3QX7A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron complexed with phosphate, a closed cap conformation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
224
structure length
224
Chain Sequence
HMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 81
structure length 224
sequence length 224
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qx7A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qx7A01
2RB5A 5ALUA 1U2TA 1T5TA 3S6JA 2AMYA 2YJ6A 3KZXA 4MWOA 2HF7A 1YV9A 2CFRA 1IWOA 3D6JA 4BYGA 2YMMA 3HYCA 2ZBEA 3WGUA 4HGPA 2AUTA 4IFTA 1Z4NA 2HF2A 4Y2JA 2X4DA 2CN1A 3AR3A 4XE5A 4BEVA 4ZEVA 1AQ6A 1L6RA 3QUQA 1QH9A 1FEZA 3BWVA 3DV9A 3QU7A 3QNMA 1QQ7A 5AK3A 3A1EA 2WM8A 4GXTA 4BNDA 1NNLA 2MSNA 3QU4A 4MUMA 3VAYA 4EZEA 2BY4A 4BX0A 2C9MA 3OCZA 5AI4A 5AW5A 3NASA 3QU2A 1Z5GA 1J8DA 1RQNA 3MN1A 2YMLA 5AM4A 3QU5A 3E84A 2HHLA 1RQLA 2RAVA 2WHEA 3IJ5A 1XVIA 2JGAA 4Y2QA 2VKQA 1TJ3A 3U7FB 3FGOA 5ALWA 3ZWKA 5AI0A 3QLEA 1WPGA 3ESRA 3EF1A 4F71A 2IOHA 3NALA 1S8OA 2FUCA 4AP9A 1O08A 2YN4A 4Y2UA 2OA0A 1KYTA 3U13A 2PKEA 5AK4A 2DQSA 2I33A 2R8EA 3QXGA 3IRUA 4KN8A 5A3QA 2YMQA 3SD7A 3R9KA 5AKJA 3PGLA 3L5KA 1VJRA 1Z88A 3U7HB 4BKMA 1XPJA 1X42A 3ZVMA 5AKHA 3KD3A 1Z4KA 2HI0A 2OBBA 1TJ4A 1U7PA 2ZXEA 2ZBFA 3BA6A 5AW1A 5AVQA 4Y2TA 1Z4IA 4O8CA 5AM0A 3J7TA 3N8GA 3ZVNA 2FPWA 3UM9A 2R8YA 3OCVA 5ALHA 3A3YA 2FUEA 2HOQA 1JUDA 4CF3A 3P96A 2W11A 3ZTYA 3ET5A 5ALJA 1N8NA 3ZX4A 1L7PA 1VFPA 2IOFK 3WKBA 3I76A 3FZQA 3WGVA 5ALTA 5ALMA 1ZD5A 4HYTA 2G1AA 4UMEA 5IT0A 1SWWA 3L8HA 3M1YA 3PCTA 3WK5A 1WZCA 3OCWA 1YJ5A 5ALVA 4UMDA 2EATA 3NIWA 2YBDA 5AW8A 3L8FA 5ALGA 4L57A 3UMBA 2YMPA 2WF7A 3DNPA 3WK4A 3W5BA 1Z4OA 3A1CA 3KOOA 3OCXA 5AW3A 4UM7A 1YDFA 1QQ6A 5AVYA 1ZJJA 3FPBA 4ZEWA 2G06A 2AGVA 2GHTA 3N07A 4FYPA 1U2SA 2HEGA 3AR7A 1ZD2P 5ALOA 4IG4A 1Q92A 4NFLA 3I1YA 3QGMA 4C4SA 4KNVA 4Y2YA 3NUQA 4BX3A 1YS9A 2FPSA 1WVIA 2R8ZA 4QJBA 1L7OA 1RLOA 2I34A 3ZU6A 4UAUA 1ZD3A 5AVZA 4HAIA 3L0BA 3QUTA 3UMCA 5AICA 1TJ5A 5ALFA 4HGRA 3WKAA 3WK8A 4YH1A 2I55A 5ALEA 3MMZA 5FP0A 2G0AA 3OTQA 5AW2A 4Y2VA 2JAUA 4JDPA 2HCFA 1J97A 1RMYA 5IT4A 3WK7A 3R4CA 3AR4A 1O03A 2GMWA 3ZX5A 3L0YA 4YIHA 3SF0A 1ZRMA 2FPRA 1Z5UA 1Z4MA 5AVXA 3B9RA 4CE6A 5IS2A 4CF5A 3EWIA 4UATA 5ALZA 4BNDB 1RDFA 1L8OA 1RMTA 2PQ0A 3I6BA 1RRCA 2WF5A 2AH5A 5A3SA 2C8LA 4DCCA 3B9BA 1SU4A 5AKKA 2ZBDA 2O2XA 3GYGA 2R8XA 3HLTA 3SHQA 2PR7A 1Z4QA 3N1UA 3E81A 4RESA 4QQFA 3EF0A 4EX6A 1XP5A 2P9JA 1WR8A 2ZBGA 4OD0A 1QQ5A 1RMQA 3R09A 1CQZA 2RARA 2WFAA 2HDOA 2GHQA 4B6JA 2NO4A 4HGOA 4J03A 3CNHA 4OCZA 2RBKA 4I9FA 5AM5A 2GO7A 4GIBA 1PW5A 1L8LA 2CFTA 2B1RA 1N9KA 3WKCA 4DW8A 3SLRA 5AKIA 3AR8A 5AVWA 1RKVA 3ZW7A 4DWOA 2HO4A 1RLMA 4UU0A 1MH9A 2QYHA 2EARA 1Y8AA 4C4RA 5ALYA 5AVUA 5AVRA 3ZUPA 4EELA 1RPZA 1F5SA 1VJ5A 4HGNA 2FI1A 5AKXA 2YFYA 2FPXA 4L6CA 3QX7A 2FEAA 3FVVA 4UAVA 3RFUA 3AR9A 4L6AA 3SKYA 3OCYA 4FE3A 4XQ0A 2YJ5A 2B0CA 2WF9A 1TA0A 1YNSA 2GFHA 5AIAA 5AIBA 1EK2A 2FPUA 3ZTWA 3B8EA 4UASA 1S2OA 3W5AA 3ONNA 2YJ3A 4UM5A 2YY6A 3E8MA 3NAMA 3I28A 4KX3A 3ED5A 1Z4JA 1ZRNA 4RETA 2BDEA 3QYPA 1K1EA 5AW4A 2HX1A 1ZS9A 3N5KA 4NAVA 4ZEXA 4HGQA 2JAOA 5ALNA 3L8EA 3CZ4A 1YMQA 1U02A 4AS3A 2D2VA 5AM1A 4OFZA 3DAOA 5AI8A 5ALQA 4UARA 3U26A 5AW0A 3KBBA 1RKQA 4NWIA 1RKUA 2G80A 4DFDA 4OHFA 1NF2A 4Y2RA 5ALSA 1L7NA 4BX2A 3MPOA 3RF6A 2G07A 5JJBA 5AKLA 3N28A 5AI6A 2CFSA 2ODAA 4BEWA 4CNQA 5AKGA 4NABA 3UMGA 3WKEA 1U7OA 3NRJA 1QYIA 2Q4TA 3KC2A 4YIKA 3K1ZA 4EEKA 4UMFA 1Z4PX 5AM3A 3L0CA 1T5SA 2JARA 2ZG6A 2B30A 2B1QA 3L7YA 4YCMA 2Q5EA 1ZOLA 2P27A 4FFDA 4KX5A 2NYVA 5AW9A 3M9LA 2OYCA 3A1DA 3W5CA 2I54A 3ZVLA 2IYEA 4C4TA 3ZWDA 1RC8A 4Y2PA 2G08A 2I6XA 4YGYA 5AVTA 5AK5A 1EK1A 3EPRA 4E88A 4XPZA 1CR6A 3F9RA 3QUCA 4EX7A 1T9ZA 3L1VA 3QUBA 1ZD4A 3QU9A 2B8EA 3WK9A 5ALKA 2QLTA 2OM6A 3L8GA 5AK6A 2O9JA 2NO5A 3AR6A 4CF4A 2P69A 5AW6A 4AS2A 4UU1A 2C4NA 2B82A 3TLMA 1LVHA 2ZOSA 3WKDA 3FPSA 3NANA 4UW9A 5E0OA 5AI5A 3U7GA 3PDWA 4NV0A 3AR2A 2YJ4A 3OCUA 1SWVA 4Y2XA 4UMVA 4Y2SA 3FM9A 3ZI4A 4F72A 3OPXA 4Y3UA 1TE2A 3ESQA 3ET4A 4J2TA 3SKXA 1L7MA 2IOFA 5AVSA 2B8JA 1Q91A 3L1UA 4YCNA 2C8KA 3SMVA 5AW7A 2FDRA 3WK6A 5AI9A 5ALRA 5T41A 2JAWA 2IA5A 2WF8A 3AR5A 3KDPA 5AKEA 3IB6A 4PNHA 4JB3A 5AKYA 1Z4LA 2P11A 4G9BA 5ALIA 3MC1A 4I9GA 2I7DA 5AKZA 4BBJA 2G09A 1RLTA 4EENA 5AHXA 5ALXA 3PGVA 3DDHA 2W43A 2C88A 4KYTA 1NRWA 2WF6A 2BDUA 2MU1A 2EAUA 4KNWA 5ALDA 4G63A 2MU2A 5A3RA 3W5DA 2W4MA 1LTQA 3E58A 4YCLA 2HSZA 5ALLA 5AVVA 5AM2A 4XOUA 4H1WA 3U19A 2Q4RA 5ALPA 5AESA 3U7EB
chains in the Genus database with same CATH superfamily
2OTCA 3IMEA 1QX3A 1ZK2A 1OH7A 1GLNA 2VYCA 3RB0A 2YXDA 3A3NA 4PJ0U 4YRGA 5TT0A 3QSYA 2GQ0A 3HNPA 3ZQ4A 1LKZA 3JPWA 1K1SA 1YV9A 4X95A 1M2GA 4ACOA 4HMPA 4BYGA 1MH1A 1TT7A 3REQA 3VZPA 1O9GA 3D6FA 3FPFA 1OTYA 4RGQA 2WV9A 4X44A 4ADSG 3EVGA 3I4LA 4GWGA 4IFTA 1DFIA 3L40A 3O2NA 5K8JB 3ZDEA 2HOFA 4KXNA 4Q93A 5DMXA 4CPDA 4DR2B 2X4DA 2Q50A 3HWTA 5JXHA 4E3ZA 4QJFB 1H38A 2H29A 2IU6A 3OP4A 2Q49A 3PQFA 2Z3ZA 1GQOA 1NUPA 3OWOA 1A8PA 2GRUA 3DZHA 4Q9LA 3Q4GA 5CLIA 1UBSB 4OJMX 1S0MA 2WIJA 4MPJA 3HYTA 4TRMA 1QHHA 3EODA 3A1EA 3EG9B 4FI3C 4QU0A 4CFSA 3E5MA 1YBFA 2AV6A 2WM3A 3HH8A 1N0VC 1NNLA 3OSZA 3I3SR 5ECGC 1NXOA 4YHBA 4BNDA 5K0TA 5L4NA 1AA6A 1QYCA 2FZGA 2D7JA 2VP0A 2HIMA 4PF1A 4BX0A 3QPVA 3OFND 4RZSA 3HUEA 5JSUA 1X0XA 1Y98A 1NVEA 4OSEA 5AW5A 7ICLA 3ND8A 3ZUGA 4P4SB 3T3IA 2OWEA 4MAFA 4P2BA 1F1JA 3E84A 4Z3KA 2BCEA 3T9AA 3X1YA 2Q5IA 2QV0A 4BB6A 1E20A 1FX0A 4R5HA 1R3DA 2ZROA 2KWIA 3FD8A 1RYFA 1TO6A 4PLGA 2CDRA 4RD2A 2YWDA 1OGIA 2YOHA 4BX8A 4EB6B 4NS1A 3IDZA 3CB2A 5HE9A 3BAZA 4BMDA 4BAUA 1ZJZA 3C24A 1N36B 4Q0MA 5JCZA 1T36A 1VG0B 2C20A 3E15A 3JPYA 2HLDA 4Q3EA 1ODSA 7ICFA 3WRWA 3SFTA 4ZYZA 4FR5A 5TQ0B 3FTQA 3QWBA 5F64A 1ESEA 1O89A 2AEEA 2R8EA 5BWNA 1UAYA 1CJSA 4NLBA 3EMDA 2I5HA 4CG0A 2NU9B 1BQ3A 3AW9A 1EE1A 5EWLA 4YR7A 4RACA 1D2GA 1KVUA 2AI2A 4J0CA 5COBA 2B20A 4MVJH 2XUPA 4U2GA 1IXSB 4H7HA 3IEIA 4G0UA 4V02A 5HKAA 3EZYA 3SOPA 2RE8A 4PO3X 3LA6A 3HBJA 1YQGA 2D7DA 3FNEA 3KD3A 4L51A 3A9RA 1MABB 2BGLA 4IC9A 1O0SA 3RAXA 1LF0A 2JGMA 2VAMA 3IH5A 4TQUS 4RVHA 2QARB 2PVPA 4D0RA 5FYQA 3FDSA 3N58A 4HDNA 3UV6A 1OIWA 5A5EA 3BXXA 2FU5C 3PD1A 1L2TA 4H4DA 3TW4A 2PLFA 3N2GA 4ZYXA 3E9EA 3OG9A 4DM3A 4MQEA 4J90A 4O8CA 2I2DA 1IULA 2PRSA 4XA5A 3B78A 5EL0A 4N6OA 2GJKA 4FYJA 4F4CA 4PAWA 5LU9A 2WI8A 5CR9A 1AO0A 3FCCA 2CHVA 2I2XB 4QSMA 4G8BA 2HHHB 1RRGA 1ZJ6A 2CNWD 4WOKA 5DT2A 1M5RA 1BJTA 4UB1A 5IULC 1GUBA 3LQ2A 5E3HA 9ICOA 3KXLA 1G5RA 1QHHB 2P9BA 4PNEA 3UBTA 1SKWA 4XCVA 9ICCA 4CF3A 5DSTA 3BZCA 4C1BA 5H9WA 1Y1TA 3E1SA 3EPHA 2VP5A 1N8NA 2P40A 1JKIA 1LDEA 3W2FA 4HC4A 5B12A 1Y8ZA 1GYRA 4BASA 3WKBA 4TL6A 5J58A 2QTRA 4HDRA 1Z3EB 1SBYA 2QROA 4OHXA 2E4AA 5KNDH 4DOMA 5ALTA 5CBPA 5CVUA 3P8ZA 3UJHA 3CZ5A 3DLAA 4CYMA 4F96A 2XGOA 4HYTA 4UMEA 4FEGA 3BGOS 4CRWB 4EPWA 3L8HA 3H4DA 5LNK1 5J2DA 4M2LA 1WZCA 3NKVA 1QVRA 4RPGA 2NP7A 3ZWOA 4MLZA 3CNBA 4YMOA 5BUCA 1WJGA 2CLSA 4PHAA 3OOJA 7ICVA 2GRJA 4YP9A 1TZJA 2W00A 3FWPA 1NDHA 1QYWA 4DPKA 4ED2A 4RLSA 3UMBA 1Z2EA 2J46A 3IVGA 3O8NA 2HLNA 4ZCPA 5EMNA 3DAYA 1UPXA 1VLLA 5F5XA 4N7RA 1M2KA 1P73A 3ZGLA 5IT5A 1KU6A 1BMQA 1XDZA 2P9QA 4KLFA 1UBCA 2PBZA 3CJRA 3QLTA 1OYOA 4GVPA 3OE4A 4L78A 8ADHA 3IDWA 4L75A 2Q3DA 2G06A 4K7JA 9LDBA 4P36A 4ZO8A 1JTEA 3W9YA 3U6KA 2HH9A 2C1ZA 4G0PA 4XJSA 3TM5A 3CXUA 2Z6AA 1QP4A 4NCAA 1Y9EA 2V5AA 1VSBA 5D1HA 1OXUA 4YFVA 4J07A 1C5KA 1N2IA 3TARA 4UB2A 2ODEA 3QGMA 1ICIA 2J7PD 2IW3A 3H65A 4GOJA 4BX3A 4FINA 5GVRA 5JMOA 1B43A 1NPDA 4ZYUA 3B38A 4HLNA 5B36A 8LDHA 2R79A 3RFFA 1L4KA 3OQ6A 4OQFA 4ETWA 5AFSA 4RT3A 1C9MA 4LTDA 3SQWA 4CCWA 3DE6X 3UMCA 1CS0A 1KOFA 2DBQA 3FZYA 1UDXA 2DH5A 3VNUA 1T5LA 1XAJA 3ZH9B 4OP1A 2I71A 1NUUA 3LI2A 2HTEA 3QITA 4CEIA 2NSLA 5EPOA 2ONYA 1OVMA 3WIDA 3TRHA 1K7XB 1SOAA 5KQRA 2QAGB 2QVLA 1R16A 1X7YB 3HWSA 3OIGA 5CLQA 5CB4B 5IT4A 2DT5A 2ATIA 1H0RA 4G23A 2OHVA 4IV0A 1XCPA 1ZQJA 3ADCA 2FPRA 4F0JA 1Q22A 2W2PA 2I6QA 4K6HA 4XRRA 2COUA 2FPPA 3TOZA 2PY6A 1A8QA 1YKFA 1B0XA 4RLQA 5LQKA 4L27A 1FUKA 2JIPA 2QRPA 4F11A 1OH8A 2E49A 2YFHA 2FZKA 3N3AC 3QMMA 4ZHQA 5CFPA 1R0BA 4MHOA 3W8DA 3DE4X 5HNKA 3HEBA 3SIRA 3IMCA 2Z08A 1UR5A 3D6MA 2J3IA 4TUYF 2VF7A 1YIOA 2AH5A 3CHYA 2R47A 2ZJ7A 2OAQ1 3GAAA 5FUWA 3SYKA 1D4AA 1F38A 2GEBA 4R8SA 4LY6A 1PS0A 5F33A 3IESA 4J3JA 3MQ2A 3GPDG 1HUQA 1Z5NA 2JB9A 2NYRA 4WLUA 3UT0A 1KERA 1W0KD 2I29A 3A2MA 4XGNA 3ABZA 1MTZA 2Z04A 3S8EA 1ZQRA 3E18A 2KS6A 5LQJA 2KE5A 2Y0SF 4MW6A 5CNJA 2HFKA 2OD9A 2ZBGA 2ZPAA 3D8SA 1O57A 3G0GA 5BW8A 2F1IA 1QKKA 1RMQA 3C3EA 2ODTX 5LZ4A 2QN1A 3INYA 5CYPA 1M10A 4JUIA 2QR2A 2Q3HA 1NK4A 1ORIA 2GHQA 1GA6A 2BEVB 2NO4A 5EY5B 5DH9A 2ZSIA 2HO5A 1SA0A 3ONFA 5D51S 1C3VA 1P1FA 5C8ZA 2E55A 1ZMTA 1ED1A 1EMDA 2JK0A 1UBGA 3BE5A 3G6WA 1N78A 4ESHA 3H97A 4QPZA 1E9AA 1DAGA 3AKDA 3TMAA 4WIAA 1UXJA 3PHGA 3K30A 3KL4A 4D8TA 1CR2A 2ZDHA 2V7TA 3A1TA 5JIBA 3QQPA 4NBVA 1KY4A 1Z8NA 3S2IA 3NTUA 3WHPA 2HHWA 1HPLA 2VYQA 3CX8A 1RKVA 4OBEA 4YCBA 1Y3HA 3B1JA 4RPHA 5KX5F 1NL3A 3Q8LA 1T4DA 1JU9A 3KJGA 4P7BA 3BG5A 3ZI7A 1EK5A 1XVUA 2JFVA 4TXJA 1SFRA 1L5HA 4ZFNA 3ETHA 4DQPA 4U00A 4DGSA 2W6MA 1E6EA 3G9ZA 5I5EA 4V0LA 1TTPB 4WN9B 4BNTA 3IC5A 3UWSA 2PRJA 1L8QA 1M2NA 4ECSA 4ITVA 1AKEA 2YRFA 2HHXA 1DAIA 1ZMRA 3BQ0A 1X70A 4HWKA 4M1MA 4X7RA 3IUEA 3F1LA 3OPYI 4LRSB 3BE6A 4UAVA 3OLXA 4IUBS 4NJMA 2ZSAA 2PO5A 4DCPA 2QUIA 1JROA 1KMNA 1NR1A 3H1EA 2FPPB 1T2DA 3KKLA 1JMYA 4B76A 1YB4A 2Y1IA 3NOOA 1UBOS 1NP3A 2PA3A 3ZPXA 1MJHA 1TM3E 2HSEA 3O73A 5IAOA 1S3FA 4K9SA 1I94B 1IIPA 3SBEA 3FWYA 4U7JA 1RWNA 1I1HA 1YAJA 4RZRA 3MD9A 4IL5A 5EI5A 3ONNA 1HY3A 4O2BF 4FE7A 2LVBA 2UXDB 1S02A 1Q57A 3UUGA 5SZIA 2DTEA 2KSQA 5ESRA 1KDZA 2LYAA 1M7HA 2W2XA 3QKSB 4FGZA 5HHIA 3HZHA 3DS8A 5IXSA 2QTHA 3NW9A 4JBLA 3WYBA 3PIIA 4UUNA 4XSGA 4IW3B 5B6PA 1GAQA 1R6AA 4JQOA 3N3BC 3NRBA 1RQXA 2FWRA 3Q10A 1BJKA 1VBNA 2X7HA 1SBQA 4JUAA 2WIAA 1SPBS 2QUZA 2B34A 2NVWA 4LI3X 4MB6A 4DEVA 2YIDA 4NOKA 4FNGA 5FEUA 3H6HA 1YR8A 5U1PA 2WZCA 1TAQA 4PL1A 1K6EA 4ALKA 4YMGA 4CEIB 1MO6A 1Y7HA 2OP1A 3DAOA 3NTOA 4ARZB 4P4MA 1GUYA 5KQMA 4HNGA 5GJVC 2GWSA 3M81A 4YLEA 1YKGA 2IPAB 4ZU3A 3WLTA 1VBMA 2P7IA 5EHGA 4HGYA 1FFYA 3AM3A 3CR7A 5C81A 2Q21A 4GD3Q 1EIWA 3EA5A 2AGOA 1KJNA 4GICA 4M0AA 1NKSA 3CLUD 4FMDF 3V7UA 4MRAA 1OREA 1TUGA 2HMAA 1II8A 2A2ZA 2FZCA 4YXFA 1E18A 4I3FA 1D2HA 1OWNA 1FJGB 1A82A 1FJXA 5ES3A 4F84A 1Z0UA 3GMDA 1XZQA 1GHTA 3N28A 1J22A 4RF2A 4RQUA 1KDVA 1LB1B 1V7PC 2PANA 1UP6A 2PTHA 3DF9A 3GA7A 2H4YA 1HGXA 1G8PA 3KS9A 4RIGA 3UMGA 1ZJ5A 1E99A 1QIDA 4B3IA 7MHTA 1F2VA 4O02B 1RYMA 2CNWA 4G0VA 4B2IA 1TQDA 3WWZA 2IPNA 5DBHX 3KOMA 1BU5A 2PMDA 3E3AA 4HDAA 4UMFA 2REOA 2I2FA 4XCQA 1IJEA 2ZS8A 2Y3IA 1A5ZA 5DOZA 2JARA 2X5JO 3OJLA 1V9PA 4XDZA 3RSOA 9ICNA 2H2IA 2O2GA 4LVNA 4KKVA 2P4HX 3BQNB 1MW8X 3EEOA 4UUAA 3T1NA 3WRYA 1RXVA 2Q8QA 4NL9A 3GLFA 4IDNA 2FPOA 2CGEA 5FL7D 2IYEA 1ISSA 4QBKA 1JEDA 5EMMA 1M6HA 3AEUA 3HDQA 1JBKA 2K2WA 5JE8A 4F5WA 2KLHA 2C2MA 1BS9A 1JT2A 5EWGA 4YMIA 4IIUA 1N2BA 4NY8A 3JYOA 4D5GA 1CR6A 5LFAA 3JASA 3JZFA 1X8KA 2CCJA 3LPNA 4DSUA 4KO4S 4EHKA 2A94A 3GEBA 3L7BA 4RL6A 2K4MA 2O7QA 2ZVDA 1U90A 3LCCA 3ZCUA 3PLRA 2CNKA 5JBNA 4YMTA 2P4UA 3HVIA 4MPRA 3PPIA 3G5LA 4WNIA 4L7QA 1GR0A 1OFUX 3ZWVA 2FEMA 2XT0A 3ST7A 4MO2A 4OA8A 3VH1A 2XV1A 2QBYB 2WKRA 3I6YA 4O2AA 4L9SA 3AUYA 1Z2NX 5LP6B 2EJTA 3FPEA 1TKAA 4X00A 1I7SB 4UW9A 2ZJYA 2OXIA 5GPBA 3IMGA 4IS7A 1NDUA 2BEKA 1BPDA 4I4TF 3PDWA 4PIPA 3G6VA 4HNSA 4P0TA 4TLCA 4JELA 1DHRA 5J0PA 4XPIB 2FETA 3LTEA 4ZVLA 4K9OA 3WSTA 1JLHA 5C5DA 5DHQA 2KD1A 4Y2SA 3U60B 3ZI4A 1XTJA 4TUYB 5K3FB 1E0KA 3VR5D 1UKBA 3MMPA 4UB6U 2DWOA 2VYVD 1JVBA 4L73A 2EAOA 4M99A 4PSKA 5SYMA 3IIIA 3DQQA 1CXZA 2PKRA 1G8FA 3CRZA 1XEFA 2IBMA 3CZAA 3VPFA 2VRNA 3L1UA 1Q91A 1C7EA 7ICKA 2PX5A 4UAZA 1M8GA 3AB7A 3KQOA 4LDZA 3AJ9A 8ICKA 5HFAA 5BQFA 4TLLB 2C2YA 4W9NC 3WGMA 3EASA 1DAPA 1SVKA 3N2KB 1JLLA 5DB4A 2Q0ZX 5A5VA 4L08A 2LTAA 3EGEA 3MTJA 5ALRA 3HW8A 5I4KA 4FMBB 5CDFA 1C3EA 1Y33E 2ZBUA 3SF8A 1IBMB 2YX1A 2BBWA 4C1NA 3M3DA 4UUPA 1TM2A 1LW7A 2RCNA 1JXMA 5IAKA 1VI6A 4Q7QA 1P45A 4UAGA 1AHPA 1ZUIA 2RHGB 2JI9A 4Q3AA 4PG7A 4O59O 2DLDA 2Y27A 1EP3B 5FPPA 3IX7A 4BKQA 3SICE 5GIOE 4ENQA 5JZOA 2VAWA 3E9DA 1RM5A 2ZR8A 1JNYA 2B37A 4LRWA 4HWRA 1NMSA 3GFTA 2OZVA 2X7XA 1EFCA 5J2GA 3KKNA 4U0JA 3SV4A 1U9IC 3KKAC 1JR2A 1PL7A 4UQPA 2GM9A 4C0SA 3EXHA 4QTTB 2NP6A 1D04A 1XZFA 3HJHA 3ZK9A 2NU9A 2G9QA 4CM4A 3EH1A 5AJVB 3FR8A 5D00A 2WHXA 2W6IA 1WUKS 2IFTA 3PWZA 2PVSA 3U0VA 5LLDA 2Y0PA 1HQYE 1F2UB 3BHMA 4QWWA 2JCVA 2O3SA 3HBLA 3VSAA 4DNXA 4URXR 4BAZA 5GVSA 3BJRA 3JQEA 1JAYA 2VN8A 3TOSA 3UJ6A 3E58A 1JIKA 5B7NA 4YCLA 2YRXA 3N0RA 5CJ7A 1DXYA 4TWBA 3L7CA 2HKIA 2YVKA 1SG6A 5IUKC 3UO8B 4RD1A 4C4ZA 4BY9E 1TIBA 3FIJA 1CRQA 2Q4RA 1L5HB 2QAGA 2WJZB 5TGZA 3TL2A 3IEKA 4EG5A 2HIGA 4PPGA 1PT5A 5AESA 4FGUA 1L5KA 1GZ3A 1WXWA 4N49A 3PNVA 1KR2A 2CYBA 3D7SA 4Z53A 1SURA 2BHSA 2F6RA 3KKPA 4FLFA 4OGKA 1N6RA 1CZNA 5J5VA 4K40A 4DMGA 3CMCO 2VDWB 4FIZA 4NEGA 3ICVA 3FB1A 9ICEA 2GPTA 5C31A 4E5SA 3NT4A 2G8NA 4P08A 3K32A 3T38A 7ICJA 5ILGA 1ZISA 1SUEA 2VG8A 4CV1A 5JFGA 4L9WA 2AU0A 3FYDA 3EY9A 3GP5A 1M34A 1ISIA 4FB4A 4GPAA 5K0BA 1P9OA 5K8CA 2JHAA 5KNCA 4Q21A 3RJIA 2PIDA 3DXXA 1UJMA 4DQSA 1CRXA 4ZU1X 2GM4A 4B87A 1L6RA 3MJDA 3PJDA 4HFRA 4Q34A 3ZCTA 4B6EA 4BQSA 3SV3A 1HTWA 3W2GA 3H8WA 3TCKA 4D99A 4YMMA 1UJCA 5FOUA 2PDAA 1DXOA 4I36A 5DXFA 1QM5A 2FVYA 2J3DA 2DAPA 2UUPA 2XSZA 3SENA 2AJBA 4DGQA 8ICBA 3STXA 1JXEA 1XT6A 3F47A 4MF2A 1CJVC 2K4PA 1GFSA 1NJ1A 2HJ9A 4LC0A 4QOGA 4EZEA 3RHZA 2VAVA 2VA9A 4FGJA 1I1NA 2APJA 1ENYA 3GJ3A 3FGPA 4JLVA 5AI4A 4FE4A 4PGQA 4K5QA 1TYZA 4C5AA 3W06A 3PC3A 3HCRA 1DFHA 4HHEA 2SNIE 2AG0A 4LJLA 1J8YF 1WPQA 5LBUA 2A57A 3WLOA 1UAAA 4YJFA 1C9DB 3VO1A 2P6PA 3OOEA 1GQSA 2W54A 1XDBA 1GRVA 1T8UA 2GCIA 4M47A 3AP1A 3EHEA 4WA7A 4ATNA 2FSHA 5KG2A 3B70A 3CLVA 1V7CA 3IR6A 3RB8A 2Y1DA 3STTA 2JH1A 3V9AA 2JXJA 2XWSA 1AVTA 4ZVOA 4B71A 3I2YX 3OZTA 2PT7A 5E1DA 3WB0A 2ZW9A 3P0JA 2V7GA 3IEUA 1WUTA 4KDFA 5KFHA 2HBRA 2HWWA 3N05A 2W9BA 1XZGA 2V65A 3I52A 4RWEA 4V3BA 4F71A 2GF2A 1UBRS 3KYCA 1J9ZA 1MEJA 3NGXA 4BNFA 2R86A 2JH9A 3JPNA 2NX2A 4R69A 3S0JA 1IHYA 4ELTA 2G71A 2QLFA 4EKGA 1KQ3A 1E64A 2A5LA 3PVZA 2HMWA 4W82A 5AQ1A 3TZLA 2Z6VA 4TZ0A 4O3FA 1MNQA 2PH1A 3AMVA 4XOIA 4YDSA 4CM7A 4PVDA 3DMRA 4TMKA 2PNFA 3FOWA 3SHWA 3MR6A 1ONBA 1YMUA 1AKTA 2QTBA 1ND6A 3AXTA 3CMMA 1VG1A 5G4KB 3JQAD 4KHZA 1T8TA 1V8ZA 4Q3KA 5G0UA 4C3ZA 9ABPA 4BNNA 4J1TC 2F1HA 1JQEA 3KZKA 1XX6A 3T7RA 4F4DA 1CUAA 2XCLA 3NIGB 4EKEA 2CVQA 3HR4A 3OM9A 5AVOA 2BTOA 1NASA 2E37A 5IJ9B 5CCDA 4B4DA 2NV2B 4PGYA 1RACA 4QYTA 3AB8A 1NOIA 2C98A 4J0DA 1I8TA 1QZ3A 1YRWA 4QBIA 5EUMA 1JTFA 3UWKA 5EHZA 5LLTA 3A70A 3HCOA 9MHTA 1MOPA 2FX2A 3INRA 2MR6A 4HX5A 4E2ZA 3OIUA 4JBWA 3AYXB 3BS4A 2I4NA 4IKEA 4E09A 5JOQA 2J33A 3J7TA 2G5CA 2W6CX 3WISA 4UEWA 4W1QA 2J7KA 2YHSA 3PA8A 1RQ2A 3PZRA 2O23A 1P5RA 2QRHA 2VLBA 3DCNA 4MUBA 4KVGA 2H4XA 4FOLA 2HAEA 3DOEA 1T1EA 5DTIA 3QVWA 3U4CA 4D6PA 4GC7A 4KODA 4CG2A 3COJA 2Z4SA 1JJAA 2DSNA 2IEGA 1QO0D 3TKAA 3FCUB 2D54A 5TGTA 2GM5A 3O4GA 4HS4A 1EFHA 4IL6U 1G4AE 1TZKA 2PVCA 3ET5A 1G38A 2FLPA 2GEJA 3OAAD 2QGFA 4ZV4A 1ZU5A 5KS2A 2DRIA 1DC7A 1MJGA 2HGZA 4K4IA 1SRRA 5DXAA 3RC2A 4M3NA 2FJ6A 1ZD5A 4N18A 3EVZA 3L6UA 5DGHA 4XQGA 5DNWA 2IV2X 1SWWA 3Q5GA 4BGIA 4FDVA 1E2UA 2R00A 3BCSA 4NOJA 3HFRA 2J3KA 1YJCA 2YINC 5EQJB 1YB5A 4JWTA 2DUWA 2K8CB 3PQ6A 4KYVA 3ZQJA 5DJ5A 1BXKA 5FPTA 1HDXA 3CW2C 1NKEA 721PA 2INGX 4F3RA 3UV3A 1VRWA 3F5MA 4IWXA 1JE1A 2R8KA 2DY1A 2P9EA 3CX7A 2Q45A 3QXSA 3QKIA 7ICGA 5BR4A 4JJ7A 1DIOB 1F20A 1OA0A 1I6WA 1XR3A 4LY9A 1A76A 4QNMA 5BYKA 2HWKA 1TMYA 5C8DA 5G40A 1ZW1A 3MTDA 4ALNA 1G20E 5LMUB 1X7ZB 4MKXA 3R9IA 4RQ8A 1XTRA 2B4KA 1JYFA 1CUBA 1KYQA 2YJGA 3BWBA 4HDSA 3EGOA 3OQHA 2NO6A 3JALA 3MSCA 1C3OB 2QRUA 3QEOA 3IKVA 4UHCA 1XA4A 1NVFA 4FM9A 1AV7A 1SXJA 2PV0A 5FB3A 4JYZA 3S55A 3W7AA 1T91A 5L1JA 3L1JA 3ZHVA 2R00C 1WXEA 3ZYZA 1X1QA 5BWLA 5JI3E 4BRWA 1J2UA 4YJ2B 3O8OA 3UGJA 4AKIA 3IHKA 3E0FA 1A98A 1GGFA 4LC1A 2PKQP 4PHDA 2LGJA 3U4GA 3WYDA 1TYEB 2JFQA 1X1EA 3UICA 1K97A 1PN3A 5AICA 2CLOB 3K9FC 2NSJA 3O8QA 3QLVC 4DLWA 3T5CA 4YVZA 1T6XA 3HYLA 4NU5A 1U0BB 4KREA 2PMBA 3JQPA 4TWRA 3PGA1 3ZZ1A 4ZDKA 5KNBA 1W85A 2COEA 1PV1A 2WZDA 3K0CA 2SKCA 4CKCA 4KDEA 1M6NA 5KTOA 4UDXX 4JVSB 1US8B 5JD3A 1JJBA 1QG2A 1SKYB 4TTIA 3V80A 4ZCTA 5CT9A 2D00A 3R7WA 3ZD9A 4BMXA 1S1MA 4MB0A 4LNUA 1KO7A 1W5BA 4EAQA 2JDID 4DSAA 4HN4B 2VJCA 1UANA 5KL8B 3E7FA 3HP7A 5F52A 4GX2A 5D84A 2ZIWA 3COVA 1U7TA 4YMNA 3OZAA 5HE8A 2R65A 1AKWA 3SP1A 1JBQA 1UPAA 2ZYGA 4X8LA 3E23A 3FUUA 3TB6A 2OV6A 2P2YA 1IAVA 1ECLA 2AEMA 3ABOB 5EEGA 2Z8XA 2C7BA 2GZRA 3QX3A 2B78A 3B53X 3WU2U 2ERYA 3GUCA 2JIZD 2NXNA 3KYIB 2PJRA 3EUEA 4QAQA 1XEWY 4XEUA 3HCCA 1I6KA 1RR6A 1NW6A 2FGJA 5EHXA 3K3PA 4C76A 2HBMA 5DBFA 4B09A 2JFFA 1A9TA 5IBRA 5JZVA 3NBAA 3TANA 2DFTA 2JI7A 3TEMA 3UMVA 4L28A 3VR1A 3WIVA 2PUTA 1DCFA 3EF0A 4RQ3A 4RANA 2BFNA 3LDHA 3S70A 1I7LA 5JVDA 4JUBA 4IGAA 5GV8A 2FP3A 3HDGA 4HFMA 1BVHA 4TKMA 1PAUA 2I2WA 2QZZA 4P80A 3IP7A 2HDOA 1JG4A 1UMBB 1HL7A 4LHSA 2ODQA 4ZO4A 4B8WA 1V47A 1NK0A 4EYSA 4BLPA 4F56A 3PQ7A 1GFWA 3TE7A 1YU6A 3BDAA 2E8MA 3EQZA 3HFSA 4FVTA 4LRUA 3BMQA 3FZGA 2CUTA 1KDRA 3QG1A 4M8SA 3KPVA 4MRRA 1N9KA 5LZ8A 3DWEX 2OEHA 1CWUA 3KCQA 3R7LA 3P9YA 4B79A 6REQA 8OHMA 1XFAA 1OJ7A 3MT8A 3JQBC 4NYMQ 2XH8A 3QEMB 4B3TB 4DRXA 4KGZA 3FPHA 2QA5A 4XFDA 1PV2A 4EG7A 2QR5A 1QHNA 3KEGA 4JWNA 5DLYA 3UC9A 1E5XA 5DGIA 5D7NA 4I5DA 1ODCA 3N75A 2JASA 2EARA 3E0QA 1Y3DE 3DBIA 4JHLA 3MABA 5DKWA 2AGQA 1JR3E 3D6HA 1G98A 4OA5A 4TMYA 5GMOA 1RBMA 2QRZA 3WNCA 5CVTA 1SXQA 3IULA 4YBRA 1KFKB 2OENG 2R3SA 5DYTA 2Z57A 1JYEA 3JQDA 3T99A 2UAGA 3UJCA 4BFTA 4F4JA 3WA7A 4LRYA 3NPAA 3KOYA 5E2BA 1WWUA 2IA6A 3G9TA 3NRCA 1JR3A 2AW5A 4TZKA 3KE9A 4CUKA 1E2MA 1VQ1A 2ZLBA 3VQTA 2AXNA 5I8WA 2JKVA 2CXTA 2P3LA 3LF1A 3ZE7A 4D9CA 1Z73A 3K8QA 2GLTA 4UVDA 4BKOA 2O7VA 4QG7A 1C1XB 3BE8A 2QZPA 4WA8A 4XX0B 2WF9A 2BEUA 1X2BA 1MQAA 2A9OA 1GL7A 2FW1A 3ITEA 2YUTA 3MGKA 1QKIA 2HHCA 4JJ6A 4RELA 2FPUA 4A2QA 3GYBA 3OM8A 4BNIA 5MN6A 1BPYA 1N4DA 8ICIA 3ZWCA 5FUYA 2EJBA 5L3QA 1IZYA 1XHLA 2YY6A 5DBOA 7REQA 5HOQA 3A9TA 2CC2A 3NJ8A 1KIMA 2BDEA 5HBRA 5HR6A 3KPJA 3A4IA 2JJ2A 2OCDA 3IKMB 1CDZA 1H6CA 2FFQA 2OV3A 1SHKA 3UT5A 4COKA 2XDQB 1C7FA 4CM1A 3L82B 2R2GA 3IKJA 4BE7B 2ZPTX 5FWXB 3CZ4A 1NV8A 4DDVA 3DPUA 1E9DA 4RY0A 3NCHA 5IMSA 2BGMA 3MAGA 3I9V1 1MX9A 1GKLA 4HQ0A 4LMPA 5ADHA 4O3SA 1G7CA 1PLLA 2GCGA 3E22B 5D6NA 5DP2A 2J32A 3RE1A 2XAUA 5AT1A 4M8NE 3SZRA 5C8YF 4PBRA 1YO6A 1UBUS 2IUUA 3N8DA 1THGA 2X0EA 1Y4DE 3RARA 4IPTA 5A6VA 5FBQB 1N33B 3DFKA 5HIAA 3T52A 3QSGA 4TT3A 1ZUD1 3VZRA 1T8WA 2R7LA 4ZT2A 3SEFA 1RLJA 5G1NA 3OPNA 3GZNA 3WNVA 2OYSA 4LDQA 1A0PA 2YCBA 4NU0A 4U7FA 1EDOA 4B9UA 1E2QA 1GO2A 1YHNA 2ZJBA 3AY6A 3DDOA 2PZBA 3DOJA 3WFZA 4PCLA 5BP7A 4IIJF 5AKLA 2LYHA 1X74A 4OJYA 3ZV4A 4CR7A 1EVYA 3O31A 3LA8A 4QNNA 4EKYA 1X2IA 4WXMA 4J4HA 1KGDA 3A7EA 5KTYA 1CUIA 4TN5A 3CKYA 3W2HA 3VVMA 1HNNA 3N70A 4QWAA 1L5MA 621PA 2F43B 3RUDA 1UKZA 5IPFA 3Q8SB 3L6DA 4UHJA 2IC5A 1NY6A 1W73A 3I09A 5KZMB 4EMUA 1KETA 4BVJA 3IKTA 4OBXA 5FO1A 1PX2A 1JX4A 1DJNA 1DRKA 2B30A 1SBHA 4XGIA 4Z6DA 3AUSA 5J29A 3GMIA 2P27A 4EQ6A 4KH1A 1G3QA 2AT1A 1GG2A 1UXKA 1WD7A 2EYUA 5GADl 3S1SA 3HN2A 4YGXB 5KHOC 2ZBVA 2RGDA 1QG0A 3CW8X 5KUTA 3LP6A 1ZK4A 4DZZA 1FA9A 3GT0A 3QI7A 3PKZA 5LOVF 4Q7KA 1G9SA 4MA4A 4OBBA 3L7NA 3V3TA 1DT5A 4NYIQ 3AM1A 4ND3A 4DL2A 3KYDB 1G2PA 4HXEB 1PJRA 3HTXA 4CR8A 1ECGA 1XTSA 1LK7A 2JLRA 3D8TA 1Q17A 5G0SA 2X6QA 2WWVD 3QUCA 4F4XA 1J5XA 3FKSA 5D3MA 5JZ9A 5FA5A 3ESZA 4I6EA 4OKNA 3NM5A 4PTZA 1VHLA 5FA8A 1QE3A 1SKAA 1W1UA 4NBLA 5CLGA 1JPVA 1I1QB 4RQ7A 1HRKA 3TE6A 5DB6A 2Q1YA 2L42A 4N47A 3KQHA 4ASUD 2H9IA 1XEXB 1Y88A 3GDOA 2WFLB 3AVTA 4A2WA 3CM0A 1RQGA 3KB8A 1D8LA 2C2OA 2CJFA 5BN1A 2LKCA 1E9CA 1ZCFA 2FEOA 3A6FA 1EG7A 3BJMA 3FPSA 3VR3A 3RB6A 5K3OA 3SEZA 3DTYA 1D2AA 1KGSA 3LWMA 2YYAA 1J90A 4E1BA 1E58A 3JRWA 1KW4A 5MFPA 1H9CA 2KJ9A 2D2IA 3OQIB 4O3PA 3GMTA 4JB2A 4GZ3A 3SSOA 2Y9MB 4G8JA 1IJBA 4FOTA 5HF6A 4BLRA 3RAEC 5J2TB 3JR7A 4I5FA 2FEPA 1PJTA 2ZI3A 4P34A 3OM0A 2HBLA 1L3VA 2GEKA 521PA 3TLZA 2DXIA 3RJKA 4JBYA 1L7MA 2QJTA 4GPTA 1DGJA 1WHTA 3SZ2A 3ZDAA 1YC2A 5KNIA 3QENA 3C85A 4DCJA 5BPCA 2OB2A 1P6XA 2E1EA 3JU3A 4FW8A 4EHHA 1G5TA 5IDXA 5L3QB 2ZM5A 4GXNA 2Y1WA 4QA9A 1U2QA 2P66A 3OUZA 2XVXA 2BFOA 2E4YA 4P4OA 1ZQAA 1NVTA 2F2AB 5D1NA 2FF7A 2P3OA 2WPDA 3AEVA 1M0SA 4WFQA 3RH5A 2QB0A 1QANA 3AR5A 3GGOA 2DGDA 3QELB 1FSFA 1UOQA 3QXXA 3RU2A 2VJNA 1BCSA 2F9LA 2NPOA 1EX7A 2VF4X 4B17A 2Q2NA 5LQUA 5JXJA 2HBQA 4MQLA 1HE4A 4OYHA 4KNYA 5BSEA 5EE9A 1JFRA 3BEDA 2VF2A 4DL9A 4QDOA 3H2YA 3SAJA 2Q4BA 3OPQA 2IZ7A 3VDQA 3W3AH 3TPFA 3WGOA 2HPAA 8ICHA 3QELA 4EW3A 3TUZC 1SZPA 1AUPA 1GSAA 1MFZA 2B3DA 4KLRA 1FDSA 2RAFA 3F49S 4QUEA 4R64A 3SDBA 4KFTA 3M5PA 2FLLA 4YRKA 4TUYA 1X7YA 2PO7A 1Y9DA 2C88A 5GGYA 3RT9A 3NHUA 1U4NA 3GT4A 2NO7A 1T3GA 3P0FA 2IYXA 3D54D 4KAAA 4RX1A 2NU8A 4DC9A 3C8HA 2OCPA 1Q95A 5LWQA 1U0TA 3WGNA 3BJZA 4YAJA 1UFRA 2P90A 2C2DA 2OEPA 5JY6A 4HVAA 1TW2A 1MPTA 4P53A 1NKBA 2O0KA 1ZVJA 5FFMA 4MMXB 5FAXA 1VMDA 3VU1A 1JDBB 1FQOA 3EYWA 1O8BA 1RRPA 2A92A 4JT8A 2FMTA 5B4TA 3LHIA 3U49A 3TKYA 5AHOA 4X84A 2HWUA 4D3XA 3ROZA 4YS6A 4ICIA 3HKEA 1OAAA 3TQHA 1MAVA 3NPMA 1B3BA 1OYWA 2X1HA 3JQAA 2CT8A 2ZYIA 1ODIA 2L2QA 4P84A 2PX2A 5CBPB 1DWOA 3AEQB 2FMHA 4BO2A 5BVGB 1Q7CA 2JFZA 1Q0RA 2ISCA 5CT8A 5E8JA 3S6JA 3MS7A 3W4KA 5F9HA 3O4VA 4C0WA 1T8RA 1ZQOA 1GCIA 1NVUQ 2P8JA 3ZWBA 5HCNA 3URKA 3YASA 4TVKA 4C7KA 4E46A 1OXMA 2HQSA 4NE2A 1OMOA 3O4HA 4II2A 1WMDA 1JV2B 1Z2AA 2OCLA 3ROGA 3T7IA 3K0SA 2AJCA 4P82A 1RYBA 1W19A 1WSWA 4BNLA 3LM8A 3WO1A 4KW7A 4XE5A 1Z56C 2FLWA 1C30A 2IOQA 4B81A 3QUQA 4PCUA 1QH9A 3M70A 4JQSA 1ODKA 1P72A 5EYPA 3LDUA 3EXHB 2D1SA 2KP7A 4OJLA 4ZIRB 9GPBA 3VHXB 1DPGA 2IITA 4GGOA 2Y1OA 4OJQA 3PW2A 3QZUA 3K6SA 4EGJA 5JR3A 1QWOA 4Y8VA 3F3YA 2X0RA 3JPSA 4ZANA 2ALJA 1XCMA 5J0XA 1QCZA 2R62A 1WCXA 1Q14A 3GEDA 2HA0A 3PE3A 4LHYA 4TVOA 4XXHA 5E38A 3V8RA 2A88A 3ZNPA 4D8UA 1FFBA 1ZQSA 1ZNYA 1ZJNA 2OECA 4L0QA 3ZHZA 2GLEA 3LP8A 4B4OA 3A1SA 1OOEA 1FP2A 1WWKA 3BORA 3LECA 1Z2PX 4BMCA 5JYBA 1ZL2A 1JAHA 1LSUA 1JKXA 4HVLA 1FUUA 1LLDA 4RHCA 1USUA 4ZT3A 3QH4A 2IX3A 4Q6BA 2WHEA 3IJ5A 4D9GA 1Q7EA 4JA2A 5JDCC 1O4WA 1NMEA 1T2AA 3FETA 4MYDA 3PEFA 1AK2A 1QQAA 4QKQA 4M2YA 1E9SA 2NV6A 3BGWA 2J6BA 5ALWA 1EAYA 1IB6A 1MX1A 2CHUA 4KPFC 5KNCD 2YCLA 4EGSA 1TEHA 1I30A 2QTVA 4WBNF 3FSRA 3VX3A 3A36A 3KJIA 3GLUA 2F9MA 4BMPB 1OWLA 1T1GA 2RGWA 4ECUA 3A6LA 3DXZA 3EXFA 4G5XA 4PLWA 5JCJA 3KXKA 4IOKA 4WNAB 3DVAB 5HF8A 2MUTA 4KLTA 1XQ9A 4OP2A 4KN8A 2IYLD 1ITZA 1JHMA 2D8MA 4DXHA 4RFSB 2O05A 5E1BA 2BDPA 3VR2D 1CX9B 1WF3A 2RLTA 4AO6A 2HYIC 1DAFA 1K08A 1CERA 5T6MA 1A5TA 2K6GA 2ZWOA 1PQYA 2XTMA 2Q3MA 1FP4A 3ETNA 4ZYTA 4GO1A 1WEKA 1T2VA 4DB4A 2IPOA 2IUSA 3ECAA 1W34A 4NLCA 4UBCA 1A7KA 3MGHA 1RPAA 1WULS 1L4HA 4P83A 1UEIA 3K9HA 4YDHB 3WGIA 4YO7A 4CCSA 2IY8A 3RYHA 3GIMA 3JW8A 5SZJA 4IQ8A 4Z9BA 2QMEA 4GZ6A 5FR1A 2QEQA 1GPLA 3BA6A 5F35A 4CF7A 1G6KA 2WIFA 4IKPA 3SR4A 4X65B 1QPZA 3NUGA 1KI3A 4QUBA 1JW9B 3GV8B 1KMIY 1NI3A 3R5JA 3KEOA 3HM9A 3PXBA 4QZBA 3QKWA 3PGJA 1Q8KA 1RXWA 1CR4A 1FSGA 2HA5A 4POAA 1INLA 1ZCZA 5FJJA 3GFOA 4IGFA 5AJZA 3LF2A 3OA2A 1NN5A 5LN1A 1M8PA 2DHQA 1MC5A 2P30A 3KAKA 4JV5B 3HV2A 3PFIA 3PFHA 3FBTA 3ZZ0A 2KMDA 3GQBB 2I7CA 5KTQA 1XI2A 2WUDA 3UAOA 3VOAA 1E6MA 2WTNA 5HS6A 4ZYLA 1ZOOA 3PGXA 2C99A 2B92A 3VOSA 1D1TA 2WUGA 1PTKA 5A2GA 2C54A 4RNOA 2JD0A 1ULZA 2B83A 2RBGA 2Z2ZA 2H9AA 4FOOA 2XHEA 4I4TB 1L5WA 2ZB3A 3ZLTA 1ZINA 4A2CA 4JP5A 4C2UA 4II7A 2XVTA 1IB0A 1VP3A 3QA3E 1D7AA 4QYSA 3VKVA 4F7DA 1JG2A 4HAOA 1Q7GA 3K70B 2HMXA 3I53A 3LZDA 3KUCA 3GMSA 1KJQA 1M2HA 1J9GA 1UUFA 1BYUA 3OJOA 3TZKA 3HWWA 1MC4A 3IDQA 1NJYA 1ORTA 3SQNA 1YC5A 3IPYA 1F8YA 4U7GA 4LYFA 1JDSA 3WK4A 1XU7A 3M9XA 5JAMA 3OJSA 1LBSA 1Z4OA 5IN5A 4C6TB 3KOOA 16PKA 4HKTA 2AZTA 2B98A 3NHPA 5AW3A 3FYTA 4L8FA 4P38A 4BL5A 2IF0A 3GLFB 1HDCA 1UDWA 5AVYA 3D81A 1S2NA 3O1IC 1C8VB 2X4GA 3AV3A 2P6OA 1ZITA 3N07A 4GEKA 5DOVA 2F17A 4IQFA 4DLGA 2QD3A 2JFUA 4QZVA 4XB2A 1J23A 4GOOD 5LB4A 4RPCA 2Z8YA 3UAZA 5BRNA 4PGMA 4FJ2A 3S4YA 1HK7A 4IDOA 1PGOA 4ZOEA 1P81A 4XM1A 1RRMA 5EMJA 1LUAA 3UPUA 5TRTA 1JAIA 5KG1A 1N5WA 3LWDA 1DARA 1G8SA 1L7XA 3C15C 3D7MA 1RLOA 2DHDA 3DB1A 3F2IA 4LGCA 2PTGA 4KMOB 4X1IB 1ZSNA 2PBRA 4KV9A 1TUBA 4KK3A 5EZ6B 4B75A 3CLRC 1EUYA 4CIYA 5F1YA 4M60A 3SYRA 1P3Y1 2H63A 2BN4A 9ATCA 3AQEA 4JYPA 2E1PA 3GHHA 4HZUA 4ZO9A 3GILA 4TQRA 3QTBA 2IU0A 1KL9A 4X1YA 4X71A 3IFSA 4E2WA 2ZR7A 1C7YA 3K09A 4KLNA 4DA6A 4N48A 3JQ8A 1RBZA 2DE0X 1G21A 2EQAA 2X13A 3EA0A 5EP1A 3CP8A 4FIDA 1MOQA 2B61A 5LKAA 5JQGF 1ZZGA 1EDDA 4YIHA 2A4MA 3SY8A 4CKWB 4CFYA 4R2XA 4BFCA 4H59A 1G5IA 1PUZA 3R7WB 5H82A 3PPYA 1N32B 1J4AA 5ECWA 2R1VA 5IT9A 4WSOA 5CW1A 3UMYA 5IS2A 1C1YA 4LJ4A 4OFWA 3MTEA 3G7NA 1U6KA 3H5LA 2P62A 2Y2UA 2C04A 3ZCQA 3GEPA 4BBPA 1UJ4A 2ROQA 4WKPA 3PX0A 1KFDA 1RDFA 2W3RA 1RM0A 1YR9A 2AJLI 2G3YA 3T54A 3G02A 3O75A 3O9VA 2BM1A 1OZ0A 4GH5A 4QT0A 4TQ9A 4LGYA 5BN5B 3TXAA 5A4KA 1GYQA 5LDHA 3HN6A 5A4MS 3EPKA 4MHVA 2A3VA 2H6EA 3B9BA 1BVSA 2ODGA 4XJXA 3D2LA 3DTVB 1OFHA 5LM3A 3HLTA 3SHQA 1J0BA 1V43A 4RS3A 3C3PA 2VTBA 1X9HA 3EG9A 2DLNA 4IHJB 1TC2A 2IL1A 5JT1A 4WE3A 4ZYWA 4N7BA 1G0OA 2EH9A 3ICWA 1CTQA 4MV9A 3ENNA 3EE6A 4GYWA 5BV2P 5KOHB 1P61B 4CIDA 3LW7A 2BCGY 2I78A 4OHBA 5KG0A 1WPXA 4FYKA 4HGOA 4F04A 1N6KA 1O95C 2PEZA 4JVMA 1GPNA 1L5LA 2OFWA 2Q3CA 4JGGA 3UK2A 1EM8A 2A9VA 1U8CB 3RJFA 1U48A 1N5LA 3PXXA 1J8QA 1NLUA 2P9GA 3I01A 4J9KA 1G8GA 3DUWA 3O3CA 5FUXA 2O8CB 3D3NA 3SLRA 4B3SB 2KW5A 3G2MA 2FG7C 1PKXA 3IXQA 4LCEA 1F2UA 3B36A 3FOBA 1U2DA 4ZZIA 2W8BB 4YRJA 2XY6A 3O8CA 2VT7A 4XVUA 1RI1A 2QUJA 3BBPA 2CXXA 3GRRA 3LCJA 3C7AA 3NU1A 1TD9A 3AUAA 2IZZA 2PJZA 5DX8A 4DQRA 5TQ0A 5DSZA 3RGGA 1LNQA 1ZJYA 1Y8AA 2WJHA 2A9PA 5ALYA 3T3PB 3G9XA 2PT6A 4QUJA 4R1TA 3OQNA 4EYOA 3DLBA 2A5FA 4KXLA 4PYQA 3G2JA 5IJZA 1AV6A 1IPHA 1A9RA 1NK8A 2QP4A 4EMBA 4UBIA 3C5WP 3RG2A 5EC8A 5EUBA 4DWJA 4BBZA 4KMRA 3QX7A 1TNDA 2X0FA 3HACA 4LECA 9ICLA 2FHSA 2LWIA 5KYXB 5DSXA 4I2GA 1TGVA 2H7XA 1N0UA 4UB3A 3BWDD 4ZVVA 2VNKA 3UWPA 1RJFA 4W9NA 4D97A 2ZVQX 3HXMA 1KIAA 4WX2B 3ZHXA 3F7OA 2GN6A 5KFDA 1PYDA 5B1SA 4CXMA 3K4PA 4O0IA 1IWPB 2YNMA 2OFOA 1L4EA 4W7SA 5MN5A 3VDMA 4NNPA 4H15A 1T3SA 1QG4A 2NGRA 4S04A 3N2GB 1VFNA 1UXIA 3QPUA 3QKRA 3WGKA 1K7FB 2BZ0A 4G25A 4HWGA 3W5JA 2DWQA 5IM4A 1Q74A 2YJ3A 1IL0A 4UUQA 5CDTA 1AMNA 1WBJB 3B2EA 3NBQA 2IJGX 1Z0JA 2CD9A 3FI9A 3DXYA 4WMLA 3KZNA 2O2YA 2X42A 4RJ2A 3X2SA 1BCRA 1KO5A 4MAAA 2Y92A 5KOIA 8ICZA 1TVAA 2JLXA 4DUYB 1SG0A 1BHQ1 2JHFA 2JH8A 3FA2A 4HDSB 5K2MA 4JP1A 4JR1A 3AHEA 1VE3A 1M8FA 2GK7A 3R2JA 5M3BA 2HMYB 2VYFA 1LDBA 2GYUA 2ZYSA 2NVUB 3PI6A 1GUAA 3HI4A 3IA2A 4NU6A 1VL0A 4TRJA 5LKRA 4YUZA 1CUZA 1NBAA 3WTBA 4MRVA 2XCSB 3BIXA 2AFRA 2NZYA 2I1QA 3URMA 4UEJA 4Q9IA 4EUEA 3HJEA 1AQNA 2DFKB 1CV2A 3V8BA 1ZM4A 4Y0NA 6AT1A 4H35A 3LBYA 1PZXA 1FO4A 3WJ7A 4ENVA 1JHXA 3REGA 3LLVA 1CZHA 1N75A 1TW3A 1Z0IA 2DH6A 2W4IA 1NU8A 3A1WA 2BKUA 3ANYB 3JX9A 4H31A 1GU0A 4TSRA 3I9MA 1UBJS 3H1BA 2H3EA 4WN3A 3KZ1E 5EG5A 3RT1A 1RPTA 5ALSA 2A5YB 3ZU2A 3H6KA 3EIWA 2WAXA 3JVUA 3PVSA 3QFFA 1XDSA 2IYUA 4V24A 1YSCA 1DC3A 4K6KA 1L5ZA 2NXCA 4JK3A 2GKOA 3GCXA 2XKAA 4C7ZA 4JS0A 4JVOA 2VC2B 2XZTA 3R5SA 3NRJA 3SQLA 4DQDA 3BD7A 2F62A 3T5LA 2DTXA 1DOHA 3RRBA 4RTJA 5BXQC 4L4SA 1URJA 4B3MB 1VTKA 1KJ9A 4KYIB 4QGSA 3HILA 1XFDA 2FAXA 2VSNA 2ZG6A 4MQUA 2VXOA 1BIFA 1KFEB 3OX2A 1PK1B 1OZAA 3GLKA 3GX1A 3I04A 4OQ4A 4X63A 4OJ5A 2VDQB 2D74A 4J9QA 4M53A 4WCFA 1DX6A 3IHWA 5H59A 1FCJA 5JNUA 5FUMA 4PRYA 2LNDA 4FUQA 1TM1E 1ZR2A 1EFPA 3GGDA 1MQ8B 1ZNQO 3AUFA 5TEWA 1WXGA 2Q46A 2R5FA 2JJMA 3E5HA 4ZI7B 1IQUA 3ZY3A 4N40A 4ZEOA 4CQLB 4KTQA 4TLAA 3O26A 4MRMB 3Q11A 3D9QX 5TPZD 5TIIA 2JEIA 2C7RA 4YGYA 5AVTA 2GBIA 4KXYA 3O1JC 4D4KA 1D0IA 1SCQA 4PFKA 4RMIA 4CM8A 4U9UA 1U81A 4AJJA 1P1HA 3CH4B 3RI3A 3EB9A 4C3VA 1Q1BA 3G8AA 2H8GA 4V1CB 2KBEA 1F8FA 2L0XA 3KHUA 1Q3KA 4ELVA 1E2LA 1FFEA 3L07A 1E3MA 4PLHA 3RIMA 3H0EA 4Z3DA 4ZN6A 4CEJB 4G67A 2CFCA 3PC8C 5FBWB 4BYMA 5KSOA 3TRIA 1EGAA 2VVTA 4O1MA 2LUOA 4R1UA 4B3HA 2HOIA 1QNLA 2BDTA 2QX4A 4RNDB 4WKBA 2R8OA 3WLLA 1LVHA 5JU5A 5DEOA 2Q8NA 1WU7A 2QRMA 5DP1A 3DKKA 2GEVA 3FYUB 2FPKA 1BQEA 1ECJA 1OILA 1ZGBA 1A71A 2BFEB 4P3OA 1ZQ1A 5KKAA 4KPUA 3OLYA 4NCHA 4N5MA 2CHFA 4CMJA 1CQIB 5JH7A 1DRGA 3GAMA 3LKDA 2O2HA 4WZAB 5JO9A 3TL3A 3IP5A 1D03A 3NWBA 4NENB 2J3QA 3UBMA 2C5BA 1NW8A 5LQAA 3S1AB 3DKPA 1DUVG 4C5BA 2I4TA 3H1TA 2O3TA 3PUKA 4GMXA 4R0VA 5LA6A 2D6FC 1E3IA 1E2FA 1MJNA 1UKYA 2QNBA 3SVLA 4XR4A 2NU7B 4N5NA 3H40A 1QF7A 2AOTB 4AI6A 1YQEA 2WM2A 2ZK7A 1KDHA 2HF8A 2G82A 3FMVA 4O4LF 3WK6A 1CF2O 1KEVA 1LDMA 3EQ9A 1KOJA 3SDSA 4KSBA 4BGUA 4UHBA 5CVJA 4DLTA 1LLCA 3V8NA 3KT3A 3ZGXA 2IQ5A 3RSHA 1KBUA 3LHKA 3GPLA 4IF4A 2FUNB 2WQZA 5EE5B 4HQLA 3LGSA 2WWYA 3DDZX 1V9LA 2ANCA 1A8SA 4EHNA 4OQLA 5CCXA 2FA9A 4PSCA 3EY4A 3H9GA 2VNJA 4PLZA 4UVGA 4K05A 3QJ5A 4TYYA 2WJYA 1AN9A 1W7AA 1CP2A 3QY0A 1IPFA 1FMJA 1OI4A 1R0RE 4EENA 1T1IA 4KZKA 2FSPA 3DPSA 4WCDA 3Q0TA 1RBYA 4AYBC 5J8YC 1B4DA 4KYTA 5D7BA 3UOAB 1IHDA 4R66A 1R27A 2V7QA 3EZ6A 3H2ZA 3SHOA 3ISBA 4CKEB 3RTCA 3DV2A 2BPGA 1I9GA 1XVAA 5JAHA 1J70A 1VJDA 3DEAA 3N0WA 4HVTA 4I08A 4PQGA 1L7BA 3E3LA 5IIKA 3INNA 4B9TA 4FN5A 3HBFA 5E6SB 5EJ6A 2YYSA 3UPTA 2WA1A 4OJ6A 4DUPA 4J0HA 1BRTA 5LA6F 3KZIU 5JQWA 2BZSA 2QLNA 3OQPA 3FXAA 3VRHA 4DCUA 1C4XA 1R8JA 4UQOA 2OV4A 2GWRA 2O7SA 2OV2A 4BE9A 5HZMA 1R00A 5G0WA 4JDUA 4NSNA 4JC5A 3PK0A 3MCWA 4LYAA 4MVYA 2LCFA 2XYGA 5CRIA 3V1TC 1BQ4A 2BM0A 1H23A 4TRNA 2XUZA 4V3CA 3GLIB 1S7GA 3A6DA 1WV0A 3B1VA 5K3BA 3STVA 2CKDA 3TJZA 1HNZB 3GUVA 4G3IA 1YJQA 4AIRA 5DNCA 3VR5H 3QTTA 2YJ6A 4ENTA 2HDWA 4CGYA 2BCJQ 3W3AD 3CLUC 3D6JA 5EWMB 1I6MA 1DOQA 2WT4A 1CUGA 2QU8A 2V6JA 3CWQA 3LHSA 3LSTA 2D4AA 4FFOA 3EGDA 4AUMA 5BURA 3U5TA 2WTAA 5FHRA 1QMGA 1V5EA 4RTSA 2V8OA 3D2AA 4WGGA 2HEIA 2QTNA 3U31A 2W6NA 1JFFB 1GNTA 2CHEA 5DVZA 1Q1EA 2CFOA 3PD7A 2ZDQA 3ZY5A 3EISA 4DA4A 1OGYA 3B3GA 1LZLA 1YE5A 4GXQA 1IPEA 1C3XA 1EVIA 2JGJA 3ZDDA 3BWVA 2FMKA 1Q1AA 1ZGGA 4LWZA 3R5KA 4MXDA 2HK9A 3T06B 1YFLA 1QTIA 3WL7A 1JHYA 2PFSA 1X80A 2F00A 2SKEA 3HP6A 4GXTA 3T7JA 3VVCA 4N65A 5KYYA 3RTEA 4ZT6A 4A92A 1X8LA 1SC9A 3CJTA 1YS1X 3LYAA 3CSSA 1UK8A 3V7KA 2W9XA 3EOBI 4HBGA 4JLBA 2FWMX 2VHTA 1IVYA 2H3FA 1IE3A 1NOKA 3N6RA 4HJXA 2QG6A 3OO0A 4M89A 1IUPA 1Z5GA 3AUOA 3KQPA 3LYUA 4FYIA 2A35A 2A14A 2ZTCA 2Q2QA 3H1GA 2GKSA 1K88A 2C4KA 2HHLA 1T13A 3M3HA 3PZBA 3UAVA 1P2VA 2R6AA 1GXSA 1C7IA 2QSJA 4PGGA 4YUYA 1M33A 1W0JD 1S4MA 4PEVA 4ZO7A 4X9XA 4P4GA 2DEUA 4JK1A 3GP8A 2QQEA 5FR2A 2VTDA 4CI0B 3JQ6A 1RHJA 5FLYA 5A1JA 1TKRA 1MC1A 3IAHA 1BDJA 2IS6A 4LTNA 1XZMA 3M9OB 5JQGA 1SQFA 4F4WA 1HZZA 5TMPA 2ERXA 1ABEA 2XE6A 4GXIA 3LCMA 4BWJA 2W7TA 2EYQA 3LTNC 2DQSA 2RGGA 3H6GA 3L01A 2V4QA 1FBTA 1P7YA 4EB8A 3SZOA 1V1MA 2XYQA 1IXRC 1ISPA 1W47A 2FCRA 4Y6LA 5LBIA 5THQA 1S2GA 2X9LA 1IBSA 2AOVA 2WHYA 4PH5A 3CCCA 1KSFX 1OASA 2HA2A 5CMLA 3ZQUA 1CUYA 3L5KA 2BISA 2D6FA 5H16A 1H69A 1UBLS 2SHKA 1I5EA 3GG9A 3NEJA 4KSCA 2ZXUA 3HFGA 4WKGA 3ZVMA 4DR7B 2ZIUB 2XOKD 3LVQE 4YCCA 3CGGA 3DW1X 2WQ7A 1E77A 1MVOA 5KAPA 1U7PA 2ZI7A 3RRGA 3W3AA 2H4HA 2BZFA 1RC0A 2EZTA 4O2AB 4WASA 4BGVA 2DM6A 4BJHB 1PRYA 2Q6KA 1P4RA 2PHZA 2VZ9A 2BPCA 2QB0B 2CXNA 1U6IA 4DJEC 2DECA 4QBGB 3AF3A 4WNCA 5H8WA 1AKUA 3A0UA 1BE8A 1EP1B 4RIFA 3ZJ4A 2J5QA 5KJ1A 3P9ZA 4NLZA 3PHBE 1MT0A 3REOA 4DV0B 2NT3A 1KF0A 3OJXA 3S27A 2ISSD 4Y0AA 4EOGA 4E5NA 4DXDA 3OCVA 3RVJA 5ALHA 1T5BA 2WG0A 3A4YA 3L3BA 3DT8A 1DDGA 4IOLA 1AGYA 3H86A 1YA4A 2W11A 3GC6A 2CV2A 2ODWA 3UATA 5TSDA 4E94A 1H2RS 3BZKA 4R9SA 4U39A 5B7GA 4FS8A 4OEHA 3E2EA 4PS0A 1BX0A 3ZX4A 1L7PA 3GRCA 4J9PA 4V0QA 3FOEC 1UWCA 3LFHA 4QYIA 5SYNA 2CJWA 1V37A 2H2WA 3HB5X 3NRZA 4Q3CA 4GSKA 2PKQO 1X6JA 3H7AA 4TXNA 3GFSA 1FLNA 2QDXA 4IDGA 4IV5A 4DBLC 3CKLA 3A05A 5AJWA 3IBSA 1XPOA 1PTJA 2VBFA 5EJIA 5TY0A 3C48A 3NIWA 5IBCA 4AZ0B 2DOKA 1H2BA 5JVDF 1XTUA 4DRZA 4R9NA 3LUAA 4MYSA 3A9WA 1WNFA 3TZHA 4PN7A 1IZZA 5BWBA 2EU8A 3IP6A 4FB5A 4YG2A 2IYOA 2WAAA 2IYFA 1TECE 3V6LA 3FHTA 2VHUA 3M7DA 5ILOA 2BGWA 3MXTA 4K9MA 3RYHB 2C1XA 4JIMA 1UFKA 2M0NA 2Y1JA 1F5NA 2BGNA 2A5JA 2E8OA 1SU6A 3GJSA 4YAUA 3L4BA 4UZSA 4X45A 4DNFA 1VI5A 1TVEA 1BNPA 1NQVA 3EDOA 4K88A 3KU1A 3D6AA 3HA2A 4BU1A 4FZNA 4DLXA 3FFTA 3RRNA 4DIMA 4F5EA 3HS3A 2G1KA 4BFSA 5HWSA 3RH4A 1SQGA 1QAOA 3Q9NA 3IS3A 2G6TA 4QWMA 1TCAA 2JHPA 4KWIA 2FK7A 2DJIA 1G18A 3VU9A 3C3XA 3QWHA 1L7OA 2M9MA 3WJ2A 2F59A 1BX3A 4Z0PA 2I34A 2IYZA 3O91A 1SG9A 3F2DA 4MKFA 1P5HA 1CNMA 1KC3A 1BMDA 1O6GA 1J21A 3EZXA 3QX9A 3VU9B 5HUHA 3I72A 1NONA 1MIOB 1RM3A 2RKOA 2VT6A 2XECA 5DB8A 1P39A 4OAQA 5FP0A 2C83A 4C21A 1G19A 4DSFA 1EDEA 3KJQA 2OHGA 5K8UA 4EY4A 3ML1A 1OBCA 2BFMA 1OLSA 1KSJA 1CS0B 1JG1A 2ARKA 3AR4A 4OH1A 3VA7A 4G86A 1TL7C 3JWGA 3L0YA 3MBYA 4GRAA 4R8KA 3BRQA 4QXOA 1IJFA 4BNMA 2W42A 4H9GA 3SYMA 2XBLA 2IHBA 1H0KA 2H2GA 2O52A 1FPQA 2VEDA 3KTDA 2E7ZA 4I1UA 5CB4A 2Q3FA 2C9CA 5FI3A 4ZREA 1H1LB 1TJYA 1WKBA 3KFUF 4B32A 3ZXSA 1VLVA 4CTKA 1YRAA 2PS3A 2XMPA 3B7GA 3NDJA 4RHUA 5ALZA 1QTQA 1F2TA 2DGZA 5JV5A 4S2UA 3FDXA 1L8OA 4O2BB 1MO4A 5F9LA 4KLQA 1ZIDA 3CEMA 1Z25A 5KFVA 2O2DA 2Q6IA 1I4DD 2QTVB 2YNMC 1GTL1 4O5CA 4O25A 1HH4A 3T4UA 3WQHA 1C4WA 1VPLA 2NYUA 4KDCA 2R84A 3PSAA 2JLAA 3PQ4A 1F0PA 2OO5A 5GOZA 1OA1A 1X15A 2R8XA 2XGJA 2C1EA 4ZQBA 2V55B 1NHWA 3EWNA 4ZOLF 2WW8A 1QBKC 4RESA 4IIHA 3QYFA 4X1YB 5DV9A 3FNIA 5IAAA 3W4IA 3A4MA 3GLQA 3ADPA 3TWOA 3RADC 2ATVA 4WNYA 3DBRB 2WOOA 3OIYA 4Q9KA 4Y1EA 2Z6QA 2P1DA 2Y71A 2AD5A 5F23A 1PEAA 4E70A 2RHMA 4F8EA 1MLDA 3PNYA 3GZFA 2DY0A 1PJ3A 3CN7A 4FMCB 3AUXA 5AXAA 2PM8A 4OCZA 2O8FB 2RBKA 2JG3A 2PS1A 2B25A 1YR6A 4W7IA 1YHZA 3GLGE 4R5MA 2NU8B 4UE3S 2EW8A 3ITNA 4GVLA 3WKCA 3PV0A 2C0QA 1YJAA 2P68A 3DEHA 3B6EA 1Q7BA 2XIDA 2BYTA 2GYYA 1XDGA 4CTMA 2NXWA 4IWNA 1WDLA 4WHMA 1QK5A 1TU4A 1CJUC 1JI3A 4O4HA 5JPDA 2VPZA 4X1OA 1SUIA 4DKXA 5BT8A 4M9XA 3NNSA 3NHJA 3WWPA 1MPXA 3HB7A 2RCYA 4LHZA 1QYRA 4HAYA 2JPDA 1DQZA 2IHUA 3DJYA 4R7TA 4BMNA 4DABA 1RPZA 2H1VA 4MGYR 4XARA 1M83A 2GD6A 4BECA 1S0OA 3OZXA 4OQYA 3ZHTA 3ZHQA 3EZLA 1M8KA 3IO3A 1JLRA 4L6CA 4RVUA 4YXWA 4J9NA 1IG3A 1ISRA 3QVXA 5E6SA 4B5KA 1GZHB 5DTQA 5KHAA 2UZAA 1AQUA 1B41A 1P0QA 2QHXA 3CX6A 4RMGA 3WC4A 2JIRA 5E9AA 5FL3A 2DQKA 2VP6A 5K7SA 2XLBA 2PMZF 5IVIA 3A3KA 2OCKA 2X5XA 3DC7A 3AEYA 4P81A 4OQNA 2Z56A 1HF3A 3P4UA 8ICYA 5JSKA 3NI2A 3ZXXA 4LZJA 5JRDS 1GRRA 1QX4A 3DMYA 2RJOA 1DO8A 1FU7A 5EIFA 1KIFA 4HAZA 4OG2A 4DUGA 1N2CE 3F3SA 4OQPA 4A8JA 1P4GA 2A1AA 5J0YA 2IODA 4O3MA 1FUYB 3MUNA 1MHPA 1Y81A 2C07A 1LLFA 1SUDA 3DE7X 1MV5A 3CNEA 1T1SA 5E7QA 3PSHA 3O2SB 5JJCA 1NIPA 1CUEA 4DLBA 1UMCA 5AW4A 1E0AA 4JFRA 4M9RA 1RHMA 3G5MA 2QZJA 4NZMA 2RK4A 2CXYA 2J07A 2R8RA 4OUDB 3TXYA 4NXZA 2GD1O 2FSVC 3L8CA 3RANA 5BVHB 5KBYA 4CV3A 4OFZA 3I61A 5ISMA 1ZQYA 1DBQA 5FO0A 2R1TB 1DGSA 1A72A 5ERGB 1ZLYA 1SA0B 1RI3A 2PSDA 1R5JA 4G0YA 1JL3A 4XCXA 4ZAFA 1KOLA 2XUFA 5T8KC 1D5CA 4I2JA 1NJFA 1P91A 2L82A 4WFJA 3SHFA 4GMGA 3WL4A 4F97A 2H06A 3L6CA 1QNFA 5IH3A 1BS1A 5CA1B 1FZTA 3D6VA 3R44A 3M4XA 2F8SA 4MCAA 3EMBA 2GCPA 5B64A 4JLKA 4BX2A 4CBVA 1T25A 1YA8A 3EIOA 1IM2A 3JCZA 4MV7A 1YI0A 1P2UA 4IMPA 1WO8A 2H0QA 3M5WA 4R2WA 5KTRA 5AI6A 2ACKA 4O9MA 4RNMA 2V9CA 3WMGA 4B35A 1ECPA 5KYNA 1CEEA 1FDWA 3NC4A 5L4LA 1EFDN 1ZRHA 2GVZC 1E7RA 2E9SA 1JDUA 1WOMA 2YYZA 3QKUA 5KI6A 3V1UA 4MP3A 1QXSA 4QOIA 3PXGA 2NMVA 1SK9A 4Q24A 3KSAC 3A6PC 3SCZA 2WSSA 5KFOA 4HP8A 2W2KB 3PEVA 3KQUA 2JEFA 4FWTA 3C39A 1S9FA 4JIGA 1C9NA 1UOPA 2Q5EA 4QXMA 5DM70 1M2JA 3VV2A 3P0IA 3BKWA 4FFDA 5CDHA 1IU9A 1MO3A 1VPTA 1Z6PA 2R751 1NLYA 4NBUA 5B1HA 3W2IA 3BT7A 2CVZA 4ZKEA 3STYA 3CONA 1W5SA 4UOZA 8ATCA 5KTPA 1AGNA 4PU0A 4ZCQA 2WFZA 3F5AA 3V48A 3TDMA 2UXCB 2QGNA 4HFNA 4IR9A 1Z07A 4IGIA 4P5PA 2AK2A 4BUJA 4IRMA 3OTGA 3HPRA 3UUFA 3VTKA 1EWVA 2UV8A 2G08A 2P5YA 3IMFA 4MI9A 5IHXA 1JRPA 1X9WA 1ZEMA 2WVHA 2PXXA 4A7PA 4YRAA 1UM9A 3EZ2A 4ZTBA 4Z4IA 3NTVA 3KEFA 5K0CA 1KHHA 3DD5A 4S1TA 4CQNA 3JSXA 1G5HA 2J48A 3DO5A 3AI3A 3SXPA 3IXMA 4EGAA 1G7TA 2W6OA 4EDFA 1IXZA 1DQNA 2EHDA 2JS7A 2A1JB 2NO5A 3L8GA 2HNAA 4PQEA 3FJYA 3VR6A 5JDCA 4DR6B 3C7TA 2WKQA 4IAOA 1W4LA 1LBEA 4RY8A 3ETRA 2HT1A 1NZDA 1P4AA 3GZJA 3WP0A 6Q21A 5HKBA 5JHGB 1OZGA 3LNCA 1AOXA 3UHAA 3TLMA 2F3NA 3FDFA 1XVLA 3R24A 3NEYA 1JA1A 2VKTA 3QPCA 1KE2A 1P1IA 1VL8A 1T2CA 4HUQB 1L8AA 3MCVA 4HDQB 4YR9A 3RFXA 4ZI7A 1EWTA 1JQ3A 1I4OA 1E3WB 3WZ2A 3PUVA 1XKTA 3D0QA 3QFTA 3ZCRA 1SD2A 2PI5A 1PR3A 3LVBA 4E5KA 3CH6A 1B76A 4J2TA 1TKCA 2OCIA 2XUIA 5LBTA 5LA6B 2H3IA 2VRWA 3HBMA 2DL0A 3DFFA 4BVAA 4EKDA 1FFUA 2AS0A 3L6OO 1VE7A 3OU2A 2XQVA 3IUNA 3OY2A 4YWJA 1TEXA 3RWBA 4CI9A 1CQJB 3VU8A 4KRFA 3K71B 4MRMA 1O9HA 3DAGA 3KVOA 3RBAA 3W5IA 2H17A 4MZDA 5DISB 1PJQA 2IKQA 1UQUA 3BRWD 3PDIB 3PNKA 4FZ3A 4PGHA 1WEHA 2FQQA 2Q4DA 3RSLA 3WGLA 1B23P 3UQ0A 3GDGA 2GPNA 3PENA 4E4TA 3ONVA 4K1XA 2JMGA 1UOOA 8ICFA 1KPGA 3HU2A 4P3NA 4O0LA 5HFJA 4QT4A 5IJWA 3P32A 2A19A 4A6DA 4G1FA 1KRPA 4Y30A 1N6HA 4HWOA 5DLPA 2X2EA 4XDHA 4ENSA 4U2BA 5TARA 5CT5A 1TK2A 2ZWPA 4LK2A 4I19A 3D0RA 4QPCA 2FG6C 3RBZA 4YJFB 3T5TA 3TD2A 1WVMA 4RK1A 2Q99A 3CE6A 3CVOA 3K6JA 4OXXA 5AMXA 1QH0A 4EHIA 4WL0A 2J5BA 2HRZA 3BIWA 3RR8A 1E9RA 2WNIA 3OP1A 2ZUDA 4TT3D 3B0YA 3U3KA 1XKQA 4GYYA 2BDUA 2MU1A 2NSHA 5E3JA 3RIYA 1ECWA 5IH7A 3B52X 3O8LA 1WW8A 7ICHA 1KKMA 1PR5A 3EEYA 3W1VA 4DV1B 3OICA 1N92A 1TK3A 2TYSB 1KARA 5JD4A 1Z39A 4EPYA 1UKCA 3VVBA 5KWSA 1BPBA 1B73A 1II0A 4XX0A 2R5WA 4YX9A 2Q1WA 3TQTA 2GARA 5B30A 4KLGA 1MTOA 3PRKE 4JI2B 5D6OA 3FNHA 4N9QA 2IEBA 1T0JB 3DBLA 3IE2A 5ALUA 1OTHA 4IJMA 4WPGA 3RU9A 3CVUA 3V4RA 3I62A 1BJRE 3I23A 4XYMA 4CLHA 1AM4D 2PBFA 5DYYA 1B0UA 2KSOA 3MGCA 3OWXA 3ICEA 5HRAA 3ORYA 3U3DA 1P1RA 4AIIA 2YMMA 1PGPA 3TEJA 3LPLA 1G5QA 2TMKA 2YWXA 3EBLA 4AS1A 2NU6B 3KYJB 2PZEA 2XKJE 4OXRA 3SC2B 2BFPA 4AJOA 5K0EA 2PX6A 2X5OA 5HM8A 5HQTA 2QSZA 3WADA 1CLUA 2CN1A 5IINA 5KSWB 4GSYA 4OGFA 1VLJA 4ZEVA 1MIHA 1NA5A 1E79D 3UXYA 1AGRA 2ZT5A 1KFTA 1GNLA 4QBFA 2NIPA 2D2EA 4A8TA 2IZ5A 4QJ4A 3QNMA 2C9DA 4PAOA 2H7YA 4P2HA 3EXG2 5PNTA 5AK3A 4RQAA 2B4RO 1U8FO 4J0QA 3ASUA 1HTBA 1DV2A 1DEOA 4K8OA 5DPMA 4RD0A 4NCJA 4C7JA 4E33A 1E5TA 3U81A 2IH5A 3K09C 1P2SA 3ZCXA 3JARB 4F3YA 3ESBA 3UENA 4C87A 1EJ0A 2Z9DA 4ZAVA 1VYTA 3C8MA 3NASA 4XW2A 3QZ7A 2Q3BA 4MINA 2YV1A 5HUJA 4QW9A 1ETHA 1PFKA 4XWAA 5JQGB 1FK8A 4RF4A 3E05A 1S9HA 1K7SN 3ZE2B 2PFPA 3OQJA 2NT4A 2O2EA 2B2CA 3QXHA 4DUGD 1JQAA 1YBMA 2R9VA 2ZRCA 3K0AA 3QVGB 4ZRNA 3GRPA 1MGPA 2QIPA 2DERA 4JBHA 2XOXA 3T79A 4NBRA 4JP2A 1W36C 2AXTU 1UMDA 4ED3A 3QHPA 3BSWA 5DKFA 1Z38A 1TO1E 3AWDA 4H7KA 2GS9A 2ZSEA 3R5XA 4ZQCB 1WPGA 1GZ6A 3ESRA 4QTYA 1NNI1 3UCEA 4YCSA 4IQ4A 2AEFA 1OI2A 1DU4A 5LU8A 1HR0B 1FSZA 3QVUA 4M55A 5BRAA 1HO3A 2OA0A 1T2NA 1Y8RB 2CEAA 3GVIA 1L1FA 2PGXA 1KHTA 4ZHSA 5HJ7A 1B8OA 3QW2A 3GUZA 4G26A 4H16A 2ORIA 4AZ3A 5C7OO 1KKXA 3AI7A 1POWA 3SD7A 3ILSA 4URVR 5KQLA 3T9EA 2F64A 2IMWP 1C3OA 3RRZA 4ARUA 5FLXA 3BZBA 3BL8A 1GGMA 1KDOA 1RWKA 4AG6A 2BSAA 2B0JA 2YVQA 1CUJA 4PE5B 1XQVA 4ZRMA 3WBBA 1A1VA 3X1DA 5EIAA 3OPMA 2DUYA 1BHJA 3ZKAA 3NNNA 4NL4H 2YJZA 4D5EA 3PW5A 3DZCA 2ZRLA 4PZYA 1GG9A 1S0NA 1NRJB 3PWKA 4JT4A 4RXUA 5TQVA 4DSOA 3E22A 5JNTA 4KR3A 4AU1A 5L1MA 4PONA 1O8CA 4DL6A 2X86A 2Z43A 2NRVA 4DLNA 1WKVA 3KM0A 5AM0A 1NYRA 2AG5A 2MINA 4JLSA 4BWVA 4DZTA 3GY0A 4Q1BA 2MT9A 2JZCA 4D92A 2JDIA 3H0CA 1OB2A 1YRQA 3PEEA 1A2OA 1D1SA 1FRZA 2NACA 3N39C 4U63A 4JITA 2R8YA 3H13A 1JH9A 3Q8RB 3K5WA 4OTZA 1ENPA 3PQCA 5KT6A 5K01A 7ICUA 1J6UA 4L02A 3UG7A 4Y9SA 2BEWB 3KR9A 2Z6UA 2QMYA 2ZE6A 3MCTA 3ZTYA 4M76B 4CMHA 1ZYQA 1ADYA 2VP3A 3AONB 2UYYA 3K1JA 3OFKA 4M7WA 4NMMA 2OBFA 5KREA 1BMTA 3WOVA 4L4ZA 3RVLA 5KWIA 1FS4A 1M1ZA 4NPCA 1FDRA 2QVYX 3OEED 3MWEA 3SVZA 2VF5X 3JTMA 4OFXA 1XRLA 3SR3A 4E0DA 3G0OA 1R4ZA 3VXKA 4X5VA 2B9EA 3FVWA 4L8VA 2XNSA 3TNLA 5J9FA 1TVKB 4IQVA 1S0UA 1YJ5A 3E9YA 4CLRA 5IEJA 3U4MA 2NG1A 3C3MA 2OZLB 3HL4A 4IXMA 1D6JA 3Q2KA 2EX0A 5AW8A 1YKSA 1J2NA 5TVGA 2OHIA 3UF0A 2JCXA 7ICEA 3LPAA 4GUAA 4LF6B 5ALGA 2PKCA 1W49A 2GPJA 3FUVA 4UEQA 4BB9A 4E21A 2ZBQA 4CM5A 4JJGA 1TQ8A 1R8SA 3C3WA 4ZH4A 1R0ZA 4QPNA 4DMRA 2WV7A 1QHFA 1GGKA 5BNZA 1XYVA 3LL7A 1Y4ZA 2W2QA 2X4IA 1YDFA 2A0UA 2VYND 1LCIA 3CPJB 3LX4A 3B9JA 2ZBPA 2UYQA 4DV6B 1XMQB 2G1PA 3WIUA 3SKVA 2BQ3A 4BLOA 3OQVA 2ZJ1A 1U2SA 3PHHA 2HEGA 1E1MA 1V3UA 4J1TA 4AXXA 3DLHA 4O6VA 4TLBA 3FUXA 3CEAA 1VCNA 4REOA 4UCQA 4Y2YA 1CUSA 2ES4A 1CQXA 2VYNA 4L9RA 2P9YA 1FS6A 1PJCA 2K87A 1LX7A 2ZATA 3DMFA 4I8XA 3CNLA 4IIJA 3TBFA 2ZJOA 3ALRA 1L4YA 2FZEA 4XIIA 5T4BA 3EGIA 3UNXA 5KFGA 4ACBA 2JCGA 8AT1A 1ZD9A 1XCBA 1J2MA 4HNUA 3ULKA 3I2IA 4MVJI 4TTPA 3CCFA 1KK1A 5JS1A 4JN6B 4HWPA 1FMFA 5BORA 2FUG6 5ALEA 5C34B 3NB0A 2BHTA 4IINA 2WZQA 2H4ZA 3EPPA 4IJVA 3NBZC 1LPAB 2AOWA 1ODTC 1RBQA 2AUNA 4HH4A 3W8EA 1CD5A 3KTAA 3BM5A 3GJ4A 4FO6A 5HG0A 1MW9X 4DXAA 1ZP6A 3F98A 1Q50A 4JD5A 2VCYA 3JD4A 4R7ZA 1QRRA 1SUAA 3NV9A 4RM2A