8 A;  3LXU X;  2VSN A;  4DK5 A;  4IJ8 A;  3QC1 A;  4HOS A;  3SBS A;  2WQ7 A;  2Y4T A;  5LCW C;  4JEU A;  1TJC A;  4ANV A;  1N52 A;  2I6H A;  3Q5M A;  4HOT A;  4CDN A;  4BFR A;  3L08 A;  4TRQ A;  2X3M A;  3S7D A;  4F3V A;  3VUZ A;  2CG2 A;  5BV0 A;  3B7S A;  3IHY A;  4U04 A;  2WXO A;  3FUF A;  4WWO A;  3M57 A;  1NP7 A;  2WXF A;  2IFU A;  2M63 A;  3CHQ A;  2R17 C;  1MQS A;  3ESK A;  2V4L A;  3QWV A;  3VTY A;  5T0K A;  4TV3 A;  4K03 A;  3FFL A;  3CVN A;  4I6G A;  5TEG A;  2IF4 A;  3PNT B;  5FQ4 A;  5JHA A;  1XNF A;  3KD7 A;  4J8S A;  4I1O B;  4CCA A;  4CGV A;  1QZ2 A;  3ULQ A;  3RKV A;  3C98 A;  3L6A A;  3T8M A;  1JUQ A;  3M53 A;  4I1M A;  2J4B A;  5LSX A;  2E0I A;  3JQ0 A;  3M54 A;  1UJK A;  3I4R B;  4XKC A;  1N3J A;  4JLG A;  2YNQ A;  2WXI A;  3TGO A;  3ZHE B;  1ELR A;  3CK9 A;  3UT8 A;  1W3B A;  4JXT A;  2KCL A;  4UI9 K;  4D10 C;  1TJF A;  4C1Q A;  4FC8 A;  3FWV A;  5AIJ A;  5JJ6 A;  3CHO A;  5F5E A;  1SQM A;  4A3T A;  1OWO A;  4DI4 A;  2WMO A;  3CVL A;  3O4Z A;  4B89 A;  2L6J A;  4J8F A;  4DI3 A;  5FJY A;  4L1B A;  4AY6 A;  3KMA A;  5CPR B;  4MKT A;  3JQ1 A;  1MHQ A;  1HG5 A;  3SHF A;  3S8P A;  3CQG B;  4RG6 A;  3ZN3 A;  3TG5 A;  3FUE A;  4AVX A;  1MVH A;  2RFI A;  4RZ0 A;  4I43 A;  3ONL A;  2WXR A;  3UQ3 A;  3LJ3 A;  3APD A;  1ZBP A;  3IV0 A;  4GA1 A;  1KT0 A;  4IYP A;  5CMY A;  3CK8 A;  2FEZ A;  4GA2 A;  3FTX A;  4KZ0 A;  5ARG A;  5KCM A;  4XZ4 A;  3KMT A;  2OOE A;  4FLB A;  5LOZ A;  3IHV A;  2FUL A;  4N39 A;  3UMV A;  1Y6I A;  3BEE A;  2KZT B;  3PE4 A;  4JHR A;  4HLE A;  3QOU A;  1Z3Y A;  3QWW A;  3MKQ B;  4MLP A;  4PUC A;  4PDX A;  5FZQ A;  4APF A;  1H2U A;  2A5U A;  2VGX A;  4ILI A;  4JC8 A;  3MJW A;  2I1J A;  4HOQ A;  3UT4 A;  5F59 A;  4XKB A;  5D0Q D;  5G05 C;  2YIN A;  2XQ0 A;  4JA9 A;  3HDX A;  4ANU A;  2FO7 A;  2WQH A;  5CMW A;  1UJJ A;  5DIZ A;  5ENN A;  2XRZ A;  4I6E A;  2IQC A;  5FQ6 A;  4DPR A;  1H2T C;  3T5X A;  4A1S A;  2ION A;  4GYY A;  5EX0 A;  4GA0 A;  4HOR A;  4AY5 A;  4FUL A;  4Q96 A;  4Y6W A;  4UWH A;  3MO2 A;  4BTB A;  4FU3 A;  5D0O D;  4TUU A;  1TEZ A;  3LKU A;  4LEU A;  3ESL A;  3LVQ E;  1H6K A;  1Z3X A;  4A1G A;  3FDH A;  1KT1 A;  3NF1 A;  3EJN A;  2C2L A;  4FP7 A;  4I9C A;  4O30 A;  4B8C B;  4LER A;  2J09 A;  2UY1 A;  2WPV A;  4I9E A;  2F69 A;  2WXN A;  4GPK A;  2OND A;  3K9I A;  3QDN A;  3VLE A;  3LCA A;  2LNI A;  3M59 A;  1HXI A;  1S0P A;  3D9J A;  1E90 A;  1DVP A;  4KVM A;  3JUI A;  4Z4P A;  4MI0 A;  3IHX A;  3PVL A;  3PEU B;  2KCK A;  4CRW A;  3FH7 A;  4K0R A;  4YNM A;  2CFU A;  3ZIM A;  2IJG X;  2MHK A;  4NQ0 A;  3RAY A;  4E6H A;  1JWF A;  2J08 A;  4FJZ A;  1E8Y A;  1QQE A;  3FUN A;  2QY7 A;  2OVB A;  2XCB A;  4C0E A;  2P58 C;  3CVY A;  2RD0 A;  3BG1 B;  1IQR A;  3MV3 B;  1JWG A;  3SF4 A;  4DJA A;  4JEH A;  4EQF A;  3M55 A;  2NSZ A;  2HYZ A;  3FH5 A;  3E4B A;  5FTP A;  4UQZ A;  5EX3 A;  4H12 A;  5AJL A;  1H19 A;  4I6J A;  5AYW D;  4BT8 A;  5E75 A;  4G2V A;  3AS5 A;  3RK6 A;  3CR3 A;  5FT9 A;  2OVF A;  1N6A A;  3CVW A;  3ZW3 A;  5FZR A;  2NC9 A;  4NAC A;  4JZY A;  3ZYK A;  4N3C A;  2J4D A;  2PL2 A;  3B13 A;  3SNX A;  4J8D A;  5AYF A;  1E8W A;  3G2U A;  5T3R A;  4URK A;  2VTB A;  1E8Z A;  4XIF A;  1HZ4 A;  3CVQ A;  5G55 A;  2PM7 A;  3MGB A;  3NQP A;  5EKQ D;  3QWP A;  4YVO A;  3R7R A;  3RRN B;  4U0S A;  3SFZ A;  4G24 A;  2Y4U A;  3QKY A;  3TXN A;  2LAH A;  3ZGQ A;  3VLF A;  3P1U A;  4AIF A;  3DAL A;  4FJY A;  3RRU A;  3PZD A;  1MUF A;  3OAW A;  3ASD A;  1EF1 C;  3SI5 A;  1BPO A;  3GZS A;  4FHK A;  4AU7 A;  2XPI A;  3DPD A;  2R59 A;  4PS7 A;  1XGW A;  3M5A A;  3NZS A;  3UPV A;  4GCO A;  3CLJ A;  2LAI A;  3ASH A;  4UWL A;  4FA6 A;  3RJV A;  1IYG A;  3FTS A;  3LPZ A;  2WXK A;  5JJ0 A;  3KAE A;  4I2W A;  1FVF A;  2E2E A;  2R3A A;  2KM4 A;  3GZ1 A;  1VDY A;  3U9W A;  4CDM A;  4U8H A;  3B7R L;  3Q4A B;  3AS4 A;  4N3A A;  3FUD A;  1WY6 A;  3G2W A;  3L17 A;  4JPS A;  5T8I A;  3IKO B;  5LSZ A;  4U0Z A;  3PRE A;  2V5F A;  2WXM A;  3RIB A;  2GGF A;  4CT0 A;  4F7A A;  4CDR A;  2O8J A;  3CHM A;  5AEN A;  5BUZ A;  2DCP A;  4KVO A;  2XHE A;  1FVH A;  4GCN A;  4NUR A;  4QEN A;  5E76 A;  4Y6C A;  4XI9 A;  2HM8 A;  4BTA A;  3FTW A;  3URZ A;  1HFA A;  1UW4 B;  3FEY A;  1E7V A;  3PRZ A;  4UWG A;  4WUY A;  2XRY A;  2IGQ A;  4IN3 B;  4UQX A;  3PH0 C;  1EDU A;  2GRL A;  3QK0 A;  4EZK A;  4H7Y A;  3UUX A;  5KJK A;  4GAA A;  2WXJ A;  5C2Y A;  5T0M A;  3CHS A;  3FY4 A;  4Q69 A;  1O9S A;  3ML9 A;  4WWP A;  4J7I A;  4GB9 A;  4EZL A;  1GW6 A;  3TJP A;  3CIA A;  4L2Y A;  4G23 A;  3UX4 A;  2I2O A;  1EPU A;  2GRM A;  1HF8 A;  3CST A;  3ONK A;  3PEV B;  5LFA A;  3M56 A;  2AWI A;  1ZU2 A;  3ZYQ A;  4GYO A;  4W9R A;  2KZT A;  1OWP A;  3EIQ C;  3ENE A;  3FTU A;  2LO6 A;  3FH8 A;  3MKQ A;  4GZC A;  1INZ A;  2AW6 A;  2AXU A;  4E47 A;  1Z6T A;  2X6K A;  4YVQ C;  3KEZ A;  4WND A;  3SD5 A;  2WXP A;  3CSF A;  3MA5 A;  1NA3 A;  4G25 A;  4KYO B;  4CEM A;  3HIZ A;  2X6F A;  3LEW A;  2IOS A;  4C9B B;  4ACK A;  5KJM A;  4UWK A;  3DBS A;  3QNK A;  2L0I A;  3OXG A;  2W5Y A;  2X38 A;  3FUK A;  1ELW A;  3FUH A;  3PDN A;  5JIY A;  1OWN A;  2MRI A;  2YQ8 A;  4HS2 A;  4U0U A;  1A17 A;  1H0A A;  2ZU6 B;  4KMO A;  5BW8 C;  3L13 A;  4N2S A;  5KJL A;  1HX8 A;  1E96 B;  4I1A A;  4UI9 C;  3ZVV A;  3CHP A;  3MO0 A;  2WMN A;  4PS8 A;  4FMU A;  3S7F A;  2J07 A;  3MYV A;  3SW9 A;  3EHN A;  3CBM A;  4WAF A;  2KCV A;  3G2V A;  2JLB A;  2FBN A;  3MCX A;  4G1T A;  4IRU A;  3S7J A;  4KBQ A;  5M72 A;  2YHC A;  4BX9 A;  4LRZ A;  2C0M A;  5G04 J;  4EBA A;  5J08 A;  4BSX A;  4ILG A;  3PE3 A;  4JHK A;  2WVI A;  5ANL A;  2OV8 A;  4YPE A;  3R9A B;  4AV7 A;  3HNA A;  2XGS A;  2IU1 A;  2KC7 A;  3D9M A;  3BG0 B;  3D9K A;  3FU3 A;  3HHM A;  3L22 A;  3QAR A;  3ZFW A;  1L5J A;  4YNP A;  2V0P A;  3OXF A;  5EG2 A;  1HU3 A;  4U63 A;  4CGW A;  4RVB A;  1PEG A;  4JHJ A;  2DBA A;  2WB2 A;  4V3I A;  3U4T A;  2DIW A;  2X6I A;  4I2Z A;  2WXG A;  5DBK A;  4OVU A;  5EDS A;  4BT9 A;  1EYH A;  1NZN A;  4LUN U;  3D9P A;  5T5G A;  3F9Y A;  4JW1 A;  4ME2 A;  3VTX A;  1OUV A;  2J9Q A;  5FZS A;  3ASG A;  1UN9 A;  3U3W A;  5BT1 A;  3N71 A;  2I1K A;  4HOU A;  4UI9 J;  1P5Q A;  4LCT A;  4CT4 A;  2YHE A;  4F1S A;  1H3I A;  4I51 A;  1LF8 A;  1QNF A;  3HVE B;  3Q47 B;  2BUG A;  5KJN A;  3D3M A;  5TH7 A;  1PC2 A;  3OS5 A;  1WAO 1;  1WM5 A;  3FUL A;  2WXQ A;  3U64 A;  2L9B A;  4GU5 A;  4GZ5 A;  4EPZ A;  5LP0 A;  3MX3 A;  3ASF A;  3GZ2 A;  1IQU A;  4GZ3 A;  1N54 A;  4A3V A;  4H7X A;  2XCC A;  4XE0 A;  3CK7 A;  3FP3 A;  4EEC A;  3RQ4 A;  3LY9 A;  1X5B A;  3FUM A;  3ZYL A;  2WXL A;  1N6C A;  2KAT A;  5G2N A;  5HI7 A;  2J49 A;  3QB2 A;  3FU6 A;  4J8E A;  4ABN A;  3MZL B;  4GMJ A;  3EP0 A;  3OPE A;  5JHN A;  2VYI A;  5A7D B;  3ZYM A;  3EIJ A;  1JPL A;  4ATG A;  3RRM B;  4ANX A;  4I17 A;  2LSV A;  4WNE A;  3D9L A;  4IUL A;  1XQH A;  4JA7 A;  4YPA A;  2GW1 A;  3K5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...