3QWVA

Crystal structure of histone lysine methyltransferase smyd2 in complex with the cofactor product adohcy
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
430
structure length
430
Chain Sequence
AEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVLGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKYLEFPDHSSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECRECTTKDKDKAKVEVRKLSSPPQAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASMWLKLGRLYMGLENKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of histone and p53 methyltransferase SmyD2 reveal a conformational flexibility of the autoinhibitory C-terminal domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords SET and MYND domain-containing protein 2
total genus 143
structure length 430
sequence length 430
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3qwvA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3qwvA01
5AYWD 3LCAA 4G26A 2VSYA 4YVQC 5DBKA 4KXKB 4N2QA 4Y6CA 4WNDA 3UPVA 5BT1A 3QDNA 4QENA 5T0KA 1N3JA 4N2SA 4E47A 1KT0A 4YNMA 4H12A 3N71A 3MO2A 3KAEA 3CBPA 4BT9A 1ELWA 1YA0A 2LSUA 4UQXA 5FZSA 5D0OD 1NA3A 4I17A 3M56A 3VUZA 3TGOA 3ESKA 3ZHEA 3SW9A 2XGSA 4RG6A 5HI7A 4YNDA 1MVHA 3LKUA 2E2EA 3QWPA 4U0SA 3ZFWA 4IN3B 2W5ZA 1ZU2A 2FEZA 3E4BA 4XIFA 1H3IA 3ZGQA 3ZPJA 4NJ5A 3AS8A 1N6CA 3GZ1A 5DIZA 3U4TA 5KJKA 3HYMB 3BEEA 3PDNA 5JJ7A 3R9AB 3S7BA 5TEGA 3LPZA 4J7IA 5FZRA 3MKRA 3VTYA 3MV2B 3CBOA 2XEVA 3M54A 2LNIA 3MO0A 1HH8A 1QZ2A 2JLBA 5EG2A 2VSNA 4EQFA 3IHXA 3FWVA 2RFIA 3M59A 3RKVA 2VYIA 1N6AA 3CVNA 3ZN3A 4GYWA 5EKQD 4IJ8A 4G23A 5JJ6A 3PE3A 3HNAA 5FZQA 2XGMA 3LY7A 4BTAA 4GZ5A 2NC9A 3TAXA 5LCWC 3CK7A 4GZ6A 4AY6A 5CHEE 4BT8A 4I9CA 4RG9A 4YPUA 2PZIA 4N39A 2Y4UA 2UY1B 1ZKKA 2HO1A 4GZ3A 3RO2A 3IEGA 2F69A 2WPVA 2DBAA 5CCMA 2VQ2A 3ASDA 1HXIA 4AY5A 4GYOA 4BUPA 2VGXA 3F9WA 1ZBPA 3OXFA 2BQZA 5BW8C 3Q47B 2FBNA 3NF1A 2C2LA 4AU7A 4GA0A 4GA2A 4UQYA 4HORA 3AS4A 3EDTB 3OXLA 3CVLA 2UWJG 3FFLA 4N3CA 3OOIA 3CK8A 2XGOA 5BNWA 2C0LA 4GA1A 4ABNA 1TJCA 4G24A 4NRHB 4MI5A 3MO5A 2L6JA 3F9YA 5JJ0A 4U0UA 5TH7A 3QWWA 3K9IA 3FP3A 3CVPA 1PC2A 3TG5A 4YPAA 3SWCA 3CK9A 4GYYA 3WXXA 4GCOA 3F9ZA 5F6KC 5LSXA 2FF4A 3KMTA 2G46A 1B89A 4HOUA 1XNFA 2W5YA 2PL2A 4HOSA 1NA0A 5JHNA 3URZA 4Z4PA 3ASFA 3DALA 1WAO1 4I1AA 5TTFA 2I6HA 4KBQA 4BTBA 5FTPA 5G05J 3DB5A 2FI7A 4O30A 4N3AA 5EX3A 4J8OA 2XPIA 2R3AA 3Q15A 5G05C 3AS5A 4GCNA 2LSVA 5FT9A 3LYAA 2XCCA 5JIYA 4XI9A 4FMUA 2YHCA 5LCWJ 2PQRA 1FCHA 3JYSA 4MI0A 3Q4AB 4IJDA 1KLXA 2R5SA 5EX0A 4J8DA 2KCKA 3S7JA 5T5GA 3RIBA 3VTXA 3CBMA 1QQEA 2KC7A 2P58C 3O48A 2QPWA 2KATA 4HOTA 2GW1A 3OPEA 3M55A 4QEOA 4ME2A 1MUFA 3VV0A 1WM5A 4WNFA 2KCLA 5KJNA 5F5EA 4Y6WA 1P5QA 3KS2A 4NVQA 4G25A 5D0QD 4YNPA 3ZHEB 3SZ7A 4U07A 3LY8A 4XI0A 2XCBA 4J0UA 3UUXA 4JLGA 2YQ8A 5F6LA 4C1QA 2O8JA 3KD7A 4J83A 2IGQA 1A17A 2HYZA 5ARFA 3ULQA 4QEPA 4I2WA 5CPRB 2IFUA 5T0MA 5ARGA 2IF4A 5FJYA 2WQHA 2VGYA 4I51A 3Q5MA 3S8PA 3RU0A 1IHGA 3CEQA 4J7FA 4KYOB 3PE4A 3U3WA 2BUGA 4O6FA 5G04C 4H7XA 3GW4A 4AM9A 3MEKA 1W3BA 2J9QA 1XQHA 5JJTA 3K5KA 4YVOA 3OS5A 4J8FA 4JA7A 4UI9C 4JA9A 3KMJA 3CKCA 1ELRA 5LSZA 3M58A 4N5CA 5C1DA 4N3BA 3F9XA 2FO7A 2UY1A 3QWVA 2Q7FA 2PQNA 4CGVA 4WNGA 4LEUA 1O9SA 4U0ZA 4WUYA 1NZNA 4F3VA 4CDRA 1E96B 3M53A 2VGXB 5KJMA 1MT6A 3LY9A 2HR2A 3RJVA 5A6CA 5AYFA 5KJLA 3QOUA 3CKBA 2ONDA 4JL0A 2KCVA 5F59A 4UI9J 1OUVA 3GZ2A 4G1TA 2V5FA 3BO5A 1KT1A 4GPKA 4I2ZA 3RAYA 2AVPA 2MHKA 3ASGA 4RZ0A 4I9EA 3EP0A 3KMAA 3S7FA 1MVXA 4APOA 4NQ0A 3S7DA 1PEGA 4BWRA 1ML9A 3OXGA 3QKYA 5A7DB 3UQ3A 2OOEA 3CVQA 2C0MA 4G2VA 5G04J 5M72A 5CCLA 5HQ8A 3MV3B 3M57A 3SF4A 4H7YA 4B94A 4W9RA 3CV0A 3MA5A 5JINA 1HZ4A 4UI9K 4AIFA 4HOQA 4A1SA 4CGWA 4U04A 2Y4TA 4J8EA 1Y8MA 3FPDA 4WNEA 3RQ4A 3GYZA 4JDSA 3M5AA 1IYGA 2JV0A 3RJWA 3Q49B 3TG4A 3ASHA 4UQZA 4YPEA 2QFCA 4LDGA 4JHRA 3RO3A
chains in the Genus database with same CATH superfamily
2AWIA 5AYWD 3LCAA 1NL4A 5LP0A 2V4HC 1HO8A 1S64A 3B7TA 4ACKA 1Z3YA 4RSYA 4Y6CA 4JZYA 5BT1A 3QDNA 4FHKA 1KZPA 4CCAA 4E47A 3N71A 1ELWA 3ZYKA 3I4GA 4UQXA 5EIDA 3TWRA 3U64A 2KM4A 3DSSA 2KXPC 4V3IA 3VUZA 3AJIA 3ZU7B 3QARA 2F37A 4U95D 1HX8A 4XEIG 5AJLA 1TJFA 2OVBA 1TNBA 3Q75A 5DIZA 5CMWA 3HYMB 3L17A 1H2TC 3BEEA 1WDYA 2P9KG 4BERA 4L1BA 3ZXPA 4DI3A 5CRUA 2IQCA 3APDA 3M54A 1X81A 4L23A 2LNIA 1HH8A 3CVUA 1OCOE 2M63A 4EQFA 1UN8A 5AQAA 3UKRG 3HVEA 3RKVA 1N6AA 5CRVA 1E8WA 3ZN3A 3QJZA 2BKGA 5LOZA 3PE3A 4D10C 2XGMA 4CEMA 1NI1A 4IRUA 2X6FA 5LCWC 2QYJA 2DYSE 4GU5A 4GZ6A 5J90A 3HDXA 4RG9A 2JABA 4K0RA 2PZIA 3UM0A 1OWPA 1ZKKA 2V4LA 2F69A 2DBAA 5CCMA 2WM9A 2ZGGA 3FUFA 1V54E 4A55A 4TXQA 2FBNA 3B95A 2C2LA 4AU7A 3G2SA 2P9SG 2NSZA 2NYJA 4HORA 3AS4A 2YNQA 1U2VG 3CK8A 5BNWA 2MYOA 4WWPA 3RRMB 3OTNA 3EU9A 4G24A 1FVFA 2VSOE 4FA6A 5JJ0A 3C5RA 4CRWA 2BEDA 5TH7A 4I6JA 1OCZE 5B1AE 5CECB 2GRPB 3CVPA 2E0IA 1E7UA 2WXQA 2HM8A 2XZTG 4RQIA 2FF4A 2G46A 1B89A 3ASNE 4YDEA 5AN8A 5ENSD 3R7QA 3B7UX 3LDZA 3FTSA 4I1AA 4K03A 3TXNA 1JUQA 2L0TB 3NZSA 3IHYA 2FI7A 3W9GA 3PH0C 4U96D 4AJWA 4HXIA 3UI2A 4LNGA 4J8OA 2LXLA 2J07A 3LYAA 4FULA 4JW1A 3BUAA 4FMUA 3DRAA 2YHCA 5E75A 5LCWJ 1N4PA 2IU1A 2FO1E 3FTUA 3UM3A 1N94A 1UW4B 3ZVVA 3FEYA 3O4ZA 2H6GA 1G3NB 3FTYA 3IHVA 2J08A 3DEOA 2EIKE 1K1AA 4XX5A 3I5PA 4DI4A 5CEAA 5AAOA 4HOTA 5ENNA 3TWSA 5EDSA 1OCRE 1WY6A 3HXEA 3ZYQA 4WNFA 5KJNA 4LUNU 4HQDA 3NOCD 3NOGD 3ZNGA 2WXJA 2XPYA 1HF8A 3Q73A 2X3MA 4B8AA 4XI0A 2WXNA 1MJ0A 4JLGA 1OWOA 2IGQA 2RFMA 3SNXA 4GMRA 1LD8A 2Y69E 1UOHA 4JEUA 3KEZA 3ZXSA 3FTXA 3IV0A 4PS7A 2KZTB 3BG0B 5LFAA 3U3WA 2IOSA 2ZISA 3HVEB 2WVIA 3FTZA 4AM9A 1TNUA 3BU8A 3MEKA 1TEZA 4ACLA 4J8FA 5B3SE 4UI9C 3CKCA 3FEXA 5LSZA 4N5CA 1N11A 3GZSA 3F9XA 5ANLA 2YINA 2QYUA 3QWVA 2Q7FA 2V8SE 1MX2A 3RAUA 3MZLB 4GMLA 4F3VA 4AP2A 4JHKA 1AWCB 1MT6A 3V2XA 5KJLA 1N9AA 1XGWA 1JWGA 1OWNA 5F59A 3EUVA 4DUIA 2CFUA 3TWXA 3P2BA 2VGEA 4JC8A 4FU3A 1KT1A 1GW6A 2MOWA 2AVPA 3ONKA 4RZ0A 3ASGA 3C3QA 1INZA 3ISMC 3S7DA 3PREA 4BWRA 1ML9A 3EHQA 3OXGA 3UQ3A 1E8YA 3CLJA 5CCLA 2BTDA 3CHQA 5ENPD 4FJZA 3NB2A 2I2OA 2WXKA 3CV0A 3MA5A 4GPMA 4UI9K 4K5AB 3UX4A 4DX7D 3FTVA 4U04A 4J8EA 3FPDA 2QY7A 3ZW3A 5CEDB 1HG5A 3SI5A 3Q79A 4CDNA 3D3MA 1L5JA 4DX1A 3TWUA 3C3OA 3PEUB 3TG4A 3ASHA 4YPEA 2P9IG 3RO3A 5KNGA 2DIWA 5ENTD 3DSWA 4EZJA 4EECA 3OAWA 3PZ3A 3EU5A 2X38A 4PH4B 4MKTA 4I6GA 4N2QA 3CHPA 4WNDA 1UJJA 4E85A 3DEPA 2GRRB 1K1BA 1BLXB 5LX8A 5T0KA 4QENA 2X6IA 3L08A 1N3JA 1D9SA 4H12A 3MO2A 4GTRA 3CBPA 4UWHA 5KCMA 2LSUA 1A5EA 1RW2A 1EPUA 3PZ4A 3FH8A 3ZUVB 4A1GA 1NA3A 4I17A 3ENEA 4LRZA 4ANVA 4HVBA 2EQXA 1O1SA 3DSVA 1YYHA 3ESKA 3ZHEA 3DPYA 2B0OE 4LNBA 4RG6A 2CG2A 4YNDA 4U0SA 2W5ZA 4I1OB 3PVLA 1H3IA 3FHEA 3AS8A 3LS8A 3GZ1A 3U4TA 3B7BA 3PDNA 5AQ9A 1N54A 3W9FA 3S7BA 5CMYA 3LPZA 2EIJE 3MKRA 3SD5A 4ZHBA 4APFA 3UIOC 1NFIE 2ZGDA 4M3OA 2XEVA 4DLOA 5BV0A 3MO0A 2KZTA 5FIOA 2JLBA 5EG2A 3PNTB 2A4ZA 3M59A 1EDUA 3CSFA 3EHRA 4LERA 4TRQA 3L6AA 4G23A 5JJ6A 5BXOA 3SFXA 1FVHA 4L7TA 3FTWA 4O1OA 2GRLA 2NC9A 1UN9A 4AY6A 1TN6A 2HO1A 4GZ3A 4JVSA 2CHWA 3IEGA 3T5XA 1SQMA 2XEEA 3QAQA 1O1TA 5AQ7A 4GYOA 1IKND 4BUPA 1TNZA 3F9WA 2H6FA 2EIME 3LJNA 3D9PA 3D9OA 3EHNA 1PAQA 5KNHD 2CHZA 3EDTB 3OXLA 3FFLA 4N3CA 3OOIA 2OV8A 2XGOA 4NURA 2C0LA 4GA1A 4X8QA 3FH7A 3PZ1A 1TJCA 3MO5A 2L6JA 4U0UA 3QWWA 3K9IA 2V0PA 5EIBE 3WG7E 1PC2A 4HNAD 4YPAA 3TWQA 2LAIA 4GCOA 2PM7A 3KSLA 3VLDA 5H7PA 1EYHA 4HOUA 3HHMA 3Q78A 5JMND 1NA0A 1Z3XA 4YDOA 4HI9A 3ASFA 3D9IA 5TTFA 2I6HA 3HXCA 2R17C 3T5VA 4Q96A 3EIJA 3FULA 3S2AA 3DB5A 1ZB1A 3L16A 5AJDA 5FT9A 2XCCA 1WG0A 3CHSA 2GRQB 5JHBA 5JIYA 4GTOA 4TXRA 4XI9A 3V2OA 3E32A 2AW6A 2PQRA 2R59A 5J08A 3L82A 3D9HA 4F1SA 4MI0A 3ABKE 4TV3A 4IJDA 4J7WA 1KLXA 1MHQA 3I3NA 3KSQA 4F7AA 5HS0A 2DWZA 2KC7A 5G55A 3O48A 2QPWA 2KATA 5CERB 3M55A 3ESLA 2J49A 2AJAA 2KCLA 3CVYA 4U8YD 4YNPA 3ZHEB 3LY8A 3SBTB 4FHJA 4F6RD 3Q7FA 1BU9A 4KZCA 3AU5A 2O8JA 3DBSA 4U63A 4LG6A 3LVRE 4UWGA 3RSEG 2HYZA 2WXOA 5CPRB 3LVQE 2XENA 2IFUA 2ETBA 2FULA 2IF4A 3ONLA 2RG8A 5BXUA 3E34A 1H6PA 3UM2A 1IHGA 1SZAA 2XPZA 5ENQD 3TL5A 4UUCA 3J5PA 2LUHA 3G2WA 4O6FA 5G04C 2IOLA 1XQHA 3K5KA 4YVOA 1MQSA 3C3RA 3G2VA 5D2MC 4JA9A 3D9MA 3U9WA 4CT0A 1PY1A 4C9BB 3KMJA 4JB8P 3M58A 5C1DA 1H6OA 2FO7A 4OAUC 1BI8B 5FQ7A 4HRLA 4WNGA 4YDWA 3UTMA 3M53A 2VGXB 1JCSA 3FUHA 3BG1B 3QOUA 2YHEA 3PUKA 4AXHA 4FP7A 4UI9J 3GZ2A 4TUUA 3J5QB 4GPKA 4I2ZA 3CSTA 2MHKA 2HE0A 3EP0A 3S7FA 4CT4A 2IY0C 4NQ0A 2JEKA 3ULEG 5ANRA 1QNFA 2C0MA 4G2VA 4U8VD 4BEPA 1MYOA 4K5BA 1DVPA 1SVXA 4H7YA 5JINA 4AIFA 2Y4TA 4JHJA 1Y8MA 5ITZF 3ML9A 4DK5A 3TWTA 3GYZA 2ZU6B 4EBAG 5HRYA 4JDSA 4HS2A 3E33A 2R2LA 4BY6A 1UG3A 3AG1E 4BSXA 2QFCA 3UIPC 3HG0D 3UM1A 4B93B 4G26A 2VSYA 1TN8A 5A23A 2WXFA 1U3DA 4YVQC 5DBKA 3QB2A 4KXKB 3UPVA 2ETCA 4P29A 3JXIA 4B0ZA 4PS3A 3FUDA 2VTBA 4DRXE 1KT0A 4YNMA 1TYQG 3KAEA 4BT9A 2X6HA 1YA0A 3T8KA 2XEHA 5FZSA 2I1JA 3FUMA 4GTQA 2GRMA 3FUKA 2J09A 1KZOA 3TGOA 3FY4A 4KVOA 4HFGA 2XGSA 1MVHA 3LKUA 1UJKA 3ZFWA 2AXUA 3E4BA 3SQVA 5IY5E 3ZPJA 4NJ5A 2XS1A 1N6CA 3APCA 5KJKA 1YMPA 3ASOE 4J7IA 4QQIA 1Q2ZA 3MV2B 3CBOA 3DSTA 2P9PG 3G2TA 5FINA 1H2VC 3MYVA 1Z5SC 3FWVA 2RFIA 5CBOA 2VYIA 3CVNA 2XQ0A 4GYWA 5EKQD 4C0EA 4IJ8A 4F1PA 3DSXA 1FPPA 2CFZA 5FZQA 4ILGA 1TR4A 3DWLG 2B6CA 3IBEA 4I9CA 1LF8A 4ATGA 4YPUA 4LSZE 4M7CA 1BI7B 1K8KG 1DNPA 2XRYA 1HXIA 4AY5A 1E8ZA 2P9UG 3CHRA 2VGXA 1ZBPA 1H2UA 4ANWA 2J8SD 2L6BA 3Q9UC 1OCCE 3JUIA 3VLFA 3Q7AA 3C72A 2RKKA 4ILHB 3UMVA 4GA2A 2IONA 3LJ3A 3CVLA 2UWJG 4HI8A 3IXEA 2WQ7A 4ABNA 4Q94A 4NRHB 4MI5A 3Q9NC 1N0RA 5CBNA 5FQ4A 1E8XA 3WXXA 3AU4A 3QC1A 3SBSA 5LSXA 4XKCA 3NBNB 4R7LA 3KMTA 2W5YA 4ATZD 2PL2A 5AIJA 1BPOA 3MJWA 5JHNA 1N52A 5EILA 4PUCA 4J8SA 3DALA 4B89A 1WAO1 4BTBA 1N4RA 1QBQA 4DX5D 5G05J 4CZ2D 5EX3A 4EHMA 2R3AA 3AS5A 4BX9A 1HE8A 2LSVA 1IHBA 3CIAA 3AAAC 3BQOA 2Y3AA 2OEVA 1KPSB 1MX4A 1H19A 2P9NG 4UWKA 3JYSA 1N4SA 2R5SA 2KCKA 3S7JA 3RIBA 2VTBB 3VTXA 4GTSA 3CBMA 2LXMA 3R9MA 2P58C 3JUEA 3CVVA 5BPPA 2EILE 2L0IA 4ME2A 5FWQA 4GTPA 2R05A 5F5EA 2ZXWE 4NACA 3PS6A 4NVQA 4G25A 5D0QD 2WXIA 1JPLA 1MZCA 5T8IA 4U07A 4HBDA 3MGBA 3IKOB 1IQUA 2I9CA 2XCBA 4J8YA 2Y1LE 1N95A 2DZOA 5AARA 3KD7A 4OVVA 4J83A 2WB2A 3ULQA 2XZDG 4QEPA 4UWLA 4I2WA 4WWNA 5T0MA 2F0YA 2VSXE 3D9JA 3HRAA 5FJYA 4C48B 2VGYA 4I51A 4GTMA 4OYSA 3RU0A 5T3RA 3ZRHA 2CG3A 3ML8A 3HXBA 3CR3A 4GTVA 2BUGA 3HIZA 2BF0X 4H7XA 4G11A 3GW4A 1W3BA 2J9QA 5JJTA 3OS5A 4FADA 4JA7A 2XRZA 1IQRA 4TXPA 4ZFHA 1ELRA 3QNKA 2V5QC 5KBAA 2VJ8A 2UY1A 3LEWA 2PQNA 4A3VA 1O9SA 3T9KA 4WUYA 4MBGA 4CDRA 1E96B 4KT6B 5KJMA 3PNLB 3V31A 3RJVA 3UKUG 3TXMA 2IO3C 4FJYA 2WXLA 3FDHA 4JD2G 3D9KA 2KCVA 3FU5A 1OUVA 4JXTA 3BO5A 5ENOD 2P2CP 3RAYA 2WXHA 3TWVA 1S0PA 4XKBA 1MVXA 4APOA 2OOEA 3C98A 3CVQA 3U66A 2QC9A 3DSUA 4BESA 4CYMD 1LD7A 3VLEA 3CVXA 1DC2A 3MV3B 4MRUA 3TWWA 3SF4A 4W9RA 1OT8A 1HZ4A 2Y0BG 1HU3A 1HFAA 1HG2A 1JWFA 4A1SA 4CGWA 1TNYA 4G8LA 2J4DA 4WNEA 2EINE 2RD0A 2F8YA 4HLLA 1QYMA 4EBAA 4O60A 3M5AA 1IYGA 5EYLA 2IJGX 3NQPA 4LDGA 3JCKC 4N5QA 3PZ2A 4NIKA 5ENRD 4PS8A 4I1MA 1SZ9A 4E6HA 4HRMB 5T4YA 2QZAA 4JEHA 2WXRA 4Q69A 3TJPA 4N2SA 4K5CA 4ANUA 5HKPA 3PEVB 5BUZA 2BKKB 2AXZA 3CQCB 4PDXA 2X6KA 5D0OD 3ZIMA 3M56A 2RFAA 4U7EB 3MKQB 1AP7A 4I43A 3SW9A 4WAFA 5HI7A 4DJAA 2E2EA 3QWPA 4IN3B 1ZU2A 3HXDA 3SY2A 3CHOA 4KZ0A 1N4QA 2FEZA 4XIFA 3ZGQA 4OVUA 4DPRA 4BFRA 3FH5A 3JXJA 3PZDA 5E76A 3PUJA 5JJ7A 3R9AB 3UXGA 3FU0A 3UT4A 3L22A 3T8MA 4B8CB 5TEGA 3RK6A 2OVFA 4FLHA 5FZRA 3VTYA 1JCRA 4AV7A 1QZ2A 4DX2A 3QK0A 2VSNA 3KEAA 3IHXA 4LNUD 4AEZC 3G2UA 3HNAA 3JQ0A 3LY7A 1VDYA 4BTAA 3DPDA 4GZ5A 1DCEA 3TAXA 3CK7A 5B1BE 5FQ6A 5CHEE 2WXMA 4BT8A 3SHFA 1BD8A 1SA5A 4N39A 2Y4UA 2UY1B 3RO2A 4AOFA 2ZIRA 3FUIA 2WPVA 1E90A 2VQ2A 3ASDA 3F6QA 2CHXA 3L54A 4JPSA 1MX6A 3CQGB 3OXFA 2BQZA 5BW8C 3Q47B 3X2QE 3NF1A 2ILRA 4A3TA 3EHMA 4GA0A 3NAWA 4UQYA 2MRIA 4MS6A 1OWMA 3AG3E 3F9YA 4IYPA 1TN7A 2ETAA 2WXPA 4DX6D 3FP3A 5AQBA 1OWLA 3TG5A 1RZ4A 3SWCA 4HLEA 3CK9A 4GYYA 3SGHA 3F9ZA 5F6KC 3B7SA 5EYPF 5AENA 4QFVA 3P1UA 4J6IA 3RRUA 1XNFA 4HOSA 2IO2C 3URZA 1IXVA 2XS8A 3ZYLA 4Z4PA 4HB5A 2DYRE 3SFZA 4U8HA 4KBQA 4XE0A 3UT7A 4O1PA 5FTPA 2R02A 2XHEA 3ZEFA 4F53A 1O1RA 4O30A 3FUNA 4N3AA 5JHAA 4EZLA 2XPIA 4EZKA 3Q15A 5G05C 4GCNA 5D66A 2L9BA 3CVWA 2GRNB 4GMJA 5G2NA 2OCCE 4L2YA 1FCHA 1S70B 2H6HA 3Q4AB 4WWOA 5EX0A 4J8DA 5T5GA 3L13A 3APFA 3LXUX 4XZ4A 1QQEA 4TUMA 3FUJA 1V55E 2GW1A 1D8DA 3OPEA 5C2YA 1ELKA 4QEOA 1MUFA 1U3CA 3VV0A 1WM5A 4ILIA 2J4BA 4ANXA 3B13A 4Y6WA 1OY3D 1P5QA 4RLYA 3KS2A 3MKQA 1TNOA 3SZ7A 2GGFA 1OXJA 3DXKG 3PRZA 4EPZA 4GB9A 3EIQC 4J0UA 4Z68A 3UUXA 2YQ8A 5F6LA 4C1QA 1SA4A 4C0MA 2WMNA 1A17A 5ARFA 4BETA 1H6KA 3V79K 2DCPA 2GROB 1FT1A 4AVXA 3FU3A 5ARGA 1S63A 1SW6A 2WQHA 4RVBA 4URKA 3Q5MA 3S8PA 3CHMA 3AG4E 2LAHA 3CEQA 4J7FA 4KYOB 3HXFA 4G8KA 3ZYMA 1HS6A 3PE4A 5BV1A 3MCXA 4LCTA 4CDMA 3ABLE 3RRNB 2WMOA 1Z6TA 2NXPA 2DVWA 5KWDA 4MLPA 3UINC 1DCQA 3ULYA 3EJNA 4N3BA 1Y6IA 2PNNA 4CGVA 3D9NA 3R7RA 4LEUA 4U0ZA 1NZNA 2R03A 4I6EA 2LO6A 2A5EA 2X6JA 3LY9A 2HR2A 4GTTA 4L2LA 5A6CA 4YDYA 5JA4D 4L9PA 5AYFA 2I1KA 2DZNA 2A5UA 3CKBA 1JCQA 2ONDA 1FT2A 2WQ6A 4JL0A 4GAAA 4KVMA 3AG2E 3MX3A 3D9LA 4IULA 4G1TA 2V5FA 1N0QA 4FC8A 2IEJA 1K3ZD 4GZDA 3FU6A 5FQ8A 1EF1C 4I9EA 3KMAA 1PEGA 3UT8A 3DXMG 3V30A 1E7VA 3ABME 2KBXA 3JQ1A 4HRNA 3QKYA 5A7DB 3SO8A 1O5MA 5M72A 5G04J 1LTXA 3NZUA 3ZKJA 5HQ8A 3SFYA 1X5BA 2F8XK 4GZCA 2OEWA 3FUEA 2AXVA 3M57A 4B94A 4OAVB 3B7RL 4DLQA 4FLBA 2P9LG 4UWFA 1NP7A 4HOQA 3L9TA 3E37A 3CGHA 3E30A 2H6IA 4BX8A 3RQ4A 4KMOA 2JV0A 3RJWA 4BSZB 3Q49B 2WXGA 3I4RB 1D8EA 4UQZA 5EN5D 1YCSB 4JHRA 4A63B 2PM6A 1H0AA
chains in the Genus database with same CATH topology
2AWIA 5AYWD 3LCAA 2DIWA 4G26A 2VSYA 5A23A 2WXFA 5LP0A 4PS8A 1U3DA 3B7TA 1HO8A 4I1MA 4ACKA 4EZJA 4EECA 3OAWA 1Z3YA 4YVQC 1SZ9A 4E6HA 2X38A 5DBKA 3QB2A 4PH4B 4KXKB 4I6GA 4MKTA 4N2QA 4RSYA 4Y6CA 5T4YA 3CHPA 4WNDA 3UPVA 1UJJA 2WXRA 4JEHA 4JZYA 4E85A 4Q69A 5BT1A 4P29A 3QDNA 4B0ZA 5LX8A 5T0KA 4QENA 2X6IA 3L08A 4FHKA 4PS3A 3FUDA 3TJPA 4N2SA 4CCAA 2VTBA 1N3JA 4E47A 1KT0A 4YNMA 4H12A 3N71A 4ANUA 3MO2A 3KAEA 3CBPA 4BT9A 1ELWA 2X6HA 3PEVB 1YA0A 5BUZA 3ZYKA 4UWHA 5KCMA 2LSUA 3I4GA 4UQXA 5FZSA 2AXZA 3CQCB 1EPUA 3U64A 4PDXA 2I1JA 3FH8A 2X6KA 5D0OD 4A1GA 3ZIMA 2KM4A 1NA3A 3FUMA 4I17A 3ENEA 2GRMA 4LRZA 4ANVA 4HVBA 3M56A 2EQXA 3FUKA 4V3IA 2J09A 3VUZA 3TGOA 3MKQB 3QARA 4I43A 3ESKA 3ZHEA 3SW9A 3FY4A 4KVOA 4HFGA 2XGSA 4RG6A 4WAFA 2CG2A 5HI7A 4YNDA 4DJAA 1MVHA 3LKUA 2E2EA 1UJKA 1HX8A 3QWPA 4U0SA 3ZFWA 5AJLA 1TJFA 2OVBA 4IN3B 2W5ZA 1ZU2A 3CHOA 4I1OB 4KZ0A 2AXUA 2FEZA 3E4BA 3PVLA 4XIFA 1H3IA 3ZGQA 3ZPJA 3FHEA 4OVUA 4NJ5A 4DPRA 3AS8A 3LS8A 1N6CA 3GZ1A 5DIZA 4BFRA 3U4TA 3FH5A 3APCA 3PZDA 5KJKA 5E76A 3HYMB 3L17A 5CMWA 1H2TC 3PUJA 3BEEA 3PDNA 5JJ7A 1N54A 3R9AB 3S7BA 3FU0A 3UT4A 3L22A 3T8MA 4B8CB 5TEGA 5CMYA 3RK6A 3LPZA 2OVFA 4L1BA 4FLHA 4J7IA 5FZRA 4DI3A 3MKRA 3SD5A 3VTYA 3MV2B 4APFA 3CBOA 4M3OA 2XEVA 2IQCA 3APDA 3M54A 4DLOA 4L23A 4AV7A 2LNIA 3G2TA 5BV0A 3MO0A 1HH8A 1QZ2A 2KZTA 3CVUA 2JLBA 5EG2A 3PNTB 3QK0A 2A4ZA 2VSNA 2M63A 4EQFA 1H2VC 3MYVA 3IHXA 1UN8A 3FWVA 2RFIA 3M59A 3HVEA 1EDUA 3RKVA 3CSFA 2VYIA 1N6AA 3CVNA 1E8WA 3ZN3A 2XQ0A 3QJZA 4GYWA 4LERA 4TRQA 5EKQD 4C0EA 4IJ8A 3L6AA 4AEZC 4G23A 5JJ6A 5LOZA 1FVHA 3G2UA 3PE3A 4L7TA 2CFZA 3FTWA 5FZQA 3HNAA 4ILGA 4D10C 2XGMA 3JQ0A 1VDYA 3LY7A 4BTAA 4CEMA 2GRLA 3DPDA 4GZ5A 2NC9A 4IRUA 3TAXA 3CK7A 2X6FA 1UN9A 5LCWC 4GZ6A 4GU5A 5J90A 5FQ6A 4AY6A 3IBEA 3HDXA 2WXMA 5CHEE 4BT8A 4I9CA 4RG9A 3SHFA 1LF8A 4ATGA 4YPUA 4K0RA 2PZIA 4N39A 1OWPA 2Y4UA 2UY1B 1ZKKA 2HO1A 4GZ3A 4JVSA 3RO2A 2CHWA 3IEGA 3T5XA 2V4LA 3FUIA 4AOFA 2F69A 1SQMA 2WPVA 1E90A 2DBAA 3QAQA 1DNPA 2VQ2A 3ASDA 5CCMA 2XRYA 1HXIA 2WM9A 4AY5A 4GYOA 1E8ZA 2CHXA 3L54A 4BUPA 4JPSA 3CHRA 2VGXA 3FUFA 3F9WA 1ZBPA 3CQGB 1H2UA 4ANWA 3OXFA 2BQZA 5BW8C 3Q47B 4A55A 2FBNA 3D9PA 3JUIA 3NF1A 3VLFA 3D9OA 3EHNA 2C2LA 2ILRA 1PAQA 4AU7A 3G2SA 4ILHB 3UMVA 3EHMA 2IONA 2NSZA 4GA0A 4GA2A 4A3TA 2CHZA 4UQYA 4HORA 2MRIA 3AS4A 3EDTB 3LJ3A 2YNQA 3OXLA 3CVLA 2UWJG 3FFLA 4N3CA 3OOIA 2OV8A 3CK8A 2WQ7A 2XGOA 4NURA 5BNWA 2C0LA 4GA1A 4MS6A 1OWMA 3FH7A 4WWPA 4ABNA 3RRMB 4Q94A 3OTNA 1TJCA 4G24A 4NRHB 1FVFA 3MO5A 4MI5A 2VSOE 4FA6A 2L6JA 3F9YA 5JJ0A 4CRWA 4IYPA 5FQ4A 4U0UA 5TH7A 3QWWA 2WXPA 2V0PA 3K9IA 4I6JA 3FP3A 1OWLA 1E8XA 3CVPA 1PC2A 2E0IA 3TG5A 4YPAA 3SWCA 4HLEA 3CK9A 1E7UA 4GYYA 3SGHA 2LAIA 2WXQA 3WXXA 4GCOA 3AU4A 3QC1A 3F9ZA 2PM7A 3SBSA 5F6KC 5LSXA 3B7SA 5AENA 2HM8A 4QFVA 4XKCA 2FF4A 4R7LA 3KMTA 3P1UA 3VLDA 2G46A 1B89A 4J6IA 1EYHA 3RRUA 4HOUA 1XNFA 2W5YA 3HHMA 2PL2A 5AIJA 1BPOA 3MJWA 4HOSA 1NA0A 5JHNA 3R7QA 3B7UX 1Z3XA 3URZA 1N52A 3LDZA 4PUCA 3FTSA 4J8SA 3ASFA 3D9IA 3ZYLA 4B89A 1WAO1 4I1AA 3DALA 2I6HA 5TTFA 3SFZA 4K03A 2R17C 4U8HA 1JUQA 4KBQA 3TXNA 3T5VA 4XE0A 3UT7A 2L0TB 4Q96A 4BTBA 3EIJA 3FULA 5FTPA 5G05J 3NZSA 3S2AA 3IHYA 3DB5A 2XHEA 2FI7A 3PH0C 3ZEFA 4F53A 4AJWA 3FUNA 4HXIA 4N3AA 5EX3A 4O30A 5JHAA 4J8OA 4EZLA 3L16A 2XPIA 2R3AA 2J07A 4EZKA 3Q15A 5G05C 3AS5A 4GCNA 4BX9A 1HE8A 2LSVA 5AJDA 5FT9A 3LYAA 4FULA 4JW1A 2L9BA 2XCCA 3CVWA 3CHSA 3CIAA 2Y3AA 5JHBA 5JIYA 4XI9A 4FMUA 4GMJA 1H19A 2YHCA 5E75A 5G2NA 4UWKA 2AW6A 2PQRA 2IU1A 2R59A 5J08A 5LCWJ 4L2YA 3FTUA 1FCHA 1UW4B 3JYSA 3FEYA 3ZVVA 4F1SA 3O4ZA 4MI0A 3Q4AB 4TV3A 4IJDA 4WWOA 1KLXA 2R5SA 3FTYA 5EX0A 4J8DA 1MHQA 3IHVA 2J08A 2KCKA 3I3NA 3S7JA 5T5GA 3RIBA 4F7AA 2VTBB 3L13A 3VTXA 3APFA 3I5PA 3LXUX 4XX5A 4XZ4A 3CBMA 1QQEA 4DI4A 2KC7A 2P58C 5G55A 3O48A 3FUJA 2QPWA 2KATA 4HOTA 2GW1A 5ENNA 5EDSA 3OPEA 3CVVA 5C2YA 1ELKA 3ESLA 5BPPA 3M55A 4QEOA 2L0IA 4ME2A 1MUFA 1WY6A 1U3CA 5FWQA 3VV0A 2J49A 3ZYQA 1WM5A 4ILIA 4WNFA 2KCLA 5KJNA 4LUNU 2J4BA 4ANXA 3B13A 3CVYA 5F5EA 4Y6WA 1P5QA 4NACA 3PS6A 3KS2A 3MKQA 2WXJA 4G25A 5D0QD 4NVQA 4YNPA 2WXIA 3ZHEB 1JPLA 2XPYA 5T8IA 1HF8A 3SZ7A 2GGFA 4U07A 2X3MA 3LY8A 3SBTB 3PRZA 4EPZA 4B8AA 4GB9A 3MGBA 4XI0A 3IKOB 4FHJA 1IQUA 2I9CA 2XCBA 2WXNA 3EIQC 4KZCA 3AU5A 4J0UA 3UUXA 4JLGA 2YQ8A 5F6LA 4C1QA 2O8JA 3DBSA 1OWOA 3KD7A 4OVVA 4U63A 3LVRE 4UWGA 4C0MA 2IGQA 2WMNA 4J83A 1A17A 2WB2A 2HYZA 5ARFA 3SNXA 3ULQA 1H6KA 2WXOA 4QEPA 4UWLA 4I2WA 5CPRB 2DCPA 3LVQE 2IFUA 4WWNA 4JEUA 4AVXA 5T0MA 3KEZA 3FU3A 3ZXSA 5ARGA 2FULA 2VSXE 2IF4A 3D9JA 3FTXA 3ONLA 5FJYA 2WQHA 2RG8A 4RVBA 3IV0A 2VGYA 4I51A 4PS7A 4URKA 3Q5MA 4OYSA 3S8PA 3RU0A 3CHMA 5T3RA 3ZRHA 2CG3A 1IHGA 1SZAA 2KZTB 2XPZA 2LAHA 3CEQA 4J7FA 4KYOB 3ML8A 3TL5A 3BG0B 3ZYMA 3CR3A 1HS6A 5LFAA 3PE4A 3U3WA 2IOSA 3G2WA 2BUGA 3HVEB 2WVIA 3HIZA 4O6FA 2BF0X 5G04C 4H7XA 5BV1A 3MCXA 3FTZA 4LCTA 2IOLA 4G11A 3GW4A 4AM9A 4CDMA 3MEKA 1W3BA 2J9QA 4ACLA 3RRNB 5JJTA 2WMOA 4YVOA 1TEZA 1XQHA 3K5KA 1MQSA 4J8FA 4FADA 3OS5A 1Z6TA 3G2VA 4JA7A 4UI9C 2XRZA 2NXPA 4JA9A 1IQRA 4MLPA 3D9MA 3U9WA 4CT0A 1PY1A 4C9BB 3KMJA 3CKCA 3FEXA 1ELRA 3QNKA 5LSZA 3M58A 3EJNA 4N5CA 3GZSA 5C1DA 4N3BA 3F9XA 5ANLA 2YINA 2FO7A 1Y6IA 2VJ8A 2UY1A 3QWVA 3LEWA 2Q7FA 5FQ7A 2PQNA 4CGVA 4A3VA 3D9NA 4WNGA 2V8SE 4LEUA 3R7RA 1O9SA 4U0ZA 3MZLB 1NZNA 4GMLA 4WUYA 4AP2A 4CDRA 4F3VA 1E96B 4JHKA 3M53A 4I6EA 2VGXB 2LO6A 4KT6B 4Z4PA 5KJMA 2X6JA 1MT6A 3LY9A 2HR2A 3PNLB 4L2LA 3RJVA 5A6CA 5AYFA 3FUHA 3BG1B 2I1KA 5KJLA 2A5UA 3QOUA 3CKBA 2ONDA 3TXMA 2WQ6A 2YHEA 2WXLA 4FJYA 3PUKA 4JL0A 3FDHA 4AXHA 1XGWA 1JWGA 3D9KA 4FP7A 4GAAA 4KVMA 1OWNA 2KCVA 3MX3A 5F59A 3FU5A 4UI9J 3D9LA 1OUVA 2CFUA 3GZ2A 4TUUA 4IULA 4JXTA 3P2BA 4G1TA 2V5FA 4FC8A 3BO5A 4JC8A 4FU3A 1KT1A 4GPKA 4I2ZA 4GZDA 1GW6A 3FU6A 3CSTA 2MOWA 3RAYA 2AVPA 3ONKA 2WXHA 5FQ8A 2MHKA 3ASGA 4RZ0A 1EF1C 1S0PA 4I9EA 4XKBA 3EP0A 3KMAA 3S7FA 1MVXA 4APOA 1INZA 4CT4A 4NQ0A 3PREA 3S7DA 3UT8A 1PEGA 4BWRA 2JEKA 5ANRA 1E7VA 1ML9A 3OXGA 3JQ1A 3QKYA 5A7DB 3UQ3A 2OOEA 3C98A 3CVQA 3U66A 1E8YA 1QNFA 2C0MA 4G2VA 3CLJA 5G04J 5M72A 5CCLA 3NZUA 2BTDA 3CHQA 5HQ8A 3VLEA 3CVXA 1X5BA 3MV3B 4GZCA 4FJZA 4MRUA 3FUEA 1DVPA 2AXVA 3M57A 2I2OA 3SF4A 2WXKA 4H7YA 4B94A 4W9RA 3CV0A 3MA5A 5JINA 3B7RL 4DLQA 4FLBA 1HZ4A 4UI9K 1HU3A 1HFAA 1NP7A 4UWFA 4AIFA 4HOQA 1HG2A 1JWFA 3UX4A 4A1SA 3CGHA 3FTVA 4CGWA 4U04A 2Y4TA 4JHJA 2J4DA 4J8EA 1Y8MA 3FPDA 2QY7A 3ZW3A 3ML9A 4WNEA 4DK5A 2RD0A 1HG5A 3SI5A 4BX8A 3RQ4A 4KMOA 3GYZA 2ZU6B 4EBAG 4EBAA 4CDNA 4JDSA 4HS2A 3M5AA 1IYGA 2JV0A 3D3MA 1L5JA 2IJGX 3RJWA 3NQPA 4BY6A 3Q49B 1UG3A 2WXGA 3I4RB 3PEUB 4BSXA 3TG4A 3ASHA 4UQZA 4YPEA 2QFCA 4LDGA 4JHRA 3RO3A 3JCKC 2PM6A 1H0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AYW D;  3LCA A;  4G26 A;  2VSY A;  4YVQ C;  5DBK A;  4KXK B;  4N2Q A;  4Y6C A;  4WND A;  3UPV A;  5BT1 A;  3QDN A;  4QEN A;  5T0K A;  1N3J A;  4N2S A;  4E47 A;  1KT0 A;  4YNM A;  4H12 A;  3N71 A;  3MO2 A;  3KAE A;  3CBP A;  4BT9 A;  1ELW A;  1YA0 A;  2LSU A;  4UQX A;  5FZS A;  5D0O D;  1NA3 A;  4I17 A;  3M56 A;  3VUZ A;  3TGO A;  3ESK A;  3ZHE A;  3SW9 A;  2XGS A;  4RG6 A;  5HI7 A;  4YND A;  1MVH A;  3LKU A;  2E2E A;  3QWP A;  4U0S A;  3ZFW A;  4IN3 B;  2W5Z A;  1ZU2 A;  2FEZ A;  3E4B A;  4XIF A;  1H3I A;  3ZGQ A;  3ZPJ A;  4NJ5 A;  3AS8 A;  1N6C A;  3GZ1 A;  5DIZ A;  3U4T A;  5KJK A;  3HYM B;  3BEE A;  3PDN A;  5JJ7 A;  3R9A B;  3S7B A;  5TEG A;  3LPZ A;  4J7I A;  5FZR A;  3MKR A;  3VTY A;  3MV2 B;  3CBO A;  2XEV A;  3M54 A;  2LNI A;  3MO0 A;  1HH8 A;  1QZ2 A;  2JLB A;  5EG2 A;  2VSN A;  4EQF A;  3IHX A;  3FWV A;  2RFI A;  3M59 A;  3RKV A;  2VYI A;  1N6A A;  3CVN A;  3ZN3 A;  4GYW A;  5EKQ D;  4IJ8 A;  4G23 A;  5JJ6 A;  3PE3 A;  3HNA A;  5FZQ A;  2XGM A;  3LY7 A;  4BTA A;  4GZ5 A;  2NC9 A;  3TAX A;  5LCW C;  3CK7 A;  4GZ6 A;  4AY6 A;  5CHE E;  4BT8 A;  4I9C A;  4RG9 A;  4YPU A;  2PZI A;  4N39 A;  2Y4U A;  2UY1 B;  1ZKK A;  2HO1 A;  4GZ3 A;  3RO2 A;  3IEG A;  2F69 A;  2WPV A;  2DBA A;  5CCM A;  2VQ2 A;  3ASD A;  1HXI A;  4AY5 A;  4GYO A;  4BUP A;  2VGX A;  3F9W A;  1ZBP A;  3OXF A;  2BQZ A;  5BW8 C;  3Q47 B;  2FBN A;  3NF1 A;  2C2L A;  4AU7 A;  4GA0 A;  4GA2 A;  4UQY A;  4HOR A;  3AS4 A;  3EDT B;  3OXL A;  3CVL A;  2UWJ G;  3FFL A;  4N3C A;  3OOI A;  3CK8 A;  2XGO A;  5BNW A;  2C0L A;  4GA1 A;  4ABN A;  1TJC A;  4G24 A;  4NRH B;  4MI5 A;  3MO5 A;  2L6J A;  3F9Y A;  5JJ0 A;  4U0U A;  5TH7 A;  3QWW A;  3K9I A;  3FP3 A;  3CVP A;  1PC2 A;  3TG5 A;  4YPA A;  3SWC A;  3CK9 A;  4GYY A;  3WXX A;  4GCO A;  3F9Z A;  5F6K C;  5LSX A;  2FF4 A;  3KMT A;  2G46 A;  1B89 A;  4HOU A;  1XNF A;  2W5Y A;  2PL2 A;  4HOS A;  1NA0 A;  5JHN A;  3URZ A;  4Z4P A;  3ASF A;  3DAL A;  1WAO 1;  4I1A A;  5TTF A;  2I6H A;  4KBQ A;  4BTB A;  5FTP A;  5G05 J;  3DB5 A;  2FI7 A;  4O30 A;  4N3A A;  5EX3 A;  4J8O A;  2XPI A;  2R3A A;  3Q15 A;  5G05 C;  3AS5 A;  4GCN A;  2LSV A;  5FT9 A;  3LYA A;  2XCC A;  5JIY A;  4XI9 A;  4FMU A;  2YHC A;  5LCW J;  2PQR A;  1FCH A;  3JYS A;  4MI0 A;  3Q4A B;  4IJD A;  1KLX A;  2R5S A;  5EX0 A;  4J8D A;  2KCK A;  3S7J A;  5T5G A;  3RIB A;  3VTX A;  3CBM A;  1QQE A;  2KC7 A;  2P58 C;  3O48 A;  2QPW A;  2KAT A;  4HOT A;  2GW1 A;  3OPE A;  3M55 A;  4QEO A;  4ME2 A;  1MUF A;  3VV0 A;  1WM5 A;  4WNF A;  2KCL A;  5KJN A;  5F5E A;  4Y6W A;  1P5Q A;  3KS2 A;  4NVQ A;  4G25 A;  5D0Q D;  4YNP A;  3ZHE B;  3SZ7 A;  4U07 A;  3LY8 A;  4XI0 A;  2XCB A;  4J0U A;  3UUX A;  4JLG A;  2YQ8 A;  5F6L A;  4C1Q A;  2O8J A;  3KD7 A;  4J83 A;  2IGQ A;  1A17 A;  2HYZ A;  5ARF A;  3ULQ A;  4QEP A;  4I2W A;  5CPR B;  2IFU A;  5T0M A;  5ARG A;  2IF4 A;  5FJY A;  2WQH A;  2VGY A;  4I51 A;  3Q5M A;  3S8P A;  3RU0 A;  1IHG A;  3CEQ A;  4J7F A;  4KYO B;  3PE4 A;  3U3W A;  2BUG A;  4O6F A;  5G04 C;  4H7X A;  3GW4 A;  4AM9 A;  3MEK A;  1W3B A;  2J9Q A;  1XQH A;  5JJT A;  3K5K A;  4YVO A;  3OS5 A;  4J8F A;  4JA7 A;  4UI9 C;  4JA9 A;  3KMJ A;  3CKC A;  1ELR A;  5LSZ A;  3M58 A;  4N5C A;  5C1D A;  4N3B A;  3F9X A;  2FO7 A;  2UY1 A;  3QWV A;  2Q7F A;  2PQN A;  4CGV A;  4WNG A;  4LEU A;  1O9S A;  4U0Z A;  4WUY A;  1NZN A;  4F3V A;  4CDR A;  1E96 B;  3M53 A;  2VGX B;  5KJM A;  1MT6 A;  3LY9 A;  2HR2 A;  3RJV A;  5A6C A;  5AYF A;  5KJL A;  3QOU A;  3CKB A;  2OND A;  4JL0 A;  2KCV A;  5F59 A;  4UI9 J;  1OUV A;  3GZ2 A;  4G1T A;  2V5F A;  3BO5 A;  1KT1 A;  4GPK A;  4I2Z A;  3RAY A;  2AVP A;  2MHK A;  3ASG A;  4RZ0 A;  4I9E A;  3EP0 A;  3KMA A;  3S7F A;  1MVX A;  4APO A;  4NQ0 A;  3S7D A;  1PEG A;  4BWR A;  1ML9 A;  3OXG A;  3QKY A;  5A7D B;  3UQ3 A;  2OOE A;  3CVQ A;  2C0M A;  4G2V A;  5G04 J;  5M72 A;  5CCL A;  5HQ8 A;  3MV3 B;  3M57 A;  3SF4 A;  4H7Y A;  4B94 A;  4W9R A;  3CV0 A;  3MA5 A;  5JIN A;  1HZ4 A;  4UI9 K;  4AIF A;  4HOQ A;  4A1S A;  4CGW A;  4U04 A;  2Y4T A;  4J8E A;  1Y8M A;  3FPD A;  4WNE A;  3RQ4 A;  3GYZ A;  4JDS A;  3M5A A;  1IYG A;  2JV0 A;  3RJW A;  3Q49 B;  3TG4 A;  3ASH A;  4UQZ A;  4YPE A;  2QFC A;  4LDG A;  4JHR A;  3RO3 A; 
#chains in the Genus database with same CATH topology
 2AWI A;  5AYW D;  3LCA A;  1NL4 A;  5LP0 A;  2V4H C;  1HO8 A;  1S64 A;  3B7T A;  4ACK A;  1Z3Y A;  4RSY A;  4Y6C A;  4JZY A;  5BT1 A;  3QDN A;  4FHK A;  1KZP A;  4CCA A;  4E47 A;  3N71 A;  1ELW A;  3ZYK A;  3I4G A;  4UQX A;  5EID A;  3TWR A;  3U64 A;  2KM4 A;  3DSS A;  2KXP C;  4V3I A;  3VUZ A;  3AJI A;  3ZU7 B;  3QAR A;  2F37 A;  4U95 D;  1HX8 A;  4XEI G;  5AJL A;  1TJF A;  2OVB A;  1TNB A;  3Q75 A;  5DIZ A;  5CMW A;  3HYM B;  3L17 A;  1H2T C;  3BEE A;  1WDY A;  2P9K G;  4BER A;  4L1B A;  3ZXP A;  4DI3 A;  5CRU A;  2IQC A;  3APD A;  3M54 A;  1X81 A;  4L23 A;  2LNI A;  1HH8 A;  3CVU A;  1OCO E;  2M63 A;  4EQF A;  1UN8 A;  5AQA A;  3UKR G;  3HVE A;  3RKV A;  1N6A A;  5CRV A;  1E8W A;  3ZN3 A;  3QJZ A;  2BKG A;  5LOZ A;  3PE3 A;  4D10 C;  2XGM A;  4CEM A;  1NI1 A;  4IRU A;  2X6F A;  5LCW C;  2QYJ A;  2DYS E;  4GU5 A;  4GZ6 A;  5J90 A;  3HDX A;  4RG9 A;  2JAB A;  4K0R A;  2PZI A;  3UM0 A;  1OWP A;  1ZKK A;  2V4L A;  2F69 A;  2DBA A;  5CCM A;  2WM9 A;  2ZGG A;  3FUF A;  1V54 E;  4A55 A;  4TXQ A;  2FBN A;  3B95 A;  2C2L A;  4AU7 A;  3G2S A;  2P9S G;  2NSZ A;  2NYJ A;  4HOR A;  3AS4 A;  2YNQ A;  1U2V G;  3CK8 A;  5BNW A;  2MYO A;  4WWP A;  3RRM B;  3OTN A;  3EU9 A;  4G24 A;  1FVF A;  2VSO E;  4FA6 A;  5JJ0 A;  3C5R A;  4CRW A;  2BED A;  5TH7 A;  4I6J A;  1OCZ E;  5B1A E;  5CEC B;  2GRP B;  3CVP A;  2E0I A;  1E7U A;  2WXQ A;  2HM8 A;  2XZT G;  4RQI A;  2FF4 A;  2G46 A;  1B89 A;  3ASN E;  4YDE A;  5AN8 A;  5ENS D;  3R7Q A;  3B7U X;  3LDZ A;  3FTS A;  4I1A A;  4K03 A;  3TXN A;  1JUQ A;  2L0T B;  3NZS A;  3IHY A;  2FI7 A;  3W9G A;  3PH0 C;  4U96 D;  4AJW A;  4HXI A;  3UI2 A;  4LNG A;  4J8O A;  2LXL A;  2J07 A;  3LYA A;  4FUL A;  4JW1 A;  3BUA A;  4FMU A;  3DRA A;  2YHC A;  5E75 A;  5LCW J;  1N4P A;  2IU1 A;  2FO1 E;  3FTU A;  3UM3 A;  1N94 A;  1UW4 B;  3ZVV A;  3FEY A;  3O4Z A;  2H6G A;  1G3N B;  3FTY A;  3IHV A;  2J08 A;  3DEO A;  2EIK E;  1K1A A;  4XX5 A;  3I5P A;  4DI4 A;  5CEA A;  5AAO A;  4HOT A;  5ENN A;  3TWS A;  5EDS A;  1OCR E;  1WY6 A;  3HXE A;  3ZYQ A;  4WNF A;  5KJN A;  4LUN U;  4HQD A;  3NOC D;  3NOG D;  3ZNG A;  2WXJ A;  2XPY A;  1HF8 A;  3Q73 A;  2X3M A;  4B8A A;  4XI0 A;  2WXN A;  1MJ0 A;  4JLG A;  1OWO A;  2IGQ A;  2RFM A;  3SNX A;  4GMR A;  1LD8 A;  2Y69 E;  1UOH A;  4JEU A;  3KEZ A;  3ZXS A;  3FTX A;  3IV0 A;  4PS7 A;  2KZT B;  3BG0 B;  5LFA A;  3U3W A;  2IOS A;  2ZIS A;  3HVE B;  2WVI A;  3FTZ A;  4AM9 A;  1TNU A;  3BU8 A;  3MEK A;  1TEZ A;  4ACL A;  4J8F A;  5B3S E;  4UI9 C;  3CKC A;  3FEX A;  5LSZ A;  4N5C A;  1N11 A;  3GZS A;  3F9X A;  5ANL A;  2YIN A;  2QYU A;  3QWV A;  2Q7F A;  2V8S E;  1MX2 A;  3RAU A;  3MZL B;  4GML A;  4F3V A;  4AP2 A;  4JHK A;  1AWC B;  1MT6 A;  3V2X A;  5KJL A;  1N9A A;  1XGW A;  1JWG A;  1OWN A;  5F59 A;  3EUV A;  4DUI A;  2CFU A;  3TWX A;  3P2B A;  2VGE A;  4JC8 A;  4FU3 A;  1KT1 A;  1GW6 A;  2MOW A;  2AVP A;  3ONK A;  4RZ0 A;  3ASG A;  3C3Q A;  1INZ A;  3ISM C;  3S7D A;  3PRE A;  4BWR A;  1ML9 A;  3EHQ A;  3OXG A;  3UQ3 A;  1E8Y A;  3CLJ A;  5CCL A;  2BTD A;  3CHQ A;  5ENP D;  4FJZ A;  3NB2 A;  2I2O A;  2WXK A;  3CV0 A;  3MA5 A;  4GPM A;  4UI9 K;  4K5A B;  3UX4 A;  4DX7 D;  3FTV A;  4U04 A;  4J8E A;  3FPD A;  2QY7 A;  3ZW3 A;  5CED B;  1HG5 A;  3SI5 A;  3Q79 A;  4CDN A;  3D3M A;  1L5J A;  4DX1 A;  3TWU A;  3C3O A;  3PEU B;  3TG4 A;  3ASH A;  4YPE A;  2P9I G;  3RO3 A;  5KNG A;  2DIW A;  5ENT D;  3DSW A;  4EZJ A;  4EEC A;  3OAW A;  3PZ3 A;  3EU5 A;  2X38 A;  4PH4 B;  4MKT A;  4I6G A;  4N2Q A;  3CHP A;  4WND A;  1UJJ A;  4E85 A;  3DEP A;  2GRR B;  1K1B A;  1BLX B;  5LX8 A;  5T0K A;  4QEN A;  2X6I A;  3L08 A;  1N3J A;  1D9S A;  4H12 A;  3MO2 A;  4GTR A;  3CBP A;  4UWH A;  5KCM A;  2LSU A;  1A5E A;  1RW2 A;  1EPU A;  3PZ4 A;  3FH8 A;  3ZUV B;  4A1G A;  1NA3 A;  4I17 A;  3ENE A;  4LRZ A;  4ANV A;  4HVB A;  2EQX A;  1O1S A;  3DSV A;  1YYH A;  3ESK A;  3ZHE A;  3DPY A;  2B0O E;  4LNB A;  4RG6 A;  2CG2 A;  4YND A;  4U0S A;  2W5Z A;  4I1O B;  3PVL A;  1H3I A;  3FHE A;  3AS8 A;  3LS8 A;  3GZ1 A;  3U4T A;  3B7B A;  3PDN A;  5AQ9 A;  1N54 A;  3W9F A;  3S7B A;  5CMY A;  3LPZ A;  2EIJ E;  3MKR A;  3SD5 A;  4ZHB A;  4APF A;  3UIO C;  1NFI E;  2ZGD A;  4M3O A;  2XEV A;  4DLO A;  5BV0 A;  3MO0 A;  2KZT A;  5FIO A;  2JLB A;  5EG2 A;  3PNT B;  2A4Z A;  3M59 A;  1EDU A;  3CSF A;  3EHR A;  4LER A;  4TRQ A;  3L6A A;  4G23 A;  5JJ6 A;  5BXO A;  3SFX A;  1FVH A;  4L7T A;  3FTW A;  4O1O A;  2GRL A;  2NC9 A;  1UN9 A;  4AY6 A;  1TN6 A;  2HO1 A;  4GZ3 A;  4JVS A;  2CHW A;  3IEG A;  3T5X A;  1SQM A;  2XEE A;  3QAQ A;  1O1T A;  5AQ7 A;  4GYO A;  1IKN D;  4BUP A;  1TNZ A;  3F9W A;  2H6F A;  2EIM E;  3LJN A;  3D9P A;  3D9O A;  3EHN A;  1PAQ A;  5KNH D;  2CHZ A;  3EDT B;  3OXL A;  3FFL A;  4N3C A;  3OOI A;  2OV8 A;  2XGO A;  4NUR A;  2C0L A;  4GA1 A;  4X8Q A;  3FH7 A;  3PZ1 A;  1TJC A;  3MO5 A;  2L6J A;  4U0U A;  3QWW A;  3K9I A;  2V0P A;  5EIB E;  3WG7 E;  1PC2 A;  4HNA D;  4YPA A;  3TWQ A;  2LAI A;  4GCO A;  2PM7 A;  3KSL A;  3VLD A;  5H7P A;  1EYH A;  4HOU A;  3HHM A;  3Q78 A;  5JMN D;  1NA0 A;  1Z3X A;  4YDO A;  4HI9 A;  3ASF A;  3D9I A;  5TTF A;  2I6H A;  3HXC A;  2R17 C;  3T5V A;  4Q96 A;  3EIJ A;  3FUL A;  3S2A A;  3DB5 A;  1ZB1 A;  3L16 A;  5AJD A;  5FT9 A;  2XCC A;  1WG0 A;  3CHS A;  2GRQ B;  5JHB A;  5JIY A;  4GTO A;  4TXR A;  4XI9 A;  3V2O A;  3E32 A;  2AW6 A;  2PQR A;  2R59 A;  5J08 A;  3L82 A;  3D9H A;  4F1S A;  4MI0 A;  3ABK E;  4TV3 A;  4IJD A;  4J7W A;  1KLX A;  1MHQ A;  3I3N A;  3KSQ A;  4F7A A;  5HS0 A;  2DWZ A;  2KC7 A;  5G55 A;  3O48 A;  2QPW A;  2KAT A;  5CER B;  3M55 A;  3ESL A;  2J49 A;  2AJA A;  2KCL A;  3CVY A;  4U8Y D;  4YNP A;  3ZHE B;  3LY8 A;  3SBT B;  4FHJ A;  4F6R D;  3Q7F A;  1BU9 A;  4KZC A;  3AU5 A;  2O8J A;  3DBS A;  4U63 A;  4LG6 A;  3LVR E;  4UWG A;  3RSE G;  2HYZ A;  2WXO A;  5CPR B;  3LVQ E;  2XEN A;  2IFU A;  2ETB A;  2FUL A;  2IF4 A;  3ONL A;  2RG8 A;  5BXU A;  3E34 A;  1H6P A;  3UM2 A;  1IHG A;  1SZA A;  2XPZ A;  5ENQ D;  3TL5 A;  4UUC A;  3J5P A;  2LUH A;  3G2W A;  4O6F A;  5G04 C;  2IOL A;  1XQH A;  3K5K A;  4YVO A;  1MQS A;  3C3R A;  3G2V A;  5D2M C;  4JA9 A;  3D9M A;  3U9W A;  4CT0 A;  1PY1 A;  4C9B B;  3KMJ A;  4JB8 P;  3M58 A;  5C1D A;  1H6O A;  2FO7 A;  4OAU C;  1BI8 B;  5FQ7 A;  4HRL A;  4WNG A;  4YDW A;  3UTM A;  3M53 A;  2VGX B;  1JCS A;  3FUH A;  3BG1 B;  3QOU A;  2YHE A;  3PUK A;  4AXH A;  4FP7 A;  4UI9 J;  3GZ2 A;  4TUU A;  3J5Q B;  4GPK A;  4I2Z A;  3CST A;  2MHK A;  2HE0 A;  3EP0 A;  3S7F A;  4CT4 A;  2IY0 C;  4NQ0 A;  2JEK A;  3ULE G;  5ANR A;  1QNF A;  2C0M A;  4G2V A;  4U8V D;  4BEP A;  1MYO A;  4K5B A;  1DVP A;  1SVX A;  4H7Y A;  5JIN A;  4AIF A;  2Y4T A;  4JHJ A;  1Y8M A;  5ITZ F;  3ML9 A;  4DK5 A;  3TWT A;  3GYZ A;  2ZU6 B;  4EBA G;  5HRY A;  4JDS A;  4HS2 A;  3E33 A;  2R2L A;  4BY6 A;  1UG3 A;  3AG1 E;  4BSX A;  2QFC A;  3UIP C;  3HG0 D;  3UM1 A;  4B93 B;  4G26 A;  2VSY A;  1TN8 A;  5A23 A;  2WXF A;  1U3D A;  4YVQ C;  5DBK A;  3QB2 A;  4KXK B;  3UPV A;  2ETC A;  4P29 A;  3JXI A;  4B0Z A;  4PS3 A;  3FUD A;  2VTB A;  4DRX E;  1KT0 A;  4YNM A;  1TYQ G;  3KAE A;  4BT9 A;  2X6H A;  1YA0 A;  3T8K A;  2XEH A;  5FZS A;  2I1J A;  3FUM A;  4GTQ A;  2GRM A;  3FUK A;  2J09 A;  1KZO A;  3TGO A;  3FY4 A;  4KVO A;  4HFG A;  2XGS A;  1MVH A;  3LKU A;  1UJK A;  3ZFW A;  2AXU A;  3E4B A;  3SQV A;  5IY5 E;  3ZPJ A;  4NJ5 A;  2XS1 A;  1N6C A;  3APC A;  5KJK A;  1YMP A;  3ASO E;  4J7I A;  4QQI A;  1Q2Z A;  3MV2 B;  3CBO A;  3DST A;  2P9P G;  3G2T A;  5FIN A;  1H2V C;  3MYV A;  1Z5S C;  3FWV A;  2RFI A;  5CBO A;  2VYI A;  3CVN A;  2XQ0 A;  4GYW A;  5EKQ D;  4C0E A;  4IJ8 A;  4F1P A;  3DSX A;  1FPP A;  2CFZ A;  5FZQ A;  4ILG A;  1TR4 A;  3DWL G;  2B6C A;  3IBE A;  4I9C A;  1LF8 A;  4ATG A;  4YPU A;  4LSZ E;  4M7C A;  1BI7 B;  1K8K G;  1DNP A;  2XRY A;  1HXI A;  4AY5 A;  1E8Z A;  2P9U G;  3CHR A;  2VGX A;  1ZBP A;  1H2U A;  4ANW A;  2J8S D;  2L6B A;  3Q9U C;  1OCC E;  3JUI A;  3VLF A;  3Q7A A;  3C72 A;  2RKK A;  4ILH B;  3UMV A;  4GA2 A;  2ION A;  3LJ3 A;  3CVL A;  2UWJ G;  4HI8 A;  3IXE A;  2WQ7 A;  4ABN A;  4Q94 A;  4NRH B;  4MI5 A;  3Q9N C;  1N0R A;  5CBN A;  5FQ4 A;  1E8X A;  3WXX A;  3AU4 A;  3QC1 A;  3SBS A;  5LSX A;  4XKC A;  3NBN B;  4R7L A;  3KMT A;  2W5Y A;  4ATZ D;  2PL2 A;  5AIJ A;  1BPO A;  3MJW A;  5JHN A;  1N52 A;  5EIL A;  4PUC A;  4J8S A;  3DAL A;  4B89 A;  1WAO 1;  4BTB A;  1N4R A;  1QBQ A;  4DX5 D;  5G05 J;  4CZ2 D;  5EX3 A;  4EHM A;  2R3A A;  3AS5 A;  4BX9 A;  1HE8 A;  2LSV A;  1IHB A;  3CIA A;  3AAA C;  3BQO A;  2Y3A A;  2OEV A;  1KPS B;  1MX4 A;  1H19 A;  2P9N G;  4UWK A;  3JYS A;  1N4S A;  2R5S A;  2KCK A;  3S7J A;  3RIB A;  2VTB B;  3VTX A;  4GTS A;  3CBM A;  2LXM A;  3R9M A;  2P58 C;  3JUE A;  3CVV A;  5BPP A;  2EIL E;  2L0I A;  4ME2 A;  5FWQ A;  4GTP A;  2R05 A;  5F5E A;  2ZXW E;  4NAC A;  3PS6 A;  4NVQ A;  4G25 A;  5D0Q D;  2WXI A;  1JPL A;  1MZC A;  5T8I A;  4U07 A;  4HBD A;  3MGB A;  3IKO B;  1IQU A;  2I9C A;  2XCB A;  4J8Y A;  2Y1L E;  1N95 A;  2DZO A;  5AAR A;  3KD7 A;  4OVV A;  4J83 A;  2WB2 A;  3ULQ A;  2XZD G;  4QEP A;  4UWL A;  4I2W A;  4WWN A;  5T0M A;  2F0Y A;  2VSX E;  3D9J A;  3HRA A;  5FJY A;  4C48 B;  2VGY A;  4I51 A;  4GTM A;  4OYS A;  3RU0 A;  5T3R A;  3ZRH A;  2CG3 A;  3ML8 A;  3HXB A;  3CR3 A;  4GTV A;  2BUG A;  3HIZ A;  2BF0 X;  4H7X A;  4G11 A;  3GW4 A;  1W3B A;  2J9Q A;  5JJT A;  3OS5 A;  4FAD A;  4JA7 A;  2XRZ A;  1IQR A;  4TXP A;  4ZFH A;  1ELR A;  3QNK A;  2V5Q C;  5KBA A;  2VJ8 A;  2UY1 A;  3LEW A;  2PQN A;  4A3V A;  1O9S A;  3T9K A;  4WUY A;  4MBG A;  4CDR A;  1E96 B;  4KT6 B;  5KJM A;  3PNL B;  3V31 A;  3RJV A;  3UKU G;  3TXM A;  2IO3 C;  4FJY A;  2WXL A;  3FDH A;  4JD2 G;  3D9K A;  2KCV A;  3FU5 A;  1OUV A;  4JXT A;  3BO5 A;  5ENO D;  2P2C P;  3RAY A;  2WXH A;  3TWV A;  1S0P A;  4XKB A;  1MVX A;  4APO A;  2OOE A;  3C98 A;  3CVQ A;  3U66 A;  2QC9 A;  3DSU A;  4BES A;  4CYM D;  1LD7 A;  3VLE A;  3CVX A;  1DC2 A;  3MV3 B;  4MRU A;  3TWW A;  3SF4 A;  4W9R A;  1OT8 A;  1HZ4 A;  2Y0B G;  1HU3 A;  1HFA A;  1HG2 A;  1JWF A;  4A1S A;  4CGW A;  1TNY A;  4G8L A;  2J4D A;  4WNE A;  2EIN E;  2RD0 A;  2F8Y A;  4HLL A;  1QYM A;  4EBA A;  4O60 A;  3M5A A;  1IYG A;  5EYL A;  2IJG X;  3NQP A;  4LDG A;  3JCK C;  4N5Q A;  3PZ2 A;  4NIK A;  5ENR D;  4PS8 A;  4I1M A;  1SZ9 A;  4E6H A;  4HRM B;  5T4Y A;  2QZA A;  4JEH A;  2WXR A;  4Q69 A;  3TJP A;  4N2S A;  4K5C A;  4ANU A;  5HKP A;  3PEV B;  5BUZ A;  2BKK B;  2AXZ A;  3CQC B;  4PDX A;  2X6K A;  5D0O D;  3ZIM A;  3M56 A;  2RFA A;  4U7E B;  3MKQ B;  1AP7 A;  4I43 A;  3SW9 A;  4WAF A;  5HI7 A;  4DJA A;  2E2E A;  3QWP A;  4IN3 B;  1ZU2 A;  3HXD A;  3SY2 A;  3CHO A;  4KZ0 A;  1N4Q A;  2FEZ A;  4XIF A;  3ZGQ A;  4OVU A;  4DPR A;  4BFR A;  3FH5 A;  3JXJ A;  3PZD A;  5E76 A;  3PUJ A;  5JJ7 A;  3R9A B;  3UXG A;  3FU0 A;  3UT4 A;  3L22 A;  3T8M A;  4B8C B;  5TEG A;  3RK6 A;  2OVF A;  4FLH A;  5FZR A;  3VTY A;  1JCR A;  4AV7 A;  1QZ2 A;  4DX2 A;  3QK0 A;  2VSN A;  3KEA A;  3IHX A;  4LNU D;  4AEZ C;  3G2U A;  3HNA A;  3JQ0 A;  3LY7 A;  1VDY A;  4BTA A;  3DPD A;  4GZ5 A;  1DCE A;  3TAX A;  3CK7 A;  5B1B E;  5FQ6 A;  5CHE E;  2WXM A;  4BT8 A;  3SHF A;  1BD8 A;  1SA5 A;  4N39 A;  2Y4U A;  2UY1 B;  3RO2 A;  4AOF A;  2ZIR A;  3FUI A;  2WPV A;  1E90 A;  2VQ2 A;  3ASD A;  3F6Q A;  2CHX A;  3L54 A;  4JPS A;  1MX6 A;  3CQG B;  3OXF A;  2BQZ A;  5BW8 C;  3Q47 B;  3X2Q E;  3NF1 A;  2ILR A;  4A3T A;  3EHM A;  4GA0 A;  3NAW A;  4UQY A;  2MRI A;  4MS6 A;  1OWM A;  3AG3 E;  3F9Y A;  4IYP A;  1TN7 A;  2ETA A;  2WXP A;  4DX6 D;  3FP3 A;  5AQB A;  1OWL A;  3TG5 A;  1RZ4 A;  3SWC A;  4HLE A;  3CK9 A;  4GYY A;  3SGH A;  3F9Z A;  5F6K C;  3B7S A;  5EYP F;  5AEN A;  4QFV A;  3P1U A;  4J6I A;  3RRU A;  1XNF A;  4HOS A;  2IO2 C;  3URZ A;  1IXV A;  2XS8 A;  3ZYL A;  4Z4P A;  4HB5 A;  2DYR E;  3SFZ A;  4U8H A;  4KBQ A;  4XE0 A;  3UT7 A;  4O1P A;  5FTP A;  2R02 A;  2XHE A;  3ZEF A;  4F53 A;  1O1R A;  4O30 A;  3FUN A;  4N3A A;  5JHA A;  4EZL A;  2XPI A;  4EZK A;  3Q15 A;  5G05 C;  4GCN A;  5D66 A;  2L9B A;  3CVW A;  2GRN B;  4GMJ A;  5G2N A;  2OCC E;  4L2Y A;  1FCH A;  1S70 B;  2H6H A;  3Q4A B;  4WWO A;  5EX0 A;  4J8D A;  5T5G A;  3L13 A;  3APF A;  3LXU X;  4XZ4 A;  1QQE A;  4TUM A;  3FUJ A;  1V55 E;  2GW1 A;  1D8D A;  3OPE A;  5C2Y A;  1ELK A;  4QEO A;  1MUF A;  1U3C A;  3VV0 A;  1WM5 A;  4ILI A;  2J4B A;  4ANX A;  3B13 A;  4Y6W A;  1OY3 D;  1P5Q A;  4RLY A;  3KS2 A;  3MKQ A;  1TNO A;  3SZ7 A;  2GGF A;  1OXJ A;  3DXK G;  3PRZ A;  4EPZ A;  4GB9 A;  3EIQ C;  4J0U A;  4Z68 A;  3UUX A;  2YQ8 A;  5F6L A;  4C1Q A;  1SA4 A;  4C0M A;  2WMN A;  1A17 A;  5ARF A;  4BET A;  1H6K A;  3V79 K;  2DCP A;  2GRO B;  1FT1 A;  4AVX A;  3FU3 A;  5ARG A;  1S63 A;  1SW6 A;  2WQH A;  4RVB A;  4URK A;  3Q5M A;  3S8P A;  3CHM A;  3AG4 E;  2LAH A;  3CEQ A;  4J7F A;  4KYO B;  3HXF A;  4G8K A;  3ZYM A;  1HS6 A;  3PE4 A;  5BV1 A;  3MCX A;  4LCT A;  4CDM A;  3ABL E;  3RRN B;  2WMO A;  1Z6T A;  2NXP A;  2DVW A;  5KWD A;  4MLP A;  3UIN C;  1DCQ A;  3ULY A;  3EJN A;  4N3B A;  1Y6I A;  2PNN A;  4CGV A;  3D9N A;  3R7R A;  4LEU A;  4U0Z A;  1NZN A;  2R03 A;  4I6E A;  2LO6 A;  2A5E A;  2X6J A;  3LY9 A;  2HR2 A;  4GTT A;  4L2L A;  5A6C A;  4YDY A;  5JA4 D;  4L9P A;  5AYF A;  2I1K A;  2DZN A;  2A5U A;  3CKB A;  1JCQ A;  2OND A;  1FT2 A;  2WQ6 A;  4JL0 A;  4GAA A;  4KVM A;  3AG2 E;  3MX3 A;  3D9L A;  4IUL A;  4G1T A;  2V5F A;  1N0Q A;  4FC8 A;  2IEJ A;  1K3Z D;  4GZD A;  3FU6 A;  5FQ8 A;  1EF1 C;  4I9E A;  3KMA A;  1PEG A;  3UT8 A;  3DXM G;  3V30 A;  1E7V A;  3ABM E;  2KBX A;  3JQ1 A;  4HRN A;  3QKY A;  5A7D B;  3SO8 A;  1O5M A;  5M72 A;  5G04 J;  1LTX A;  3NZU A;  3ZKJ A;  5HQ8 A;  3SFY A;  1X5B A;  2F8X K;  4GZC A;  2OEW A;  3FUE A;  2AXV A;  3M57 A;  4B94 A;  4OAV B;  3B7R L;  4DLQ A;  4FLB A;  2P9L G;  4UWF A;  1NP7 A;  4HOQ A;  3L9T A;  3E37 A;  3CGH A;  3E30 A;  2H6I A;  4BX8 A;  3RQ4 A;  4KMO A;  2JV0 A;  3RJW A;  4BSZ B;  3Q49 B;  2WXG A;  3I4R B;  1D8E A;  4UQZ A;  5EN5 D;  1YCS B;  4JHR A;  4A63 B;  2PM6 A;  1H0A A; 
#chains in the Genus database with same CATH homology
 2AWI A;  5AYW D;  3LCA A;  2DIW A;  4G26 A;  2VSY A;  5A23 A;  2WXF A;  5LP0 A;  4PS8 A;  1U3D A;  3B7T A;  1HO8 A;  4I1M A;  4ACK A;  4EZJ A;  4EEC A;  3OAW A;  1Z3Y A;  4YVQ C;  1SZ9 A;  4E6H A;  2X38 A;  5DBK A;  3QB2 A;  4PH4 B;  4KXK B;  4I6G A;  4MKT A;  4N2Q A;  4RSY A;  4Y6C A;  5T4Y A;  3CHP A;  4WND A;  3UPV A;  1UJJ A;  2WXR A;  4JEH A;  4JZY A;  4E85 A;  4Q69 A;  5BT1 A;  4P29 A;  3QDN A;  4B0Z A;  5LX8 A;  5T0K A;  4QEN A;  2X6I A;  3L08 A;  4FHK A;  4PS3 A;  3FUD A;  3TJP A;  4N2S A;  4CCA A;  2VTB A;  1N3J A;  4E47 A;  1KT0 A;  4YNM A;  4H12 A;  3N71 A;  4ANU A;  3MO2 A;  3KAE A;  3CBP A;  4BT9 A;  1ELW A;  2X6H A;  3PEV B;  1YA0 A;  5BUZ A;  3ZYK A;  4UWH A;  5KCM A;  2LSU A;  3I4G A;  4UQX A;  5FZS A;  2AXZ A;  3CQC B;  1EPU A;  3U64 A;  4PDX A;  2I1J A;  3FH8 A;  2X6K A;  5D0O D;  4A1G A;  3ZIM A;  2KM4 A;  1NA3 A;  3FUM A;  4I17 A;  3ENE A;  2GRM A;  4LRZ A;  4ANV A;  4HVB A;  3M56 A;  2EQX A;  3FUK A;  4V3I A;  2J09 A;  3VUZ A;  3TGO A;  3MKQ B;  3QAR A;  4I43 A;  3ESK A;  3ZHE A;  3SW9 A;  3FY4 A;  4KVO A;  4HFG A;  2XGS A;  4RG6 A;  4WAF A;  2CG2 A;  5HI7 A;  4YND A;  4DJA A;  1MVH A;  3LKU A;  2E2E A;  1UJK A;  1HX8 A;  3QWP A;  4U0S A;  3ZFW A;  5AJL A;  1TJF A;  2OVB A;  4IN3 B;  2W5Z A;  1ZU2 A;  3CHO A;  4I1O B;  4KZ0 A;  2AXU A;  2FEZ A;  3E4B A;  3PVL A;  4XIF A;  1H3I A;  3ZGQ A;  3ZPJ A;  3FHE A;  4OVU A;  4NJ5 A;  4DPR A;  3AS8 A;  3LS8 A;  1N6C A;  3GZ1 A;  5DIZ A;  4BFR A;  3U4T A;  3FH5 A;  3APC A;  3PZD A;  5KJK A;  5E76 A;  3HYM B;  3L17 A;  5CMW A;  1H2T C;  3PUJ A;  3BEE A;  3PDN A;  5JJ7 A;  1N54 A;  3R9A B;  3S7B A;  3FU0 A;  3UT4 A;  3L22 A;  3T8M A;  4B8C B;  5TEG A;  5CMY A;  3RK6 A;  3LPZ A;  2OVF A;  4L1B A;  4FLH A;  4J7I A;  5FZR A;  4DI3 A;  3MKR A;  3SD5 A;  3VTY A;  3MV2 B;  4APF A;  3CBO A;  4M3O A;  2XEV A;  2IQC A;  3APD A;  3M54 A;  4DLO A;  4L23 A;  4AV7 A;  2LNI A;  3G2T A;  5BV0 A;  3MO0 A;  1HH8 A;  1QZ2 A;  2KZT A;  3CVU A;  2JLB A;  5EG2 A;  3PNT B;  3QK0 A;  2A4Z A;  2VSN A;  2M63 A;  4EQF A;  1H2V C;  3MYV A;  3IHX A;  1UN8 A;  3FWV A;  2RFI A;  3M59 A;  3HVE A;  1EDU A;  3RKV A;  3CSF A;  2VYI A;  1N6A A;  3CVN A;  1E8W A;  3ZN3 A;  2XQ0 A;  3QJZ A;  4GYW A;  4LER A;  4TRQ A;  5EKQ D;  4C0E A;  4IJ8 A;  3L6A A;  4AEZ C;  4G23 A;  5JJ6 A;  5LOZ A;  1FVH A;  3G2U A;  3PE3 A;  4L7T A;  2CFZ A;  3FTW A;  5FZQ A;  3HNA A;  4ILG A;  4D10 C;  2XGM A;  3JQ0 A;  1VDY A;  3LY7 A;  4BTA A;  4CEM A;  2GRL A;  3DPD A;  4GZ5 A;  2NC9 A;  4IRU A;  3TAX A;  3CK7 A;  2X6F A;  1UN9 A;  5LCW C;  4GZ6 A;  4GU5 A;  5J90 A;  5FQ6 A;  4AY6 A;  3IBE A;  3HDX A;  2WXM A;  5CHE E;  4BT8 A;  4I9C A;  4RG9 A;  3SHF A;  1LF8 A;  4ATG A;  4YPU A;  4K0R A;  2PZI A;  4N39 A;  1OWP A;  2Y4U A;  2UY1 B;  1ZKK A;  2HO1 A;  4GZ3 A;  4JVS A;  3RO2 A;  2CHW A;  3IEG A;  3T5X A;  2V4L A;  3FUI A;  4AOF A;  2F69 A;  1SQM A;  2WPV A;  1E90 A;  2DBA A;  3QAQ A;  1DNP A;  2VQ2 A;  3ASD A;  5CCM A;  2XRY A;  1HXI A;  2WM9 A;  4AY5 A;  4GYO A;  1E8Z A;  2CHX A;  3L54 A;  4BUP A;  4JPS A;  3CHR A;  2VGX A;  3FUF A;  3F9W A;  1ZBP A;  3CQG B;  1H2U A;  4ANW A;  3OXF A;  2BQZ A;  5BW8 C;  3Q47 B;  4A55 A;  2FBN A;  3D9P A;  3JUI A;  3NF1 A;  3VLF A;  3D9O A;  3EHN A;  2C2L A;  2ILR A;  1PAQ A;  4AU7 A;  3G2S A;  4ILH B;  3UMV A;  3EHM A;  2ION A;  2NSZ A;  4GA0 A;  4GA2 A;  4A3T A;  2CHZ A;  4UQY A;  4HOR A;  2MRI A;  3AS4 A;  3EDT B;  3LJ3 A;  2YNQ A;  3OXL A;  3CVL A;  2UWJ G;  3FFL A;  4N3C A;  3OOI A;  2OV8 A;  3CK8 A;  2WQ7 A;  2XGO A;  4NUR A;  5BNW A;  2C0L A;  4GA1 A;  4MS6 A;  1OWM A;  3FH7 A;  4WWP A;  4ABN A;  3RRM B;  4Q94 A;  3OTN A;  1TJC A;  4G24 A;  4NRH B;  1FVF A;  3MO5 A;  4MI5 A;  2VSO E;  4FA6 A;  2L6J A;  3F9Y A;  5JJ0 A;  4CRW A;  4IYP A;  5FQ4 A;  4U0U A;  5TH7 A;  3QWW A;  2WXP A;  2V0P A;  3K9I A;  4I6J A;  3FP3 A;  1OWL A;  1E8X A;  3CVP A;  1PC2 A;  2E0I A;  3TG5 A;  4YPA A;  3SWC A;  4HLE A;  3CK9 A;  1E7U A;  4GYY A;  3SGH A;  2LAI A;  2WXQ A;  3WXX A;  4GCO A;  3AU4 A;  3QC1 A;  3F9Z A;  2PM7 A;  3SBS A;  5F6K C;  5LSX A;  3B7S A;  5AEN A;  2HM8 A;  4QFV A;  4XKC A;  2FF4 A;  4R7L A;  3KMT A;  3P1U A;  3VLD A;  2G46 A;  1B89 A;  4J6I A;  1EYH A;  3RRU A;  4HOU A;  1XNF A;  2W5Y A;  3HHM A;  2PL2 A;  5AIJ A;  1BPO A;  3MJW A;  4HOS A;  1NA0 A;  5JHN A;  3R7Q A;  3B7U X;  1Z3X A;  3URZ A;  1N52 A;  3LDZ A;  4PUC A;  3FTS A;  4J8S A;  3ASF A;  3D9I A;  3ZYL A;  4B89 A;  1WAO 1;  4I1A A;  3DAL A;  2I6H A;  5TTF A;  3SFZ A;  4K03 A;  2R17 C;  4U8H A;  1JUQ A;  4KBQ A;  3TXN A;  3T5V A;  4XE0 A;  3UT7 A;  2L0T B;  4Q96 A;  4BTB A;  3EIJ A;  3FUL A;  5FTP A;  5G05 J;  3NZS A;  3S2A A;  3IHY A;  3DB5 A;  2XHE A;  2FI7 A;  3PH0 C;  3ZEF A;  4F53 A;  4AJW A;  3FUN A;  4HXI A;  4N3A A;  5EX3 A;  4O30 A;  5JHA A;  4J8O A;  4EZL A;  3L16 A;  2XPI A;  2R3A A;  2J07 A;  4EZK A;  3Q15 A;  5G05 C;  3AS5 A;  4GCN A;  4BX9 A;  1HE8 A;  2LSV A;  5AJD A;  5FT9 A;  3LYA A;  4FUL A;  4JW1 A;  2L9B A;  2XCC A;  3CVW A;  3CHS A;  3CIA A;  2Y3A A;  5JHB A;  5JIY A;  4XI9 A;  4FMU A;  4GMJ A;  1H19 A;  2YHC A;  5E75 A;  5G2N A;  4UWK A;  2AW6 A;  2PQR A;  2IU1 A;  2R59 A;  5J08 A;  5LCW J;  4L2Y A;  3FTU A;  1FCH A;  1UW4 B;  3JYS A;  3FEY A;  3ZVV A;  4F1S A;  3O4Z A;  4MI0 A;  3Q4A B;  4TV3 A;  4IJD A;  4WWO A;  1KLX A;  2R5S A;  3FTY A;  5EX0 A;  4J8D A;  1MHQ A;  3IHV A;  2J08 A;  2KCK A;  3I3N A;  3S7J A;  5T5G A;  3RIB A;  4F7A A;  2VTB B;  3L13 A;  3VTX A;  3APF A;  3I5P A;  3LXU X;  4XX5 A;  4XZ4 A;  3CBM A;  1QQE A;  4DI4 A;  2KC7 A;  2P58 C;  5G55 A;  3O48 A;  3FUJ A;  2QPW A;  2KAT A;  4HOT A;  2GW1 A;  5ENN A;  5EDS A;  3OPE A;  3CVV A;  5C2Y A;  1ELK A;  3ESL A;  5BPP A;  3M55 A;  4QEO A;  2L0I A;  4ME2 A;  1MUF A;  1WY6 A;  1U3C A;  5FWQ A;  3VV0 A;  2J49 A;  3ZYQ A;  1WM5 A;  4ILI A;  4WNF A;  2KCL A;  5KJN A;  4LUN U;  2J4B A;  4ANX A;  3B13 A;  3CVY A;  5F5E A;  4Y6W A;  1P5Q A;  4NAC A;  3PS6 A;  3KS2 A;  3MKQ A;  2WXJ A;  4G25 A;  5D0Q D;  4NVQ A;  4YNP A;  2WXI A;  3ZHE B;  1JPL A;  2XPY A;  5T8I A;  1HF8 A;  3SZ7 A;  2GGF A;  4U07 A;  2X3M A;  3LY8 A;  3SBT B;  3PRZ A;  4EPZ A;  4B8A A;  4GB9 A;  3MGB A;  4XI0 A;  3IKO B;  4FHJ A;  1IQU A;  2I9C A;  2XCB A;  2WXN A;  3EIQ C;  4KZC A;  3AU5 A;  4J0U A;  3UUX A;  4JLG A;  2YQ8 A;  5F6L A;  4C1Q A;  2O8J A;  3DBS A;  1OWO A;  3KD7 A;  4OVV A;  4U63 A;  3LVR E;  4UWG A;  4C0M A;  2IGQ A;  2WMN A;  4J83 A;  1A17 A;  2WB2 A;  2HYZ A;  5ARF A;  3SNX A;  3ULQ A;  1H6K A;  2WXO A;  4QEP A;  4UWL A;  4I2W A;  5CPR B;  2DCP A;  3LVQ E;  2IFU A;  4WWN A;  4JEU A;  4AVX A;  5T0M A;  3KEZ A;  3FU3 A;  3ZXS A;  5ARG A;  2FUL A;  2VSX E;  2IF4 A;  3D9J A;  3FTX A;  3ONL A;  5FJY A;  2WQH A;  2RG8 A;  4RVB A;  3IV0 A;  2VGY A;  4I51 A;  4PS7 A;  4URK A;  3Q5M A;  4OYS A;  3S8P A;  3RU0 A;  3CHM A;  5T3R A;  3ZRH A;  2CG3 A;  1IHG A;  1SZA A;  2KZT B;  2XPZ A;  2LAH A;  3CEQ A;  4J7F A;  4KYO B;  3ML8 A;  3TL5 A;  3BG0 B;  3ZYM A;  3CR3 A;  1HS6 A;  5LFA A;  3PE4 A;  3U3W A;  2IOS A;  3G2W A;  2BUG A;  3HVE B;  2WVI A;  3HIZ A;  4O6F A;  2BF0 X;  5G04 C;  4H7X A;  5BV1 A;  3MCX A;  3FTZ A;  4LCT A;  2IOL A;  4G11 A;  3GW4 A;  4AM9 A;  4CDM A;  3MEK A;  1W3B A;  2J9Q A;  4ACL A;  3RRN B;  5JJT A;  2WMO A;  4YVO A;  1TEZ A;  1XQH A;  3K5K A;  1MQS A;  4J8F A;  4FAD A;  3OS5 A;  1Z6T A;  3G2V A;  4JA7 A;  4UI9 C;  2XRZ A;  2NXP A;  4JA9 A;  1IQR A;  4MLP A;  3D9M A;  3U9W A;  4CT0 A;  1PY1 A;  4C9B B;  3KMJ A;  3CKC A;  3FEX A;  1ELR A;  3QNK A;  5LSZ A;  3M58 A;  3EJN A;  4N5C A;  3GZS A;  5C1D A;  4N3B A;  3F9X A;  5ANL A;  2YIN A;  2FO7 A;  1Y6I A;  2VJ8 A;  2UY1 A;  3QWV A;  3LEW A;  2Q7F A;  5FQ7 A;  2PQN A;  4CGV A;  4A3V A;  3D9N A;  4WNG A;  2V8S E;  4LEU A;  3R7R A;  1O9S A;  4U0Z A;  3MZL B;  1NZN A;  4GML A;  4WUY A;  4AP2 A;  4CDR A;  4F3V A;  1E96 B;  4JHK A;  3M53 A;  4I6E A;  2VGX B;  2LO6 A;  4KT6 B;  4Z4P A;  5KJM A;  2X6J A;  1MT6 A;  3LY9 A;  2HR2 A;  3PNL B;  4L2L A;  3RJV A;  5A6C A;  5AYF A;  3FUH A;  3BG1 B;  2I1K A;  5KJL A;  2A5U A;  3QOU A;  3CKB A;  2OND A;  3TXM A;  2WQ6 A;  2YHE A;  2WXL A;  4FJY A;  3PUK A;  4JL0 A;  3FDH A;  4AXH A;  1XGW A;  1JWG A;  3D9K A;  4FP7 A;  4GAA A;  4KVM A;  1OWN A;  2KCV A;  3MX3 A;  5F59 A;  3FU5 A;  4UI9 J;  3D9L A;  1OUV A;  2CFU A;  3GZ2 A;  4TUU A;  4IUL A;  4JXT A;  3P2B A;  4G1T A;  2V5F A;  4FC8 A;  3BO5 A;  4JC8 A;  4FU3 A;  1KT1 A;  4GPK A;  4I2Z A;  4GZD A;  1GW6 A;  3FU6 A;  3CST A;  2MOW A;  3RAY A;  2AVP A;  3ONK A;  2WXH A;  5FQ8 A;  2MHK A;  3ASG A;  4RZ0 A;  1EF1 C;  1S0P A;  4I9E A;  4XKB A;  3EP0 A;  3KMA A;  3S7F A;  1MVX A;  4APO A;  1INZ A;  4CT4 A;  4NQ0 A;  3PRE A;  3S7D A;  3UT8 A;  1PEG A;  4BWR A;  2JEK A;  5ANR A;  1E7V A;  1ML9 A;  3OXG A;  3JQ1 A;  3QKY A;  5A7D B;  3UQ3 A;  2OOE A;  3C98 A;  3CVQ A;  3U66 A;  1E8Y A;  1QNF A;  2C0M A;  4G2V A;  3CLJ A;  5G04 J;  5M72 A;  5CCL A;  3NZU A;  2BTD A;  3CHQ A;  5HQ8 A;  3VLE A;  3CVX A;  1X5B A;  3MV3 B;  4GZC A;  4FJZ A;  4MRU A;  3FUE A;  1DVP A;  2AXV A;  3M57 A;  2I2O A;  3SF4 A;  2WXK A;  4H7Y A;  4B94 A;  4W9R A;  3CV0 A;  3MA5 A;  5JIN A;  3B7R L;  4DLQ A;  4FLB A;  1HZ4 A;  4UI9 K;  1HU3 A;  1HFA A;  1NP7 A;  4UWF A;  4AIF A;  4HOQ A;  1HG2 A;  1JWF A;  3UX4 A;  4A1S A;  3CGH A;  3FTV A;  4CGW A;  4U04 A;  2Y4T A;  4JHJ A;  2J4D A;  4J8E A;  1Y8M A;  3FPD A;  2QY7 A;  3ZW3 A;  3ML9 A;  4WNE A;  4DK5 A;  2RD0 A;  1HG5 A;  3SI5 A;  4BX8 A;  3RQ4 A;  4KMO A;  3GYZ A;  2ZU6 B;  4EBA G;  4EBA A;  4CDN A;  4JDS A;  4HS2 A;  3M5A A;  1IYG A;  2JV0 A;  3D3M A;  1L5J A;  2IJG X;  3RJW A;  3NQP A;  4BY6 A;  3Q49 B;  1UG3 A;  2WXG A;  3I4R B;  3PEU B;  4BSX A;  3TG4 A;  3ASH A;  4UQZ A;  4YPE A;  2QFC A;  4LDG A;  4JHR A;  3RO3 A;  3JCK C;  2PM6 A;  1H0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...