3QWVA

Crystal structure of histone lysine methyltransferase smyd2 in complex with the cofactor product adohcy
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
430
structure length
430
Chain Sequence
AEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVLGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKYLEFPDHSSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECRECTTKDKDKAKVEVRKLSSPPQAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASMWLKLGRLYMGLENKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SET and MYND domain-containing protein 2
publication title Crystal structures of histone and p53 methyltransferase SmyD2 reveal a conformational flexibility of the autoinhibitory C-terminal domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 143
structure length 430
sequence length 430
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3qwvA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3qwvA01
4CGWA 3VTXA 3KD7A 3F9YA 3O48A 1MUFA 2KC7A 4NJ5A 3KMJA 3CKBA 5A6CA 3GZ1A 4GZ5A 3M55A 1KT1A 4XIFA 5FZQA 4AIFA 1N6AA 4WNDA 4G1TA 1O9SA 3SWCA 2R3AA 3JYSA 4ABNA 4J8DA 3ZHEB 3R9AB 4GA1A 3TGOA 4AU7A 3VTYA 5KJLA 3M58A 2KCLA 2YQ8A 3OXGA 5BT1A 4N2SA 2G46A 5LSXA 2LNIA 4YNPA 4QEPA 2W5ZA 4XI9A 4YPAA 1MVHA 2VGXA 3GYZA 1P5QA 4GA0A 2FI7A 3QKYA 3OXLA 3BO5A 3ZN3A 3LY7A 4U04A 4JDSA 1ZU2A 2Y4UA 5TEGA 3KAEA 3F9XA 3RJVA 5FZRA 4G2VA 3KMTA 4I17A 5JIYA 4J7IA 3FFLA 2KCVA 4G25A 3MO2A 1KLXA 4J83A 4JHRA 4I9CA 3FWVA 4IJDA 2J9QA 4LEUA 3QOUA 4UQXA 4GYOA 2Q7FA 4N5CA 3QWWA 2O8JA 4CDRA 5F59A 4J8EA 3MA5A 2UY1B 5F5EA 4HOTA 4Z4PA 1ELWA 2XCBA 3M53A 4J0UA 3Q4AB 4G24A 2PZIA 1NA3A 2F69A 4YNMA 4RG9A 4HOSA 1ZBPA 3AS4A 3GW4A 3U3WA 2C0LA 1NA0A 4H12A 3IEGA 4NVQA 3FPDA 2XCCA 4JL0A 5CHEE 4NRHB 4UQZA 3CK7A 3NF1A 4YPUA 3SZ7A 4G23A 2FF4A 5T5GA 5ARGA 3ZHEA 2LSVA 4KYOB 4BUPA 3LY8A 5LSZA 4C1QA 2XGMA 4I2WA 1QQEA 5FTPA 5T0MA 5G04C 3KMAA 3S8PA 3M54A 4NQ0A 2DBAA 5M72A 3OXFA 4IN3B 5LCWC 2E2EA 4AY5A 3RO2A 3CKCA 4O30A 3S7DA 3ULQA 5CPRB 3RU0A 1MT6A 4WNGA 3ZGQA 3M5AA 2VGYA 1NZNA 5FZSA 4GCNA 4BT8A 2LSUA 1XNFA 3WXXA 3LPZA 3IHXA 4AM9A 3N71A 3MO5A 2BUGA 3Q47B 4GYWA 4YNDA 3EP0A 5AYFA 3MKRA 2W5YA 3QWPA 2BQZA 4U0UA 4HOQA 4GZ3A 4RZ0A 2XEVA 2UY1A 4QENA 3QWVA 5JJTA 4Y6WA 4FMUA 3S7JA 5HI7A 2XGSA 3M59A 3ASFA 4BTAA 2GW1A 3CVNA 4BTBA 3U4TA 3CV0A 2V5FA 5G05C 5EG2A 1ML9A 1HXIA 1MVXA 3RO3A 4RG6A 2R5SA 2IF4A 4YVQC 3UPVA 3AS8A 3VV0A 1WM5A 5TH7A 3PE4A 3LKUA 3M57A 2FEZA 5BW8C 2QFCA 4BT9A 3SF4A 1N6CA 2YHCA 3LYAA 3MEKA 5BNWA 1HH8A 2VSYA 1PC2A 4U0ZA 2XPIA 4B94A 4UI9C 3ASGA 3CBMA 4GPKA 3RAYA 3RQ4A 2HYZA 4BWRA 2OOEA 3TAXA 3HNAA 4MI5A 5DBKA 1WAO1 4KBQA 4O6FA 2QPWA 3ASHA 3LCAA 3MV2B 4UI9K 1PEGA 4N2QA 3UQ3A 4I51A 2C0MA 3OPEA 2C2LA 4GYYA 3ASDA 3K5KA 4APOA 3QDNA 4G26A 5JINA 3VUZA 4I2ZA 1IYGA 1A17A 3PE3A 4JLGA 1W3BA 2ONDA 3PDNA 4I1AA 4IJ8A 1YA0A 4H7YA 3S7BA 4WNEA 5JJ6A 5C1DA 5EX3A 5LCWJ 2IGQA 4WUYA 4KXKB 5KJMA 2XGOA 4WNFA 3Q5MA 3F9WA 4J8OA 4J7FA 4U07A 4EQFA 3F9ZA 2HR2A 3DALA 3Q49B 2RFIA 2VSNA 2KCKA 4MI0A 5KJNA 3RIBA 4XI0A 3S7FA 2VYIA 3FP3A 3ZFWA 5EKQD 3M56A 4Y6CA 1QZ2A 3RJWA 3UUXA 2AVPA 3LY9A 2P58C 2I6HA 3ZPJA 4W9RA 4HORA 5JHNA 3CK9A 2Y4TA 4F3VA 2NC9A 1B89A 3CVPA 5A7DB 5FJYA 2JV0A 5G05J 4AY6A 5D0OD 2VQ2A 5T0KA 1FCHA 2KATA 3CK8A 3CBOA 1OUVA 5FT9A 1IHGA 4ME2A 5D0QD 4A1SA 1N3JA 1XQHA 3K9IA 3CEQA 5AYWD 2PQRA 3AS5A 3OOIA 5JJ7A 4H7XA 2VGXB 2JLBA 4LDGA 3EDTB 1H3IA 1Y8MA 3Q15A 3KS2A 3TG4A 5TTFA 1KT0A 4QEOA 4U0SA 4N3BA 4GZ6A 4N39A 2FO7A 1ELRA 4UI9J 3BEEA 3HYMB 5F6KC 5F6LA 3CVQA 1ZKKA 3SW9A 2PL2A 5JJ0A 3CVLA 4E47A 2PQNA 5CCMA 3MO0A 2FBNA 1TJCA 4I9EA 4CGVA 4JA9A 5ARFA 3URZA 4UQYA 4N3AA 5EX0A 2HO1A 3OS5A 3ESKA 4HOUA 4GCOA 2UWJG 1E96B 3TG5A 2MHKA 5DIZA 3DB5A 3GZ2A 4J8FA 4YPEA 4N3CA 5G04J 3RKVA 3MV3B 3CBPA 3E4BA 4JA7A 5CCLA 5HQ8A 2WQHA 1HZ4A 2L6JA 5KJKA 2WPVA 4YVOA 2IFUA 4GA2A
chains in the Genus database with same CATH superfamily
4K0RA 4CGWA 3Q9NC 3F9YA 4APFA 3P1UA 2KC7A 4IRUA 3CKBA 5CMYA 3ZRHA 5A6CA 4GTVA 3T9KA 1N6AA 5CRVA 3UT7A 4WWOA 3SWCA 2M63A 4J8DA 4KMOA 2KM4A 3R9AB 3ZYQA 2V4LA 3TGOA 3I5PA 1OWOA 3ISMC 3QK0A 2V4HC 4IYPA 3FTZA 2VSOE 3ML8A 3HIZA 3L54A 4DX2A 3FUMA 4M7CA 4XI9A 1MVHA 3L13A 1P5QA 4HRNA 2GROB 4GA0A 3L6AA 3ZN3A 3G2VA 4U04A 1BI8B 3FUKA 3APFA 2DYRE 2EIKE 1K1AA 3BQOA 4I6GA 3FFLA 5CBNA 2MOWA 4P29A 3MO2A 1U3CA 2R05A 4QQIA 3FWVA 2J9QA 2QZAA 3QOUA 5FINA 2CFZA 4GYOA 3TWWA 3QWWA 2ZISA 5F59A 3MA5A 5EYLA 3LJNA 1JWGA 3UINC 1ELWA 2XCBA 4TXQA 4J0UA 4G24A 3FHEA 3MYVA 1NA3A 4G11A 3DSSA 2ETAA 4B93B 5ENTD 4HOSA 1ZBPA 3TL5A 3X2QE 3MZLB 3TWVA 1NP7A 1UG3A 4U7EB 2ZGGA 4OYSA 2XCCA 4JL0A 5IY5E 3FULA 2J8SD 4UQZA 3CK7A 3JCKC 3BG0B 4GZDA 4JW1A 5ARGA 3D9LA 3ZHEA 2PM6A 5EN5D 2XGMA 1UN8A 2LUHA 3Q7AA 4Q94A 2DZNA 2IOSA 2WXJA 1AWCB 3OXFA 3BU8A 4E85A 3RO2A 3ZYKA 3S7DA 2LAHA 5CPRB 5EILA 3RU0A 2GGFA 3ZGQA 4QFVA 3UIPC 1TNZA 3M5AA 3I4GA 4GTQA 2R17C 1OWMA 2KBXA 3HG0D 3WXXA 4ANVA 4AM9A 3MO5A 2IJGX 3I3NA 3Q47B 5AN8A 5AYFA 4L7TA 2HM8A 3R7RA 4U0UA 4CT0A 1U2VG 1IHBA 2HE0A 2VTBB 2UY1A 3PREA 3SQVA 5JJTA 4Y6WA 3QJZA 2KZTB 3ZEFA 3W9FA 2F0YA 3UXGA 3ASFA 2QYJA 4BTBA 4D10C 3AG4E 4HLEA 2BTDA 5EG2A 4V3IA 2WXLA 3ZYLA 4Z68A 3WG7E 2XHEA 2VSXE 3CVYA 3C5RA 1H2TC 4XE0A 1OWNA 1TJFA 3D9OA 4BT9A 4BY6A 5HS0A 3FH8A 2YHCA 4MBGA 2VSYA 1OWPA 4U0ZA 1HE8A 4DX1A 3ASGA 3L9TA 4EBAA 3CHOA 4DX5D 3ASOE 5DBKA 4O6FA 2QPWA 3LCAA 4ACKA 2BKGA 5ITZF 3CR3A 3QARA 2J4BA 5JINA 1HF8A 4I2ZA 3EIJA 4JLGA 2OVBA 4LERA 4IJ8A 3G2TA 4EECA 4WNEA 5JJ6A 5EX3A 3F6QA 3B7BA 4HLLA 3PEVB 4FC8A 1PAQA 4PUCA 2IGQA 3HVEA 1H0AA 4DX6D 3VLDA 5KJMA 4WNFA 4U07A 1E8YA 1HG2A 4U95D 4JVSA 4K5CA 3LVRE 5FQ6A 2KCKA 4FJZA 4MI0A 3RIBA 4XI0A 3FUHA 3ZFWA 5EKQD 3PZ3A 3M56A 4Y6CA 2WM9A 4XEIG 3UUXA 4HI9A 2WXNA 2I6HA 3FUNA 3ZPJA 1OY3D 2YHEA 4OAVB 3HRAA 2NC9A 3JUIA 3TWTA 1B89A 5FJYA 3EJNA 2XEEA 3ULYA 5AQAA 3IKOB 5D0OD 4L2YA 2VQ2A 5ANRA 5T0KA 1OUVA 4ANWA 4A1SA 2P9KG 4UWKA 3CEQA 5AYWD 1OT8A 2X3MA 2XEHA 3C3QA 3Q9UC 5A23A 3DRAA 4ANUA 1MX2A 4BX8A 3EUVA 2JLBA 5AQBA 3G2SA 2LXLA 3B7UX 2P2CP 1H3IA 1HG5A 1Y8MA 3KS2A 3Q15A 4FHJA 3TG4A 5TTFA 4U0SA 3NZSA 4GZ6A 4N39A 2FO7A 3L16A 4EPZA 5EIBE 5G2NA 3HYMB 5F6KC 1QBQA 5ENQD 2J49A 3SW9A 3CVLA 1ELKA 1TJCA 4I9EA 3CHSA 5ARFA 1EYHA 2HO1A 5EX0A 1GW6A 1E8WA 3DEPA 1E96B 3TG5A 4CYMD 4MRUA 3GZ2A 4I43A 3CQGB 1UN9A 5G04J 3RKVA 2V5QC 3NOGD 1HZ4A 4GAAA 3UM2A 4AOFA 1DC2A 1H6PA 1O1RA 2I1KA 3J5QB 4YVOA 4KVMA 5FQ8A 4NJ5A 2PNNA 3GZ1A 4XIFA 4JEHA 5FZQA 3C72A 5T3RA 1OXJA 2I9CA 4G1TA 1O9SA 3ZHEB 3MGBA 4AVXA 4AU7A 5C2YA 4DJAA 3CIAA 2KCLA 4WAFA 3OXGA 5BT1A 1D9SA 3U64A 2XZTG 2JABA 1TYQG 1JWFA 2ZXWE 4JB8P 1JCSA 1N9AA 1OCRE 3UKUG 1SZAA 4YPAA 5CEDB 3SI5A 1X81A 4FU3A 2BKKB 1NFIE 3QKYA 3OXLA 4B0ZA 5FQ4A 4C0MA 3LY7A 2Y4UA 4HQDA 5TEGA 4G2VA 5KNHD 1S63A 5JIYA 3OTNA 3TWQA 1QNFA 4LSZE 3L17A 4J83A 4JHRA 4I9CA 4JHKA 4MS6A 4N5CA 4I1MA 3EHQA 2UY1B 3L82A 3UKRG 3RRMB 1V54E 4CZ2D 2FULA 3Q79A 4EZKA 5B1BE 3Q4AB 2RG8A 1EPUA 4EHMA 3UI2A 3IV0A 2YINA 3EU9A 4L9PA 4B8AA 5BXUA 3LXUX 4HXIA 1TN7A 2C0LA 4RVBA 4PS7A 3G2UA 4NVQA 3JXJA 3IXEA 2NXPA 4Q69A 3SZ7A 1N0RA 3O4ZA 3PZDA 3ONLA 1NL4A 5D2MC 3FU6A 3PZ2A 5LSZA 5J90A 4RQIA 2WMNA 1HU3A 1DNPA 3ABLE 4JHJA 2XRZA 1Z3XA 5FTPA 3AJIA 1IQUA 3SBTB 2QY7A 1SA4A 4DX7D 3S8PA 3AU4A 3C3RA 3E32A 2DBAA 3L08A 3TJPA 4EBAG 5M72A 4IN3B 3VLFA 4A3TA 2E2EA 4AY5A 3EHRA 5AQ9A 3ULQA 2VJ8A 1JPLA 4WNGA 2VGYA 1NZNA 3JXIA 5FZSA 4GCNA 1LF8A 2WXRA 2LSUA 3IHYA 3T5VA 4F6RD 1XNFA 2DIWA 4KVOA 3SFXA 3V2OA 2BUGA 3CLJA 4GYWA 5LFAA 2KXPC 3EP0A 3DSTA 1G3NB 3HVEB 3QWPA 4HOQA 2WB2A 4RZ0A 1Z5SC 3FUEA 4QENA 4IULA 3QWVA 3QAQA 1VDYA 4U96D 5HI7A 2XRYA 2XGSA 2CG3A 3R9MA 4BTAA 3SFZA 3CVNA 1SA5A 2IQCA 5G05C 5CECB 3RAUA 1HXIA 2ILRA 3DEOA 1MVXA 3RO3A 1N94A 5FQ7A 5AENA 2XQ0A 4E6HA 3PZ4A 3NQPA 3VV0A 1WM5A 2XENA 5TH7A 3PNLB 2FEZA 3SF4A 2OVFA 2OV8A 4UI9C 4B8CB 3KEAA 3CBMA 2ZGDA 1H2VC 4GMJA 2OOEA 3HNAA 3FU5A 3PRZA 2L0TB 3DSVA 2GRRB 4KBQA 3TWXA 2X6KA 1BD8A 5KBAA 3MV2B 4UI9K 3FTSA 1PEGA 4N2QA 3UQ3A 4O60A 1FT2A 4AJWA 4GYYA 3ASDA 4DI4A 3K5KA 5HRYA 4CDNA 3ZNGA 4A63B 2L0IA 1IYGA 3PE3A 4LG6A 1W3BA 3KSLA 3GZSA 4DRXE 3NBNB 2P9PG 4H7YA 5C1DA 2OCCE 2R02A 3Q73A 3Q5MA 4YDWA 3ASNE 1XGWA 2DCPA 4YDOA 2H6FA 2IO3C 5KJNA 3PS6A 5BV0A 4XX5A 3ENEA 4B89A 3LDZA 3V79K 1QZ2A 3Q75A 3FU0A 4GTSA 2AVPA 3B7TA 3LY9A 1E7UA 3V30A 1RZ4A 1O1TA 3QB2A 3B13A 4HORA 2R59A 4XKBA 2R03A 4TUMA 1Y6IA 4U8VD 3CVPA 2WMOA 5G05J 4AY6A 1TNYA 1OCOE 4YDEA 1FCHA 2KATA 3CBOA 1N0QA 4RLYA 1IHGA 4ME2A 5D0QD 1XQHA 3K9IA 4HS2A 2F8XK 4M3OA 5H7PA 4NACA 3BG1B 4DPRA 5JJ7A 5CMWA 3FDHA 3MKQB 3FUIA 4HRMB 5LP0A 1KT0A 4A1GA 4QEOA 4HBDA 5KWDA 1MX6A 2X38A 1ELRA 4UI9J 3Q78A 5F6LA 4UWFA 3C98A 3D9PA 4WWNA 5JJ0A 4E47A 2PQNA 3NB2A 1V55E 4I6JA 3FY4A 3ESKA 4PDXA 1FVHA 1UJJA 4G8KA 4ZFHA 4DUIA 3ZXPA 4J8FA 4YPEA 2B0OE 5CRUA 4N3CA 3IBEA 5HQ8A 2WQHA 2LXMA 4YDYA 3U66A 4OVUA 3R7QA 1IQRA 1E7VA 1N4RA 3VTXA 3O48A 1MUFA 3KMJA 4GZ5A 3PVLA 2MRIA 1KT1A 4O1OA 1N4QA 1DVPA 4AIFA 4BEPA 2J4DA 3MCXA 3FEXA 2IU1A 1WG0A 3JYSA 4ABNA 4XKCA 2DYSE 4GA1A 3MX3A 4CCAA 5KJLA 3HXFA 2GRQB 3V31A 1TR4A 4UUCA 2YQ8A 4GU5A 5AIJA 5LSXA 3AG2E 2GRPB 2LNIA 5T8IA 4YNPA 4QEPA 4EZLA 2CHXA 2EILE 1SW6A 2VGXA 2EQXA 1HS6A 4DI3A 2CHWA 3BO5A 4JDSA 4ILHB 1LTXA 1X5BA 1O5MA 3D9JA 3PUKA 4ACLA 5FZRA 5JHBA 3KMTA 4I17A 2AXZA 4ILIA 1KLXA 2LAIA 1N52A 3D9KA 3ZU7B 3TWSA 4LEUA 4UQXA 2Q7FA 3G2WA 1KZPA 3UTMA 4CDRA 2H6GA 2WQ6A 4J8EA 2YNQA 4HOTA 5AJDA 3U9WA 3SNXA 4PS3A 4PH4B 2F69A 3ZUVB 4YNMA 5B3SE 3DSXA 4GTRA 1BLXB 2JEKA 4RG9A 3AU5A 3AS4A 1OCZE 3GW4A 3U3WA 3DPDA 4A55A 1TNBA 3FTVA 2WXGA 3HXEA 3SBSA 3KEZA 4YPUA 4G23A 5T5GA 5ENNA 4KYOB 2A5EA 3TXNA 4BUPA 2QYUA 4C1QA 5T0MA 5ENRD 4F53A 4GB9A 3I4RB 3KMAA 1INZA 1EDUA 3CHRA 4CT4A 1DCQA 4Q96A 4GMRA 5JA4D 1E8XA 5LCWC 3RSEG 2WXFA 3FTWA 3TXMA 4J6IA 2AXVA 1A5EA 2F8YA 2VTBA 4BT8A 4LCTA 3LEWA 1QYMA 3HDXA 1D8DA 1EF1C 3N71A 5HKPA 2EINE 4MLPA 2XEVA 3DSUA 3QNKA 3ZW3A 3ESLA 4I1OB 3DWLG 4L1BA 4AV7A 3DXKG 1U3DA 1BI7B 4TUUA 2GW1A 3HHMA 3U4TA 4TRQA 3CV0A 2V5FA 5G55A 3ZYMA 2P9SG 1UOHA 3B7RL 4J8SA 1ML9A 1SQMA 2IOLA 4JEUA 2I1JA 5FIOA 2R5SA 4OVVA 3SD5A 2IF4A 3AS8A 1MJ0A 3JUEA 1KZOA 5KNGA 3LKUA 2QFCA 2DWZA 1N6CA 3LYAA 3MEKA 4O1PA 1HH8A 2XPIA 3FTXA 2F37A 2V0PA 4GPKA 3D9IA 3RAYA 1TNUA 2HYZA 2ZIRA 1WAO1 2B6CA 1NI1A 3OPEA 2C2LA 3AG1E 2RFMA 1MX4A 4LNUD 4UWGA 3ZIMA 4APOA 3QDNA 4G26A 3ML9A 2IY0C 3UT4A 4DLQA 2WVIA 1JCQA 2ONDA 3PDNA 4R7LA 1YA0A 4FULA 3S7BA 4FA6A 5LCWJ 4N5QA 2P9UG 2I2OA 3DSWA 4BFRA 3F9WA 4HB5A 2R2LA 3CHQA 3FH5A 4J8OA 1K1BA 4J7FA 3JQ0A 3DXMG 2FO1E 1MQSA 3DALA 3Q49B 1FT1A 3CHPA 4HI8A 2OEWA 3W9GA 4JD2G 3CQCB 1PY1A 4U63A 4F1SA 4ATZD 3FP3A 4OAUC 3RK6A 2H6HA 4LRZA 3FU3A 5BXOA 2A5UA 1BU9A 3RJWA 4JPSA 3AAAC 4GTMA 5CBOA 3NOCD 2P58C 3UM0A 3PZ1A 4W9RA 2WXKA 5AARA 4F3VA 2IO2C 4A3VA 2JV0A 3J5PA 3D9MA 5D66A 3CK8A 3KSQA 3NAWA 4UWLA 1N3JA 4GTOA 4JZYA 4F1PA 2Y3AA 3TWUA 3T8KA 4G8LA 2CG2A 2VGXB 3E33A 4LDGA 4FLHA 1IKND 1OWLA 4N3BA 3ABME 5EIDA 2J07A 4FP7A 2RFAA 1WY6A 3PEUB 3RRNB 3APCA 4BSXA 1RW2A 3E37A 2FBNA 5E75A 1MHQA 2XZDG 4JA9A 3URZA 4UQYA 5EDSA 4N3AA 3OS5A 5J08A 1LD8A 3PNTB 4TXPA 1IXVA 2WXOA 4BX9A 2GRLA 5B1AE 2UWJG 3UT8A 5ANLA 2MHKA 5DIZA 2Y69E 3EHNA 3SGHA 3MV3B 3E4BA 4JA7A 2L6JA 5BUZA 5KJKA 3LS8A 2WPVA 5AQ7A 4GA2A 3KD7A 1TN8A 1H19A 2H6IA 3M55A 2NYJA 1FVFA 1OCCE 4WNDA 3FEYA 3DBSA 1JCRA 3CVUA 2R3AA 1Q2ZA 3FTUA 2XS8A 3VTYA 2WXHA 3M58A 1HFAA 4KZ0A 4N2SA 2AJAA 2G46A 1N54A 4GTPA 3EIQC 4HRLA 2W5ZA 1TN6A 4FLBA 2X6JA 1H2UA 5CEAA 4LUNU 3CVWA 4L2LA 3GYZA 4JXTA 2Y0BG 5LOZA 3Q7FA 2FI7A 2CHZA 3VLEA 2X6FA 2X6IA 1ZU2A 2EIJE 4BESA 3KAEA 3F9XA 3RJVA 4LNGA 4J7IA 2KCVA 4G25A 3ZVVA 1TNOA 5CERB 4C0EA 4IJDA 3T5XA 2O8JA 4ANXA 3SHFA 2WXQA 4ILGA 4XZ4A 5F5EA 1Z6TA 4Z4PA 3M53A 4BETA 3UIOC 1ZB1A 2PZIA 3UMVA 1D8EA 1UW4B 1BPOA 3EHMA 2BEDA 4FADA 2IEJA 3HXDA 1NA0A 4TXRA 5EYPF 3IEGA 4H12A 3FPDA 3CGHA 5CHEE 3IHVA 4NRHB 1JUQA 3UM1A 3FTYA 1MYOA 3NF1A 5AAOA 2A4ZA 2FF4A 4K5BA 2LSVA 4BSZB 3LY8A 4I2WA 2RKKA 5LX8A 1MZCA 1QQEA 4EZJA 5G04C 4K03A 3M54A 4NQ0A 3PH0C 2ETBA 2GRNB 3CKCA 4NIKA 4O30A 2AW6A 1MT6A 2XPZA 1H6KA 2VGEA 2J09A 3P2BA 4HVBA 1E8ZA 2WXIA 3D3MA 3PUJA 1K3ZD 4NURA 4AXHA 1L5JA 3LPZA 3IHXA 2GRMA 2WXPA 4GTTA 4ZHBA 4YNDA 2DVWA 3MKRA 3SO8A 2J08A 2W5YA 2BQZA 1SZ9A 4GZ3A 3BUAA 3E30A 3B7SA 3FH7A 4FMUA 3S7JA 2WXMA 2XPYA 3D9HA 3M59A 4LNBA 1S70B 4HNAD 1HO8A 3DPYA 4URKA 4ATGA 1DCEA 2CFUA 4WWPA 3HXCA 2RD0A 2Y1LE 4RG6A 4TV3A 2WQ7A 4C9BB 2LO6A 2IONA 2V8SE 3T8MA 4YVQC 2MYOA 3UPVA 5BV1A 4DK5A 3PE4A 5T4YA 3M57A 5BW8C 3FUFA 3FUJA 3QC1A 5BNWA 3V2XA 1PC2A 4B94A 1YCSB 1N4SA 5BPPA 3RQ4A 2OEVA 4KT6B 1AP7A 1N11A 4BWRA 3TAXA 4MI5A 2XS1A 4MKTA 2X6HA 3ASHA 3EU5A 1YYHA 4RSYA 3LVQE 4I51A 2C0MA 5ENSD 2AWIA 4K5AB 4CEMA 4UWHA 3UX4A 3VUZA 3SY2A 4X8QA 3D9NA 1A17A 4CDMA 4GZCA 3C3OA 4JC8A 4J7WA 1KPSB 4I1AA 3UM3A 1E90A 4AEZC 3JQ1A 4WUYA 4KZCA 4KXKB 2XGOA 3OAWA 4FJYA 4PS8A 3CSTA 5ENPD 4EQFA 3F9ZA 3NZUA 2HR2A 3RRUA 5ENOD 2RFIA 2KZTA 2VSNA 1WDYA 3TWRA 3CVXA 2DZOA 4U8HA 3FUDA 2NSZA 3S7FA 2VYIA 1S0PA 3E34A 2E0IA 5KCMA 4DLOA 5E76A 4U8YD 1K8KG 4F7AA 2AXUA 2P9NG 3ONKA 2ZU6B 3ULEG 4I6EA 5JHNA 2QC9A 3CK9A 2Y4TA 1YMPA 1O1SA 2L9BA 5A7DB 3MKQA 1UJKA 2PM7A 4CRWA 2P9IG 5FT9A 1HX8A 3B95A 2PQRA 3ZKJA 3AS5A 4J8YA 4L23A 3CVVA 4FHKA 3OOIA 3S2AA 1H6OA 1SVXA 3CSFA 2EIME 4H7XA 4HFGA 5JMND 2P9LG 3EDTB 3ABKE 3CHMA 3HXBA 3AG3E 5FWQA 2ETCA 5AJLA 3BEEA 1FPPA 4C48B 3CVQA 1ZKKA 1LD7A 2PL2A 1Z3YA 4BERA 5CCMA 3MO0A 4GMLA 4CGVA 1N4PA 1TEZA 2BF0X 4GPMA 4HOUA 4GCOA 3MJWA 3L22A 3DB5A 3LJ3A 4AP2A 1S64A 3CBPA 1N95A 5CCLA 3ZXSA 2L6BA 3APDA 3SFYA 5JHAA 2IFUA
chains in the Genus database with same CATH topology
4K0RA 4CGWA 5FQ8A 3VTXA 3KD7A 3F9YA 3O48A 1MUFA 4APFA 3P1UA 2KC7A 4NJ5A 4IRUA 3KMJA 1H19A 3CKBA 5CMYA 3ZRHA 5A6CA 3GZ1A 4GZ5A 3M55A 1FVFA 3PVLA 2MRIA 1KT1A 4XIFA 1DVPA 4JEHA 5FZQA 2J4DA 4AIFA 4WNDA 1N6AA 5T3RA 3MCXA 3FEXA 3FEYA 3UT7A 2I9CA 4WWOA 2IU1A 4G1TA 1O9SA 3SWCA 3DBSA 2M63A 3CVUA 2R3AA 3JYSA 4ABNA 4J8DA 4KMOA 4XKCA 3ZHEB 2KM4A 3R9AB 3FTUA 2V4LA 3MGBA 4GA1A 3ZYQA 3MX3A 5C2YA 4AVXA 4DJAA 3TGOA 4AU7A 3I5PA 3VTYA 4CCAA 3CIAA 2WXHA 1OWOA 5KJLA 3M58A 2KCLA 2YQ8A 1HFAA 4WAFA 3OXGA 4KZ0A 4GU5A 5BT1A 4N2SA 3U64A 5AIJA 3QK0A 2G46A 1N54A 5LSXA 4IYPA 3FTZA 2VSOE 3EIQC 2LNIA 5T8IA 4YNPA 1JWFA 3ML8A 4EZLA 4QEPA 2CHXA 2W5ZA 3HIZA 4FLBA 2X6JA 3L54A 3FUMA 4XI9A 1H2UA 1SZAA 4YPAA 4LUNU 1MVHA 3CVWA 4L2LA 2VGXA 3GYZA 3L13A 4JXTA 3SI5A 5LOZA 1P5QA 4FU3A 4GA0A 2FI7A 2CHZA 1HS6A 2EQXA 2X6FA 3OXLA 2CHWA 3L6AA 2X6IA 3QKYA 5FQ4A 3G2VA 3LY7A 3ZN3A 4C0MA 4U04A 3BO5A 4JDSA 3FUKA 1ZU2A 2Y4UA 3APFA 4ILHB 5TEGA 1X5BA 3KAEA 3F9XA 3D9JA 3PUKA 3RJVA 4ACLA 5FZRA 5JHBA 4I6GA 4G2VA 3KMTA 4I17A 5JIYA 4J7IA 3FFLA 2KCVA 4G25A 2AXZA 3OTNA 1QNFA 2MOWA 4ILIA 4P29A 1KLXA 1U3CA 3ZVVA 2LAIA 3L17A 3MO2A 4J83A 4JHRA 1N52A 3D9KA 4I9CA 4C0EA 3FWVA 4JHKA 4IJDA 3T5XA 4MS6A 2J9QA 4LEUA 3QOUA 4UQXA 2CFZA 2Q7FA 4GYOA 3G2WA 4N5CA 3QWWA 2O8JA 4CDRA 4ANXA 5F59A 4I1MA 3SHFA 2WQ6A 2WXQA 4ILGA 4XZ4A 4J8EA 3MA5A 2UY1B 5F5EA 2YNQA 1Z6TA 4HOTA 1JWGA 4Z4PA 3RRMB 5AJDA 1ELWA 3U9WA 2XCBA 2FULA 3M53A 4EZKA 4J0UA 3SNXA 3Q4AB 4G24A 2RG8A 4PS3A 3FHEA 3MYVA 1EPUA 1NA3A 2PZIA 4PH4B 2F69A 3UMVA 4G11A 4YNMA 3IV0A 2YINA 1UW4B 1BPOA 3EHMA 4B8AA 4RG9A 2JEKA 1ZBPA 4HOSA 3LXUX 3TL5A 3AU5A 3AS4A 4FADA 3GW4A 4HXIA 3MZLB 3DPDA 3U3WA 1NP7A 4A55A 1UG3A 2C0LA 1NA0A 3FTVA 4PS7A 4RVBA 3G2UA 4H12A 3IEGA 4OYSA 4NVQA 2WXGA 2XCCA 4JL0A 3FPDA 3CGHA 5CHEE 3SBSA 3KEZA 3FULA 3IHVA 4NRHB 4UQZA 1JUQA 3FTYA 3CK7A 3NF1A 2NXPA 3JCKC 4Q69A 4YPUA 3SZ7A 3R7QA 3O4ZA 3BG0B 2A4ZA 3PZDA 5TTFA 3ONLA 4GZDA 4G23A 2FF4A 5T5GA 4JW1A 5ARGA 3D9LA 2LSVA 4KYOB 5ENNA 3ZHEA 2PM6A 3TXNA 4BUPA 3FU6A 3LY8A 5LSZA 4C1QA 2XGMA 5J90A 4I2WA 2WMNA 1HU3A 1DNPA 1UN8A 4JHJA 2XRZA 5LX8A 1QQEA 1Z3XA 5FTPA 5T0MA 1IQUA 3SBTB 4EZJA 2QY7A 4F53A 4GB9A 5G04C 3I4RB 4K03A 4Q94A 3KMAA 3S8PA 1INZA 1EDUA 3M54A 3AU4A 3CHRA 4CT4A 3VLEA 4NQ0A 2IOSA 4Q96A 2DBAA 3L08A 3PH0C 3TJPA 1E8XA 2WXJA 4EBAG 5M72A 3OXFA 4IN3B 5LCWC 3VLFA 4A3TA 2WXFA 2E2EA 3FTWA 4AY5A 4E85A 3RO2A 3TXMA 3ZYKA 4J6IA 3CKCA 4O30A 2AW6A 3S7DA 2LAHA 3ULQA 5CPRB 2AXVA 3RU0A 2VJ8A 1MT6A 2GGFA 1JPLA 4QFVA 4WNGA 3ZGQA 2XPZA 2VTBA 3M5AA 2VGYA 1NZNA 3I4GA 1H6KA 5FZSA 4GCNA 2J09A 1LF8A 3P2BA 4HVBA 2R17C 1E8ZA 2WXRA 1OWMA 4BT8A 2LSUA 2WXIA 3D3MA 3IHYA 3T5VA 3PUJA 4LCTA 3LEWA 1XNFA 3WXXA 3HDXA 4ANVA 4NURA 4AXHA 1L5JA 2DIWA 1EF1C 3LPZA 2GRMA 4KVOA 4AM9A 3N71A 3IHXA 2IJGX 2WXPA 3MO5A 2BUGA 3CLJA 3I3NA 3Q47B 4GYWA 5LFAA 4YNDA 3EP0A 5AYFA 3MKRA 4L7TA 2HM8A 2J08A 3HVEB 2W5YA 3QWPA 3R7RA 2BQZA 1SZ9A 4U0UA 4CT0A 4HOQA 4GZ3A 4MLPA 2WB2A 4RZ0A 2XEVA 3QNKA 2VTBB 2UY1A 3ESLA 3ZW3A 4I1OB 3FUEA 3PREA 4QENA 4IULA 3QWVA 5JJTA 3B7SA 3QAQA 3FH7A 4Y6WA 3QJZA 4FMUA 4L1BA 1VDYA 2KZTB 3ZEFA 3S7JA 2WXMA 2XPYA 5HI7A 4AV7A 2XRYA 2XGSA 3M59A 2CG3A 3ASFA 4BTAA 1U3DA 4TUUA 3SFZA 2GW1A 3HHMA 3CVNA 4BTBA 2IQCA 3U4TA 4TRQA 1HO8A 3CV0A 4D10C 2V5FA 5G55A 5G05C 3ZYMA 4URKA 4ATGA 4HLEA 2BTDA 2CFUA 4V3IA 5EG2A 3B7RL 4WWPA 4J8SA 1ML9A 1HXIA 1SQMA 2ILRA 1MVXA 2IOLA 2RD0A 2I1JA 4JEUA 4RG6A 3RO3A 4TV3A 2WXLA 3ZYLA 2WQ7A 4C9BB 2XHEA 2R5SA 2VSXE 5FQ7A 4OVVA 3CVYA 5AENA 3SD5A 2LO6A 1H2TC 2IONA 1OWNA 2V8SE 2XQ0A 4XE0A 1TJFA 2IF4A 3T8MA 4E6HA 3D9OA 4YVQC 3UPVA 3AS8A 3NQPA 3VV0A 1WM5A 5BV1A 4DK5A 5TH7A 3PE4A 5T4YA 3LKUA 3PNLB 3M57A 2FEZA 5BW8C 3FUFA 2QFCA 4BT9A 3FUJA 3SF4A 4BY6A 2OVFA 3FH8A 3QC1A 2YHCA 3LYAA 3MEKA 5BNWA 1N6CA 1HH8A 2VSYA 1OWPA 1PC2A 2OV8A 4U0ZA 2XPIA 3FTXA 4B94A 1HE8A 4UI9C 2V0PA 3ASGA 4B8CB 3CBMA 4GPKA 3D9IA 3RAYA 5BPPA 3RQ4A 1H2VC 2HYZA 4GMJA 4KT6B 4EBAA 3CHOA 4BWRA 2OOEA 3TAXA 3HNAA 3FU5A 3PRZA 4MI5A 2L0TB 4MKTA 5DBKA 1WAO1 2X6HA 4KBQA 2X6KA 4O6FA 3ASHA 2QPWA 3LCAA 4ACKA 3MV2B 4UI9K 3FTSA 4RSYA 1PEGA 4N2QA 3UQ3A 3LVQE 4I51A 2C0MA 3OPEA 4AJWA 2C2LA 3CR3A 3QARA 2AWIA 4GYYA 3ASDA 4UWGA 2J4BA 4CEMA 4DI4A 3K5KA 3ZIMA 4CDNA 4APOA 3QDNA 4G26A 1HF8A 4UWHA 5JINA 3ML9A 3UX4A 3UT4A 3VUZA 4DLQA 2WVIA 2L0IA 4I2ZA 1IYGA 3D9NA 1A17A 3PE3A 3EIJA 4JLGA 1W3BA 4CDMA 3GZSA 4GZCA 2ONDA 2OVBA 3PDNA 4JC8A 4LERA 4I1AA 4R7LA 4IJ8A 1YA0A 4H7YA 4B0ZA 4FULA 3G2TA 3S7BA 4WNEA 4EECA 5JJ6A 5C1DA 4FA6A 5EX3A 5LCWJ 1E90A 4AEZC 3PEVB 4FC8A 1PAQA 4PUCA 3JQ1A 2IGQA 4WUYA 3HVEA 2I2OA 1H0AA 4KZCA 4KXKB 3VLDA 5KJMA 2XGOA 4WNFA 3Q5MA 4BFRA 3F9WA 3OAWA 4FJYA 3CHQA 3FH5A 4PS8A 4J8OA 3CSTA 4J7FA 4U07A 1E8YA 1HG2A 4EQFA 3JQ0A 3F9ZA 1XGWA 2HR2A 3NZUA 1MQSA 4JVSA 3DALA 3Q49B 3RRUA 2RFIA 3LVRE 2KZTA 2VSNA 3CHPA 5FQ6A 2KCKA 2DCPA 4FJZA 3CVXA 4MI0A 4U8HA 5KJNA 3FUDA 3RIBA 3CQCB 1PY1A 4U63A 4XI0A 2NSZA 3PS6A 3S7FA 5BV0A 2VYIA 4XX5A 4F1SA 3FUHA 3FP3A 3ZFWA 3RK6A 5EKQD 1S0PA 3ENEA 4B89A 3M56A 4LRZA 5KCMA 2E0IA 3FU3A 3LDZA 4Y6CA 4DLOA 5E76A 2WM9A 2A5UA 1QZ2A 3RJWA 4F7AA 2AXUA 4JPSA 3FU0A 3UUXA 2WXNA 2AVPA 3B7TA 3ONKA 2ZU6B 3LY9A 2P58C 1E7UA 2I6HA 3FUNA 4I6EA 3ZPJA 3QB2A 3B13A 4W9RA 4HORA 2WXKA 5JHNA 2YHEA 3CK9A 2Y4TA 4F3VA 2R59A 4XKBA 4A3VA 2NC9A 3JUIA 1Y6IA 1B89A 2L9BA 3CVPA 5A7DB 5FJYA 3MKQA 2JV0A 3EJNA 2WMOA 5G05J 1UJKA 4AY6A 3IKOB 5D0OD 4L2YA 2VQ2A 2PM7A 5ANRA 3D9MA 4DI3A 5T0KA 4CRWA 1FCHA 2KATA 3CK8A 3CBOA 1OUVA 5FT9A 4ANWA 4UWLA 1IHGA 4ME2A 5D0QD 1HX8A 4A1SA 4UWKA 4JZYA 1N3JA 1XQHA 3K9IA 2Y3AA 3CEQA 4HS2A 5AYWD 2PQRA 3AS5A 4L23A 2X3MA 3CVVA 4M3OA 4FHKA 5A23A 4BX8A 4ANUA 4NACA 3S2AA 3OOIA 3CSFA 3BG1B 4DPRA 5JJ7A 2CG2A 4H7XA 2VGXB 5CMWA 2JLBA 4LDGA 3G2SA 4HFGA 3FDHA 4FLHA 3EDTB 3MKQB 3B7UX 3FUIA 3CHMA 1H3IA 1HG5A 1Y8MA 3KS2A 3Q15A 4FHJA 3TG4A 1KT0A 4A1GA 5FWQA 5LP0A 4QEOA 4U0SA 1OWLA 4N3BA 5AJLA 3NZSA 4GZ6A 2J07A 4N39A 2X38A 2FO7A 1ELRA 3L16A 4UI9J 4FP7A 4EPZA 5G2NA 3BEEA 1WY6A 3HYMB 5F6KC 5F6LA 4UWFA 3C98A 3PEUB 3D9PA 4WWNA 2J49A 3RRNB 3CVQA 3APCA 4BSXA 1ZKKA 3SW9A 2PL2A 1Z3YA 5JJ0A 3CVLA 4E47A 2PQNA 1ELKA 5CCMA 3MO0A 2FBNA 1TJCA 4GMLA 4I9EA 5E75A 3CHSA 1MHQA 4CGVA 4JA9A 4I6JA 5ARFA 3URZA 4UQYA 3FY4A 4N3AA 1EYHA 2HO1A 5EX0A 1GW6A 5EDSA 1TEZA 3OS5A 5J08A 1E8WA 3ESKA 3PNTB 2BF0X 4HOUA 4GCOA 4PDXA 3MJWA 2WXOA 4BX9A 2GRLA 1FVHA 1UJJA 2UWJG 3UT8A 5ANLA 1E96B 3TG5A 2MHKA 5DIZA 4GA2A 3L22A 4MRUA 3GZ2A 4I43A 3DB5A 4J8FA 3EHNA 3LJ3A 3CQGB 4YPEA 1UN9A 4N3CA 4AP2A 3IBEA 5G04J 3RKVA 3SGHA 3MV3B 3CBPA 3E4BA 4JA7A 5CCLA 3ZXSA 5HQ8A 2WQHA 1HZ4A 2L6JA 4GAAA 4AOFA 3LS8A 5BUZA 5KJKA 3APDA 2I1KA 2WPVA 4YVOA 5JHAA 3U66A 4KVMA 4OVUA 1IQRA 2IFUA 1E7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGW A;  3VTX A;  3KD7 A;  3F9Y A;  3O48 A;  1MUF A;  2KC7 A;  4NJ5 A;  3KMJ A;  3CKB A;  5A6C A;  3GZ1 A;  4GZ5 A;  3M55 A;  1KT1 A;  4XIF A;  5FZQ A;  4AIF A;  1N6A A;  4WND A;  4G1T A;  1O9S A;  3SWC A;  2R3A A;  3JYS A;  4ABN A;  4J8D A;  3ZHE B;  3R9A B;  4GA1 A;  3TGO A;  4AU7 A;  3VTY A;  5KJL A;  3M58 A;  2KCL A;  2YQ8 A;  3OXG A;  5BT1 A;  4N2S A;  2G46 A;  5LSX A;  2LNI A;  4YNP A;  4QEP A;  2W5Z A;  4XI9 A;  4YPA A;  1MVH A;  2VGX A;  3GYZ A;  1P5Q A;  4GA0 A;  2FI7 A;  3QKY A;  3OXL A;  3BO5 A;  3ZN3 A;  3LY7 A;  4U04 A;  4JDS A;  1ZU2 A;  2Y4U A;  5TEG A;  3KAE A;  3F9X A;  3RJV A;  5FZR A;  4G2V A;  3KMT A;  4I17 A;  5JIY A;  4J7I A;  3FFL A;  2KCV A;  4G25 A;  3MO2 A;  1KLX A;  4J83 A;  4JHR A;  4I9C A;  3FWV A;  4IJD A;  2J9Q A;  4LEU A;  3QOU A;  4UQX A;  4GYO A;  2Q7F A;  4N5C A;  3QWW A;  2O8J A;  4CDR A;  5F59 A;  4J8E A;  3MA5 A;  2UY1 B;  5F5E A;  4HOT A;  4Z4P A;  1ELW A;  2XCB A;  3M53 A;  4J0U A;  3Q4A B;  4G24 A;  2PZI A;  1NA3 A;  2F69 A;  4YNM A;  4RG9 A;  4HOS A;  1ZBP A;  3AS4 A;  3GW4 A;  3U3W A;  2C0L A;  1NA0 A;  4H12 A;  3IEG A;  4NVQ A;  3FPD A;  2XCC A;  4JL0 A;  5CHE E;  4NRH B;  4UQZ A;  3CK7 A;  3NF1 A;  4YPU A;  3SZ7 A;  4G23 A;  2FF4 A;  5T5G A;  5ARG A;  3ZHE A;  2LSV A;  4KYO B;  4BUP A;  3LY8 A;  5LSZ A;  4C1Q A;  2XGM A;  4I2W A;  1QQE A;  5FTP A;  5T0M A;  5G04 C;  3KMA A;  3S8P A;  3M54 A;  4NQ0 A;  2DBA A;  5M72 A;  3OXF A;  4IN3 B;  5LCW C;  2E2E A;  4AY5 A;  3RO2 A;  3CKC A;  4O30 A;  3S7D A;  3ULQ A;  5CPR B;  3RU0 A;  1MT6 A;  4WNG A;  3ZGQ A;  3M5A A;  2VGY A;  1NZN A;  5FZS A;  4GCN A;  4BT8 A;  2LSU A;  1XNF A;  3WXX A;  3LPZ A;  3IHX A;  4AM9 A;  3N71 A;  3MO5 A;  2BUG A;  3Q47 B;  4GYW A;  4YND A;  3EP0 A;  5AYF A;  3MKR A;  2W5Y A;  3QWP A;  2BQZ A;  4U0U A;  4HOQ A;  4GZ3 A;  4RZ0 A;  2XEV A;  2UY1 A;  4QEN A;  3QWV A;  5JJT A;  4Y6W A;  4FMU A;  3S7J A;  5HI7 A;  2XGS A;  3M59 A;  3ASF A;  4BTA A;  2GW1 A;  3CVN A;  4BTB A;  3U4T A;  3CV0 A;  2V5F A;  5G05 C;  5EG2 A;  1ML9 A;  1HXI A;  1MVX A;  3RO3 A;  4RG6 A;  2R5S A;  2IF4 A;  4YVQ C;  3UPV A;  3AS8 A;  3VV0 A;  1WM5 A;  5TH7 A;  3PE4 A;  3LKU A;  3M57 A;  2FEZ A;  5BW8 C;  2QFC A;  4BT9 A;  3SF4 A;  1N6C A;  2YHC A;  3LYA A;  3MEK A;  5BNW A;  1HH8 A;  2VSY A;  1PC2 A;  4U0Z A;  2XPI A;  4B94 A;  4UI9 C;  3ASG A;  3CBM A;  4GPK A;  3RAY A;  3RQ4 A;  2HYZ A;  4BWR A;  2OOE A;  3TAX A;  3HNA A;  4MI5 A;  5DBK A;  1WAO 1;  4KBQ A;  4O6F A;  2QPW A;  3ASH A;  3LCA A;  3MV2 B;  4UI9 K;  1PEG A;  4N2Q A;  3UQ3 A;  4I51 A;  2C0M A;  3OPE A;  2C2L A;  4GYY A;  3ASD A;  3K5K A;  4APO A;  3QDN A;  4G26 A;  5JIN A;  3VUZ A;  4I2Z A;  1IYG A;  1A17 A;  3PE3 A;  4JLG A;  1W3B A;  2OND A;  3PDN A;  4I1A A;  4IJ8 A;  1YA0 A;  4H7Y A;  3S7B A;  4WNE A;  5JJ6 A;  5C1D A;  5EX3 A;  5LCW J;  2IGQ A;  4WUY A;  4KXK B;  5KJM A;  2XGO A;  4WNF A;  3Q5M A;  3F9W A;  4J8O A;  4J7F A;  4U07 A;  4EQF A;  3F9Z A;  2HR2 A;  3DAL A;  3Q49 B;  2RFI A;  2VSN A;  2KCK A;  4MI0 A;  5KJN A;  3RIB A;  4XI0 A;  3S7F A;  2VYI A;  3FP3 A;  3ZFW A;  5EKQ D;  3M56 A;  4Y6C A;  1QZ2 A;  3RJW A;  3UUX A;  2AVP A;  3LY9 A;  2P58 C;  2I6H A;  3ZPJ A;  4W9R A;  4HOR A;  5JHN A;  3CK9 A;  2Y4T A;  4F3V A;  2NC9 A;  1B89 A;  3CVP A;  5A7D B;  5FJY A;  2JV0 A;  5G05 J;  4AY6 A;  5D0O D;  2VQ2 A;  5T0K A;  1FCH A;  2KAT A;  3CK8 A;  3CBO A;  1OUV A;  5FT9 A;  1IHG A;  4ME2 A;  5D0Q D;  4A1S A;  1N3J A;  1XQH A;  3K9I A;  3CEQ A;  5AYW D;  2PQR A;  3AS5 A;  3OOI A;  5JJ7 A;  4H7X A;  2VGX B;  2JLB A;  4LDG A;  3EDT B;  1H3I A;  1Y8M A;  3Q15 A;  3KS2 A;  3TG4 A;  5TTF A;  1KT0 A;  4QEO A;  4U0S A;  4N3B A;  4GZ6 A;  4N39 A;  2FO7 A;  1ELR A;  4UI9 J;  3BEE A;  3HYM B;  5F6K C;  5F6L A;  3CVQ A;  1ZKK A;  3SW9 A;  2PL2 A;  5JJ0 A;  3CVL A;  4E47 A;  2PQN A;  5CCM A;  3MO0 A;  2FBN A;  1TJC A;  4I9E A;  4CGV A;  4JA9 A;  5ARF A;  3URZ A;  4UQY A;  4N3A A;  5EX0 A;  2HO1 A;  3OS5 A;  3ESK A;  4HOU A;  4GCO A;  2UWJ G;  1E96 B;  3TG5 A;  2MHK A;  5DIZ A;  3DB5 A;  3GZ2 A;  4J8F A;  4YPE A;  4N3C A;  5G04 J;  3RKV A;  3MV3 B;  3CBP A;  3E4B A;  4JA7 A;  5CCL A;  5HQ8 A;  2WQH A;  1HZ4 A;  2L6J A;  5KJK A;  2WPV A;  4YVO A;  2IFU A;  4GA2 A; 
#chains in the Genus database with same CATH topology
 4K0R A;  4CGW A;  3Q9N C;  3F9Y A;  4APF A;  3P1U A;  2KC7 A;  4IRU A;  3CKB A;  5CMY A;  3ZRH A;  5A6C A;  4GTV A;  3T9K A;  1N6A A;  5CRV A;  3UT7 A;  4WWO A;  3SWC A;  2M63 A;  4J8D A;  4KMO A;  2KM4 A;  3R9A B;  3ZYQ A;  2V4L A;  3TGO A;  3I5P A;  1OWO A;  3ISM C;  3QK0 A;  2V4H C;  4IYP A;  3FTZ A;  2VSO E;  3ML8 A;  3HIZ A;  3L54 A;  4DX2 A;  3FUM A;  4M7C A;  4XI9 A;  1MVH A;  3L13 A;  1P5Q A;  4HRN A;  2GRO B;  4GA0 A;  3L6A A;  3ZN3 A;  3G2V A;  4U04 A;  1BI8 B;  3FUK A;  3APF A;  2DYR E;  2EIK E;  1K1A A;  3BQO A;  4I6G A;  3FFL A;  5CBN A;  2MOW A;  4P29 A;  3MO2 A;  1U3C A;  2R05 A;  4QQI A;  3FWV A;  2J9Q A;  2QZA A;  3QOU A;  5FIN A;  2CFZ A;  4GYO A;  3TWW A;  3QWW A;  2ZIS A;  5F59 A;  3MA5 A;  5EYL A;  3LJN A;  1JWG A;  3UIN C;  1ELW A;  2XCB A;  4TXQ A;  4J0U A;  4G24 A;  3FHE A;  3MYV A;  1NA3 A;  4G11 A;  3DSS A;  2ETA A;  4B93 B;  5ENT D;  4HOS A;  1ZBP A;  3TL5 A;  3X2Q E;  3MZL B;  3TWV A;  1NP7 A;  1UG3 A;  4U7E B;  2ZGG A;  4OYS A;  2XCC A;  4JL0 A;  5IY5 E;  3FUL A;  2J8S D;  4UQZ A;  3CK7 A;  3JCK C;  3BG0 B;  4GZD A;  4JW1 A;  5ARG A;  3D9L A;  3ZHE A;  2PM6 A;  5EN5 D;  2XGM A;  1UN8 A;  2LUH A;  3Q7A A;  4Q94 A;  2DZN A;  2IOS A;  2WXJ A;  1AWC B;  3OXF A;  3BU8 A;  4E85 A;  3RO2 A;  3ZYK A;  3S7D A;  2LAH A;  5CPR B;  5EIL A;  3RU0 A;  2GGF A;  3ZGQ A;  4QFV A;  3UIP C;  1TNZ A;  3M5A A;  3I4G A;  4GTQ A;  2R17 C;  1OWM A;  2KBX A;  3HG0 D;  3WXX A;  4ANV A;  4AM9 A;  3MO5 A;  2IJG X;  3I3N A;  3Q47 B;  5AN8 A;  5AYF A;  4L7T A;  2HM8 A;  3R7R A;  4U0U A;  4CT0 A;  1U2V G;  1IHB A;  2HE0 A;  2VTB B;  2UY1 A;  3PRE A;  3SQV A;  5JJT A;  4Y6W A;  3QJZ A;  2KZT B;  3ZEF A;  3W9F A;  2F0Y A;  3UXG A;  3ASF A;  2QYJ A;  4BTB A;  4D10 C;  3AG4 E;  4HLE A;  2BTD A;  5EG2 A;  4V3I A;  2WXL A;  3ZYL A;  4Z68 A;  3WG7 E;  2XHE A;  2VSX E;  3CVY A;  3C5R A;  1H2T C;  4XE0 A;  1OWN A;  1TJF A;  3D9O A;  4BT9 A;  4BY6 A;  5HS0 A;  3FH8 A;  2YHC A;  4MBG A;  2VSY A;  1OWP A;  4U0Z A;  1HE8 A;  4DX1 A;  3ASG A;  3L9T A;  4EBA A;  3CHO A;  4DX5 D;  3ASO E;  5DBK A;  4O6F A;  2QPW A;  3LCA A;  4ACK A;  2BKG A;  5ITZ F;  3CR3 A;  3QAR A;  2J4B A;  5JIN A;  1HF8 A;  4I2Z A;  3EIJ A;  4JLG A;  2OVB A;  4LER A;  4IJ8 A;  3G2T A;  4EEC A;  4WNE A;  5JJ6 A;  5EX3 A;  3F6Q A;  3B7B A;  4HLL A;  3PEV B;  4FC8 A;  1PAQ A;  4PUC A;  2IGQ A;  3HVE A;  1H0A A;  4DX6 D;  3VLD A;  5KJM A;  4WNF A;  4U07 A;  1E8Y A;  1HG2 A;  4U95 D;  4JVS A;  4K5C A;  3LVR E;  5FQ6 A;  2KCK A;  4FJZ A;  4MI0 A;  3RIB A;  4XI0 A;  3FUH A;  3ZFW A;  5EKQ D;  3PZ3 A;  3M56 A;  4Y6C A;  2WM9 A;  4XEI G;  3UUX A;  4HI9 A;  2WXN A;  2I6H A;  3FUN A;  3ZPJ A;  1OY3 D;  2YHE A;  4OAV B;  3HRA A;  2NC9 A;  3JUI A;  3TWT A;  1B89 A;  5FJY A;  3EJN A;  2XEE A;  3ULY A;  5AQA A;  3IKO B;  5D0O D;  4L2Y A;  2VQ2 A;  5ANR A;  5T0K A;  1OUV A;  4ANW A;  4A1S A;  2P9K G;  4UWK A;  3CEQ A;  5AYW D;  1OT8 A;  2X3M A;  2XEH A;  3C3Q A;  3Q9U C;  5A23 A;  3DRA A;  4ANU A;  1MX2 A;  4BX8 A;  3EUV A;  2JLB A;  5AQB A;  3G2S A;  2LXL A;  3B7U X;  2P2C P;  1H3I A;  1HG5 A;  1Y8M A;  3KS2 A;  3Q15 A;  4FHJ A;  3TG4 A;  5TTF A;  4U0S A;  3NZS A;  4GZ6 A;  4N39 A;  2FO7 A;  3L16 A;  4EPZ A;  5EIB E;  5G2N A;  3HYM B;  5F6K C;  1QBQ A;  5ENQ D;  2J49 A;  3SW9 A;  3CVL A;  1ELK A;  1TJC A;  4I9E A;  3CHS A;  5ARF A;  1EYH A;  2HO1 A;  5EX0 A;  1GW6 A;  1E8W A;  3DEP A;  1E96 B;  3TG5 A;  4CYM D;  4MRU A;  3GZ2 A;  4I43 A;  3CQG B;  1UN9 A;  5G04 J;  3RKV A;  2V5Q C;  3NOG D;  1HZ4 A;  4GAA A;  3UM2 A;  4AOF A;  1DC2 A;  1H6P A;  1O1R A;  2I1K A;  3J5Q B;  4YVO A;  4KVM A;  5FQ8 A;  4NJ5 A;  2PNN A;  3GZ1 A;  4XIF A;  4JEH A;  5FZQ A;  3C72 A;  5T3R A;  1OXJ A;  2I9C A;  4G1T A;  1O9S A;  3ZHE B;  3MGB A;  4AVX A;  4AU7 A;  5C2Y A;  4DJA A;  3CIA A;  2KCL A;  4WAF A;  3OXG A;  5BT1 A;  1D9S A;  3U64 A;  2XZT G;  2JAB A;  1TYQ G;  1JWF A;  2ZXW E;  4JB8 P;  1JCS A;  1N9A A;  1OCR E;  3UKU G;  1SZA A;  4YPA A;  5CED B;  3SI5 A;  1X81 A;  4FU3 A;  2BKK B;  1NFI E;  3QKY A;  3OXL A;  4B0Z A;  5FQ4 A;  4C0M A;  3LY7 A;  2Y4U A;  4HQD A;  5TEG A;  4G2V A;  5KNH D;  1S63 A;  5JIY A;  3OTN A;  3TWQ A;  1QNF A;  4LSZ E;  3L17 A;  4J83 A;  4JHR A;  4I9C A;  4JHK A;  4MS6 A;  4N5C A;  4I1M A;  3EHQ A;  2UY1 B;  3L82 A;  3UKR G;  3RRM B;  1V54 E;  4CZ2 D;  2FUL A;  3Q79 A;  4EZK A;  5B1B E;  3Q4A B;  2RG8 A;  1EPU A;  4EHM A;  3UI2 A;  3IV0 A;  2YIN A;  3EU9 A;  4L9P A;  4B8A A;  5BXU A;  3LXU X;  4HXI A;  1TN7 A;  2C0L A;  4RVB A;  4PS7 A;  3G2U A;  4NVQ A;  3JXJ A;  3IXE A;  2NXP A;  4Q69 A;  3SZ7 A;  1N0R A;  3O4Z A;  3PZD A;  3ONL A;  1NL4 A;  5D2M C;  3FU6 A;  3PZ2 A;  5LSZ A;  5J90 A;  4RQI A;  2WMN A;  1HU3 A;  1DNP A;  3ABL E;  4JHJ A;  2XRZ A;  1Z3X A;  5FTP A;  3AJI A;  1IQU A;  3SBT B;  2QY7 A;  1SA4 A;  4DX7 D;  3S8P A;  3AU4 A;  3C3R A;  3E32 A;  2DBA A;  3L08 A;  3TJP A;  4EBA G;  5M72 A;  4IN3 B;  3VLF A;  4A3T A;  2E2E A;  4AY5 A;  3EHR A;  5AQ9 A;  3ULQ A;  2VJ8 A;  1JPL A;  4WNG A;  2VGY A;  1NZN A;  3JXI A;  5FZS A;  4GCN A;  1LF8 A;  2WXR A;  2LSU A;  3IHY A;  3T5V A;  4F6R D;  1XNF A;  2DIW A;  4KVO A;  3SFX A;  3V2O A;  2BUG A;  3CLJ A;  4GYW A;  5LFA A;  2KXP C;  3EP0 A;  3DST A;  1G3N B;  3HVE B;  3QWP A;  4HOQ A;  2WB2 A;  4RZ0 A;  1Z5S C;  3FUE A;  4QEN A;  4IUL A;  3QWV A;  3QAQ A;  1VDY A;  4U96 D;  5HI7 A;  2XRY A;  2XGS A;  2CG3 A;  3R9M A;  4BTA A;  3SFZ A;  3CVN A;  1SA5 A;  2IQC A;  5G05 C;  5CEC B;  3RAU A;  1HXI A;  2ILR A;  3DEO A;  1MVX A;  3RO3 A;  1N94 A;  5FQ7 A;  5AEN A;  2XQ0 A;  4E6H A;  3PZ4 A;  3NQP A;  3VV0 A;  1WM5 A;  2XEN A;  5TH7 A;  3PNL B;  2FEZ A;  3SF4 A;  2OVF A;  2OV8 A;  4UI9 C;  4B8C B;  3KEA A;  3CBM A;  2ZGD A;  1H2V C;  4GMJ A;  2OOE A;  3HNA A;  3FU5 A;  3PRZ A;  2L0T B;  3DSV A;  2GRR B;  4KBQ A;  3TWX A;  2X6K A;  1BD8 A;  5KBA A;  3MV2 B;  4UI9 K;  3FTS A;  1PEG A;  4N2Q A;  3UQ3 A;  4O60 A;  1FT2 A;  4AJW A;  4GYY A;  3ASD A;  4DI4 A;  3K5K A;  5HRY A;  4CDN A;  3ZNG A;  4A63 B;  2L0I A;  1IYG A;  3PE3 A;  4LG6 A;  1W3B A;  3KSL A;  3GZS A;  4DRX E;  3NBN B;  2P9P G;  4H7Y A;  5C1D A;  2OCC E;  2R02 A;  3Q73 A;  3Q5M A;  4YDW A;  3ASN E;  1XGW A;  2DCP A;  4YDO A;  2H6F A;  2IO3 C;  5KJN A;  3PS6 A;  5BV0 A;  4XX5 A;  3ENE A;  4B89 A;  3LDZ A;  3V79 K;  1QZ2 A;  3Q75 A;  3FU0 A;  4GTS A;  2AVP A;  3B7T A;  3LY9 A;  1E7U A;  3V30 A;  1RZ4 A;  1O1T A;  3QB2 A;  3B13 A;  4HOR A;  2R59 A;  4XKB A;  2R03 A;  4TUM A;  1Y6I A;  4U8V D;  3CVP A;  2WMO A;  5G05 J;  4AY6 A;  1TNY A;  1OCO E;  4YDE A;  1FCH A;  2KAT A;  3CBO A;  1N0Q A;  4RLY A;  1IHG A;  4ME2 A;  5D0Q D;  1XQH A;  3K9I A;  4HS2 A;  2F8X K;  4M3O A;  5H7P A;  4NAC A;  3BG1 B;  4DPR A;  5JJ7 A;  5CMW A;  3FDH A;  3MKQ B;  3FUI A;  4HRM B;  5LP0 A;  1KT0 A;  4A1G A;  4QEO A;  4HBD A;  5KWD A;  1MX6 A;  2X38 A;  1ELR A;  4UI9 J;  3Q78 A;  5F6L A;  4UWF A;  3C98 A;  3D9P A;  4WWN A;  5JJ0 A;  4E47 A;  2PQN A;  3NB2 A;  1V55 E;  4I6J A;  3FY4 A;  3ESK A;  4PDX A;  1FVH A;  1UJJ A;  4G8K A;  4ZFH A;  4DUI A;  3ZXP A;  4J8F A;  4YPE A;  2B0O E;  5CRU A;  4N3C A;  3IBE A;  5HQ8 A;  2WQH A;  2LXM A;  4YDY A;  3U66 A;  4OVU A;  3R7Q A;  1IQR A;  1E7V A;  1N4R A;  3VTX A;  3O48 A;  1MUF A;  3KMJ A;  4GZ5 A;  3PVL A;  2MRI A;  1KT1 A;  4O1O A;  1N4Q A;  1DVP A;  4AIF A;  4BEP A;  2J4D A;  3MCX A;  3FEX A;  2IU1 A;  1WG0 A;  3JYS A;  4ABN A;  4XKC A;  2DYS E;  4GA1 A;  3MX3 A;  4CCA A;  5KJL A;  3HXF A;  2GRQ B;  3V31 A;  1TR4 A;  4UUC A;  2YQ8 A;  4GU5 A;  5AIJ A;  5LSX A;  3AG2 E;  2GRP B;  2LNI A;  5T8I A;  4YNP A;  4QEP A;  4EZL A;  2CHX A;  2EIL E;  1SW6 A;  2VGX A;  2EQX A;  1HS6 A;  4DI3 A;  2CHW A;  3BO5 A;  4JDS A;  4ILH B;  1LTX A;  1X5B A;  1O5M A;  3D9J A;  3PUK A;  4ACL A;  5FZR A;  5JHB A;  3KMT A;  4I17 A;  2AXZ A;  4ILI A;  1KLX A;  2LAI A;  1N52 A;  3D9K A;  3ZU7 B;  3TWS A;  4LEU A;  4UQX A;  2Q7F A;  3G2W A;  1KZP A;  3UTM A;  4CDR A;  2H6G A;  2WQ6 A;  4J8E A;  2YNQ A;  4HOT A;  5AJD A;  3U9W A;  3SNX A;  4PS3 A;  4PH4 B;  2F69 A;  3ZUV B;  4YNM A;  5B3S E;  3DSX A;  4GTR A;  1BLX B;  2JEK A;  4RG9 A;  3AU5 A;  3AS4 A;  1OCZ E;  3GW4 A;  3U3W A;  3DPD A;  4A55 A;  1TNB A;  3FTV A;  2WXG A;  3HXE A;  3SBS A;  3KEZ A;  4YPU A;  4G23 A;  5T5G A;  5ENN A;  4KYO B;  2A5E A;  3TXN A;  4BUP A;  2QYU A;  4C1Q A;  5T0M A;  5ENR D;  4F53 A;  4GB9 A;  3I4R B;  3KMA A;  1INZ A;  1EDU A;  3CHR A;  4CT4 A;  1DCQ A;  4Q96 A;  4GMR A;  5JA4 D;  1E8X A;  5LCW C;  3RSE G;  2WXF A;  3FTW A;  3TXM A;  4J6I A;  2AXV A;  1A5E A;  2F8Y A;  2VTB A;  4BT8 A;  4LCT A;  3LEW A;  1QYM A;  3HDX A;  1D8D A;  1EF1 C;  3N71 A;  5HKP A;  2EIN E;  4MLP A;  2XEV A;  3DSU A;  3QNK A;  3ZW3 A;  3ESL A;  4I1O B;  3DWL G;  4L1B A;  4AV7 A;  3DXK G;  1U3D A;  1BI7 B;  4TUU A;  2GW1 A;  3HHM A;  3U4T A;  4TRQ A;  3CV0 A;  2V5F A;  5G55 A;  3ZYM A;  2P9S G;  1UOH A;  3B7R L;  4J8S A;  1ML9 A;  1SQM A;  2IOL A;  4JEU A;  2I1J A;  5FIO A;  2R5S A;  4OVV A;  3SD5 A;  2IF4 A;  3AS8 A;  1MJ0 A;  3JUE A;  1KZO A;  5KNG A;  3LKU A;  2QFC A;  2DWZ A;  1N6C A;  3LYA A;  3MEK A;  4O1P A;  1HH8 A;  2XPI A;  3FTX A;  2F37 A;  2V0P A;  4GPK A;  3D9I A;  3RAY A;  1TNU A;  2HYZ A;  2ZIR A;  1WAO 1;  2B6C A;  1NI1 A;  3OPE A;  2C2L A;  3AG1 E;  2RFM A;  1MX4 A;  4LNU D;  4UWG A;  3ZIM A;  4APO A;  3QDN A;  4G26 A;  3ML9 A;  2IY0 C;  3UT4 A;  4DLQ A;  2WVI A;  1JCQ A;  2OND A;  3PDN A;  4R7L A;  1YA0 A;  4FUL A;  3S7B A;  4FA6 A;  5LCW J;  4N5Q A;  2P9U G;  2I2O A;  3DSW A;  4BFR A;  3F9W A;  4HB5 A;  2R2L A;  3CHQ A;  3FH5 A;  4J8O A;  1K1B A;  4J7F A;  3JQ0 A;  3DXM G;  2FO1 E;  1MQS A;  3DAL A;  3Q49 B;  1FT1 A;  3CHP A;  4HI8 A;  2OEW A;  3W9G A;  4JD2 G;  3CQC B;  1PY1 A;  4U63 A;  4F1S A;  4ATZ D;  3FP3 A;  4OAU C;  3RK6 A;  2H6H A;  4LRZ A;  3FU3 A;  5BXO A;  2A5U A;  1BU9 A;  3RJW A;  4JPS A;  3AAA C;  4GTM A;  5CBO A;  3NOC D;  2P58 C;  3UM0 A;  3PZ1 A;  4W9R A;  2WXK A;  5AAR A;  4F3V A;  2IO2 C;  4A3V A;  2JV0 A;  3J5P A;  3D9M A;  5D66 A;  3CK8 A;  3KSQ A;  3NAW A;  4UWL A;  1N3J A;  4GTO A;  4JZY A;  4F1P A;  2Y3A A;  3TWU A;  3T8K A;  4G8L A;  2CG2 A;  2VGX B;  3E33 A;  4LDG A;  4FLH A;  1IKN D;  1OWL A;  4N3B A;  3ABM E;  5EID A;  2J07 A;  4FP7 A;  2RFA A;  1WY6 A;  3PEU B;  3RRN B;  3APC A;  4BSX A;  1RW2 A;  3E37 A;  2FBN A;  5E75 A;  1MHQ A;  2XZD G;  4JA9 A;  3URZ A;  4UQY A;  5EDS A;  4N3A A;  3OS5 A;  5J08 A;  1LD8 A;  3PNT B;  4TXP A;  1IXV A;  2WXO A;  4BX9 A;  2GRL A;  5B1A E;  2UWJ G;  3UT8 A;  5ANL A;  2MHK A;  5DIZ A;  2Y69 E;  3EHN A;  3SGH A;  3MV3 B;  3E4B A;  4JA7 A;  2L6J A;  5BUZ A;  5KJK A;  3LS8 A;  2WPV A;  5AQ7 A;  4GA2 A;  3KD7 A;  1TN8 A;  1H19 A;  2H6I A;  3M55 A;  2NYJ A;  1FVF A;  1OCC E;  4WND A;  3FEY A;  3DBS A;  1JCR A;  3CVU A;  2R3A A;  1Q2Z A;  3FTU A;  2XS8 A;  3VTY A;  2WXH A;  3M58 A;  1HFA A;  4KZ0 A;  4N2S A;  2AJA A;  2G46 A;  1N54 A;  4GTP A;  3EIQ C;  4HRL A;  2W5Z A;  1TN6 A;  4FLB A;  2X6J A;  1H2U A;  5CEA A;  4LUN U;  3CVW A;  4L2L A;  3GYZ A;  4JXT A;  2Y0B G;  5LOZ A;  3Q7F A;  2FI7 A;  2CHZ A;  3VLE A;  2X6F A;  2X6I A;  1ZU2 A;  2EIJ E;  4BES A;  3KAE A;  3F9X A;  3RJV A;  4LNG A;  4J7I A;  2KCV A;  4G25 A;  3ZVV A;  1TNO A;  5CER B;  4C0E A;  4IJD A;  3T5X A;  2O8J A;  4ANX A;  3SHF A;  2WXQ A;  4ILG A;  4XZ4 A;  5F5E A;  1Z6T A;  4Z4P A;  3M53 A;  4BET A;  3UIO C;  1ZB1 A;  2PZI A;  3UMV A;  1D8E A;  1UW4 B;  1BPO A;  3EHM A;  2BED A;  4FAD A;  2IEJ A;  3HXD A;  1NA0 A;  4TXR A;  5EYP F;  3IEG A;  4H12 A;  3FPD A;  3CGH A;  5CHE E;  3IHV A;  4NRH B;  1JUQ A;  3UM1 A;  3FTY A;  1MYO A;  3NF1 A;  5AAO A;  2A4Z A;  2FF4 A;  4K5B A;  2LSV A;  4BSZ B;  3LY8 A;  4I2W A;  2RKK A;  5LX8 A;  1MZC A;  1QQE A;  4EZJ A;  5G04 C;  4K03 A;  3M54 A;  4NQ0 A;  3PH0 C;  2ETB A;  2GRN B;  3CKC A;  4NIK A;  4O30 A;  2AW6 A;  1MT6 A;  2XPZ A;  1H6K A;  2VGE A;  2J09 A;  3P2B A;  4HVB A;  1E8Z A;  2WXI A;  3D3M A;  3PUJ A;  1K3Z D;  4NUR A;  4AXH A;  1L5J A;  3LPZ A;  3IHX A;  2GRM A;  2WXP A;  4GTT A;  4ZHB A;  4YND A;  2DVW A;  3MKR A;  3SO8 A;  2J08 A;  2W5Y A;  2BQZ A;  1SZ9 A;  4GZ3 A;  3BUA A;  3E30 A;  3B7S A;  3FH7 A;  4FMU A;  3S7J A;  2WXM A;  2XPY A;  3D9H A;  3M59 A;  4LNB A;  1S70 B;  4HNA D;  1HO8 A;  3DPY A;  4URK A;  4ATG A;  1DCE A;  2CFU A;  4WWP A;  3HXC A;  2RD0 A;  2Y1L E;  4RG6 A;  4TV3 A;  2WQ7 A;  4C9B B;  2LO6 A;  2ION A;  2V8S E;  3T8M A;  4YVQ C;  2MYO A;  3UPV A;  5BV1 A;  4DK5 A;  3PE4 A;  5T4Y A;  3M57 A;  5BW8 C;  3FUF A;  3FUJ A;  3QC1 A;  5BNW A;  3V2X A;  1PC2 A;  4B94 A;  1YCS B;  1N4S A;  5BPP A;  3RQ4 A;  2OEV A;  4KT6 B;  1AP7 A;  1N11 A;  4BWR A;  3TAX A;  4MI5 A;  2XS1 A;  4MKT A;  2X6H A;  3ASH A;  3EU5 A;  1YYH A;  4RSY A;  3LVQ E;  4I51 A;  2C0M A;  5ENS D;  2AWI A;  4K5A B;  4CEM A;  4UWH A;  3UX4 A;  3VUZ A;  3SY2 A;  4X8Q A;  3D9N A;  1A17 A;  4CDM A;  4GZC A;  3C3O A;  4JC8 A;  4J7W A;  1KPS B;  4I1A A;  3UM3 A;  1E90 A;  4AEZ C;  3JQ1 A;  4WUY A;  4KZC A;  4KXK B;  2XGO A;  3OAW A;  4FJY A;  4PS8 A;  3CST A;  5ENP D;  4EQF A;  3F9Z A;  3NZU A;  2HR2 A;  3RRU A;  5ENO D;  2RFI A;  2KZT A;  2VSN A;  1WDY A;  3TWR A;  3CVX A;  2DZO A;  4U8H A;  3FUD A;  2NSZ A;  3S7F A;  2VYI A;  1S0P A;  3E34 A;  2E0I A;  5KCM A;  4DLO A;  5E76 A;  4U8Y D;  1K8K G;  4F7A A;  2AXU A;  2P9N G;  3ONK A;  2ZU6 B;  3ULE G;  4I6E A;  5JHN A;  2QC9 A;  3CK9 A;  2Y4T A;  1YMP A;  1O1S A;  2L9B A;  5A7D B;  3MKQ A;  1UJK A;  2PM7 A;  4CRW A;  2P9I G;  5FT9 A;  1HX8 A;  3B95 A;  2PQR A;  3ZKJ A;  3AS5 A;  4J8Y A;  4L23 A;  3CVV A;  4FHK A;  3OOI A;  3S2A A;  1H6O A;  1SVX A;  3CSF A;  2EIM E;  4H7X A;  4HFG A;  5JMN D;  2P9L G;  3EDT B;  3ABK E;  3CHM A;  3HXB A;  3AG3 E;  5FWQ A;  2ETC A;  5AJL A;  3BEE A;  1FPP A;  4C48 B;  3CVQ A;  1ZKK A;  1LD7 A;  2PL2 A;  1Z3Y A;  4BER A;  5CCM A;  3MO0 A;  4GML A;  4CGV A;  1N4P A;  1TEZ A;  2BF0 X;  4GPM A;  4HOU A;  4GCO A;  3MJW A;  3L22 A;  3DB5 A;  3LJ3 A;  4AP2 A;  1S64 A;  3CBP A;  1N95 A;  5CCL A;  3ZXS A;  2L6B A;  3APD A;  3SFY A;  5JHA A;  2IFU A; 
#chains in the Genus database with same CATH homology
 4K0R A;  4CGW A;  5FQ8 A;  3VTX A;  3KD7 A;  3F9Y A;  3O48 A;  1MUF A;  4APF A;  3P1U A;  2KC7 A;  4NJ5 A;  4IRU A;  3KMJ A;  1H19 A;  3CKB A;  5CMY A;  3ZRH A;  5A6C A;  3GZ1 A;  4GZ5 A;  3M55 A;  1FVF A;  3PVL A;  2MRI A;  1KT1 A;  4XIF A;  1DVP A;  4JEH A;  5FZQ A;  2J4D A;  4AIF A;  4WND A;  1N6A A;  5T3R A;  3MCX A;  3FEX A;  3FEY A;  3UT7 A;  2I9C A;  4WWO A;  2IU1 A;  4G1T A;  1O9S A;  3SWC A;  3DBS A;  2M63 A;  3CVU A;  2R3A A;  3JYS A;  4ABN A;  4J8D A;  4KMO A;  4XKC A;  3ZHE B;  2KM4 A;  3R9A B;  3FTU A;  2V4L A;  3MGB A;  4GA1 A;  3ZYQ A;  3MX3 A;  5C2Y A;  4AVX A;  4DJA A;  3TGO A;  4AU7 A;  3I5P A;  3VTY A;  4CCA A;  3CIA A;  2WXH A;  1OWO A;  5KJL A;  3M58 A;  2KCL A;  2YQ8 A;  1HFA A;  4WAF A;  3OXG A;  4KZ0 A;  4GU5 A;  5BT1 A;  4N2S A;  3U64 A;  5AIJ A;  3QK0 A;  2G46 A;  1N54 A;  5LSX A;  4IYP A;  3FTZ A;  2VSO E;  3EIQ C;  2LNI A;  5T8I A;  4YNP A;  1JWF A;  3ML8 A;  4EZL A;  4QEP A;  2CHX A;  2W5Z A;  3HIZ A;  4FLB A;  2X6J A;  3L54 A;  3FUM A;  4XI9 A;  1H2U A;  1SZA A;  4YPA A;  4LUN U;  1MVH A;  3CVW A;  4L2L A;  2VGX A;  3GYZ A;  3L13 A;  4JXT A;  3SI5 A;  5LOZ A;  1P5Q A;  4FU3 A;  4GA0 A;  2FI7 A;  2CHZ A;  1HS6 A;  2EQX A;  2X6F A;  3OXL A;  2CHW A;  3L6A A;  2X6I A;  3QKY A;  5FQ4 A;  3G2V A;  3LY7 A;  3ZN3 A;  4C0M A;  4U04 A;  3BO5 A;  4JDS A;  3FUK A;  1ZU2 A;  2Y4U A;  3APF A;  4ILH B;  5TEG A;  1X5B A;  3KAE A;  3F9X A;  3D9J A;  3PUK A;  3RJV A;  4ACL A;  5FZR A;  5JHB A;  4I6G A;  4G2V A;  3KMT A;  4I17 A;  5JIY A;  4J7I A;  3FFL A;  2KCV A;  4G25 A;  2AXZ A;  3OTN A;  1QNF A;  2MOW A;  4ILI A;  4P29 A;  1KLX A;  1U3C A;  3ZVV A;  2LAI A;  3L17 A;  3MO2 A;  4J83 A;  4JHR A;  1N52 A;  3D9K A;  4I9C A;  4C0E A;  3FWV A;  4JHK A;  4IJD A;  3T5X A;  4MS6 A;  2J9Q A;  4LEU A;  3QOU A;  4UQX A;  2CFZ A;  2Q7F A;  4GYO A;  3G2W A;  4N5C A;  3QWW A;  2O8J A;  4CDR A;  4ANX A;  5F59 A;  4I1M A;  3SHF A;  2WQ6 A;  2WXQ A;  4ILG A;  4XZ4 A;  4J8E A;  3MA5 A;  2UY1 B;  5F5E A;  2YNQ A;  1Z6T A;  4HOT A;  1JWG A;  4Z4P A;  3RRM B;  5AJD A;  1ELW A;  3U9W A;  2XCB A;  2FUL A;  3M53 A;  4EZK A;  4J0U A;  3SNX A;  3Q4A B;  4G24 A;  2RG8 A;  4PS3 A;  3FHE A;  3MYV A;  1EPU A;  1NA3 A;  2PZI A;  4PH4 B;  2F69 A;  3UMV A;  4G11 A;  4YNM A;  3IV0 A;  2YIN A;  1UW4 B;  1BPO A;  3EHM A;  4B8A A;  4RG9 A;  2JEK A;  1ZBP A;  4HOS A;  3LXU X;  3TL5 A;  3AU5 A;  3AS4 A;  4FAD A;  3GW4 A;  4HXI A;  3MZL B;  3DPD A;  3U3W A;  1NP7 A;  4A55 A;  1UG3 A;  2C0L A;  1NA0 A;  3FTV A;  4PS7 A;  4RVB A;  3G2U A;  4H12 A;  3IEG A;  4OYS A;  4NVQ A;  2WXG A;  2XCC A;  4JL0 A;  3FPD A;  3CGH A;  5CHE E;  3SBS A;  3KEZ A;  3FUL A;  3IHV A;  4NRH B;  4UQZ A;  1JUQ A;  3FTY A;  3CK7 A;  3NF1 A;  2NXP A;  3JCK C;  4Q69 A;  4YPU A;  3SZ7 A;  3R7Q A;  3O4Z A;  3BG0 B;  2A4Z A;  3PZD A;  5TTF A;  3ONL A;  4GZD A;  4G23 A;  2FF4 A;  5T5G A;  4JW1 A;  5ARG A;  3D9L A;  2LSV A;  4KYO B;  5ENN A;  3ZHE A;  2PM6 A;  3TXN A;  4BUP A;  3FU6 A;  3LY8 A;  5LSZ A;  4C1Q A;  2XGM A;  5J90 A;  4I2W A;  2WMN A;  1HU3 A;  1DNP A;  1UN8 A;  4JHJ A;  2XRZ A;  5LX8 A;  1QQE A;  1Z3X A;  5FTP A;  5T0M A;  1IQU A;  3SBT B;  4EZJ A;  2QY7 A;  4F53 A;  4GB9 A;  5G04 C;  3I4R B;  4K03 A;  4Q94 A;  3KMA A;  3S8P A;  1INZ A;  1EDU A;  3M54 A;  3AU4 A;  3CHR A;  4CT4 A;  3VLE A;  4NQ0 A;  2IOS A;  4Q96 A;  2DBA A;  3L08 A;  3PH0 C;  3TJP A;  1E8X A;  2WXJ A;  4EBA G;  5M72 A;  3OXF A;  4IN3 B;  5LCW C;  3VLF A;  4A3T A;  2WXF A;  2E2E A;  3FTW A;  4AY5 A;  4E85 A;  3RO2 A;  3TXM A;  3ZYK A;  4J6I A;  3CKC A;  4O30 A;  2AW6 A;  3S7D A;  2LAH A;  3ULQ A;  5CPR B;  2AXV A;  3RU0 A;  2VJ8 A;  1MT6 A;  2GGF A;  1JPL A;  4QFV A;  4WNG A;  3ZGQ A;  2XPZ A;  2VTB A;  3M5A A;  2VGY A;  1NZN A;  3I4G A;  1H6K A;  5FZS A;  4GCN A;  2J09 A;  1LF8 A;  3P2B A;  4HVB A;  2R17 C;  1E8Z A;  2WXR A;  1OWM A;  4BT8 A;  2LSU A;  2WXI A;  3D3M A;  3IHY A;  3T5V A;  3PUJ A;  4LCT A;  3LEW A;  1XNF A;  3WXX A;  3HDX A;  4ANV A;  4NUR A;  4AXH A;  1L5J A;  2DIW A;  1EF1 C;  3LPZ A;  2GRM A;  4KVO A;  4AM9 A;  3N71 A;  3IHX A;  2IJG X;  2WXP A;  3MO5 A;  2BUG A;  3CLJ A;  3I3N A;  3Q47 B;  4GYW A;  5LFA A;  4YND A;  3EP0 A;  5AYF A;  3MKR A;  4L7T A;  2HM8 A;  2J08 A;  3HVE B;  2W5Y A;  3QWP A;  3R7R A;  2BQZ A;  1SZ9 A;  4U0U A;  4CT0 A;  4HOQ A;  4GZ3 A;  4MLP A;  2WB2 A;  4RZ0 A;  2XEV A;  3QNK A;  2VTB B;  2UY1 A;  3ESL A;  3ZW3 A;  4I1O B;  3FUE A;  3PRE A;  4QEN A;  4IUL A;  3QWV A;  5JJT A;  3B7S A;  3QAQ A;  3FH7 A;  4Y6W A;  3QJZ A;  4FMU A;  4L1B A;  1VDY A;  2KZT B;  3ZEF A;  3S7J A;  2WXM A;  2XPY A;  5HI7 A;  4AV7 A;  2XRY A;  2XGS A;  3M59 A;  2CG3 A;  3ASF A;  4BTA A;  1U3D A;  4TUU A;  3SFZ A;  2GW1 A;  3HHM A;  3CVN A;  4BTB A;  2IQC A;  3U4T A;  4TRQ A;  1HO8 A;  3CV0 A;  4D10 C;  2V5F A;  5G55 A;  5G05 C;  3ZYM A;  4URK A;  4ATG A;  4HLE A;  2BTD A;  2CFU A;  4V3I A;  5EG2 A;  3B7R L;  4WWP A;  4J8S A;  1ML9 A;  1HXI A;  1SQM A;  2ILR A;  1MVX A;  2IOL A;  2RD0 A;  2I1J A;  4JEU A;  4RG6 A;  3RO3 A;  4TV3 A;  2WXL A;  3ZYL A;  2WQ7 A;  4C9B B;  2XHE A;  2R5S A;  2VSX E;  5FQ7 A;  4OVV A;  3CVY A;  5AEN A;  3SD5 A;  2LO6 A;  1H2T C;  2ION A;  1OWN A;  2V8S E;  2XQ0 A;  4XE0 A;  1TJF A;  2IF4 A;  3T8M A;  4E6H A;  3D9O A;  4YVQ C;  3UPV A;  3AS8 A;  3NQP A;  3VV0 A;  1WM5 A;  5BV1 A;  4DK5 A;  5TH7 A;  3PE4 A;  5T4Y A;  3LKU A;  3PNL B;  3M57 A;  2FEZ A;  5BW8 C;  3FUF A;  2QFC A;  4BT9 A;  3FUJ A;  3SF4 A;  4BY6 A;  2OVF A;  3FH8 A;  3QC1 A;  2YHC A;  3LYA A;  3MEK A;  5BNW A;  1N6C A;  1HH8 A;  2VSY A;  1OWP A;  1PC2 A;  2OV8 A;  4U0Z A;  2XPI A;  3FTX A;  4B94 A;  1HE8 A;  4UI9 C;  2V0P A;  3ASG A;  4B8C B;  3CBM A;  4GPK A;  3D9I A;  3RAY A;  5BPP A;  3RQ4 A;  1H2V C;  2HYZ A;  4GMJ A;  4KT6 B;  4EBA A;  3CHO A;  4BWR A;  2OOE A;  3TAX A;  3HNA A;  3FU5 A;  3PRZ A;  4MI5 A;  2L0T B;  4MKT A;  5DBK A;  1WAO 1;  2X6H A;  4KBQ A;  2X6K A;  4O6F A;  3ASH A;  2QPW A;  3LCA A;  4ACK A;  3MV2 B;  4UI9 K;  3FTS A;  4RSY A;  1PEG A;  4N2Q A;  3UQ3 A;  3LVQ E;  4I51 A;  2C0M A;  3OPE A;  4AJW A;  2C2L A;  3CR3 A;  3QAR A;  2AWI A;  4GYY A;  3ASD A;  4UWG A;  2J4B A;  4CEM A;  4DI4 A;  3K5K A;  3ZIM A;  4CDN A;  4APO A;  3QDN A;  4G26 A;  1HF8 A;  4UWH A;  5JIN A;  3ML9 A;  3UX4 A;  3UT4 A;  3VUZ A;  4DLQ A;  2WVI A;  2L0I A;  4I2Z A;  1IYG A;  3D9N A;  1A17 A;  3PE3 A;  3EIJ A;  4JLG A;  1W3B A;  4CDM A;  3GZS A;  4GZC A;  2OND A;  2OVB A;  3PDN A;  4JC8 A;  4LER A;  4I1A A;  4R7L A;  4IJ8 A;  1YA0 A;  4H7Y A;  4B0Z A;  4FUL A;  3G2T A;  3S7B A;  4WNE A;  4EEC A;  5JJ6 A;  5C1D A;  4FA6 A;  5EX3 A;  5LCW J;  1E90 A;  4AEZ C;  3PEV B;  4FC8 A;  1PAQ A;  4PUC A;  3JQ1 A;  2IGQ A;  4WUY A;  3HVE A;  2I2O A;  1H0A A;  4KZC A;  4KXK B;  3VLD A;  5KJM A;  2XGO A;  4WNF A;  3Q5M A;  4BFR A;  3F9W A;  3OAW A;  4FJY A;  3CHQ A;  3FH5 A;  4PS8 A;  4J8O A;  3CST A;  4J7F A;  4U07 A;  1E8Y A;  1HG2 A;  4EQF A;  3JQ0 A;  3F9Z A;  1XGW A;  2HR2 A;  3NZU A;  1MQS A;  4JVS A;  3DAL A;  3Q49 B;  3RRU A;  2RFI A;  3LVR E;  2KZT A;  2VSN A;  3CHP A;  5FQ6 A;  2KCK A;  2DCP A;  4FJZ A;  3CVX A;  4MI0 A;  4U8H A;  5KJN A;  3FUD A;  3RIB A;  3CQC B;  1PY1 A;  4U63 A;  4XI0 A;  2NSZ A;  3PS6 A;  3S7F A;  5BV0 A;  2VYI A;  4XX5 A;  4F1S A;  3FUH A;  3FP3 A;  3ZFW A;  3RK6 A;  5EKQ D;  1S0P A;  3ENE A;  4B89 A;  3M56 A;  4LRZ A;  5KCM A;  2E0I A;  3FU3 A;  3LDZ A;  4Y6C A;  4DLO A;  5E76 A;  2WM9 A;  2A5U A;  1QZ2 A;  3RJW A;  4F7A A;  2AXU A;  4JPS A;  3FU0 A;  3UUX A;  2WXN A;  2AVP A;  3B7T A;  3ONK A;  2ZU6 B;  3LY9 A;  2P58 C;  1E7U A;  2I6H A;  3FUN A;  4I6E A;  3ZPJ A;  3QB2 A;  3B13 A;  4W9R A;  4HOR A;  2WXK A;  5JHN A;  2YHE A;  3CK9 A;  2Y4T A;  4F3V A;  2R59 A;  4XKB A;  4A3V A;  2NC9 A;  3JUI A;  1Y6I A;  1B89 A;  2L9B A;  3CVP A;  5A7D B;  5FJY A;  3MKQ A;  2JV0 A;  3EJN A;  2WMO A;  5G05 J;  1UJK A;  4AY6 A;  3IKO B;  5D0O D;  4L2Y A;  2VQ2 A;  2PM7 A;  5ANR A;  3D9M A;  4DI3 A;  5T0K A;  4CRW A;  1FCH A;  2KAT A;  3CK8 A;  3CBO A;  1OUV A;  5FT9 A;  4ANW A;  4UWL A;  1IHG A;  4ME2 A;  5D0Q D;  1HX8 A;  4A1S A;  4UWK A;  4JZY A;  1N3J A;  1XQH A;  3K9I A;  2Y3A A;  3CEQ A;  4HS2 A;  5AYW D;  2PQR A;  3AS5 A;  4L23 A;  2X3M A;  3CVV A;  4M3O A;  4FHK A;  5A23 A;  4BX8 A;  4ANU A;  4NAC A;  3S2A A;  3OOI A;  3CSF A;  3BG1 B;  4DPR A;  5JJ7 A;  2CG2 A;  4H7X A;  2VGX B;  5CMW A;  2JLB A;  4LDG A;  3G2S A;  4HFG A;  3FDH A;  4FLH A;  3EDT B;  3MKQ B;  3B7U X;  3FUI A;  3CHM A;  1H3I A;  1HG5 A;  1Y8M A;  3KS2 A;  3Q15 A;  4FHJ A;  3TG4 A;  1KT0 A;  4A1G A;  5FWQ A;  5LP0 A;  4QEO A;  4U0S A;  1OWL A;  4N3B A;  5AJL A;  3NZS A;  4GZ6 A;  2J07 A;  4N39 A;  2X38 A;  2FO7 A;  1ELR A;  3L16 A;  4UI9 J;  4FP7 A;  4EPZ A;  5G2N A;  3BEE A;  1WY6 A;  3HYM B;  5F6K C;  5F6L A;  4UWF A;  3C98 A;  3PEU B;  3D9P A;  4WWN A;  2J49 A;  3RRN B;  3CVQ A;  3APC A;  4BSX A;  1ZKK A;  3SW9 A;  2PL2 A;  1Z3Y A;  5JJ0 A;  3CVL A;  4E47 A;  2PQN A;  1ELK A;  5CCM A;  3MO0 A;  2FBN A;  1TJC A;  4GML A;  4I9E A;  5E75 A;  3CHS A;  1MHQ A;  4CGV A;  4JA9 A;  4I6J A;  5ARF A;  3URZ A;  4UQY A;  3FY4 A;  4N3A A;  1EYH A;  2HO1 A;  5EX0 A;  1GW6 A;  5EDS A;  1TEZ A;  3OS5 A;  5J08 A;  1E8W A;  3ESK A;  3PNT B;  2BF0 X;  4HOU A;  4GCO A;  4PDX A;  3MJW A;  2WXO A;  4BX9 A;  2GRL A;  1FVH A;  1UJJ A;  2UWJ G;  3UT8 A;  5ANL A;  1E96 B;  3TG5 A;  2MHK A;  5DIZ A;  4GA2 A;  3L22 A;  4MRU A;  3GZ2 A;  4I43 A;  3DB5 A;  4J8F A;  3EHN A;  3LJ3 A;  3CQG B;  4YPE A;  1UN9 A;  4N3C A;  4AP2 A;  3IBE A;  5G04 J;  3RKV A;  3SGH A;  3MV3 B;  3CBP A;  3E4B A;  4JA7 A;  5CCL A;  3ZXS A;  5HQ8 A;  2WQH A;  1HZ4 A;  2L6J A;  4GAA A;  4AOF A;  3LS8 A;  5BUZ A;  5KJK A;  3APD A;  2I1K A;  2WPV A;  4YVO A;  5JHA A;  3U66 A;  4KVM A;  4OVU A;  1IQR A;  2IFU A;  1E7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...