3QWVA

Crystal structure of histone lysine methyltransferase smyd2 in complex with the cofactor product adohcy
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
430
structure length
430
Chain Sequence
AEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKEDWPLHKLECSSMVVLGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKYLEFPDHSSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSYFFTCECRECTTKDKDKAKVEVRKLSSPPQAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASMWLKLGRLYMGLENKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SET and MYND domain-containing protein 2
publication title Crystal structures of histone and p53 methyltransferase SmyD2 reveal a conformational flexibility of the autoinhibitory C-terminal domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 143
structure length 430
sequence length 430
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3qwvA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3qwvA01
3S7BA 2KCLA 3ZN3A 4BTAA 3CKBA 3GZ1A 5FZSA 3VV0A 4GZ3A 2XGMA 3CK9A 3LKUA 4N39A 2UY1B 4N2QA 3BEEA 3FWVA 3SW9A 1W3BA 4HORA 1ML9A 3U3WA 2BQZA 3F9XA 3AS4A 4BT9A 4BWRA 4UI9C 4QENA 1HXIA 5DBKA 5F6LA 3MO5A 4JA9A 2HO1A 3PE3A 4UQYA 5C1DA 4YNMA 5G05C 2VSYA 5FZQA 1ZKKA 4U07A 4G24A 2FBNA 3S8PA 3EDTB 3RJVA 3SF4A 5D0OD 5KJMA 1KT0A 4GYOA 3MO2A 1PEGA 4RZ0A 4A1SA 2VQ2A 2WQHA 3U4TA 3PDNA 4GA1A 4YPEA 3TAXA 3UUXA 5JJ7A 1IHGA 1WM5A 4AIFA 1N6AA 2YQ8A 2VGYA 1MUFA 3AS5A 2KCKA 1NA0A 1O9SA 4GYWA 3PE4A 4I9EA 5JIYA 3CBOA 3OPEA 2VSNA 2J9QA 2ONDA 3KMJA 4KYOB 4UI9J 2XPIA 2PL2A 3Q5MA 3KMAA 4JA7A 4YVQC 2XEVA 2XGSA 2AVPA 3FP3A 3WXXA 1KLXA 5G05J 3DALA 3IHXA 3OXLA 5F5EA 4MI0A 2F69A 2PQNA 5JJ6A 4KXKB 5CCMA 3TG5A 5T5GA 5CCLA 4I9CA 1A17A 4NRHB 1IYGA 5FZRA 4EQFA 4Y6CA 3ZPJA 3CKCA 3SWCA 3ASDA 3KS2A 1TJCA 3Q15A 4RG9A 3RO2A 4J7IA 3LY7A 3UPVA 5LSZA 5EX3A 3MV2B 3VTYA 4Z4PA 5BNWA 3F9YA 1N6CA 3M57A 4YPAA 4CGWA 4IN3B 3F9WA 2LSUA 3OOIA 4WNEA 5M72A 4I1AA 4GYYA 4J83A 3S7FA 4N3BA 4AM9A 2UWJG 4IJ8A 4LEUA 4N3AA 4XI0A 5T0MA 4GCOA 4YVOA 4XIFA 2Y4UA 3ZGQA 2W5YA 2P58C 4U0SA 5G04C 3CVLA 2FI7A 4NQ0A 5LCWC 3M5AA 4KBQA 4APOA 5HI7A 3DB5A 1ZBPA 2V5FA 5KJKA 3MV3B 3QWWA 3GYZA 5A7DB 4JLGA 4GZ6A 2YHCA 4J8DA 4J0UA 3IEGA 3GZ2A 4AY6A 4AU7A 4N3CA 2JV0A 3K5KA 2JLBA 1MVXA 4YNDA 3R9AB 3EP0A 5EX0A 4YPUA 2NC9A 3Q4AB 2E2EA 3KD7A 5TEGA 5ARFA 1ELRA 3M53A 5TH7A 2RFIA 1N3JA 3RJWA 3M58A 4G25A 1B89A 5LSXA 1HH8A 1OUVA 3HYMB 2FF4A 2PZIA 3F9ZA 3RKVA 4G2VA 3S7DA 4J7FA 5A6CA 4J8FA 4H7XA 2R3AA 4BUPA 2IGQA 4UQZA 5KJLA 3N71A 3QKYA 5EG2A 3O48A 3ASGA 5G04J 4XI9A 3CEQA 4U0ZA 3MA5A 1PC2A 2QFCA 3ESKA 5LCWJ 3LYAA 3OXFA 3QWPA 4B94A 4U0UA 2OOEA 2KC7A 4H7YA 4ME2A 2KCVA 1ELWA 3ULQA 4HOTA 2IFUA 5KJNA 4BTBA 4I17A 1XQHA 4ABNA 3CBPA 3LY9A 5CHEE 1H3IA 4FMUA 2BUGA 1HZ4A 4LDGA 4NVQA 3RAYA 4WUYA 2VGXA 5T0KA 4QEPA 3QDNA 3CVQA 4JHRA 1MVHA 4Y6WA 5FJYA 4F3VA 3M56A 4JL0A 2C2LA 2C0MA 5JHNA 4WNDA 3RU0A 3CK8A 4N5CA 1YA0A 4CGVA 4GCNA 3AS8A 5JINA 2XCBA 5AYFA 4O6FA 4N2SA 3M55A 5BT1A 5BW8C 2XGOA 3Q49B 4GZ5A 5FT9A 2W5ZA 4GPKA 3HNAA 3FPDA 3M59A 3CV0A 2VYIA 2LNIA 4G1TA 4AY5A 1Y8MA 4G23A 3RIBA 1NA3A 5D0QD 3KMTA 3ASFA 4MI5A 3URZA 3S7JA 3ZHEA 4I51A 2VGXB 3CVPA 4HOQA 4WNGA 4RG6A 1NZNA 3E4BA 4I2WA 4JDSA 3GW4A 4W9RA 2O8JA 3VUZA 3MKRA 4BT8A 5FTPA 2LSVA 5JJTA 2Q7FA 4GA0A 4E47A 2C0LA 4C1QA 3OS5A 3BO5A 1P5QA 3NF1A 4IJDA 3LCAA 3LPZA 3LY8A 5AYWD 1QZ2A 4I2ZA 3CVNA 5JJ0A 2IF4A 2DBAA 1WAO1 1MT6A 3SZ7A 5TTFA 5CPRB 4HOUA 3K9IA 4O30A 3QOUA 3ZHEB 3VTXA 2L6JA 3TG4A 2FO7A 3MO0A 5EKQD 2HR2A 1E96B 5HQ8A 2KATA 2MHKA 3ZFWA 4H12A 5F6KC 2I6HA 2UY1A 4G26A 4CDRA 5DIZA 3OXGA 2GW1A 1XNFA 2G46A 4J8EA 1FCHA 4QEOA 4UI9K 3TGOA 3RO3A 3RQ4A 3UQ3A 4J8OA 3MEKA 4YNPA 3KAEA 1KT1A 5ARGA 3JYSA 3M54A 3Q47B 4GA2A 1ZU2A 3ASHA 4U04A 2PQRA 1QQEA 3FFLA 2HYZA 4WNFA 2QPWA 5F59A 4HOSA 2WPVA 2FEZA 2XCCA 2R5SA 3CK7A 3QWVA 3CBMA 4UQXA 4NJ5A 2Y4TA
chains in the Genus database with same CATH superfamily
1GW6A 4HI9A 1LD7A 4IYPA 1OWLA 1V54E 3Q73A 4JD2G 4BSZB 4DX7D 3JXJA 1K1BA 4HLLA 4BETA 3FWVA 2WB2A 1N54A 1ML9A 2BQZA 4BT9A 1AWCB 5ENNA 1HXIA 4DX5D 1OWOA 2P9KG 4TXPA 2WXNA 2HO1A 4GMJA 2EILE 3PE3A 3WG7E 3UXGA 2DZNA 5C1DA 3PZDA 3MYVA 4B8AA 2A4ZA 4G24A 4OAUC 3S8PA 4RSYA 3RJVA 3JQ1A 4ANUA 5D0OD 1D9SA 3FY4A 3AJIA 4GYOA 3MO2A 3PZ1A 5ENTD 2WQHA 3FTZA 2BTDA 1TN7A 4GA1A 4YPEA 3TAXA 3TWWA 1H2TC 2YQ8A 2KCKA 3CHPA 5AAOA 4F6RD 1O9SA 3KSLA 5JIYA 3CBOA 4MKTA 3ABME 3KMJA 2XPIA 4AXHA 3C3QA 4O1OA 4A63B 3D9MA 4EZKA 2XEVA 2AVPA 3FP3A 3BU8A 1KLXA 2LAHA 4LSZE 3GZSA 5G05J 3CQCB 1EF1C 4APFA 3BG0B 4CT0A 3ZYQA 1NI1A 2PQNA 2XS8A 5JJ6A 3TG5A 3SY2A 4ATZD 3PEVB 5T5GA 1UN9A 1OCRE 2DIWA 3SFZA 1EYHA 3UIOC 3EU9A 3TWRA 4Y6CA 5CECB 2DZOA 3ML8A 1K3ZD 3HXDA 3DSWA 3ASDA 2X6IA 1TNZA 5ENOD 3M57A 4UWFA 3ESLA 1TN8A 4IN3B 2LSUA 4WNEA 2X6KA 4I1AA 4J83A 3S7FA 3TXNA 4RVBA 1SVXA 2EIME 2F8XK 4XX5A 3HXCA 4AM9A 3LS8A 3B7RL 5T0MA 4GCOA 4YVOA 3U64A 3CIAA 5HRYA 2P58C 4U0SA 2DYSE 2ZXWE 3ABLE 1DVPA 5FQ4A 4U63A 3QJZA 3RAUA 3Q79A 3ZEFA 2HE0A 5HI7A 1ZBPA 2V5FA 3HVEB 2DYRE 3CGHA 3CVXA 4J0UA 4AY6A 4J8SA 4N3CA 2WXIA 4AU7A 4LRZA 2JLBA 3HHMA 1MVXA 3R9AB 1TJFA 1TR4A 5CRVA 1U3CA 2M63A 2E2EA 3KD7A 5ARFA 2AJAA 1AP7A 3AAAC 4G25A 5EDSA 1B89A 2GRMA 1HH8A 3ZIMA 2FF4A 2PZIA 5FQ7A 1LTXA 1HG2A 3E30A 2NSZA 3EHMA 3Q7FA 5G04J 4XI9A 2CG3A 1PC2A 3ESKA 1G3NB 3Q9NC 5ENPD 5LCWJ 3JQ0A 3CHQA 5EN5D 4B94A 2ZISA 4U96D 5AN8A 1OCOE 2OOEA 3FUMA 2V8SE 4ME2A 2IOSA 4HOTA 2IEJA 3LEWA 3CBPA 3BG1B 3LY9A 2WXFA 4YDYA 2BUGA 5FQ6A 2J4BA 3E34A 2VGXA 4DJAA 2CFUA 3M56A 3SD5A 2C0MA 5JHNA 2OCCE 5T3RA 4R7LA 3CK8A 3B13A 2DVWA 2WXMA 4GCNA 3MGBA 3T5VA 1H6PA 3UM0A 5AYFA 4DRXE 4L2YA 1UG3A 3FH5A 5BW8C 2OVFA 4GZ5A 4Z68A 4AEZC 2L6BA 2V4LA 3TJPA 3HNAA 3FPDA 3CHSA 3JUIA 4HI8A 2WXOA 4PUCA 3M59A 4AY5A 3RIBA 5ENSD 2YNQA 3ASFA 1K1AA 3NZSA 4ILGA 2DWZA 3ZHEA 3CVUA 4BEPA 1HS6A 3RSEG 1YYHA 3TWSA 3W9FA 1NZNA 3CHOA 1IKND 3GW4A 3FUDA 3MKRA 4BT8A 5JJTA 3D9HA 1UN8A 3SBSA 2C0LA 3BO5A 3DSUA 2GRQB 4L2LA 1P5QA 1BI8B 4FLHA 3I4GA 4U95D 3MCXA 2B6CA 3APCA 2KZTA 2DBAA 2AWIA 1WAO1 4ANWA 3SZ7A 1MT6A 2A5EA 1XGWA 5B3SE 1O1TA 5ENQD 3K9IA 4TXRA 3Q9UC 4TUMA 4TUUA 4ANXA 3UKRG 1MYOA 2EQXA 2HR2A 3NB2A 3W9GA 3ZFWA 3RRMB 1H2VC 3R7QA 4CDRA 3APFA 4BERA 3OXGA 4EZLA 1XNFA 2G46A 4Q94A 1N52A 4FHJA 2IO2C 3TGOA 4HBDA 3UQ3A 4J8OA 4DPRA 3D9OA 1E8YA 4LG6A 4GTOA 5AQAA 4I6JA 2LUHA 3FUKA 3PZ2A 3Q47B 1ZU2A 2B0OE 3ASHA 4U8HA 2PQRA 5BUZA 2QYJA 3FFLA 3SHFA 4WNFA 3QC1A 4UWHA 2GRPB 4UQXA 4DX2A 3ZW3A 4NJ5A 1H0AA 1TN6A 3CHRA 3S7BA 2KCLA 4BTAA 4BESA 2WXQA 3ZXPA 2XGMA 2R05A 5B1AE 2VSOE 3UT8A 3LKUA 3ZYLA 2QC9A 2J07A 4BX8A 1JPLA 1W3BA 4C48B 5CEDB 2VJ8A 3U3WA 3FUJA 4UI9C 3ONKA 2L0TB 3SI5A 5F6LA 4JA9A 1SA4A 4UQYA 3SBTB 4I43A 5LOZA 3EDTB 4HXIA 4GTPA 3ULEG 3TWXA 5KJMA 1KT0A 1N0RA 2IU1A 1MZCA 1MX6A 2LXLA 3G2TA 3UUXA 5G55A 3ZU7B 1BI7B 2GRNB 5JJ7A 1IHGA 4AIFA 3ZYMA 4HRLA 3MJWA 1RW2A 1NA0A 2DCPA 4G8LA 2GRLA 4K0RA 5E76A 3L13A 4I9EA 3FEYA 3D9JA 3OPEA 2VSNA 2P9LG 4KYOB 3AG2E 2P2CP 3HIZA 3KMAA 2XGSA 2ZU6B 5JHAA 3WXXA 1KZPA 4NIKA 4PS8A 1O1RA 1N9AA 1IQUA 3FTYA 2F69A 1SA5A 1BLXB 3L6AA 4HRMB 3KSQA 4NRHB 2WXLA 4ILHB 4P29A 2WXKA 4L7TA 4B0ZA 3CKCA 3SWCA 4XE0A 4KMOA 3KS2A 3FU5A 1TJCA 1Z5SC 3J5PA 3LY7A 3CLJA 4WWNA 1N6CA 4YPAA 5EYLA 4CGWA 3UM3A 3OOIA 3C98A 3DWLG 4N3BA 3G2SA 4N3AA 3IHVA 5C2YA 4XIFA 3ZGQA 3ISMC 2W5YA 5CERB 1Z6TA 3HXFA 4GTRA 4JB8P 5CMWA 2VTBA 4NQ0A 3KEAA 3M5AA 4KBQA 1EDUA 4JHJA 3TL5A 2IONA 3QWWA 3SFYA 2YHCA 4J8DA 3IEGA 2R03A 5BXOA 4IULA 2J09A 2JV0A 1MX2A 3DXKG 4YNDA 3DPYA 3EP0A 5AQBA 4YPUA 4U7EB 2NC9A 4A1GA 3Q4AB 2WQ6A 4UWLA 3ZYKA 5TEGA 5FWQA 5TH7A 2RFIA 4EECA 3RJWA 1DCQA 5LSXA 1LD8A 2V4HC 2XEHA 3RKVA 3NQPA 2PNNA 5A6CA 4KZCA 4FLBA 2R3AA 1N0QA 4CDMA 2IGQA 2J08A 4UQZA 2ETBA 3QKYA 4ATGA 5EG2A 3BQOA 3MA5A 2QFCA 2P9NG 2BKKB 2AW6A 4U0UA 1SW6A 1TNOA 4HS2A 5KJNA 4X8QA 1MJ0A 3UTMA 4I17A 3EUVA 4DUIA 5CHEE 3P2BA 1H3IA 4XKCA 1HZ4A 2QYUA 3D3MA 4LDGA 3RAYA 3HDXA 4FHKA 2PM6A 3UT4A 3CVQA 4JHRA 4Y6WA 4JEHA 4WNDA 2WXRA 4UWGA 2V5QC 3RU0A 4FU3A 2I1JA 4N5CA 3PNLB 1U2VG 4O6FA 4N2SA 3HXEA 2RKKA 3UX4A 1OT8A 3FUNA 3LXUX 4HB5A 2RG8A 3AG1E 1RZ4A 3FUHA 4J6IA 4GMLA 4F7AA 4OAVB 3CV0A 2VYIA 4G1TA 2P9IG 4WAFA 1Y8MA 3KMTA 3FUFA 2I1KA 3NBNB 3DRAA 4FULA 3CQGB 4BX9A 2OVBA 5T4YA 4A3TA 4PS7A 4I2WA 4JDSA 4W9RA 3FU6A 3VUZA 3UM1A 1FVFA 4GA0A 3UIPC 4E47A 4C1QA 4GTMA 3NF1A 4PH4B 5AJDA 3LPZA 3LY8A 1HX8A 2AXUA 4FP7A 2VTBB 2WQ7A 3NZUA 4LCTA 2WXJA 2R2LA 5TTFA 4HOUA 4O30A 2XZTG 3QOUA 3MO0A 2R02A 5EKQD 3ASOE 3L82A 4GB9A 4H12A 5F6KC 5KCMA 5DIZA 2IY0C 3NOGD 4J8EA 3UMVA 2FULA 3V2XA 1IHBA 1N4SA 4G11A 4DK5A 1UJJA 4YNPA 2IOLA 1KT1A 4DX6D 3O4ZA 2X6HA 3AG3E 4FADA 4N5QA 3DSTA 2QPWA 5F59A 3RRNB 2WPVA 2FEZA 2XCCA 2XENA 1H2UA 3RRUA 4CT4A 3CVYA 2LXMA 3FTSA 3MKQB 1V55E 3ZN3A 3PVLA 4B89A 3TXMA 4GZ3A 3CK9A 4FC8A 3JCKC 4N39A 2UY1B 4HVBA 4QQIA 4N2QA 3BEEA 1PAQA 1OCCE 4C9BB 4I1MA 4HORA 3EHNA 3F9XA 4BWRA 4NACA 4NURA 2P9SG 5DBKA 4DI4A 2MRIA 3MO5A 2NYJA 5D66A 4HQDA 2LAIA 3I5PA 3TWVA 4YNMA 5G05C 2FO1E 3F6QA 4JZYA 5FZQA 1ZKKA 4U07A 3V30A 2BF0X 4GTTA 2WXHA 3G2UA 4F1PA 4A1SA 2VQ2A 3MX3A 3FDHA 3U4TA 3ZXSA 3DPDA 2BEDA 3SO8A 3D9PA 4YDEA 4J7WA 2ETAA 2MOWA 3AS5A 4EZJA 1WY6A 4GYWA 3PE4A 2IO3C 1TNUA 3E37A 4AJWA 1PY1A 2J9QA 2PL2A 3Q5MA 2WMOA 3FUIA 2JABA 1FT2A 4UWKA 3CR3A 3DALA 3PUKA 5KNHD 4F53A 2F0YA 3APDA 4KXKB 5CCMA 1YCSB 1VDYA 3T9KA 4J8YA 4I9CA 5LP0A 1A17A 3PH0C 3FULA 5FZRA 1FPPA 3FTUA 1N11A 3D9IA 2GRRB 2Y1LE 3ZUVB 4UUCA 4RG9A 3RO2A 4J7IA 5LFAA 1L5JA 3G2VA 5LSZA 5EX3A 3MV2B 4Z4PA 5T8IA 1FT1A 3DXMG 4F1SA 3F9WA 5D2MC 3RK6A 2XS1A 1KPSB 3E33A 4U8YD 1INZA 3UKUG 4AVXA 2UWJG 4LEUA 1H19A 1SZAA 3DEOA 2Y4UA 4Q69A 5G04C 2I9CA 3PREA 2WXPA 3R9MA 3CVLA 3Q7AA 5LCWC 3C3RA 2NXPA 2X38A 3ZNGA 2CFZA 3DB5A 3PUJA 2ZGGA 5KJKA 5A7DB 1QBQA 1IQRA 2J49A 3TWUA 4GZDA 1OY3D 2Y0BG 1ELKA 2I2OA 3OTNA 5EX0A 5KNGA 3R7RA 3ZRHA 2IJGX 5J08A 2HM8A 1N3JA 4M3OA 4MLPA 2YINA 2GROB 1N95A 4EBAA 3KEZA 3HYMB 3VLFA 3F9ZA 4G2VA 4J7FA 4J8FA 3U9WA 4K03A 4BUPA 4C0EA 2RFAA 5H7PA 4TRQA 3G2WA 4TXQA 1DNPA 3B7TA 4GTQA 4U0ZA 3LYAA 3QWPA 4ILIA 2KC7A 4H7YA 3TWTA 2KCVA 1ELWA 1NL4A 4BSXA 4BTBA 4JXTA 2GGFA 1U3DA 3IHYA 2PM7A 1QYMA 3ZVVA 4EHMA 4YDOA 4WUYA 5CEAA 5T0KA 5JHBA 3QDNA 1D8DA 5HKPA 1MVHA 2P9UG 5FJYA 4F3VA 4JL0A 4AOFA 1WG0A 4C0MA 1YA0A 4Q96A 5EIBE 2RFMA 4LERA 3JXIA 5JA4D 4CRWA 1N4RA 3M55A 3CVVA 3FTWA 3Q49B 5HS0A 3PEUB 4GTVA 2ILRA 1S63A 3PZ3A 5FT9A 3DSXA 1LF8A 3UINC 5BV0A 3Q75A 5D0QD 4ACKA 1E90A 2KM4A 3FH8A 2VSXE 3S7JA 3AU5A 2OEVA 1YMPA 4I51A 5EILA 5JMND 2RD0A 3FTVA 4HOQA 3CSTA 1X5BA 3FU3A 4RG6A 3SNXA 4GMRA 4FJYA 5FTPA 2LSVA 1TNYA 3SQVA 2Q7FA 4MS6A 3LDZA 5CBNA 3OS5A 2Y69E 4YDWA 3EHRA 3B95A 4HFGA 1NP7A 3LCAA 5IY5E 2H6FA 4JC8A 1QZ2A 3OAWA 3PS6A 4I2ZA 5JJ0A 1K8KG 3T8KA 4IRUA 3L17A 3QB2A 5J90A 5CPRB 2WXGA 3DEPA 3MKQA 3IBEA 2L6JA 3TG4A 2FO7A 2ZIRA 5AQ9A 4XKBA 3LVRE 4MBGA 2A5UA 4BFRA 2MHKA 3EHQA 1EPUA 1E7VA 4PS3A 3PNTB 2I6HA 2UY1A 3CSFA 2YHEA 3FHEA 2ZGDA 2XHEA 1HG5A 1S70B 4UI9K 4JHKA 3EJNA 3RO3A 1O5MA 4OVVA 1UOHA 4GA2A 2J4DA 4U04A 1Z3XA 3T5XA 1HO8A 4LNBA 4M7CA 4L9PA 4KVOA 2R5SA 3CK7A 3CBMA 4ZHBA 3EIQC 2Y4TA 3X2QE 1HFAA 1UJKA 1OCZE 2EINE 3CKBA 3CHMA 3GZ1A 5FZSA 4I1OB 1H6OA 4EBAG 3VV0A 1IXVA 4D10C 2IQCA 1D8EA 1DC2A 4G8KA 5B1BE 4DLQA 4B93B 1SQMA 2X3MA 4I6EA 5CMYA 3SW9A 1DCEA 4CYMD 3AS4A 4RLYA 5AENA 4QENA 3FH7A 5E75A 4RQIA 4KT6B 1N94A 2VSYA 4B8CB 2FBNA 3C3OA 1O1SA 3SF4A 5KBAA 1Z3YA 1OWNA 1SZ9A 3C72A 4TV3A 3L16A 4XEIG 1PEGA 1JCRA 4RZ0A 2XRYA 2CHZA 2CG2A 3PDNA 2J8SD 1S0PA 4KVMA 3QARA 1WM5A 4O1PA 1BPOA 4HLEA 1N6AA 4JEUA 2VGYA 1MUFA 2OV8A 4URKA 3DSVA 5BXUA 1BD8A 3P1UA 3C5RA 2ONDA 4UI9J 2CHXA 1Q2ZA 5AQ7A 4KZ0A 4JA7A 4QFVA 3S2AA 1JWFA 2QZAA 3SGHA 5AIJA 4YVQC 5AARA 4JVSA 1E8XA 3EIJA 3IHXA 3OXLA 5F5EA 4FJZA 4MI0A 3IXEA 4GU5A 4JW1A 5AJLA 3D9NA 4LNUD 5CCLA 4A3VA 3D9KA 1IYGA 3V79K 1E8ZA 4AP2A 4L1BA 4EQFA 3NAWA 4AV7A 3ZPJA 5EYPF 2X6JA 4GPMA 3Q15A 3FU0A 3T8MA 2V0PA 3UPVA 4OVUA 1OWMA 3VTYA 5BNWA 3F9YA 2OEWA 1BU9A 4E85A 3JUEA 4FA6A 3I3NA 5M72A 5CBOA 4CDNA 4EPZA 4GYYA 3LJ3A 2F8YA 3V2OA 4OYSA 4HNAD 2F37A 4IJ8A 4L23A 1TNBA 4XI0A 2R59A 3CVWA 2Y3AA 4K5BA 4GAAA 3B7BA 2FI7A 4APOA 3DBSA 5EIDA 1ZB1A 3MV3B 3GYZA 4JLGA 4JPSA 4GZ6A 2XPZA 2EIJE 3QAQA 3GZ2A 3K5KA 3HXBA 1E8WA 3VLDA 4PDXA 1A5EA 1S64A 3FUEA 4ACLA 1ELRA 2MYOA 3M53A 3B7SA 4LNGA 4CEMA 3M58A 2H6GA 1OUVA 1HF8A 4A55A 3S7DA 5A23A 3MZLB 4H7XA 5CRUA 1JUQA 5KJLA 3N71A 1Y6IA 3ASGA 3ENEA 3O48A 5FINA 4BY6A 3D9LA 3CEQA 5ENRD 2AXZA 3UM2A 4K5AB 2KXPC 3L54A 3OXFA 4CZ2D 3ABKE 3LJNA 1X81A 4V3IA 1WDYA 3ULQA 4E6HA 2IFUA 2ETCA 5FQ8A 1XQHA 1H6KA 4ABNA 5ITZF 2L9BA 4I6GA 1QNFA 2E0IA 4FMUA 3IV0A 4NVQA 1N4QA 4CCAA 4QEPA 3EU5A 3HRAA 1HE8A 2H6HA 1N4PA 2JEKA 3I4RB 2C2LA 1NFIE 4GZCA 3ML9A 5ANLA 4CGVA 3AS8A 5JINA 2XCBA 5FIOA 2L0IA 3ONLA 1MQSA 5BT1A 5G2NA 3ULYA 4HRNA 3UI2A 1HU3A 2XGOA 4MRUA 3UT7A 2W5ZA 3ZKJA 4GPKA 2LNIA 2WMNA 1UW4B 4G23A 1OXJA 1JWGA 1NA3A 4MI5A 3Q78A 2P9PG 3URZA 4WWPA 3AG4E 1MX4A 2KBXA 5KWDA 3L08A 2H6IA 2VGXB 3CVPA 2QY7A 2XRZA 4WNGA 3BUAA 3B7UX 1FVHA 1MHQA 3DSSA 3E4BA 2O8JA 2XEEA 3AU4A 3PRZA 5BV1A 2XPYA 3TWQA 4DLOA 2BKGA 1JCSA 3HG0D 1TEZA 3SFXA 3PZ4A 4IJDA 1KZOA 1E7UA 2WVIA 2R17C 3QNKA 3E32A 5AYWD 3QK0A 4WWOA 3CVNA 5BPPA 4XZ4A 1OWPA 2IF4A 3VLEA 1JCQA 3L22A 3L9TA 3V31A 3VTXA 3ZHEB 4ANVA 2AXVA 1E96B 1TYQG 5HQ8A 2KATA 3FTXA 2XZDG 4DI3A 4G26A 4U8VD 3LVQE 2GW1A 4K5CA 1FCHA 3J5QB 4QEOA 4ZFHA 3RQ4A 2EIKE 4GTSA 2LO6A 3MEKA 3KAEA 5ARGA 2CHWA 3JYSA 4O60A 3M54A 2XQ0A 3NOCD 3ASNE 4LUNU 1QQEA 2HYZA 3U66A 5LX8A 2KZTB 3FEXA 2WM9A 4DX1A 4HOSA 3IKOB 3QWVA 2VGEA 2X6FA 3HVEA 5ANRA
chains in the Genus database with same CATH topology
3S7BA 2KCLA 1HFAA 1UJKA 3ZN3A 1GW6A 3PVLA 4B89A 4BTAA 3CKBA 3CHMA 3GZ1A 5FZSA 4I1OB 2WXQA 4EBAG 3TXMA 4IYPA 3VV0A 4GZ3A 4D10C 2IQCA 1OWLA 2XGMA 2VSOE 3CK9A 4FC8A 3UT8A 3LKUA 3JCKC 4N39A 3ZYLA 2UY1B 2J07A 4DLQA 4HVBA 4N2QA 1SQMA 4BX8A 2X3MA 4I6EA 3BEEA 1PAQA 3FWVA 5CMYA 1JPLA 2WB2A 4C9BB 3SW9A 1N54A 1W3BA 4I1MA 4HORA 1ML9A 2VJ8A 3U3WA 3EHNA 2BQZA 3F9XA 3AS4A 4BT9A 4BWRA 3FUJA 5AENA 4UI9C 5ENNA 4NACA 4QENA 4NURA 1HXIA 5DBKA 3ONKA 4DI4A 2L0TB 1OWOA 3SI5A 2MRIA 5F6LA 2WXNA 3MO5A 4JA9A 2HO1A 3FH7A 4GMJA 5E75A 3PE3A 4UQYA 5C1DA 2LAIA 3I5PA 4YNMA 4KT6B 5G05C 3PZDA 3MYVA 3SBTB 4JZYA 2VSYA 5FZQA 4B8CB 1ZKKA 4U07A 2A4ZA 4B8AA 4G24A 2FBNA 4I43A 5LOZA 3S8PA 3EDTB 2BF0X 4RSYA 4HXIA 3RJVA 3SF4A 1Z3YA 1OWNA 1SZ9A 2WXHA 3JQ1A 3G2UA 5D0OD 4ANUA 5KJMA 4TV3A 3FY4A 1KT0A 3L16A 4GYOA 3MO2A 1PEGA 2IU1A 4RZ0A 4A1SA 2VQ2A 2XRYA 3MX3A 2WQHA 3FDHA 2CHZA 3FTZA 2BTDA 2CG2A 3U4TA 3PDNA 3G2TA 3ZXSA 4GA1A 4YPEA 3TAXA 3DPDA 5G55A 1S0PA 4KVMA 3UUXA 3QARA 1H2TC 5JJ7A 1IHGA 1WM5A 4AIFA 3ZYMA 1BPOA 3D9PA 4HLEA 1N6AA 2YQ8A 4JEUA 2VGYA 3MJWA 2MOWA 1MUFA 2OV8A 3AS5A 2KCKA 3CHPA 1NA0A 2DCPA 4EZJA 1O9SA 1WY6A 2GRLA 4GYWA 4K0RA 5E76A 3PE4A 4URKA 3L13A 4I9EA 5JIYA 3FEYA 3D9JA 3P1UA 3CBOA 4MKTA 1PY1A 2VSNA 2J9QA 2ONDA 4AJWA 3OPEA 3KMJA 4KYOB 4UI9J 2XPIA 4AXHA 2CHXA 2PL2A 3D9MA 3HIZA 3Q5MA 4KZ0A 3KMAA 4JA7A 4QFVA 3S2AA 1JWFA 4EZKA 2WMOA 3SGHA 4YVQC 2XEVA 2XGSA 2AVPA 2ZU6B 3FP3A 3FUIA 3WXXA 5AIJA 5JHAA 4PS8A 1KLXA 2LAHA 1E8XA 4JVSA 3EIJA 4UWKA 3GZSA 3CR3A 5G05J 3DALA 3CQCB 1EF1C 3OXLA 4APFA 3IHXA 4FJZA 3PUKA 1IQUA 3BG0B 5F5EA 4CT0A 3FTYA 4MI0A 3ZYQA 2F69A 2PQNA 4GU5A 4JW1A 5AJLA 4F53A 5JJ6A 3APDA 4KXKB 5CCMA 3TG5A 3L6AA 3PEVB 5T5GA 1UN9A 3D9NA 1VDYA 2DIWA 5CCLA 4I9CA 4A3VA 3D9KA 5LP0A 1A17A 4NRHB 3PH0C 2WXLA 4ILHB 1IYGA 3FULA 5FZRA 1E8ZA 3FTUA 4P29A 3SFZA 1EYHA 2WXKA 4AP2A 3D9IA 4L1BA 4L7TA 4EQFA 4Y6CA 4AV7A 4B0ZA 3ZPJA 3CKCA 3SWCA 2X6JA 3ML8A 4XE0A 4KMOA 3ASDA 3KS2A 3FU5A 1TJCA 3Q15A 4RG9A 3RO2A 3FU0A 4J7IA 2X6IA 3LY7A 5LFAA 1L5JA 3T8MA 2V0PA 3CLJA 3G2VA 3UPVA 4OVUA 5LSZA 1OWMA 5EX3A 3MV2B 3VTYA 4Z4PA 4WWNA 5BNWA 3F9YA 5T8IA 1N6CA 3M57A 4YPAA 4UWFA 4F1SA 3ESLA 4CGWA 4IN3B 3RK6A 3F9WA 2LSUA 4E85A 3OOIA 3C98A 4FA6A 4WNEA 3I3NA 2X6KA 5M72A 4CDNA 4EPZA 4I1AA 4GYYA 4J83A 3LJ3A 3S7FA 3TXNA 4RVBA 4XX5A 1INZA 4N3BA 4OYSA 4AM9A 4AVXA 2UWJG 3G2SA 4LEUA 4L23A 4N3AA 4IJ8A 4XI0A 3IHVA 1H19A 2R59A 3LS8A 3B7RL 3CVWA 5T0MA 4GCOA 2Y3AA 5C2YA 1SZAA 4YVOA 4XIFA 2Y4UA 3ZGQA 3U64A 2W5YA 3CIAA 1Z6TA 4Q69A 2P58C 4U0SA 5G04C 2I9CA 3PREA 2WXPA 4GAAA 5CMWA 3CVLA 2VTBA 1DVPA 5FQ4A 2FI7A 4NQ0A 4U63A 3QJZA 5LCWC 2NXPA 3ZEFA 3M5AA 2X38A 2CFZA 4KBQA 4APOA 5HI7A 3DB5A 1EDUA 3DBSA 1ZBPA 2V5FA 4JHJA 3TL5A 3PUJA 5KJKA 2IONA 3MV3B 3QWWA 3GYZA 3HVEB 5A7DB 4JLGA 4JPSA 4GZ6A 1IQRA 2J49A 2XPZA 2YHCA 4GZDA 3CGHA 3QAQA 4J8DA 3CVXA 4J0UA 3IEGA 3GZ2A 1ELKA 4AY6A 2I2OA 4IULA 4J8SA 2WXIA 4N3CA 4AU7A 2J09A 4LRZA 2JV0A 3K5KA 2JLBA 3HHMA 1MVXA 1E8WA 4YNDA 3R9AB 1TJFA 3EP0A 3OTNA 3VLDA 4PDXA 5EX0A 4YPUA 1U3CA 3FUEA 2M63A 2NC9A 4A1GA 3Q4AB 2E2EA 3R7RA 3ZRHA 2WQ6A 3KD7A 4UWLA 4ACLA 3ZYKA 5TEGA 5ARFA 1ELRA 3M53A 2IJGX 3B7SA 5FWQA 2HM8A 5J08A 5TH7A 2RFIA 1N3JA 4M3OA 4EECA 4MLPA 3RJWA 4CEMA 2YINA 3M58A 4G25A 5EDSA 1B89A 2GRMA 4EBAA 5LSXA 1HH8A 1OUVA 3KEZA 3ZIMA 3HYMB 2FF4A 3VLFA 1HF8A 2PZIA 5FQ7A 3F9ZA 3RKVA 3NQPA 4A55A 4G2VA 3S7DA 5A23A 5A6CA 3MZLB 4J7FA 1HG2A 4J8FA 4KZCA 4H7XA 3U9WA 4K03A 4FLBA 2R3AA 4CDMA 4C0EA 2NSZA 4BUPA 2IGQA 2J08A 1JUQA 4TRQA 4UQZA 5KJLA 4ATGA 3EHMA 3N71A 3QKYA 5EG2A 3G2WA 1Y6IA 3ASGA 3ENEA 3O48A 5G04J 4XI9A 4BY6A 3D9LA 1DNPA 3B7TA 3CEQA 2CG3A 4U0ZA 2AXZA 3MA5A 1PC2A 2QFCA 3ESKA 3L54A 5LCWJ 3LYAA 3OXFA 3JQ0A 3CHQA 3QWPA 4B94A 2AW6A 4U0UA 4ILIA 2OOEA 4V3IA 2KC7A 3FUMA 4H7YA 2V8SE 4ME2A 2IOSA 4HS2A 2KCVA 1ELWA 3ULQA 4HOTA 4E6HA 2IFUA 5KJNA 5FQ8A 3LEWA 4BSXA 4BTBA 4I17A 1H6KA 4JXTA 1XQHA 4ABNA 3CBPA 2L9BA 3BG1B 2GGFA 4I6GA 1U3DA 3IHYA 3LY9A 1QNFA 2E0IA 2PM7A 2WXFA 5CHEE 3P2BA 1H3IA 4FMUA 4XKCA 3ZVVA 2BUGA 5FQ6A 3IV0A 1HZ4A 4LDGA 3D3MA 4NVQA 3RAYA 2J4BA 3HDXA 4FHKA 4WUYA 2VGXA 4DJAA 5T0KA 4CCAA 5JHBA 4QEPA 1HE8A 2PM6A 3QDNA 3UT4A 3CVQA 4JHRA 1MVHA 4Y6WA 5FJYA 4F3VA 2CFUA 2JEKA 3I4RB 3M56A 3SD5A 4JL0A 2C2LA 2C0MA 4JEHA 5JHNA 4WNDA 2WXRA 4GZCA 4UWGA 3RU0A 4AOFA 5T3RA 4FU3A 4R7LA 2I1JA 3ML9A 3CK8A 4N5CA 3B13A 4C0MA 1YA0A 4Q96A 5ANLA 2WXMA 4CGVA 4GCNA 3AS8A 3MGBA 3T5VA 5JINA 2XCBA 2L0IA 5AYFA 3PNLB 3ONLA 4LERA 4L2YA 4O6FA 1MQSA 4CRWA 4N2SA 1UG3A 3FH5A 3M55A 5BT1A 3CVVA 5G2NA 5BW8C 3FTWA 1HU3A 2OVFA 2XGOA 3Q49B 4MRUA 3UT7A 4GZ5A 3UX4A 3PEUB 4AEZC 2ILRA 3FUNA 3LXUX 2V4LA 5FT9A 2W5ZA 3TJPA 4GPKA 2RG8A 3HNAA 3FPDA 3CHSA 1LF8A 3FUHA 4J6IA 4GMLA 3JUIA 2WXOA 4PUCA 4F7AA 3CV0A 2VYIA 2LNIA 2WMNA 4G1TA 1UW4B 4AY5A 4WAFA 3M59A 1Y8MA 4G23A 3RIBA 5BV0A 1JWGA 1NA3A 1E90A 2KM4A 2YNQA 3ASFA 3FH8A 3FUFA 5D0QD 2I1KA 4ACKA 2VSXE 3KMTA 3URZA 3NZSA 4FULA 4ILGA 3S7JA 3ZHEA 3CQGB 3AU5A 4I51A 3CVUA 4WWPA 4BX9A 1HS6A 2RD0A 3FTVA 2VGXB 3CVPA 3L08A 2OVBA 2QY7A 4HOQA 4WNGA 5T4YA 2XRZA 4A3TA 3B7UX 3CSTA 1FVHA 1X5BA 3FU3A 1MHQA 1NZNA 4PS7A 4RG6A 3CHOA 3E4BA 4I2WA 4JDSA 3GW4A 4W9RA 3FU6A 3SNXA 3FUDA 3AU4A 3MKRA 4BT8A 2O8JA 3VUZA 4FJYA 5FTPA 2LSVA 3PRZA 5BV1A 5JJTA 2XPYA 4DLOA 1UN8A 1FVFA 2Q7FA 4GA0A 4E47A 4MS6A 3SBSA 2C0LA 3LDZA 4C1QA 3OS5A 3BO5A 1TEZA 4L2LA 1P5QA 3NF1A 4PH4B 4FLHA 5AJDA 4IJDA 1E7UA 4HFGA 1NP7A 3LCAA 3I4GA 2WVIA 3MCXA 3LPZA 3LY8A 2R17C 3QNKA 5AYWD 3QK0A 1HX8A 4WWOA 4JC8A 1QZ2A 3OAWA 3PS6A 3APCA 4I2ZA 3CVNA 5BPPA 4XZ4A 1OWPA 2AXUA 5JJ0A 2KZTA 2IF4A 2DBAA 4FP7A 2AWIA 1WAO1 4IRUA 2VTBB 4ANWA 3SZ7A 2WQ7A 1MT6A 3NZUA 3L17A 3QB2A 4LCTA 1XGWA 2WXJA 5J90A 5TTFA 5CPRB 2WXGA 4HOUA 3VLEA 3K9IA 4O30A 3MKQA 4ANXA 4TUUA 3L22A 3QOUA 3ZHEB 3VTXA 3IBEA 2L6JA 3TG4A 2FO7A 4ANVA 3MO0A 5EKQD 2EQXA 4XKBA 2HR2A 2AXVA 3LVRE 1E96B 2A5UA 4BFRA 2KATA 2MHKA 3FTXA 4GB9A 3ZFWA 5HQ8A 3RRMB 1H2VC 1EPUA 1E7VA 4PS3A 4H12A 3R7QA 4DI3A 3PNTB 2I6HA 2UY1A 5F6KC 4G26A 4CDRA 3APFA 5KCMA 3CSFA 5DIZA 3OXGA 3LVQE 4EZLA 2YHEA 2GW1A 1XNFA 3FHEA 2G46A 2XHEA 4J8EA 4MI5A 4Q94A 3UMVA 1N52A 4FHJA 1FCHA 1HG5A 2FULA 4QEOA 4UI9K 4JHKA 3TGOA 3EJNA 4G11A 4DK5A 3RO3A 3RQ4A 3UQ3A 4J8OA 1UJJA 4DPRA 2LO6A 3D9OA 3MEKA 1E8YA 2IOLA 1KT1A 3KAEA 5ARGA 4YNPA 4OVVA 4I6JA 3FUKA 2CHWA 3JYSA 3M54A 3O4ZA 3Q47B 1ZU2A 2X6HA 4GA2A 2J4DA 3ASHA 2XQ0A 4U8HA 4LUNU 2PQRA 4U04A 1QQEA 4FADA 5BUZA 3FFLA 1Z3XA 3SHFA 3T5XA 2HYZA 3U66A 5LX8A 1HO8A 2KZTB 4WNFA 3FEXA 2QPWA 2WM9A 5F59A 3RRNB 4HOSA 2WPVA 3IKOB 2FEZA 2XCCA 2R5SA 1H2UA 3CK7A 4KVOA 3RRUA 3QWVA 3QC1A 4CT4A 4UWHA 3CBMA 4UQXA 3EIQC 2X6FA 3HVEA 3CVYA 3ZW3A 2Y4TA 4NJ5A 1H0AA 3CHRA 5ANRA 3FTSA 3MKQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7B A;  2KCL A;  3ZN3 A;  4BTA A;  3CKB A;  3GZ1 A;  5FZS A;  3VV0 A;  4GZ3 A;  2XGM A;  3CK9 A;  3LKU A;  4N39 A;  2UY1 B;  4N2Q A;  3BEE A;  3FWV A;  3SW9 A;  1W3B A;  4HOR A;  1ML9 A;  3U3W A;  2BQZ A;  3F9X A;  3AS4 A;  4BT9 A;  4BWR A;  4UI9 C;  4QEN A;  1HXI A;  5DBK A;  5F6L A;  3MO5 A;  4JA9 A;  2HO1 A;  3PE3 A;  4UQY A;  5C1D A;  4YNM A;  5G05 C;  2VSY A;  5FZQ A;  1ZKK A;  4U07 A;  4G24 A;  2FBN A;  3S8P A;  3EDT B;  3RJV A;  3SF4 A;  5D0O D;  5KJM A;  1KT0 A;  4GYO A;  3MO2 A;  1PEG A;  4RZ0 A;  4A1S A;  2VQ2 A;  2WQH A;  3U4T A;  3PDN A;  4GA1 A;  4YPE A;  3TAX A;  3UUX A;  5JJ7 A;  1IHG A;  1WM5 A;  4AIF A;  1N6A A;  2YQ8 A;  2VGY A;  1MUF A;  3AS5 A;  2KCK A;  1NA0 A;  1O9S A;  4GYW A;  3PE4 A;  4I9E A;  5JIY A;  3CBO A;  3OPE A;  2VSN A;  2J9Q A;  2OND A;  3KMJ A;  4KYO B;  4UI9 J;  2XPI A;  2PL2 A;  3Q5M A;  3KMA A;  4JA7 A;  4YVQ C;  2XEV A;  2XGS A;  2AVP A;  3FP3 A;  3WXX A;  1KLX A;  5G05 J;  3DAL A;  3IHX A;  3OXL A;  5F5E A;  4MI0 A;  2F69 A;  2PQN A;  5JJ6 A;  4KXK B;  5CCM A;  3TG5 A;  5T5G A;  5CCL A;  4I9C A;  1A17 A;  4NRH B;  1IYG A;  5FZR A;  4EQF A;  4Y6C A;  3ZPJ A;  3CKC A;  3SWC A;  3ASD A;  3KS2 A;  1TJC A;  3Q15 A;  4RG9 A;  3RO2 A;  4J7I A;  3LY7 A;  3UPV A;  5LSZ A;  5EX3 A;  3MV2 B;  3VTY A;  4Z4P A;  5BNW A;  3F9Y A;  1N6C A;  3M57 A;  4YPA A;  4CGW A;  4IN3 B;  3F9W A;  2LSU A;  3OOI A;  4WNE A;  5M72 A;  4I1A A;  4GYY A;  4J83 A;  3S7F A;  4N3B A;  4AM9 A;  2UWJ G;  4IJ8 A;  4LEU A;  4N3A A;  4XI0 A;  5T0M A;  4GCO A;  4YVO A;  4XIF A;  2Y4U A;  3ZGQ A;  2W5Y A;  2P58 C;  4U0S A;  5G04 C;  3CVL A;  2FI7 A;  4NQ0 A;  5LCW C;  3M5A A;  4KBQ A;  4APO A;  5HI7 A;  3DB5 A;  1ZBP A;  2V5F A;  5KJK A;  3MV3 B;  3QWW A;  3GYZ A;  5A7D B;  4JLG A;  4GZ6 A;  2YHC A;  4J8D A;  4J0U A;  3IEG A;  3GZ2 A;  4AY6 A;  4AU7 A;  4N3C A;  2JV0 A;  3K5K A;  2JLB A;  1MVX A;  4YND A;  3R9A B;  3EP0 A;  5EX0 A;  4YPU A;  2NC9 A;  3Q4A B;  2E2E A;  3KD7 A;  5TEG A;  5ARF A;  1ELR A;  3M53 A;  5TH7 A;  2RFI A;  1N3J A;  3RJW A;  3M58 A;  4G25 A;  1B89 A;  5LSX A;  1HH8 A;  1OUV A;  3HYM B;  2FF4 A;  2PZI A;  3F9Z A;  3RKV A;  4G2V A;  3S7D A;  4J7F A;  5A6C A;  4J8F A;  4H7X A;  2R3A A;  4BUP A;  2IGQ A;  4UQZ A;  5KJL A;  3N71 A;  3QKY A;  5EG2 A;  3O48 A;  3ASG A;  5G04 J;  4XI9 A;  3CEQ A;  4U0Z A;  3MA5 A;  1PC2 A;  2QFC A;  3ESK A;  5LCW J;  3LYA A;  3OXF A;  3QWP A;  4B94 A;  4U0U A;  2OOE A;  2KC7 A;  4H7Y A;  4ME2 A;  2KCV A;  1ELW A;  3ULQ A;  4HOT A;  2IFU A;  5KJN A;  4BTB A;  4I17 A;  1XQH A;  4ABN A;  3CBP A;  3LY9 A;  5CHE E;  1H3I A;  4FMU A;  2BUG A;  1HZ4 A;  4LDG A;  4NVQ A;  3RAY A;  4WUY A;  2VGX A;  5T0K A;  4QEP A;  3QDN A;  3CVQ A;  4JHR A;  1MVH A;  4Y6W A;  5FJY A;  4F3V A;  3M56 A;  4JL0 A;  2C2L A;  2C0M A;  5JHN A;  4WND A;  3RU0 A;  3CK8 A;  4N5C A;  1YA0 A;  4CGV A;  4GCN A;  3AS8 A;  5JIN A;  2XCB A;  5AYF A;  4O6F A;  4N2S A;  3M55 A;  5BT1 A;  5BW8 C;  2XGO A;  3Q49 B;  4GZ5 A;  5FT9 A;  2W5Z A;  4GPK A;  3HNA A;  3FPD A;  3M59 A;  3CV0 A;  2VYI A;  2LNI A;  4G1T A;  4AY5 A;  1Y8M A;  4G23 A;  3RIB A;  1NA3 A;  5D0Q D;  3KMT A;  3ASF A;  4MI5 A;  3URZ A;  3S7J A;  3ZHE A;  4I51 A;  2VGX B;  3CVP A;  4HOQ A;  4WNG A;  4RG6 A;  1NZN A;  3E4B A;  4I2W A;  4JDS A;  3GW4 A;  4W9R A;  2O8J A;  3VUZ A;  3MKR A;  4BT8 A;  5FTP A;  2LSV A;  5JJT A;  2Q7F A;  4GA0 A;  4E47 A;  2C0L A;  4C1Q A;  3OS5 A;  3BO5 A;  1P5Q A;  3NF1 A;  4IJD A;  3LCA A;  3LPZ A;  3LY8 A;  5AYW D;  1QZ2 A;  4I2Z A;  3CVN A;  5JJ0 A;  2IF4 A;  2DBA A;  1WAO 1;  1MT6 A;  3SZ7 A;  5TTF A;  5CPR B;  4HOU A;  3K9I A;  4O30 A;  3QOU A;  3ZHE B;  3VTX A;  2L6J A;  3TG4 A;  2FO7 A;  3MO0 A;  5EKQ D;  2HR2 A;  1E96 B;  5HQ8 A;  2KAT A;  2MHK A;  3ZFW A;  4H12 A;  5F6K C;  2I6H A;  2UY1 A;  4G26 A;  4CDR A;  5DIZ A;  3OXG A;  2GW1 A;  1XNF A;  2G46 A;  4J8E A;  1FCH A;  4QEO A;  4UI9 K;  3TGO A;  3RO3 A;  3RQ4 A;  3UQ3 A;  4J8O A;  3MEK A;  4YNP A;  3KAE A;  1KT1 A;  5ARG A;  3JYS A;  3M54 A;  3Q47 B;  4GA2 A;  1ZU2 A;  3ASH A;  4U04 A;  2PQR A;  1QQE A;  3FFL A;  2HYZ A;  4WNF A;  2QPW A;  5F59 A;  4HOS A;  2WPV A;  2FEZ A;  2XCC A;  2R5S A;  3CK7 A;  3QWV A;  3CBM A;  4UQX A;  4NJ5 A;  2Y4T A; 
#chains in the Genus database with same CATH topology
 1GW6 A;  4HI9 A;  1LD7 A;  4IYP A;  1OWL A;  1V54 E;  3Q73 A;  4JD2 G;  4BSZ B;  4DX7 D;  3JXJ A;  1K1B A;  4HLL A;  4BET A;  3FWV A;  2WB2 A;  1N54 A;  1ML9 A;  2BQZ A;  4BT9 A;  1AWC B;  5ENN A;  1HXI A;  4DX5 D;  1OWO A;  2P9K G;  4TXP A;  2WXN A;  2HO1 A;  4GMJ A;  2EIL E;  3PE3 A;  3WG7 E;  3UXG A;  2DZN A;  5C1D A;  3PZD A;  3MYV A;  4B8A A;  2A4Z A;  4G24 A;  4OAU C;  3S8P A;  4RSY A;  3RJV A;  3JQ1 A;  4ANU A;  5D0O D;  1D9S A;  3FY4 A;  3AJI A;  4GYO A;  3MO2 A;  3PZ1 A;  5ENT D;  2WQH A;  3FTZ A;  2BTD A;  1TN7 A;  4GA1 A;  4YPE A;  3TAX A;  3TWW A;  1H2T C;  2YQ8 A;  2KCK A;  3CHP A;  5AAO A;  4F6R D;  1O9S A;  3KSL A;  5JIY A;  3CBO A;  4MKT A;  3ABM E;  3KMJ A;  2XPI A;  4AXH A;  3C3Q A;  4O1O A;  4A63 B;  3D9M A;  4EZK A;  2XEV A;  2AVP A;  3FP3 A;  3BU8 A;  1KLX A;  2LAH A;  4LSZ E;  3GZS A;  5G05 J;  3CQC B;  1EF1 C;  4APF A;  3BG0 B;  4CT0 A;  3ZYQ A;  1NI1 A;  2PQN A;  2XS8 A;  5JJ6 A;  3TG5 A;  3SY2 A;  4ATZ D;  3PEV B;  5T5G A;  1UN9 A;  1OCR E;  2DIW A;  3SFZ A;  1EYH A;  3UIO C;  3EU9 A;  3TWR A;  4Y6C A;  5CEC B;  2DZO A;  3ML8 A;  1K3Z D;  3HXD A;  3DSW A;  3ASD A;  2X6I A;  1TNZ A;  5ENO D;  3M57 A;  4UWF A;  3ESL A;  1TN8 A;  4IN3 B;  2LSU A;  4WNE A;  2X6K A;  4I1A A;  4J83 A;  3S7F A;  3TXN A;  4RVB A;  1SVX A;  2EIM E;  2F8X K;  4XX5 A;  3HXC A;  4AM9 A;  3LS8 A;  3B7R L;  5T0M A;  4GCO A;  4YVO A;  3U64 A;  3CIA A;  5HRY A;  2P58 C;  4U0S A;  2DYS E;  2ZXW E;  3ABL E;  1DVP A;  5FQ4 A;  4U63 A;  3QJZ A;  3RAU A;  3Q79 A;  3ZEF A;  2HE0 A;  5HI7 A;  1ZBP A;  2V5F A;  3HVE B;  2DYR E;  3CGH A;  3CVX A;  4J0U A;  4AY6 A;  4J8S A;  4N3C A;  2WXI A;  4AU7 A;  4LRZ A;  2JLB A;  3HHM A;  1MVX A;  3R9A B;  1TJF A;  1TR4 A;  5CRV A;  1U3C A;  2M63 A;  2E2E A;  3KD7 A;  5ARF A;  2AJA A;  1AP7 A;  3AAA C;  4G25 A;  5EDS A;  1B89 A;  2GRM A;  1HH8 A;  3ZIM A;  2FF4 A;  2PZI A;  5FQ7 A;  1LTX A;  1HG2 A;  3E30 A;  2NSZ A;  3EHM A;  3Q7F A;  5G04 J;  4XI9 A;  2CG3 A;  1PC2 A;  3ESK A;  1G3N B;  3Q9N C;  5ENP D;  5LCW J;  3JQ0 A;  3CHQ A;  5EN5 D;  4B94 A;  2ZIS A;  4U96 D;  5AN8 A;  1OCO E;  2OOE A;  3FUM A;  2V8S E;  4ME2 A;  2IOS A;  4HOT A;  2IEJ A;  3LEW A;  3CBP A;  3BG1 B;  3LY9 A;  2WXF A;  4YDY A;  2BUG A;  5FQ6 A;  2J4B A;  3E34 A;  2VGX A;  4DJA A;  2CFU A;  3M56 A;  3SD5 A;  2C0M A;  5JHN A;  2OCC E;  5T3R A;  4R7L A;  3CK8 A;  3B13 A;  2DVW A;  2WXM A;  4GCN A;  3MGB A;  3T5V A;  1H6P A;  3UM0 A;  5AYF A;  4DRX E;  4L2Y A;  1UG3 A;  3FH5 A;  5BW8 C;  2OVF A;  4GZ5 A;  4Z68 A;  4AEZ C;  2L6B A;  2V4L A;  3TJP A;  3HNA A;  3FPD A;  3CHS A;  3JUI A;  4HI8 A;  2WXO A;  4PUC A;  3M59 A;  4AY5 A;  3RIB A;  5ENS D;  2YNQ A;  3ASF A;  1K1A A;  3NZS A;  4ILG A;  2DWZ A;  3ZHE A;  3CVU A;  4BEP A;  1HS6 A;  3RSE G;  1YYH A;  3TWS A;  3W9F A;  1NZN A;  3CHO A;  1IKN D;  3GW4 A;  3FUD A;  3MKR A;  4BT8 A;  5JJT A;  3D9H A;  1UN8 A;  3SBS A;  2C0L A;  3BO5 A;  3DSU A;  2GRQ B;  4L2L A;  1P5Q A;  1BI8 B;  4FLH A;  3I4G A;  4U95 D;  3MCX A;  2B6C A;  3APC A;  2KZT A;  2DBA A;  2AWI A;  1WAO 1;  4ANW A;  3SZ7 A;  1MT6 A;  2A5E A;  1XGW A;  5B3S E;  1O1T A;  5ENQ D;  3K9I A;  4TXR A;  3Q9U C;  4TUM A;  4TUU A;  4ANX A;  3UKR G;  1MYO A;  2EQX A;  2HR2 A;  3NB2 A;  3W9G A;  3ZFW A;  3RRM B;  1H2V C;  3R7Q A;  4CDR A;  3APF A;  4BER A;  3OXG A;  4EZL A;  1XNF A;  2G46 A;  4Q94 A;  1N52 A;  4FHJ A;  2IO2 C;  3TGO A;  4HBD A;  3UQ3 A;  4J8O A;  4DPR A;  3D9O A;  1E8Y A;  4LG6 A;  4GTO A;  5AQA A;  4I6J A;  2LUH A;  3FUK A;  3PZ2 A;  3Q47 B;  1ZU2 A;  2B0O E;  3ASH A;  4U8H A;  2PQR A;  5BUZ A;  2QYJ A;  3FFL A;  3SHF A;  4WNF A;  3QC1 A;  4UWH A;  2GRP B;  4UQX A;  4DX2 A;  3ZW3 A;  4NJ5 A;  1H0A A;  1TN6 A;  3CHR A;  3S7B A;  2KCL A;  4BTA A;  4BES A;  2WXQ A;  3ZXP A;  2XGM A;  2R05 A;  5B1A E;  2VSO E;  3UT8 A;  3LKU A;  3ZYL A;  2QC9 A;  2J07 A;  4BX8 A;  1JPL A;  1W3B A;  4C48 B;  5CED B;  2VJ8 A;  3U3W A;  3FUJ A;  4UI9 C;  3ONK A;  2L0T B;  3SI5 A;  5F6L A;  4JA9 A;  1SA4 A;  4UQY A;  3SBT B;  4I43 A;  5LOZ A;  3EDT B;  4HXI A;  4GTP A;  3ULE G;  3TWX A;  5KJM A;  1KT0 A;  1N0R A;  2IU1 A;  1MZC A;  1MX6 A;  2LXL A;  3G2T A;  3UUX A;  5G55 A;  3ZU7 B;  1BI7 B;  2GRN B;  5JJ7 A;  1IHG A;  4AIF A;  3ZYM A;  4HRL A;  3MJW A;  1RW2 A;  1NA0 A;  2DCP A;  4G8L A;  2GRL A;  4K0R A;  5E76 A;  3L13 A;  4I9E A;  3FEY A;  3D9J A;  3OPE A;  2VSN A;  2P9L G;  4KYO B;  3AG2 E;  2P2C P;  3HIZ A;  3KMA A;  2XGS A;  2ZU6 B;  5JHA A;  3WXX A;  1KZP A;  4NIK A;  4PS8 A;  1O1R A;  1N9A A;  1IQU A;  3FTY A;  2F69 A;  1SA5 A;  1BLX B;  3L6A A;  4HRM B;  3KSQ A;  4NRH B;  2WXL A;  4ILH B;  4P29 A;  2WXK A;  4L7T A;  4B0Z A;  3CKC A;  3SWC A;  4XE0 A;  4KMO A;  3KS2 A;  3FU5 A;  1TJC A;  1Z5S C;  3J5P A;  3LY7 A;  3CLJ A;  4WWN A;  1N6C A;  4YPA A;  5EYL A;  4CGW A;  3UM3 A;  3OOI A;  3C98 A;  3DWL G;  4N3B A;  3G2S A;  4N3A A;  3IHV A;  5C2Y A;  4XIF A;  3ZGQ A;  3ISM C;  2W5Y A;  5CER B;  1Z6T A;  3HXF A;  4GTR A;  4JB8 P;  5CMW A;  2VTB A;  4NQ0 A;  3KEA A;  3M5A A;  4KBQ A;  1EDU A;  4JHJ A;  3TL5 A;  2ION A;  3QWW A;  3SFY A;  2YHC A;  4J8D A;  3IEG A;  2R03 A;  5BXO A;  4IUL A;  2J09 A;  2JV0 A;  1MX2 A;  3DXK G;  4YND A;  3DPY A;  3EP0 A;  5AQB A;  4YPU A;  4U7E B;  2NC9 A;  4A1G A;  3Q4A B;  2WQ6 A;  4UWL A;  3ZYK A;  5TEG A;  5FWQ A;  5TH7 A;  2RFI A;  4EEC A;  3RJW A;  1DCQ A;  5LSX A;  1LD8 A;  2V4H C;  2XEH A;  3RKV A;  3NQP A;  2PNN A;  5A6C A;  4KZC A;  4FLB A;  2R3A A;  1N0Q A;  4CDM A;  2IGQ A;  2J08 A;  4UQZ A;  2ETB A;  3QKY A;  4ATG A;  5EG2 A;  3BQO A;  3MA5 A;  2QFC A;  2P9N G;  2BKK B;  2AW6 A;  4U0U A;  1SW6 A;  1TNO A;  4HS2 A;  5KJN A;  4X8Q A;  1MJ0 A;  3UTM A;  4I17 A;  3EUV A;  4DUI A;  5CHE E;  3P2B A;  1H3I A;  4XKC A;  1HZ4 A;  2QYU A;  3D3M A;  4LDG A;  3RAY A;  3HDX A;  4FHK A;  2PM6 A;  3UT4 A;  3CVQ A;  4JHR A;  4Y6W A;  4JEH A;  4WND A;  2WXR A;  4UWG A;  2V5Q C;  3RU0 A;  4FU3 A;  2I1J A;  4N5C A;  3PNL B;  1U2V G;  4O6F A;  4N2S A;  3HXE A;  2RKK A;  3UX4 A;  1OT8 A;  3FUN A;  3LXU X;  4HB5 A;  2RG8 A;  3AG1 E;  1RZ4 A;  3FUH A;  4J6I A;  4GML A;  4F7A A;  4OAV B;  3CV0 A;  2VYI A;  4G1T A;  2P9I G;  4WAF A;  1Y8M A;  3KMT A;  3FUF A;  2I1K A;  3NBN B;  3DRA A;  4FUL A;  3CQG B;  4BX9 A;  2OVB A;  5T4Y A;  4A3T A;  4PS7 A;  4I2W A;  4JDS A;  4W9R A;  3FU6 A;  3VUZ A;  3UM1 A;  1FVF A;  4GA0 A;  3UIP C;  4E47 A;  4C1Q A;  4GTM A;  3NF1 A;  4PH4 B;  5AJD A;  3LPZ A;  3LY8 A;  1HX8 A;  2AXU A;  4FP7 A;  2VTB B;  2WQ7 A;  3NZU A;  4LCT A;  2WXJ A;  2R2L A;  5TTF A;  4HOU A;  4O30 A;  2XZT G;  3QOU A;  3MO0 A;  2R02 A;  5EKQ D;  3ASO E;  3L82 A;  4GB9 A;  4H12 A;  5F6K C;  5KCM A;  5DIZ A;  2IY0 C;  3NOG D;  4J8E A;  3UMV A;  2FUL A;  3V2X A;  1IHB A;  1N4S A;  4G11 A;  4DK5 A;  1UJJ A;  4YNP A;  2IOL A;  1KT1 A;  4DX6 D;  3O4Z A;  2X6H A;  3AG3 E;  4FAD A;  4N5Q A;  3DST A;  2QPW A;  5F59 A;  3RRN B;  2WPV A;  2FEZ A;  2XCC A;  2XEN A;  1H2U A;  3RRU A;  4CT4 A;  3CVY A;  2LXM A;  3FTS A;  3MKQ B;  1V55 E;  3ZN3 A;  3PVL A;  4B89 A;  3TXM A;  4GZ3 A;  3CK9 A;  4FC8 A;  3JCK C;  4N39 A;  2UY1 B;  4HVB A;  4QQI A;  4N2Q A;  3BEE A;  1PAQ A;  1OCC E;  4C9B B;  4I1M A;  4HOR A;  3EHN A;  3F9X A;  4BWR A;  4NAC A;  4NUR A;  2P9S G;  5DBK A;  4DI4 A;  2MRI A;  3MO5 A;  2NYJ A;  5D66 A;  4HQD A;  2LAI A;  3I5P A;  3TWV A;  4YNM A;  5G05 C;  2FO1 E;  3F6Q A;  4JZY A;  5FZQ A;  1ZKK A;  4U07 A;  3V30 A;  2BF0 X;  4GTT A;  2WXH A;  3G2U A;  4F1P A;  4A1S A;  2VQ2 A;  3MX3 A;  3FDH A;  3U4T A;  3ZXS A;  3DPD A;  2BED A;  3SO8 A;  3D9P A;  4YDE A;  4J7W A;  2ETA A;  2MOW A;  3AS5 A;  4EZJ A;  1WY6 A;  4GYW A;  3PE4 A;  2IO3 C;  1TNU A;  3E37 A;  4AJW A;  1PY1 A;  2J9Q A;  2PL2 A;  3Q5M A;  2WMO A;  3FUI A;  2JAB A;  1FT2 A;  4UWK A;  3CR3 A;  3DAL A;  3PUK A;  5KNH D;  4F53 A;  2F0Y A;  3APD A;  4KXK B;  5CCM A;  1YCS B;  1VDY A;  3T9K A;  4J8Y A;  4I9C A;  5LP0 A;  1A17 A;  3PH0 C;  3FUL A;  5FZR A;  1FPP A;  3FTU A;  1N11 A;  3D9I A;  2GRR B;  2Y1L E;  3ZUV B;  4UUC A;  4RG9 A;  3RO2 A;  4J7I A;  5LFA A;  1L5J A;  3G2V A;  5LSZ A;  5EX3 A;  3MV2 B;  4Z4P A;  5T8I A;  1FT1 A;  3DXM G;  4F1S A;  3F9W A;  5D2M C;  3RK6 A;  2XS1 A;  1KPS B;  3E33 A;  4U8Y D;  1INZ A;  3UKU G;  4AVX A;  2UWJ G;  4LEU A;  1H19 A;  1SZA A;  3DEO A;  2Y4U A;  4Q69 A;  5G04 C;  2I9C A;  3PRE A;  2WXP A;  3R9M A;  3CVL A;  3Q7A A;  5LCW C;  3C3R A;  2NXP A;  2X38 A;  3ZNG A;  2CFZ A;  3DB5 A;  3PUJ A;  2ZGG A;  5KJK A;  5A7D B;  1QBQ A;  1IQR A;  2J49 A;  3TWU A;  4GZD A;  1OY3 D;  2Y0B G;  1ELK A;  2I2O A;  3OTN A;  5EX0 A;  5KNG A;  3R7R A;  3ZRH A;  2IJG X;  5J08 A;  2HM8 A;  1N3J A;  4M3O A;  4MLP A;  2YIN A;  2GRO B;  1N95 A;  4EBA A;  3KEZ A;  3HYM B;  3VLF A;  3F9Z A;  4G2V A;  4J7F A;  4J8F A;  3U9W A;  4K03 A;  4BUP A;  4C0E A;  2RFA A;  5H7P A;  4TRQ A;  3G2W A;  4TXQ A;  1DNP A;  3B7T A;  4GTQ A;  4U0Z A;  3LYA A;  3QWP A;  4ILI A;  2KC7 A;  4H7Y A;  3TWT A;  2KCV A;  1ELW A;  1NL4 A;  4BSX A;  4BTB A;  4JXT A;  2GGF A;  1U3D A;  3IHY A;  2PM7 A;  1QYM A;  3ZVV A;  4EHM A;  4YDO A;  4WUY A;  5CEA A;  5T0K A;  5JHB A;  3QDN A;  1D8D A;  5HKP A;  1MVH A;  2P9U G;  5FJY A;  4F3V A;  4JL0 A;  4AOF A;  1WG0 A;  4C0M A;  1YA0 A;  4Q96 A;  5EIB E;  2RFM A;  4LER A;  3JXI A;  5JA4 D;  4CRW A;  1N4R A;  3M55 A;  3CVV A;  3FTW A;  3Q49 B;  5HS0 A;  3PEU B;  4GTV A;  2ILR A;  1S63 A;  3PZ3 A;  5FT9 A;  3DSX A;  1LF8 A;  3UIN C;  5BV0 A;  3Q75 A;  5D0Q D;  4ACK A;  1E90 A;  2KM4 A;  3FH8 A;  2VSX E;  3S7J A;  3AU5 A;  2OEV A;  1YMP A;  4I51 A;  5EIL A;  5JMN D;  2RD0 A;  3FTV A;  4HOQ A;  3CST A;  1X5B A;  3FU3 A;  4RG6 A;  3SNX A;  4GMR A;  4FJY A;  5FTP A;  2LSV A;  1TNY A;  3SQV A;  2Q7F A;  4MS6 A;  3LDZ A;  5CBN A;  3OS5 A;  2Y69 E;  4YDW A;  3EHR A;  3B95 A;  4HFG A;  1NP7 A;  3LCA A;  5IY5 E;  2H6F A;  4JC8 A;  1QZ2 A;  3OAW A;  3PS6 A;  4I2Z A;  5JJ0 A;  1K8K G;  3T8K A;  4IRU A;  3L17 A;  3QB2 A;  5J90 A;  5CPR B;  2WXG A;  3DEP A;  3MKQ A;  3IBE A;  2L6J A;  3TG4 A;  2FO7 A;  2ZIR A;  5AQ9 A;  4XKB A;  3LVR E;  4MBG A;  2A5U A;  4BFR A;  2MHK A;  3EHQ A;  1EPU A;  1E7V A;  4PS3 A;  3PNT B;  2I6H A;  2UY1 A;  3CSF A;  2YHE A;  3FHE A;  2ZGD A;  2XHE A;  1HG5 A;  1S70 B;  4UI9 K;  4JHK A;  3EJN A;  3RO3 A;  1O5M A;  4OVV A;  1UOH A;  4GA2 A;  2J4D A;  4U04 A;  1Z3X A;  3T5X A;  1HO8 A;  4LNB A;  4M7C A;  4L9P A;  4KVO A;  2R5S A;  3CK7 A;  3CBM A;  4ZHB A;  3EIQ C;  2Y4T A;  3X2Q E;  1HFA A;  1UJK A;  1OCZ E;  2EIN E;  3CKB A;  3CHM A;  3GZ1 A;  5FZS A;  4I1O B;  1H6O A;  4EBA G;  3VV0 A;  1IXV A;  4D10 C;  2IQC A;  1D8E A;  1DC2 A;  4G8K A;  5B1B E;  4DLQ A;  4B93 B;  1SQM A;  2X3M A;  4I6E A;  5CMY A;  3SW9 A;  1DCE A;  4CYM D;  3AS4 A;  4RLY A;  5AEN A;  4QEN A;  3FH7 A;  5E75 A;  4RQI A;  4KT6 B;  1N94 A;  2VSY A;  4B8C B;  2FBN A;  3C3O A;  1O1S A;  3SF4 A;  5KBA A;  1Z3Y A;  1OWN A;  1SZ9 A;  3C72 A;  4TV3 A;  3L16 A;  4XEI G;  1PEG A;  1JCR A;  4RZ0 A;  2XRY A;  2CHZ A;  2CG2 A;  3PDN A;  2J8S D;  1S0P A;  4KVM A;  3QAR A;  1WM5 A;  4O1P A;  1BPO A;  4HLE A;  1N6A A;  4JEU A;  2VGY A;  1MUF A;  2OV8 A;  4URK A;  3DSV A;  5BXU A;  1BD8 A;  3P1U A;  3C5R A;  2OND A;  4UI9 J;  2CHX A;  1Q2Z A;  5AQ7 A;  4KZ0 A;  4JA7 A;  4QFV A;  3S2A A;  1JWF A;  2QZA A;  3SGH A;  5AIJ A;  4YVQ C;  5AAR A;  4JVS A;  1E8X A;  3EIJ A;  3IHX A;  3OXL A;  5F5E A;  4FJZ A;  4MI0 A;  3IXE A;  4GU5 A;  4JW1 A;  5AJL A;  3D9N A;  4LNU D;  5CCL A;  4A3V A;  3D9K A;  1IYG A;  3V79 K;  1E8Z A;  4AP2 A;  4L1B A;  4EQF A;  3NAW A;  4AV7 A;  3ZPJ A;  5EYP F;  2X6J A;  4GPM A;  3Q15 A;  3FU0 A;  3T8M A;  2V0P A;  3UPV A;  4OVU A;  1OWM A;  3VTY A;  5BNW A;  3F9Y A;  2OEW A;  1BU9 A;  4E85 A;  3JUE A;  4FA6 A;  3I3N A;  5M72 A;  5CBO A;  4CDN A;  4EPZ A;  4GYY A;  3LJ3 A;  2F8Y A;  3V2O A;  4OYS A;  4HNA D;  2F37 A;  4IJ8 A;  4L23 A;  1TNB A;  4XI0 A;  2R59 A;  3CVW A;  2Y3A A;  4K5B A;  4GAA A;  3B7B A;  2FI7 A;  4APO A;  3DBS A;  5EID A;  1ZB1 A;  3MV3 B;  3GYZ A;  4JLG A;  4JPS A;  4GZ6 A;  2XPZ A;  2EIJ E;  3QAQ A;  3GZ2 A;  3K5K A;  3HXB A;  1E8W A;  3VLD A;  4PDX A;  1A5E A;  1S64 A;  3FUE A;  4ACL A;  1ELR A;  2MYO A;  3M53 A;  3B7S A;  4LNG A;  4CEM A;  3M58 A;  2H6G A;  1OUV A;  1HF8 A;  4A55 A;  3S7D A;  5A23 A;  3MZL B;  4H7X A;  5CRU A;  1JUQ A;  5KJL A;  3N71 A;  1Y6I A;  3ASG A;  3ENE A;  3O48 A;  5FIN A;  4BY6 A;  3D9L A;  3CEQ A;  5ENR D;  2AXZ A;  3UM2 A;  4K5A B;  2KXP C;  3L54 A;  3OXF A;  4CZ2 D;  3ABK E;  3LJN A;  1X81 A;  4V3I A;  1WDY A;  3ULQ A;  4E6H A;  2IFU A;  2ETC A;  5FQ8 A;  1XQH A;  1H6K A;  4ABN A;  5ITZ F;  2L9B A;  4I6G A;  1QNF A;  2E0I A;  4FMU A;  3IV0 A;  4NVQ A;  1N4Q A;  4CCA A;  4QEP A;  3EU5 A;  3HRA A;  1HE8 A;  2H6H A;  1N4P A;  2JEK A;  3I4R B;  2C2L A;  1NFI E;  4GZC A;  3ML9 A;  5ANL A;  4CGV A;  3AS8 A;  5JIN A;  2XCB A;  5FIO A;  2L0I A;  3ONL A;  1MQS A;  5BT1 A;  5G2N A;  3ULY A;  4HRN A;  3UI2 A;  1HU3 A;  2XGO A;  4MRU A;  3UT7 A;  2W5Z A;  3ZKJ A;  4GPK A;  2LNI A;  2WMN A;  1UW4 B;  4G23 A;  1OXJ A;  1JWG A;  1NA3 A;  4MI5 A;  3Q78 A;  2P9P G;  3URZ A;  4WWP A;  3AG4 E;  1MX4 A;  2KBX A;  5KWD A;  3L08 A;  2H6I A;  2VGX B;  3CVP A;  2QY7 A;  2XRZ A;  4WNG A;  3BUA A;  3B7U X;  1FVH A;  1MHQ A;  3DSS A;  3E4B A;  2O8J A;  2XEE A;  3AU4 A;  3PRZ A;  5BV1 A;  2XPY A;  3TWQ A;  4DLO A;  2BKG A;  1JCS A;  3HG0 D;  1TEZ A;  3SFX A;  3PZ4 A;  4IJD A;  1KZO A;  1E7U A;  2WVI A;  2R17 C;  3QNK A;  3E32 A;  5AYW D;  3QK0 A;  4WWO A;  3CVN A;  5BPP A;  4XZ4 A;  1OWP A;  2IF4 A;  3VLE A;  1JCQ A;  3L22 A;  3L9T A;  3V31 A;  3VTX A;  3ZHE B;  4ANV A;  2AXV A;  1E96 B;  1TYQ G;  5HQ8 A;  2KAT A;  3FTX A;  2XZD G;  4DI3 A;  4G26 A;  4U8V D;  3LVQ E;  2GW1 A;  4K5C A;  1FCH A;  3J5Q B;  4QEO A;  4ZFH A;  3RQ4 A;  2EIK E;  4GTS A;  2LO6 A;  3MEK A;  3KAE A;  5ARG A;  2CHW A;  3JYS A;  4O60 A;  3M54 A;  2XQ0 A;  3NOC D;  3ASN E;  4LUN U;  1QQE A;  2HYZ A;  3U66 A;  5LX8 A;  2KZT B;  3FEX A;  2WM9 A;  4DX1 A;  4HOS A;  3IKO B;  3QWV A;  2VGE A;  2X6F A;  3HVE A;  5ANR A; 
#chains in the Genus database with same CATH homology
 3S7B A;  2KCL A;  1HFA A;  1UJK A;  3ZN3 A;  1GW6 A;  3PVL A;  4B89 A;  4BTA A;  3CKB A;  3CHM A;  3GZ1 A;  5FZS A;  4I1O B;  2WXQ A;  4EBA G;  3TXM A;  4IYP A;  3VV0 A;  4GZ3 A;  4D10 C;  2IQC A;  1OWL A;  2XGM A;  2VSO E;  3CK9 A;  4FC8 A;  3UT8 A;  3LKU A;  3JCK C;  4N39 A;  3ZYL A;  2UY1 B;  2J07 A;  4DLQ A;  4HVB A;  4N2Q A;  1SQM A;  4BX8 A;  2X3M A;  4I6E A;  3BEE A;  1PAQ A;  3FWV A;  5CMY A;  1JPL A;  2WB2 A;  4C9B B;  3SW9 A;  1N54 A;  1W3B A;  4I1M A;  4HOR A;  1ML9 A;  2VJ8 A;  3U3W A;  3EHN A;  2BQZ A;  3F9X A;  3AS4 A;  4BT9 A;  4BWR A;  3FUJ A;  5AEN A;  4UI9 C;  5ENN A;  4NAC A;  4QEN A;  4NUR A;  1HXI A;  5DBK A;  3ONK A;  4DI4 A;  2L0T B;  1OWO A;  3SI5 A;  2MRI A;  5F6L A;  2WXN A;  3MO5 A;  4JA9 A;  2HO1 A;  3FH7 A;  4GMJ A;  5E75 A;  3PE3 A;  4UQY A;  5C1D A;  2LAI A;  3I5P A;  4YNM A;  4KT6 B;  5G05 C;  3PZD A;  3MYV A;  3SBT B;  4JZY A;  2VSY A;  5FZQ A;  4B8C B;  1ZKK A;  4U07 A;  2A4Z A;  4B8A A;  4G24 A;  2FBN A;  4I43 A;  5LOZ A;  3S8P A;  3EDT B;  2BF0 X;  4RSY A;  4HXI A;  3RJV A;  3SF4 A;  1Z3Y A;  1OWN A;  1SZ9 A;  2WXH A;  3JQ1 A;  3G2U A;  5D0O D;  4ANU A;  5KJM A;  4TV3 A;  3FY4 A;  1KT0 A;  3L16 A;  4GYO A;  3MO2 A;  1PEG A;  2IU1 A;  4RZ0 A;  4A1S A;  2VQ2 A;  2XRY A;  3MX3 A;  2WQH A;  3FDH A;  2CHZ A;  3FTZ A;  2BTD A;  2CG2 A;  3U4T A;  3PDN A;  3G2T A;  3ZXS A;  4GA1 A;  4YPE A;  3TAX A;  3DPD A;  5G55 A;  1S0P A;  4KVM A;  3UUX A;  3QAR A;  1H2T C;  5JJ7 A;  1IHG A;  1WM5 A;  4AIF A;  3ZYM A;  1BPO A;  3D9P A;  4HLE A;  1N6A A;  2YQ8 A;  4JEU A;  2VGY A;  3MJW A;  2MOW A;  1MUF A;  2OV8 A;  3AS5 A;  2KCK A;  3CHP A;  1NA0 A;  2DCP A;  4EZJ A;  1O9S A;  1WY6 A;  2GRL A;  4GYW A;  4K0R A;  5E76 A;  3PE4 A;  4URK A;  3L13 A;  4I9E A;  5JIY A;  3FEY A;  3D9J A;  3P1U A;  3CBO A;  4MKT A;  1PY1 A;  2VSN A;  2J9Q A;  2OND A;  4AJW A;  3OPE A;  3KMJ A;  4KYO B;  4UI9 J;  2XPI A;  4AXH A;  2CHX A;  2PL2 A;  3D9M A;  3HIZ A;  3Q5M A;  4KZ0 A;  3KMA A;  4JA7 A;  4QFV A;  3S2A A;  1JWF A;  4EZK A;  2WMO A;  3SGH A;  4YVQ C;  2XEV A;  2XGS A;  2AVP A;  2ZU6 B;  3FP3 A;  3FUI A;  3WXX A;  5AIJ A;  5JHA A;  4PS8 A;  1KLX A;  2LAH A;  1E8X A;  4JVS A;  3EIJ A;  4UWK A;  3GZS A;  3CR3 A;  5G05 J;  3DAL A;  3CQC B;  1EF1 C;  3OXL A;  4APF A;  3IHX A;  4FJZ A;  3PUK A;  1IQU A;  3BG0 B;  5F5E A;  4CT0 A;  3FTY A;  4MI0 A;  3ZYQ A;  2F69 A;  2PQN A;  4GU5 A;  4JW1 A;  5AJL A;  4F53 A;  5JJ6 A;  3APD A;  4KXK B;  5CCM A;  3TG5 A;  3L6A A;  3PEV B;  5T5G A;  1UN9 A;  3D9N A;  1VDY A;  2DIW A;  5CCL A;  4I9C A;  4A3V A;  3D9K A;  5LP0 A;  1A17 A;  4NRH B;  3PH0 C;  2WXL A;  4ILH B;  1IYG A;  3FUL A;  5FZR A;  1E8Z A;  3FTU A;  4P29 A;  3SFZ A;  1EYH A;  2WXK A;  4AP2 A;  3D9I A;  4L1B A;  4L7T A;  4EQF A;  4Y6C A;  4AV7 A;  4B0Z A;  3ZPJ A;  3CKC A;  3SWC A;  2X6J A;  3ML8 A;  4XE0 A;  4KMO A;  3ASD A;  3KS2 A;  3FU5 A;  1TJC A;  3Q15 A;  4RG9 A;  3RO2 A;  3FU0 A;  4J7I A;  2X6I A;  3LY7 A;  5LFA A;  1L5J A;  3T8M A;  2V0P A;  3CLJ A;  3G2V A;  3UPV A;  4OVU A;  5LSZ A;  1OWM A;  5EX3 A;  3MV2 B;  3VTY A;  4Z4P A;  4WWN A;  5BNW A;  3F9Y A;  5T8I A;  1N6C A;  3M57 A;  4YPA A;  4UWF A;  4F1S A;  3ESL A;  4CGW A;  4IN3 B;  3RK6 A;  3F9W A;  2LSU A;  4E85 A;  3OOI A;  3C98 A;  4FA6 A;  4WNE A;  3I3N A;  2X6K A;  5M72 A;  4CDN A;  4EPZ A;  4I1A A;  4GYY A;  4J83 A;  3LJ3 A;  3S7F A;  3TXN A;  4RVB A;  4XX5 A;  1INZ A;  4N3B A;  4OYS A;  4AM9 A;  4AVX A;  2UWJ G;  3G2S A;  4LEU A;  4L23 A;  4N3A A;  4IJ8 A;  4XI0 A;  3IHV A;  1H19 A;  2R59 A;  3LS8 A;  3B7R L;  3CVW A;  5T0M A;  4GCO A;  2Y3A A;  5C2Y A;  1SZA A;  4YVO A;  4XIF A;  2Y4U A;  3ZGQ A;  3U64 A;  2W5Y A;  3CIA A;  1Z6T A;  4Q69 A;  2P58 C;  4U0S A;  5G04 C;  2I9C A;  3PRE A;  2WXP A;  4GAA A;  5CMW A;  3CVL A;  2VTB A;  1DVP A;  5FQ4 A;  2FI7 A;  4NQ0 A;  4U63 A;  3QJZ A;  5LCW C;  2NXP A;  3ZEF A;  3M5A A;  2X38 A;  2CFZ A;  4KBQ A;  4APO A;  5HI7 A;  3DB5 A;  1EDU A;  3DBS A;  1ZBP A;  2V5F A;  4JHJ A;  3TL5 A;  3PUJ A;  5KJK A;  2ION A;  3MV3 B;  3QWW A;  3GYZ A;  3HVE B;  5A7D B;  4JLG A;  4JPS A;  4GZ6 A;  1IQR A;  2J49 A;  2XPZ A;  2YHC A;  4GZD A;  3CGH A;  3QAQ A;  4J8D A;  3CVX A;  4J0U A;  3IEG A;  3GZ2 A;  1ELK A;  4AY6 A;  2I2O A;  4IUL A;  4J8S A;  2WXI A;  4N3C A;  4AU7 A;  2J09 A;  4LRZ A;  2JV0 A;  3K5K A;  2JLB A;  3HHM A;  1MVX A;  1E8W A;  4YND A;  3R9A B;  1TJF A;  3EP0 A;  3OTN A;  3VLD A;  4PDX A;  5EX0 A;  4YPU A;  1U3C A;  3FUE A;  2M63 A;  2NC9 A;  4A1G A;  3Q4A B;  2E2E A;  3R7R A;  3ZRH A;  2WQ6 A;  3KD7 A;  4UWL A;  4ACL A;  3ZYK A;  5TEG A;  5ARF A;  1ELR A;  3M53 A;  2IJG X;  3B7S A;  5FWQ A;  2HM8 A;  5J08 A;  5TH7 A;  2RFI A;  1N3J A;  4M3O A;  4EEC A;  4MLP A;  3RJW A;  4CEM A;  2YIN A;  3M58 A;  4G25 A;  5EDS A;  1B89 A;  2GRM A;  4EBA A;  5LSX A;  1HH8 A;  1OUV A;  3KEZ A;  3ZIM A;  3HYM B;  2FF4 A;  3VLF A;  1HF8 A;  2PZI A;  5FQ7 A;  3F9Z A;  3RKV A;  3NQP A;  4A55 A;  4G2V A;  3S7D A;  5A23 A;  5A6C A;  3MZL B;  4J7F A;  1HG2 A;  4J8F A;  4KZC A;  4H7X A;  3U9W A;  4K03 A;  4FLB A;  2R3A A;  4CDM A;  4C0E A;  2NSZ A;  4BUP A;  2IGQ A;  2J08 A;  1JUQ A;  4TRQ A;  4UQZ A;  5KJL A;  4ATG A;  3EHM A;  3N71 A;  3QKY A;  5EG2 A;  3G2W A;  1Y6I A;  3ASG A;  3ENE A;  3O48 A;  5G04 J;  4XI9 A;  4BY6 A;  3D9L A;  1DNP A;  3B7T A;  3CEQ A;  2CG3 A;  4U0Z A;  2AXZ A;  3MA5 A;  1PC2 A;  2QFC A;  3ESK A;  3L54 A;  5LCW J;  3LYA A;  3OXF A;  3JQ0 A;  3CHQ A;  3QWP A;  4B94 A;  2AW6 A;  4U0U A;  4ILI A;  2OOE A;  4V3I A;  2KC7 A;  3FUM A;  4H7Y A;  2V8S E;  4ME2 A;  2IOS A;  4HS2 A;  2KCV A;  1ELW A;  3ULQ A;  4HOT A;  4E6H A;  2IFU A;  5KJN A;  5FQ8 A;  3LEW A;  4BSX A;  4BTB A;  4I17 A;  1H6K A;  4JXT A;  1XQH A;  4ABN A;  3CBP A;  2L9B A;  3BG1 B;  2GGF A;  4I6G A;  1U3D A;  3IHY A;  3LY9 A;  1QNF A;  2E0I A;  2PM7 A;  2WXF A;  5CHE E;  3P2B A;  1H3I A;  4FMU A;  4XKC A;  3ZVV A;  2BUG A;  5FQ6 A;  3IV0 A;  1HZ4 A;  4LDG A;  3D3M A;  4NVQ A;  3RAY A;  2J4B A;  3HDX A;  4FHK A;  4WUY A;  2VGX A;  4DJA A;  5T0K A;  4CCA A;  5JHB A;  4QEP A;  1HE8 A;  2PM6 A;  3QDN A;  3UT4 A;  3CVQ A;  4JHR A;  1MVH A;  4Y6W A;  5FJY A;  4F3V A;  2CFU A;  2JEK A;  3I4R B;  3M56 A;  3SD5 A;  4JL0 A;  2C2L A;  2C0M A;  4JEH A;  5JHN A;  4WND A;  2WXR A;  4GZC A;  4UWG A;  3RU0 A;  4AOF A;  5T3R A;  4FU3 A;  4R7L A;  2I1J A;  3ML9 A;  3CK8 A;  4N5C A;  3B13 A;  4C0M A;  1YA0 A;  4Q96 A;  5ANL A;  2WXM A;  4CGV A;  4GCN A;  3AS8 A;  3MGB A;  3T5V A;  5JIN A;  2XCB A;  2L0I A;  5AYF A;  3PNL B;  3ONL A;  4LER A;  4L2Y A;  4O6F A;  1MQS A;  4CRW A;  4N2S A;  1UG3 A;  3FH5 A;  3M55 A;  5BT1 A;  3CVV A;  5G2N A;  5BW8 C;  3FTW A;  1HU3 A;  2OVF A;  2XGO A;  3Q49 B;  4MRU A;  3UT7 A;  4GZ5 A;  3UX4 A;  3PEU B;  4AEZ C;  2ILR A;  3FUN A;  3LXU X;  2V4L A;  5FT9 A;  2W5Z A;  3TJP A;  4GPK A;  2RG8 A;  3HNA A;  3FPD A;  3CHS A;  1LF8 A;  3FUH A;  4J6I A;  4GML A;  3JUI A;  2WXO A;  4PUC A;  4F7A A;  3CV0 A;  2VYI A;  2LNI A;  2WMN A;  4G1T A;  1UW4 B;  4AY5 A;  4WAF A;  3M59 A;  1Y8M A;  4G23 A;  3RIB A;  5BV0 A;  1JWG A;  1NA3 A;  1E90 A;  2KM4 A;  2YNQ A;  3ASF A;  3FH8 A;  3FUF A;  5D0Q D;  2I1K A;  4ACK A;  2VSX E;  3KMT A;  3URZ A;  3NZS A;  4FUL A;  4ILG A;  3S7J A;  3ZHE A;  3CQG B;  3AU5 A;  4I51 A;  3CVU A;  4WWP A;  4BX9 A;  1HS6 A;  2RD0 A;  3FTV A;  2VGX B;  3CVP A;  3L08 A;  2OVB A;  2QY7 A;  4HOQ A;  4WNG A;  5T4Y A;  2XRZ A;  4A3T A;  3B7U X;  3CST A;  1FVH A;  1X5B A;  3FU3 A;  1MHQ A;  1NZN A;  4PS7 A;  4RG6 A;  3CHO A;  3E4B A;  4I2W A;  4JDS A;  3GW4 A;  4W9R A;  3FU6 A;  3SNX A;  3FUD A;  3AU4 A;  3MKR A;  4BT8 A;  2O8J A;  3VUZ A;  4FJY A;  5FTP A;  2LSV A;  3PRZ A;  5BV1 A;  5JJT A;  2XPY A;  4DLO A;  1UN8 A;  1FVF A;  2Q7F A;  4GA0 A;  4E47 A;  4MS6 A;  3SBS A;  2C0L A;  3LDZ A;  4C1Q A;  3OS5 A;  3BO5 A;  1TEZ A;  4L2L A;  1P5Q A;  3NF1 A;  4PH4 B;  4FLH A;  5AJD A;  4IJD A;  1E7U A;  4HFG A;  1NP7 A;  3LCA A;  3I4G A;  2WVI A;  3MCX A;  3LPZ A;  3LY8 A;  2R17 C;  3QNK A;  5AYW D;  3QK0 A;  1HX8 A;  4WWO A;  4JC8 A;  1QZ2 A;  3OAW A;  3PS6 A;  3APC A;  4I2Z A;  3CVN A;  5BPP A;  4XZ4 A;  1OWP A;  2AXU A;  5JJ0 A;  2KZT A;  2IF4 A;  2DBA A;  4FP7 A;  2AWI A;  1WAO 1;  4IRU A;  2VTB B;  4ANW A;  3SZ7 A;  2WQ7 A;  1MT6 A;  3NZU A;  3L17 A;  3QB2 A;  4LCT A;  1XGW A;  2WXJ A;  5J90 A;  5TTF A;  5CPR B;  2WXG A;  4HOU A;  3VLE A;  3K9I A;  4O30 A;  3MKQ A;  4ANX A;  4TUU A;  3L22 A;  3QOU A;  3ZHE B;  3VTX A;  3IBE A;  2L6J A;  3TG4 A;  2FO7 A;  4ANV A;  3MO0 A;  5EKQ D;  2EQX A;  4XKB A;  2HR2 A;  2AXV A;  3LVR E;  1E96 B;  2A5U A;  4BFR A;  2KAT A;  2MHK A;  3FTX A;  4GB9 A;  3ZFW A;  5HQ8 A;  3RRM B;  1H2V C;  1EPU A;  1E7V A;  4PS3 A;  4H12 A;  3R7Q A;  4DI3 A;  3PNT B;  2I6H A;  2UY1 A;  5F6K C;  4G26 A;  4CDR A;  3APF A;  5KCM A;  3CSF A;  5DIZ A;  3OXG A;  3LVQ E;  4EZL A;  2YHE A;  2GW1 A;  1XNF A;  3FHE A;  2G46 A;  2XHE A;  4J8E A;  4MI5 A;  4Q94 A;  3UMV A;  1N52 A;  4FHJ A;  1FCH A;  1HG5 A;  2FUL A;  4QEO A;  4UI9 K;  4JHK A;  3TGO A;  3EJN A;  4G11 A;  4DK5 A;  3RO3 A;  3RQ4 A;  3UQ3 A;  4J8O A;  1UJJ A;  4DPR A;  2LO6 A;  3D9O A;  3MEK A;  1E8Y A;  2IOL A;  1KT1 A;  3KAE A;  5ARG A;  4YNP A;  4OVV A;  4I6J A;  3FUK A;  2CHW A;  3JYS A;  3M54 A;  3O4Z A;  3Q47 B;  1ZU2 A;  2X6H A;  4GA2 A;  2J4D A;  3ASH A;  2XQ0 A;  4U8H A;  4LUN U;  2PQR A;  4U04 A;  1QQE A;  4FAD A;  5BUZ A;  3FFL A;  1Z3X A;  3SHF A;  3T5X A;  2HYZ A;  3U66 A;  5LX8 A;  1HO8 A;  2KZT B;  4WNF A;  3FEX A;  2QPW A;  2WM9 A;  5F59 A;  3RRN B;  4HOS A;  2WPV A;  3IKO B;  2FEZ A;  2XCC A;  2R5S A;  1H2U A;  3CK7 A;  4KVO A;  3RRU A;  3QWV A;  3QC1 A;  4CT4 A;  4UWH A;  3CBM A;  4UQX A;  3EIQ C;  2X6F A;  3HVE A;  3CVY A;  3ZW3 A;  2Y4T A;  4NJ5 A;  1H0A A;  3CHR A;  5ANR A;  3FTS A;  3MKQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...