3QX7A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron complexed with phosphate, a closed cap conformation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
224
structure length
224
Chain Sequence
HMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 81
structure length 224
sequence length 224
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qx7A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qx7A01
4DWOA 3ZTYA 4ZEXA 4OD0A 2R8XA 2I55A 1RDFA 1N8NA 1X42A 1L6RA 1NF2A 1Q92A 3D6JA 2P69A 5ALXA 5AM1A 2IOFA 2Q5EA 4O8CA 1TJ4A 2RBKA 3OPXA 2DQSA 3WK6A 4I9FA 4YIHA 3M9LA 1SU4A 4EX7A 4BEWA 4NABA 3AR8A 4UU1A 3L8GA 3S6JA 3KD3A 3U13A 3WGVA 2B8JA 3E81A 3FPSA 3QNMA 2WHEA 4Y3UA 3MMZA 2FEAA 3L8HA 2B1QA 1WR8A 2OM6A 3WK5A 5ALDA 2ZBFA 3FM9A 5AICA 4KNWA 5AK6A 3DAOA 3SLRA 1ZJJA 2X4DA 2NYVA 4BX0A 3L0BA 4L57A 4UMEA 5AIAA 2HO4A 4C4SA 2ZOSA 1YV9A 3U7HB 1ZD3A 2C88A 5AVZA 1RPZA 5FP0A 3WKAA 4CF5A 2WF6A 3EF1A 4HAIA 5AW6A 5ALNA 2OBBA 3ESRA 5AKHA 4DFDA 2G07A 4UAVA 3B8EA 4G63A 5AKYA 1T9ZA 4MUMA 4XPZA 3ZX4A 1RQLA 3QX7A 4UATA 2OYCA 5IT0A 2FPUA 3AR9A 3ET4A 3MN1A 3PCTA 4QQFA 2IOHA 1Q91A 2O2XA 3KC2A 1O03A 2PR7A 2MU1A 4EX6A 4OFZA 1L7PA 4E88A 1QH9A 3ZI4A 2AGVA 5AVXA 4B6JA 2YY6A 3ONNA 4FFDA 3I1YA 3BA6A 1VFPA 2QYHA 2B30A 5AVYA 3QUTA 1XPJA 4XE5A 3M1YA 2B1RA 5AM2A 2YMQA 2WF5A 4FE3A 4OHFA 3A1DA 2HSZA 1U2SA 2WFAA 3SF0A 2PKEA 3KOOA 1ZRNA 1NRWA 3L0CA 4YIKA 4BX3A 2BDEA 1RQNA 3ZX5A 1U7PA 2RB5A 3VAYA 2CFRA 5AKKA 5AK5A 5ALQA 3ZVNA 3QUBA 2W4MA 4YGYA 3EWIA 3ZVMA 5AKZA 2WM8A 2YFYA 5E0OA 1RRCA 3QLEA 5AVVA 4KN8A 3QU7A 2HDOA 1RLTA 3MPOA 3P96A 4Y2VA 5AM5A 4NV0A 4ZEVA 2HCFA 3ZVLA 3SMVA 5A3RA 2I34A 2IYEA 2AH5A 2GHTA 3WK9A 4EELA 1J97A 1L8LA 1RMTA 4NAVA 4BX2A 3U7GA 3PGLA 4UMDA 2HOQA 2C8KA 4Y2QA 3OTQA 3DDHA 3AR3A 4UM5A 4KYTA 3U19A 2WF7A 1Z4QA 3OCUA 5ALKA 3WKDA 2R8EA 2ZBGA 4G9BA 3NASA 5AKJA 1K1EA 2YN4A 3W5DA 5ALOA 2FPSA 2RAVA 5AVQA 4IFTA 1WVIA 3NRJA 3KBBA 5AESA 4HGOA 1CR6A 4HGNA 3NAMA 3PGVA 2NO5A 3E84A 1SWVA 2FI1A 2FPWA 3FZQA 4EZEA 3PDWA 3K1ZA 3WGUA 5AKLA 2EATA 4H1WA 1TJ3A 2ZG6A 5AK3A 3NANA 3N28A 3CZ4A 3ET5A 3QUCA 4UARA 3E58A 1ZOLA 3U7FB 3QXGA 5ALJA 5AI4A 4YH1A 3ZWDA 3AR6A 1Z4LA 2HEGA 4AS3A 2YMMA 2ZBEA 3MC1A 3FPBA 1Z5GA 5IT4A 4DW8A 1Z88A 4AS2A 5AW4A 5AW1A 5ALZA 1IWOA 1RC8A 4YCNA 3OCVA 4F72A 3UMGA 4Y2UA 5AHXA 1ZD4A 2CN1A 4NFLA 4Y2TA 3AR5A 3B9BA 3UMCA 2P27A 4HGPA 1T5TA 3J7TA 1ZS9A 3RFUA 2Q4TA 1QYIA 4HYTA 1VJRA 4BYGA 3L0YA 3ZW7A 1WZCA 1VJ5A 5AI9A 4L6AA 2WF8A 5ALSA 1S2OA 4C4RA 2C9MA 5AW5A 2G0AA 1Z4NA 3N1UA 2ZBDA 5ALEA 3QU9A 1SWWA 2HF2A 2HHLA 4PNHA 3I28A 4QJBA 5AM3A 3ZU6A 3ESQA 2GMWA 4KNVA 3E8MA 4F71A 3UMBA 3CNHA 1YS9A 3KDPA 4UU0A 4UASA 4AP9A 1L7MA 3AR7A 3R4CA 1Y8AA 3OCYA 2FUEA 5AKXA 4FYPA 5ALIA 4BKMA 2I54A 3QU4A 5ALMA 2R8YA 1RKUA 5AW7A 1FEZA 3DNPA 4BBJA 1TJ5A 2B0CA 4YCLA 3QUQA 4ZEWA 2YMPA 3GYGA 1YJ5A 3EPRA 4XQ0A 4Y2SA 1O08A 2JAWA 3IB6A 4UMVA 3BWVA 3QYPA 4CNQA 4HGRA 3OCWA 1EK2A 2RARA 5AI5A 1MH9A 1Z4IA 3OCXA 5A3SA 2GHQA 3QU2A 3QU5A 3SHQA 1YMQA 5AK4A 1F5SA 2VKQA 3I6BA 1Z4MA 4OCZA 3DV9A 4C4TA 1J8DA 5AW3A 3EF0A 2PQ0A 5AKIA 4Y2XA 3AR2A 4IG4A 2FDRA 3L8FA 1ZD2P 1TE2A 3WKEA 5AI0A 2G80A 3L1VA 3W5AA 1QQ6A 1YDFA 3HYCA 2EAUA 3WK8A 2G06A 2I7DA 5ALWA 5ALVA 4EENA 1T5SA 1ZD5A 1Z4PX 3NALA 4XOUA 1XP5A 5AVTA 2CFSA 1RLMA 5T41A 2NO4A 2D2VA 2IOFK 2YMLA 1RMQA 1Z4KA 2JGAA 2W11A 4RESA 4Y2YA 4CF3A 3L5KA 1AQ6A 2CFTA 2B82A 1ZRMA 2FUCA 1XVIA 3FGOA 3ZTWA 2YJ6A 4MWOA 4L6CA 1LVHA 5AVRA 1RKVA 2AMYA 1L7OA 4I9GA 1JUDA 1KYTA 1YNSA 4UW9A 2EARA 3SD7A 3L7YA 5ALPA 2P11A 3ZUPA 5AVSA 5IS2A 4BNDA 4BNDB 3SKXA 5ALHA 4DCCA 2GFHA 5ALUA 2MU2A 1RMYA 1N9KA 3HLTA 5A3QA 3RF6A 4NWIA 4GXTA 3ZWKA 4Y2JA 5ALRA 1Z4JA 1TA0A 4Y2PA 3A1EA 3AR4A 2I6XA 2WF9A 3KZXA 2BDUA 5AW9A 2G1AA 2P9JA 4JDPA 4CF4A 2HX1A 3A1CA 2G09A 1S8OA 1U02A 2GO7A 2O9JA 4YCMA 5JJBA 4Y2RA 3WKBA 2QLTA 3N07A 2YJ5A 3B9RA 5AVUA 3N8GA 2W43A 3WK4A 2B8EA 3R9KA 3WK7A 1L8OA 2G08A 3QGMA 2ODAA 5AW2A 4GIBA 1RLOA 3TLMA 4UMFA 2HI0A 3WKCA 1U2TA 4EEKA 2C8LA 4CE6A 1NNLA 3I76A 3L8EA 3OCZA 1Z4OA 3IJ5A 3W5BA 2AUTA 3SKYA 2YJ4A 2BY4A 2MSNA 2I33A 3UM9A 1EK1A 4BEVA 3NIWA 4J2TA 4RETA 2JAOA 5AW8A 1L7NA 3F9RA 5ALTA 2C4NA 4KX3A 4HGQA 2YJ3A 3IRUA 3R09A 5AKGA 1CQZA 4JB3A 2OA0A 5AKEA 2YBDA 2JARA 2Q4RA 5AM0A 5ALYA 3FVVA 2R8ZA 5AM4A 1U7OA 5AI6A 2IA5A 5ALLA 4UAUA 3N5KA 5ALGA 5AW0A 1Z5UA 1QQ5A 1RKQA 3L1UA 4KX5A 1WPGA 4UM7A 1QQ7A 3U26A 2FPRA 2JAUA 3NUQA 4J03A 1LTQA 1PW5A 5AI8A 5ALFA 3ED5A 3W5CA 2ZXEA 5AIBA 5AVWA 3U7EB 2FPXA 3A3YA 2HF7A
chains in the Genus database with same CATH superfamily
1X1DA 2FZLA 4YK7A 1RDFA 5FA8A 1Y34E 4DLNA 3HGQA 4JCCA 4ZO7A 1WXEA 4XUDA 2FW9A 1HL7A 4A6EA 3WLFA 4LZGA 2EW1A 4BEWA 3F5AA 4B7UA 1HFEL 1C7YA 4XPIB 1UM9B 2ZJ6A 4GM1A 2Z5VA 3MB5A 3QLJA 3CPHA 1U28C 3C5GA 1GADO 2K5UA 4A2PA 3E9CA 1WCNA 4S1TA 2PA3A 3TM5A 1JIQA 1K08A 5HF9A 5DM4A 1P5HA 4X8LA 1RQLA 1F2TA 3MR2A 3TXAA 1GPKA 1F0NA 3H19A 5ICGA 3UAGA 4QZEA 3AEUB 5A4FS 3JQBC 4DLLA 3T1QA 2JEGA 3LUFA 2C54A 1NT2A 2GN0A 2PJZA 3N87A 4QO7A 4MTLA 4D79A 7GPBA 2ES4A 2RB5A 1XT6A 1J5XA 4QYSA 5AK5A 1H6AA 2OESA 4LHYA 4UVIA 4LMPA 1RYNA 2HYDA 2ZRQA 1S76D 2HCFA 5ELLA 1QK4A 2XRZA 2AH5A 4BUCA 3IP9A 4UHFA 3AQIA 1EWQA 5JY1A 4YBZA 4FFSA 1EG2A 1PK8A 1SXJA 3X1YA 4MGKR 4RENA 3BTUA 1MO4A 1NZDA 5E4YA 4J75A 4P4SA 5EZSA 3PU6A 1SVOA 2DWOA 4RY9A 7ICFA 2K4HA 1VPEA 4I46A 2HLHA 3MR3A 2Z8ZA 3ET5A 3PW2A 3LY9A 4QQRA 2GLUA 5J4HA 3DBHB 3GRYA 1Q46A 1X0XA 5H1YA 4IZIA 9ATCA 5F64A 1QP7A 5K09A 3ZV5A 2WICA 5KI6A 2E8MA 4NU6A 2IIPA 3P5BA 1B74A 2WJHA 1MXHA 4BNGA 2NT3A 4J43A 2JGLA 1RJWA 4G1BA 2F43B 3A6ZA 3CXRA 1WYGA 1BS1A 4IUYA 4QASA 2H17A 3EJ6A 4PQYA 3MCUA 4MFCA 1IU9A 3VUEA 2IVZA 2ZBDA 5G2OA 1L3UA 3KV3O 5A1JA 2PS9A 4HDKA 1E8NA 1E3WB 3OQHA 4XARA 4OG2A 5KQLA 1XJQA 2K87A 3G3EA 2CNLA 4AO8A 3JV7A 5TE9A 4BVAA 3KJFA 5KOHA 5BO5A 1LY1A 2H63A 2B0CA 1OBFO 1VMEA 5JSKA 3IPCA 3K05A 1XZCA 1KSPA 4PE5B 8ICZA 1C3XA 4MEBA 4V03A 4WKPA 3G8BA 1PGOA 3T9FA 1DC8A 4OMCA 5E2AA 4C0LA 1K5PA 2V3VA 3V7LA 3L8FA 3RJIA 2WBLC 1RBZA 5J0PA 4YUVA 4DV3B 2O8EA 5LWHA 4QARA 1WHSB 2ZE6A 2W5UA 3CCBA 4G5XA 4N49A 4Z3OA 4X8HA 1AZWA 4BL5A 5AD1A 1KP2A 3NUZA 3FPCA 4TQ9A 1EUDB 1XVIA 1QONA 2WTBA 1P0MA 4L6CA 2FRVA 4PO8A 4KXYA 2XDAA 3B89A 1T1RA 3R20A 1FDVA 4NYJR 4RZHA 1O94D 2WA2A 1IOWA 3GUZA 2H2FA 3E3OA 2LR0A 4D97A 1RZ3A 2XMQA 3PVSA 4AUMA 1KEKA 4MFFA 2G4LA 2ZU6A 3K6SB 2ZSFA 5EG5A 2Z8YA 1ML3A 4E7OA 1KK1A 3UJNA 1H2FA 2C4TA 3AFIA 1Z06A 3BL8A 3C45A 1ZP6A 2FSPA 2BRUA 1OWPA 4OF4A 4DJEC 1JFVA 3IPRA 1ZJZA 2LDBA 4OI0A 2AGQA 9ICUA 1BVRA 2QMYA 3ENNA 4PYJA 3OQPA 4B3DA 3KOMA 3AJDA 2YBDA 1PO7A 3QKWA 3E5MA 3WGJA 1JI3A 3EA5A 2OYYA 3FJ1A 2W9MA 4AL4A 3UWDA 2NPOA 4PO3X 1BX1A 4TLAA 4XR9A 3BXPA 2G9UA 1AS3A 3RKRA 4EIWA 5E1BA 3HSKA 1QDLB 1TJ4A 4PQGA 3IOYA 1E1RD 2O19A 1RTTA 1MC5A 4YR9A 2PUHA 2IH5A 2B8JA 2EZZA 2H16A 2O1SA 5J2GA 3PXGA 2J45A 3RRMA 5LZ4A 2P40A 2FLKA 4IUCS 1T6XA 1UBOS 3UK0A 1KL9A 1MC8A 3SYLA 2CCKA 4AWBA 5CLGA 1E4EB 2I2XB 2YIVX 3HHPA 1P1FA 5FBZA 4N7BA 4JBHA 2J4DA 4AKSA 4QYTA 1CRZA 4UATA 1DCKA 4IEEA 5BSEA 1MQSA 1L7PA 1E94E 2J9XB 4X71A 3RIYA 5DHRA 2GSWA 2FMSA 1GZ7A 5L8VA 1FXUA 3DXZA 5E6UB 1NV8A 1YQWA 3NNSA 1QIDA 1SIBE 2QRHA 2ZYHA 3HL4A 1G3MA 2PV0A 5KFWA 1T0PA 4CLEA 3FSRA 1BS2A 1JROA 2W8LA 1OZHA 3AH8A 1R0YA 3HRDD 1BU8A 2CXXA 4V0RA 4PRLA 2EBFX 4ZAZA 4E1VA 4EFMA 1XROA 5FWAA 3V8MA 2ODGA 4ZCRA 5IJ0A 3A6DA 4BZPA 2BGNA 4CL3A 2XYHA 3QX8A 1SOAA 1FX0A 4R3NA 4DVJA 1GY8A 2FMFA 4NZYA 3RTGA 3DHEA 3RS7A 5FR1A 1KY2A 4HHEA 4DA4A 1YFLA 2CCJA 5FWXA 5I9SA 4FBUA 4YP0A 3VVMA 4C80A 3G1UA 1UPUA 2HBZA 1YR7A 1QM5A 4EJSB 3HXPA 3ME5A 7ICHA 2JJ2D 1E99A 2JLYA 5KFHA 3IDWA 1OFUX 3VH1A 4G0ZA 2MSDB 2FHSA 1AHIA 3DUFA 4Z6DA 3N3BC 4TKVA 4X6XA 4D5EA 1ES9A 4LFAB 3INRA 3IAEA 1NKCA 3A9WA 4GXNA 2PUFA 5ALEA 2I8CA 1C81A 2RI1A 1DWUA 1CDOA 4NECA 5ALIA 1TM2A 4ECAA 2IHUA 3T7RA 2IUFA 2Y1FA 1TC1A 4FSDA 3A25A 1PUJA 5JV5A 3EY9A 3RR2A 1HDZA 1Z0KA 4WH0A 2MDTA 2OP1A 1SNYA 1P4JA 1Q0TA 3BHMA 3OKCA 4EKEA 1IHYA 1TZKA 2HRBA 4MVJP 3EXEA 1G66A 3UB4A 1VSTA 2KSOB 1Z47A 3JZDA 4KREA 1PR2A 4QJ5A 3GEGA 4U2DA 2FQYA 3RHTA 3TVYA 3QEBZ 2JR5A 2R8KA 5KFQA 4DSLA 2G1KA 1Q7BA 5K6AC 4KO3S 1B6TA 3TOCA 5LC1A 2FSVC 5UKDA 2ZIEA 1KN5A 2ZYGA 3ICCA 4ZFNA 3A32A 2VDVE 3RAEC 1Y8RA 1KQNA 1LRJA 4RMGA 2P11A 4G4SO 1JQBA 5EQFA 5J23A 1PEKE 2UYHA 2XT6A 2RAPA 4KE9A 1I14A 4BO3A 4C7XA 3KB2A 1Z45A 4Y2PA 3HN6A 3RTDA 4ARAA 1TK8A 1XSEA 5DHFA 1UBMS 2AJQA 1PSZA 5AXDA 2CD7A 3SJAA 2ZXFA 2W9BB 4EGQA 3LC0A 3KPVA 1YRLA 1M5TA 2Q3EA 3SJCA 2IBKA 4Q82A 3W6PA 1T8EA 1D2CA 1KR5A 2I33A 2JLZA 3M1IA 4J2TA 1IZYA 4RCYA 1L9XA 1CJSA 1OXSC 1Y5IA 2RGGA 1JRPA 1WDTA 4H6XA 4QOGA 3FYSA 2WIJA 4GX1A 3T3PB 3RJ9A 2QAJA 3A04A 4IIHA 4AMYA 3NUQA 1RYUA 1T8YA 4GVXA 1G18A 3KWLA 4BAUA 2A1UB 3RH6A 5B2FA 2P5SA 3PQCA 3BXOA 3ZTYA 1Q1AA 3RYTC 4BP1A 3IAM1 2VJCA 2EU8A 4L02A 3EMVA 1JNXX 4US0R 3V8NA 5CFMA 5DZSA 1EKXA 1S8NA 4N9QA 5L4SA 1THMA 1N5XA 3SVTA 4BNTA 1H0KA 3DMTC 1QYRA 1XN4A 3TMKA 1SL0A 2GNAA 4B3JA 5ELXA 4IVQA 3IAHA 3CW8X 4H7DA 4R8KA 2EKLA 1WA5A 1ZOPA 3TNYA 1B16A 3ON5A 3DXXA 3DLTA 3I30X 4O59O 5K3DA 3G2KA 3X0DA 1P4HA 3PWKA 4LDQA 2JEZA 2B1RA 2OV1A 3OU7A 1EJ2A 2WWIA 3DTVA 3EEYA 4Z4FA 2RKWA 4OJLA 1LPNA 1PLLA 1NYLA 2Q6LA 4ED9A 1HK7A 1QOZA 2VSQA 2IW3A 5AVVA 4G4IA 1HT2E 1UAAA 4XIJA 5E7IA 3FETA 3WOHA 4BEBA 4IUDS 1N2ZA 1FYEA 3O2SB 3JZIA 4Q03A 2G82A 4QODA 1NRJB 3D5QA 2ZTVA 4DCVA 1EJ0A 1JSRA 3QXCA 4JZKA 1DIRA 2R79A 1EXDA 1O8CA 4Z6CA 1G8SA 1QFXA 5I5EA 1KLNA 3C2MA 1BOOA 1WD7A 3P0FA 2VP9A 3R7BA 3ODPA 2I66A 4AN4A 4D96A 1DPGA 4R1MA 2UUBB 3NHSA 2Q9UA 2IXGA 2JLCA 5CW1A 4JUBA 3LP5A 1F9AA 5IJWA 3LBYA 3MJFA 4LYHA 1P3DA 2NUAB 2AG5A 4DUGA 4V2UA 1RZVA 4ZCLA 5JVDB 2QQGA 4DLZA 3N0VA 2XXBA 1VB5A 1SV0A 4QUJA 1MX3A 5EJ8A 4WCFA 4IWXA 4KR7A 2W70A 1BXRB 4NU8X 2Q3BA 4BJHB 4XVRA 4NXMB 3GROA 1OVMA 3OKAA 4UU0A 2BHRA 3SM3A 1Z7YA 1ISFA 4KE7A 3A6JA 2A9JA 1CR1A 2BFNA 4KXWA 3Q8MA 5FYDA 3Q7IA 3CUTA 2FETA 2HO5A 4YB8A 1QQAA 4M21A 4OJ5A 2BFDA 2HPHA 2NZYA 1OLUB 1NXQA 1VHQA 4M0LA 5IHXA 2F1OA 1W94A 1OLXA 4CHTA 3FYUC 4C4TA 1G9SA 2IBSA 3GELA 3C28A 4KGXA 1I4TD 9ICKA 4JFAA 4JLSA 3UH1A 1FLNA 5LU8A 4DNPA 1U04A 2N3ZA 3JALA 4G4SP 1G7RA 2X2PA 5J2UB 4IJ5A 1GXSA 2Q3LA 1AU9A 4HUTA 3JQAD 3OJWA 5HHHA 4IHQA 4X41A 2QGNA 1RZTA 4P6VF 5E9QA 4YDSA 2J9RA 2TMKA 5JSZB 1EFVB 3AU2A 3JQBA 4I55F 4PC2A 1TT7A 4N8DA 2W90A 1KKLA 2VNSA 2VHJA 1DLJA 4Q48A 1LNZA 2VHZA 4QGGA 2GO7A 1H85A 4BE9A 9ICWA 5CYPA 1JN3A 4KGDA 3KSUA 1XN1A 3IUYA 4B87A 4BRZA 5EE5B 4G9GA 3W34A 1RKBA 2WRZA 3LPMA 4EY7A 1QCKA 3CJTA 1QS0A 2VXYA 4LSMA 3ZS9A 3CYMA 2JEOA 1UM8A 3U3DA 1ZNWA 1QGDA 2MSNA 4JGGA 1L7NA 3EMBA 4GR4A 3BZKA 2VJQA 4O5OA 3KBOA 3RUHA 3FGZA 3UH0A 1VMDA 4DEZA 2UAGA 3E1GA 1KK2A 1T4GA 2MR5A 3CLKA 3WDLA 4NL4H 3D6HA 2W2TA 3FPEA 3MWLA 1S96A 1YMVA 1YRQA 2QRMA 3O2JA 5ER9A 4KE8A 3LLCA 2EAMA 2R68A 3HJRA 2YUTA 1Y81A 5AJWA 1OIXA 2O05A 1FMLA 1XA0A 4C76A 4S0XA 3OE1A 3AOEC 4DCGA 4DILA 1FBTA 2HO4A 3D3JA 1SN7A 4JVNA 1OZGA 3EZYA 3P4XA 2B4TO 1R0WA 1KKMA 1A9RA 5HJEA 2WINI 1V97A 3ET4A 4EP1A 4L3WA 1T5HX 5F5XA 2AKEA 3BT7A 5KG2A 1B76A 3BVPA 1GNTA 1ODJA 3B82A 3EWSA 2RC5A 3PE3A 4PFJA 3RJHA 3BFXA 4J7CA 2WLSA 4IMRA 4TTAA 3OP1A 1MX9A 4C0SA 2KB0A 2V96A 3P9KA 5IILA 3PNKA 4WLVA 4RQAA 5ALQA 2P66A 3FPLA 3LW7A 4CCYB 1C9MA 3HWSA 5E0OA 4C30A 2A7XA 5EINA 3I4LA 4HZUB 1G2IA 4BWGA 4BNNA 5CBPA 3OIGA 2P0EA 3H5OA 1Q7GA 2BF7A 5KWVA 2D1QA 2VHCA 2D7CA 2A0KA 1KQ3A 2RC6A 2O48X 3BJIC 2ZRMA 1M76A 4RZQA 1PT5A 4DKJA 2KJ8A 1ECFA 1Z2DA 1PYDA 4CPDA 2QYTA 1Q5PA 2XC9A 1BKYA 5L7TA 4EWLA 2E4YA 2FUG6 3EA0A 1OU0A 1ZDMA 4Q9HA 2RDMA 1A8SA 2FQXA 4FZMA 4RQ1A 5GV7A 4DABA 1SD5A 3RVOA 4W1PA 4Y2UA 2J33A 2NSJA 5F7JA 2GX6A 1TYEB 2HTEA 2OHFA 4RULA 2GHIA 4KUEA 4CCHA 1A98A 3ZW7A 1Y9DA 4JJ8A 1LV5A 2J4CA 3KPJA 1TUBA 3D6UA 3O82A 1ISJA 4LE2A 3ND8A 4HT3B 1WBJB 1IM5A 5AM3A 1UDXA 1ADJA 2AQ8A 1KI8A 2BELA 2X0IA 4D3YA 4F5RA 1Y8AA 1SCKA 2FP3A 1EUYA 4GKAA 4V24A 1IWBB 2AJBA 1IHXA 4PJ0U 1A0OA 1RKUA 1XTTA 5K2OA 2RCYA 4HWSA 3OFKA 1FXWA 2IDMA 3DCIA 3DPSA 3WGLA 3AEXA 4DQRA 1ZN8A 1URJA 9LDTA 3LCMA 5F52A 2YNMA 1EVLA 4H7PA 3KR2A 1HZJA 1C0KA 2Q3DA 3T5DA 4EG8A 1F1BA 4NBVA 1EZ1A 2EX4A 4WX2B 4D0LB 4QAJA 4Q1AA 1G8PA 3ZHTA 1KDVA 2ZYTX 3W5SA 3U37A 2AEFA 5D84A 4UAZA 1T0BA 1YNSA 1BVUA 3MJRA 2AYZA 3ITNA 1G2QA 4HH3C 4D6XA 2CFOA 3THOA 4OJOA 2BUAA 3HUTA 5ALHA 2ACVA 2GFHA 3SSMA 4WLEA 3K5IA 2FPKA 4QUDA 1W44A 2X0RA 3MINB 2G9QA 5IXSA 1BOFA 2CHQA 1Z38A 1T5LA 1KDOA 3FVQA 2B4QA 3JPNA 4NF2A 3OG9A 1USVA 4KIWA 4OQQA 4QOEA 3TPZA 1RLOA 4CKBA 1MG5A 3VX4A 5KSWB 1Z4OA 1Q3UA 2VUTA 1TJYA 4CMBA 1A4UA 1ZMRA 2PFOA 3CUSA 4B3XA 4BEVA 1EHCA 3NU1A 4HB0A 5CD1A 2ZRDA 1SKMA 2CF5A 3P94A 3A70A 4HN9A 2GKSA 4MB0A 1EK5A 4BECA 2FX5A 4WXRA 3J81A 3GNLA 4REQB 3HBNA 4K8RB 5LQDA 3EZ6A 4PYNA 3DE1X 1XG5A 2AFRA 1FTWA 4TXHA 3M5PA 4FK8A 3COJA 2R8XA 4FIZA 4DOMA 2AEMA 4PZNA 2EFGA 1WZUA 3H97A 4G6ZA 3Q8WA 2ASVA 1KDRA 3NT5A 1NP7A 4Q00A 3V1MA 2VJKA 4RM2A 2CYCA 3DVAB 3W2TA 1SM4A 2Z4SA 2LYHA 1NZPA 5BRAA 3OIDA 3R3XA 1EJ6A 3T7IA 4DO9A 3EPLA 4JZYA 2JFWA 4RF3A 4L57A 2P6OA 2WNSA 3OOWA 2XRFA 5CA0B 4YBRA 3RFVA 3IL2A 3BRWD 2VNHA 4G09A 2E4AA 4R8LA 3VYVA 3QW4B 1XNSA 2W04A 2XA2A 3FRIA 4NE2A 2RGBA 2YVLA 3O3MB 4M89A 1CLUA 4G37A 2AE2A 1T1EA 1NI4A 4TYNA 1J09A 1B3BA 2PAFA 3L0CA 3WHPA 1WXQA 2IYYA 3H2YA 1YQQA 5BWCA 2RGRA 3QOWA 4X94A 4NDAA 2JGDA 2R4QA 2WM8A 3L0IB 2DT8A 2ZVQX 1LDNA 3IBFA 4ZEVA 3WS7A 2Y1IA 4DLXA 5I7RA 5K6AA 1L8LA 4TM8A 2XQFA 2ZZMA 5FWDA 1NLMA 3WYGA 3JCZA 4COKA 2J3QA 3MW8A 3CC8A 1K88A 4FW8A 4N0EA 1N60A 3HUFA 4I14A 4EY5A 3BILA 4KQWA 1G59A 3KOYA 1V16B 3SZUA 1A5TA 2ZIGA 1S4MA 2QXYA 5DN9A 1U0SY 4OXIA 4F45A 3G6KA 4YRZA 2C61A 4HMPA 2AN3A 1CZOA 3S4YA 3ZDZB 1BVSA 4HK4A 3K5PA 2XUZA 5FBRB 4AS3A 1M34A 3TECE 3I2JA 4G8JA 3GNTA 5BMVB 1DAKA 3C3BA 4AKTA 4HGPA 3PPXA 4HYTA 4I55A 4IRDA 3TQSA 3ADKA 4Q7QA 4LAFA 4QWEA 3E2MA 4TV9B 1YL5A 4S05A 5DHPA 1BEEA 4Z6KA 3R24A 2EYUA 2GF0A 5K4AA 5K8TA 3G0OA 1Z7BA 1L4YA 4Q16A 3QPCA 1ZZEA 3WB0A 1KMHA 2QNIA 2FFJA 4HAOA 4AJLA 4N3GA 4UPVA 2FFRA 1NJ2A 1EGVB 1NQ5A 4YP5A 1N32B 1GU0A 2H1FA 5TEVA 5EIOA 4QVKA 3HPOA 1D04A 1WUKS 3NHBA 1P9RA 1EBFA 1LJUA 3BMOB 4KEAA 1CB0A 5KREA 1WEHA 2IPAB 1T4DA 4KMUA 2GPSA 1QFZA 2JH1A 4N8SA 1U1EA 1J2UA 1TMKA 2C82A 1B15A 1KDHA 2EZTA 3M6MD 2VL7A 3RC1A 1YNOA 2K4PA 1NBME 1M2HA 3DMTA 2Q46A 3BHJA 3ROPA 1GZSA 1XEXB 3G6YA 3ZTWA 4L7QA 5KTQA 1NYQA 1BKDR 1W85B 4GGOA 1IXYA 1M0WA 4JI4B 3DWGA 9ICIA 2G5PA 1ZQYA 2UZIR 1M6WA 4IF4A 2AD5A 3G2NA 3RRJA 2I6QA 3M4JA 2MINA 5K9ZA 2TSYB 4I9UA 4AT1A 1SMKA 4HNAA 2QV7A 1LKYA 1AH2A 3MTJA 2N1MA 3OEED 1RPJA 2HX1A 3C0KA 3GIWA 1JHXA 4JP5A 3D2LA 1FUKA 5BN1A 2YFHA 4HQRA 3K8YA 4CG1A 1V7QA 5TQ0B 4Q8FA 3NHPA 3GQVA 3AESB 4EEKA 5EVCA 2C96A 1XTQA 4KR9A 1QIKA 2ZE8A 5JBNA 3HBJA 4PZCA 1JAIA 5DLPA 2EDCA 3W3ZB 2II6A 1XQYA 1J1ZA 1H5QA 3N5KA 1GQ2A 5F3WB 1WZIA 3JQPA 4DFMA 2GK6A 5IX8A 3PXAA 1K66A 1UBSB 4NYMR 4Y1FA 5M3BA 3ZGZA 3GA5A 3SZLA 4DDMA 3VO9A 4ROTA 2XDQA 2R8HA 1E2QA 3AVYA 3OQJA 3LYLA 3A6FA 5JMTA 2UZAA 4G1CA 4WN3A 2DYKA 1CZKA 5EWMB 2XYPA 4QLBA 5KYWA 2FG5A 4CIBA 4J16A 2XMZA 4ESVA 4F2GA 3WNZA 2OGUA 2BTEA 2G07A 3ZX4A 1DRUA 2VUIB 5BOMA 1WHTA 2UZ4A 4JEMA 2X1MA 2XVZA 4IV0A 4OJ6A 1J99A 3IH5A 3OFSA 3NIFB 5FNVF 3RASA 2D6FC 3D4LA 1CS0B 2X0DA 4ZYWA 5KPDA 2VJNA 2BCSA 3RFTA 4RPCA 3FYUA 4LF4B 2EZYA 3V4SA 1J9GA 3KB6A 4IDHA 3WRYC 1U45A 1ULHA 1YIOA 1RAGA 4F2PA 4PN3A 2QUZA 2UYYA 2ZSUA 4NARA 4LXXA 2WE8A 3EAFA 5T4BA 5JD5A 1Z16A 3BFPA 1C1XA 4PTZA 3DXYA 4UUAA 1COZA 2VZLA 3L0SA 5JC1A 5DBGA 1XZLA 2QRJA 1GM5A 3PFCA 4LV5B 4B34A 4GVLA 4KQIA 3SDSA 4N3CA 4C04A 3NX4A 3MWJA 1KVTA 3IA7A 5FO0A 4I1IA 4WNIA 4EF6A 1WCXA 1GTVA 5IANA 2F67A 1NJSA 3LFTA 2WU4A 5I8PA 2X2OA 3HN7A 4YQWA 1JHYA 1UXHA 3DLAA 3W8RA 4PX2A 2VHQA 4MW0A 1SC3A 1X87A 3P27A 3JATB 2RJ3A 1NK9A 5DLYA 1GKUB 1SPBS 3WJ7A 1KOGA 1HF3A 4LBYA 4EZ9A 3REQA 5LYJA 1W6RA 2ON6A 1NX9A 5EJ4A 3A31A 5GQSA 1PR4A 2H4YA 3TJMA 3ETJA 4P35A 2JDID 1S3FA 3IERA 4FXOA 1HYHA 2W3RA 4IEIA 1TZBA 4CEIA 1L7EA 2Q5LA 3DS8A 4OHPA 3PUWA 3QXHA 4JFRA 1M72A 4OB8A 4URFA 4I1UA 3BIWA 1UBLS 2XOEA 5IVIA 5CHEA 4I2BA 2C2ZA 4O02B 4OUDA 4RNCA 5LZ7A 2BI4A 1V96A 3VHXB 2ZJ8A 4LY9A 1SUDA 3CLVA 1S1MA 2ONCA 4YCLA 4FBMA 5AJXA 3TINA 2BKEA 1GPH1 4L50A 3VTFA 3VR0A 1YDEA 2QXTA 1KFJB 1MEJA 2ZRGA 2GA9A 3PEVA 1TYZA 2QZ9A 4KQ2A 1XX6A 1IHOA 2ID7A 3ISDA 4KE6A 4YN4A 5L3QA 5D8DA 1MO3A 4LDJA 4S12A 1N7JA 2QM7A 3E0XA 2FK8A 3LVVA 3AOEA 1JJBA 4ZU3A 3HFRA 1Z4PX 3H05A 3ZXSA 4L9AA 3A2KA 5DX8A 2IOFK 4MS4A 3WNQA 3LY7A 3BERA 4OKIA 1AURA 2C28A 2PH7A 4M2LA 4S1PA 2ATLA 1ZYUA 8ICXA 3IP5A 2GB4A 3DZDA 2LYBA 4K6CA 1BD4A 5IDQA 5FHRA 5BWOA 4C4AA 4Y1RA 3UMVA 3KDSE 4HDSA 1QHHB 4RCVA 3EDOA 1HY3A 1SXQA 2SKDA 4OAQA 1JMSA 1L3IA 1EIWA 4LHEA 4E08A 1R4NA 2VA3A 2IXAA 3KQVA 5J1SB 3R7AA 4CM6A 4KO1S 2XSZA 1TF7A 1YRYE 2LIPA 2OWOA 2B8EA 5CK4A 3WHIA 2G9RA 2BONA 2QL9A 4BGIA 3E3LA 1Y6QA 2KHZA 1E2EA 3CPEA 3EIHA 4QUAA 3NR2A 4L0QA 3A36A 2WUWE 2PFQA 5CEJA 3R0VA 1HJPA 1Z00A 2WNHA 5EIAA 3JD3A 2IKQA 1JEYA 4TLDA 3BTSA 1T8SA 4FLEA 3WZLA 1U8ZA 1M9NA 4QSMA 1Q0UA 2FMHA 2FPIB 3P19A 4JJFA 1JPNA 3EYWA 3MLEA 2OR3A 4BN5A 1RPLA 4W1SA 4ZVQA 4OD0A 1N5KA 5LBUA 3RC7A 1VFNA 4DJFC 4F84A 4M83A 1OJLA 3U5ZB 4QDUA 4N82A 4EECA 3STYA 1M66A 4EOGA 3UF0A 4X95A 2OXRA 3VSAA 5KYYB 3Q3EA 5K4GA 4CETA 3GFTA 3FLAA 3NWBA 2J5RA 5KQSA 3ZJ5A 1KVQA 4D74A 1ORVA 1HIWA 1M1UA 2YZ7A 9ICQA 4K46A 4PHHA 1ZICA 2VF2A 1QK5A 2CZGA 1CW2B 3HABA 2BP7B 3FCSB 1U0TA 4S1NA 1HDEA 4O1HA 4W8HA 2Z09A 1IUNA 1KIMA 5IEJA 1M5UA 4INOA 4B44A 4IY1A 2CV0A 1FSFA 1BQEA 4M9UA 5A62A 4C7BA 1CF2O 1O8BA 2YS7A 5AP9A 1OF1A 4DUPA 1YE8A 4MQBA 4MUYA 4ZI2A 2QTNA 3D4PA 3RO7A 4RZRA 1PU2A 3DWEX 3I8SA 4O3RA 2CBZA 5T4EA 2XT0A 4NBWA 3TIXB 4R1SA 3H11A 4OIFA 3EPGA 3AJEA 4F8JA 1CY7A 1WAMA 2ZVJA 2QWXA 3I04M 3FBTA 5ED0A 2EW2A 2WSLA 3FR7A 4JWNA 3VGPA 5KT7A 2Y6UA 3W0LB 1CR6A 3KZKA 3SBOA 3MUOA 1F9EA 4CKWB 3MS4A 3M8RA 3C2KA 1XALA 3RTVA 2YTUA 4F3KA 3NANA 1CDEA 1VLQA 2BE9A 3GLUA 4XUSA 3AHEA 4QZGA 3L41A 3TRDA 2VUSA 5ALZA 1CUUA 2ID8A 1NVTA 2PWZA 2WP8J 3A06A 3MUFA 3DQQA 1X86B 3DCYA 4YCBA 2RHCA 2HJ9A 1EXMA 2WF8A 3DAGA 2AJ8A 3ORYA 4MA0A 4OBEA 2BH2A 2J3HA 3TZEA 4PPGA 1TAUA 2ECQA 2JL1A 4EQZA 4NH0A 4KMOA 1RHMA 1MX1A 1NN3A 4J07A 2KX7A 1Z63A 2QSUA 3SHVA 1VG1A 3ML1A 4WCFC 4NONA 3GFBA 3ZGYA 2EL9A 4OYLA 1NJYA 1YDMA 2R6ZA 1LSSA 4KQMA 2X0JA 2VKQA 3DF7A 1F6WA 1FTSA 7ICKA 4S3MA 1VL5A 4INPA 1BAPA 2C2XA 4RVFA 2OL4A 2EDAA 4PGFA 1DBWA 3PDIB 3KLMX 1W88B 2I7XA 1QF6A 4B9MA 4YNBA 2DH5A 3NALA 4M38A 4E09A 4BO8A 1QIHA 3D6VA 4N5LA 4PPQA 5FLYA 3HL0A 4GVPA 4HRXA 1NK8A 1IEQA 1WUIS 3THRA 3IHTA 1JI7A 2MJLA 2CXRA 4TMWA 1IY8A 3G02A 4I9GA 2C7OA 5TT0A 1NKTA 4YAUA 3PK0A 2J09A 5HQTA 2F64A 1R4MA 2AZ4A 4BRUA 2IYUA 2F8MA 3KELA 1F20A 3KTFA 4DXAA 1T94A 5I8ZA 4Y2RA 3H86A 4GWGA 4J1TA 2AFIA 4U7PB 3F3SA 1F8UA 4MQMA 5FRDA 4HDOB 4DTIA 5FNVA 5BP7A 2H51A 3S1AB 4D9KA 4ECWA 1BW9B 3EPKA 1OWNA 2FZEA 2R62A 3KSBC 3ANYB 5LOVA 5HKKA 1QPZA 4FYMA 3V8RA 1XZMA 3ESAA 1QKJA 4R66A 3OX2A 2WI8A 4CXMA 1E63A 3QENA 2IL1A 4M46A 2NPIA 4Y6LA 4ZEMA 4HYKA 5HWSA 1TYCA 1U5BA 4BKRA 4DWOA 1DFIA 4AJKA 4G0PA 1VB3A 1IG0A 2FLVA 1IH8A 4FX2A 5KTYA 1JDBC 5TXGA 2RBKA 7AT1A 2YXLA 5CFZA 1KP9A 3O8QA 3JPQA 3SF8A 4FP9A 4UEOA 1WLSA 3NEAA 5KVAA 2XZOA 1RFGE 5JNSA 1V8DA 3INTA 5IT5A 5E38A 3ZCPA 3IEPA 4QTXA 1YR3A 4JLBA 4EG7A 2C7RA 5AIAA 4K5QA 1E32A 4CI0B 1J2MA 1SZJG 1BX0A 2NQTA 2BPGA 2W00A 4ITUA 2B2XA 4S04A 4GSKA 4X20B 3NZEA 1M8KA 1TM4E 2NO6A 1P3JA 1R0BA 3CONA 2ZJ1A 2VP0A 4BC1A 1QH9A 2WUFA 5B30A 5JIBA 1UMCA 2V1XA 5F2EA 2R7KA 4LF6B 5C3UA 1AGYA 5A5FA 1NRWA 5JSHA 1LNQA 3QVOA 1IBKB 4HEA1 1YK1A 5A71A 2B5OA 3BQ2A 5ITZA 2COEA 2JK1A 3VSDA 4LQLA 3DVQX 2ZT8A 4KGVA 4F4JA 5KAFU 3DW1X 4OL9A 4ND8B 1JHVA 2WVHA 2DSTA 2A5GA 4BX2A 3OTQA 1X7GA 4U6QA 3LC1O 3OCUA 2ORIA 1FNCA 1VSQA 4TMTA 3U40A 1XAJA 3H4TA 1JU9A 1CUWA 1JKIA 3QTBA 1LPSA 1VL8A 4QC2A 3U80A 2CE2X 1R9NA 4NULA 4RE5A 3QPBA 4Z4QA 5KG0A 1COOA 5A4MS 1T6YA 5DTMA 5H82A 1P3Y1 4LGMA 4TL6A 4GDMA 5IINA 1SL1A 3IILA 3FPBA 3C74A 3O75A 2QRQA 4Z9AA 4RD3A 4DLTA 4G0UA 5L7WA 3RRFA 4LJYA 3D7SA 2J0EA 3D0KA 3C7KA 2DLNA 4LJ5A 2NM0A 2NSYA 5ALSA 3OUTA 3ZWNA 3EF3A 2FXVA 1U94A 3V55A 2D7DA 4TS4A 2N42A 2IHVA 3CRQA 3FWKA 5EYPB 3UV3A 4A6XA 2I71A 4ZVVA 4DEVA 2C5SA 1ZH6A 5HGJA 4X97A 2ZUWA 1L7MA 5DLQC 3RF7A 2JI8A 4Q3BA 3PLRA 4XA8A 1ETHA 3GEMA 3OY2A 4RPGA 3FFXA 4NK4A 4PTLA 4KSBA 3I2GA 3B3AA 3QQ5A 4HDAA 5AI5A 4I4LA 1OBHA 2RGCA 2XCOA 3ZJ4A 1Z5NA 3TEMA 5B6PA 4ND2A 3QKRA 4FWBA 4MHSA 4IW3B 3SU8A 4XRHA 3DEEA 4I2EA 3RVKA 4ZI7A 3WR5A 3L1VA 1UC5B 1DGSA 1TLLA 2FW7A 1R4ZA 4P4SB 3SR0A 2FZKA 1TGYA 4MARA 1IE3A 4CR7A 1QPBA 3ZWPA 2IMWP 2ZBUA 3VPSA 3F9CA 1YGPA 1CDZA 5FLEX 4GZ6A 2YNMC 2FUCA 3AIKA 1S97A 1DFGA 1I0ZA 5DHAA 3DZHA 3WQHA 3UZUA 3C5CA 1WUDA 1FL9A 3A6LA 1YQDA 4WFQA 4IO0A 5B57C 2BZ0A 4PPYA 4G36A 1D6MA 3F6YA 4YMWA 4BWMA 4QUBA 3Q4GA 4X8MA 1ZK0A 2D6FA 3DEJA 1QWOA 3LWZA 3IXQA 3NYQA 5JFGA 1OREA 3HCWA 5K51A 2X0EA 5JJBA 1M6VA 4MRAA 3WRYA 4HDKB 4PSKA 4DDVA 4FILA 2JHCA 2OHHA 4BDSA 2G17A 1DZ3A 3T35A 3FIJA 3AIIA 5BV2P 4BVEA 4AQ7A 4K81B 1JA1A 1VIAA 3C1YA 1SUSA 1FJXA 4XM2A 4X8OA 1NW9B 4ECXA 2C7BA 5HOEA 2KLBA 4NLZA 1IN7A 2ZXHA 3BSWA 3PLAE 5A6VA 3V7WA 2NLOA 3B0YA 2QRVB 1IY9A 5DBEX 1UR5A 2V45A 3P9RA 5MN5A 5G53C 4ZANA 1F2UB 2VAXA 2V7XA 5J5VA 1FLDA 3MPUA 5AHKA 3EQ2A 2O8EB 3ETEA 3WIVA 1X9SA 2GQ0A 4EITA 4WXYB 3PHLA 4EW2A 2D2EA 3FY4A 2G7ZA 3FFWA 4QULA 1ANKA 2J6TA 2KJQA 2HWXA 3KD3A 2BKXA 4FHGA 3ECAA 3WGVA 1XXHA 1FFXA 2VP5A 4Y3UA 2PZKA 2IDZA 1GV1A 1LDBA 2FRDA 2IWHA 2I4MA 3HDTA 4BB6A 4JQYA 2WZCA 1MKYA 1G5HA 4XCVA 2ZUTA 1N2GA 3SXPA 3HVJA 5T5QA 5AFSA 4MR9B 1DC6A 1Z6PA 4QZFA 3BE6A 3GV0A 4ENUA 3FSJX 1X9WA 3KXKA 1PLKA 1GKLA 1J8VA 3QE0A 2VIXA 1WMDA 1ZQPA 2ERYA 3H8VA 1T4BA 4YXFA 1P8AA 4D81A 3C5HA 1E1DA 3RUFA 3EG9A 3SYKA 2PT9A 1K7EB 4YREA 2VPIA 3P9YA 4UJ3A 1V9CA 3QVUA 1O9BA 1VDZA 1Q19A 5AXBA 2QQFA 3QBEA 4L5CA 1RRCA 4R0NA 3F1LA 1KK3A 3RADC 3QJGA 1ZL2A 1XEAA 1P0PA 4FGLA 2Z5FA 2O8DB 9ICVA 4R1TA 3FTNA 2MTBA 4CKEA 4FE4A 1U7DA 2X8JA 4JR2A 4FZLA 5D3QA 1PFVA 4PAWA 4IFTA 5J59A 3NDJA 4U6NA 3DE0X 2B7BA 2EATA 5JO0A 1NONA 2CHUA 3HKBB 3A4MA 4RJJA 2GD6A 5KAIU 1ZKDA 2DBYA 3D2SA 5HM6A 4QZBA 4URXR 1BFKA 2OXEA 5JZBA 1XXLA 4V0LA 4CRXA 3BICA 3ZOKA 4NCNA 2CBGA 4FDMA 4NFLA 4YJHA 2QMEA 3FYCA 1Y3IA 4C7JA 4CQMA 1A8UA 3WLTA 5H3CA 4F4FA 3EMDA 3TK1A 1XVLA 3IIKA 1ZCFA 1T7PA 5DKFA 2XNJA 3BDVA 2WIBA 5LZ2A 2FMKA 4E3WA 3C3CA 3KDAA 2RIRA 1X9XA 4ZMRA 3KFVA 4ZDKA 3HQ4O 1P91A 1XOIA 4BMZA 4HYYA 1BCSA 3KDPA 3S27A 4MWDA 1A69A 3S2YA 4JI6B 1EVEA 2KQUA 3QSYA 5JXGA 2DE0X 3Q7RA 2IXBA 5LA6F 4P7BA 5ARBA 2F4VB 3KRTA 1ZQSA 3EFHA 5BORA 5CP2A 3RUDA 4CMGA 1JPVA 1FXWF 3V7FA 1QO0A 2BGLA 3V6HA 4EB0A 4HDMA 1OCEA 3QU2A 4Y6PA 3DV2A 3OLWA 4JEIA 1DXQA 3IAXA 4DWVA 4U7DA 5TS2A 1FS6A 3PUVA 3ZBPA 2RJNA 1SBYA 5FWXB 1E60A 4O25A 2X9QA 3CEPB 3ROMA 1NHWA 4TUYB 1YR9A 2BEUB 2IZZA 3FNQA 1VZ3A 4EBDA 3WWCA 3IQEA 2PLRA 2VHWA 4KMSA 1X3LA 3KSDO 3HO6A 5IC6A 5IHPA 1X14A 3ZG6A 3DUFB 3BXEA 1N9KA 1NAIA 2Z30A 4R8VA 4C7OB 2FG7C 1OI2A 3QFRA 2PXIA 1EUCA 1P2FA 1BWPA 1IHDA 2VDWA 3DDCA 2CLCX 1E3SA 2PU5A 5KNBH 1N5MA 2R5FA 5BRNA 4MUNA 4Q1DA 4BV8A 5DSZA 3LPAA 2AS0A 3W3AD 1P2TA 4RHEA 1ZQEA 4QAQA 3IV9A 3MCZA 2XUDA 4DV6B 2H52A 3DNMA 3OAAD 3DGEC 3G2HA 5CXXA 2PVPA 3NIWA 2JIRA 1KEVA 3NYRA 2RHOA 5TF4A 5HOQA 1SKRA 2OO3A 5K0SA 2FF7A 5H7XA 5DH9A 2JAQA 1VKRA 3F4KA 3GDWA 4LI3X 3E7XA 5AM4A 3LLMA 1B26A 3HBFA 4B71A 3O6VA 3L1UA 5FPYA 5JC8A 3L1HA 1OWLA 2JHPA 3K1JA 4JV0A 1TU3A 1DNPA 1TIKA 1H6CA 3LXXA 3PQ6A 3QKIA 4KLLA 3PKIA 1D9ZA 1SQSA 2Y1XA 3FHJA 3NBXX 5B36A 1QG6A 4YIHA 2QARA 2W48A 2ZTUA 3ZU3A 3NHYA 1W2GA 3ONWA 3D54D 2NUPA 2WG2A 3E53A 1FW6A 3FBWA 1NNEA 1RJDA 1BE1A 3DC7A 5AK6A 4DDWA 2B9EA 3DBVO 5DTQA 5EJGA 1B8OA 2YHIA 4FE7A 3O3NB 4D3XA 5T7BA 3PW5A 4JI3B 4FBGA 5TQ2A 1PK7A 3PP8A 3GWGA 4Q39A 3I4FA 3PIIA 3CUKA 3T5CA 1UKYA 4QTZA 2PTGA 4I27A 1YK0A 2AGVA 3KE9A 4J16C 2RHTA 4JX8A 1ID1A 1SCQA 4RT3A 5TRTA 3KQWA 5EWJB 4CLOA 2DFKB 3TIGA 2BGIA 4E2FA 4CM8A 2J0QA 2ZI6A 3C3PA 3Q9LA 5LNK1 3HFGA 5EKUA 2KD1A 2DQ4A 4FT2A 2FFBA 2QTVA 3QFHA 1S77D 1XLTA 1GT91 2W83A 3HUUA 5DB9A 5ILGA 3WL7A 4H6WA 2FDCA 3UHJA 4A8TA 3GJXC 3SMVA 4O3MA 3KZVA 3QFSA 3OZDA 1Z8NA 3LK6A 4W4TA 4QDTA 1QF7A 2GF2A 1SD2A 2QTGA 5CT5A 2JFZA 3ZUGA 4OKNA 4Q66C 1L5KA 1L5LA 1UWCA 3WNCA 4R16A 3NP9A 2JMGA 2AEEA 4UTOA 3K1ZA 1TZJA 3PDCA 3C39A 3LCJA 1KFTA 4MV5A 4IC9A 2QHXA 3VSCA 1U9ZA 1Y63A 2HCRA 2A67A 4R2MA 3I8OA 4GI5A 2Y1JA 3SOPA 4Q7JB 1NXVA 5T57A 3AIMA 2AFHB 1L5VA 2VEDA 3N8NA 5BQFA 5D51S 1NYRA 4IYJA 4HLCA 4JI8B 2P27A 5DG7A 4PTYA 5EE0A 1HE3A 4FGSA 4LWQA 1P29A 5KNLA 1WZCA 3TLZA 5TPWA 4YDHB 3LBHA 1ATZA 5FV7A 4DNXA 4NJEA 3DFZA 1CUHA 3F5DA 3PC6A 3GOHA 1NQAO 1R6VA 4TMZA 3DTVB 4W5JA 4BFWA 4ABYA 3PQ2A 1K1SA 5AJZA 3KQQA 2JH9A 2WSMA 2W2QA 1QGUA 4YMOA 2PMBA 4A16A 3FB1A 3ZY4A 4HWGA 4NZMA 4MQFA 4YJKA 1XU9A 4I4TA 1Q44A 3NKVA 1W2HA 4EHJA 1WKBA 5KTOA 1QFJA 2I62A 4HPJB 5JTIA 1HQDA 1NMXA 5JZOA 3FB4A 1YZKA 5B4VA 1E79A 1Y0BA 4KG7A 1OXKB 3CEHA 4W7HA 3VGJA 2JZBB 3WAJA 5A1TA 2ETVA 4F3RA 1V1MB 3AY6A 2QG6A 1GNLA 4KLZA 1XWFA 3VKHA 4IX1A 1NBMD 2WAYA 4X1OA 1Y1TA 1DEKA 1M7GA 1N78A 1GQQA 3R5XA 4L4RA 4C05A 3O93A 1Z34A 2X8WA 3ND5A 1ZQ9A 1Y6JA 2WOOA 4X9XA 1NYTA 2VBCA 2OXOA 1SU7A 2YQ4A 4DYVA 5AVSA 2YCBA 3RS4A 3F5SA 3I5XA 2AMLA 1LI5A 3GFFA 4ZXFA 4ESHA 5LMNB 5JCZA 5LQMA 3KCQA 4GECA 3H99A 1NBEA 3KOXA 3M6WA 1TAGA 4KLHA 3CR3C 1ZM2A 1I2BA 1FTGA 3X1ZA 2ORWA 3RUIA 2G4VA 3R5HA 2AGOA 1M2VA 1GPBA 2O0MA 3BJYA 2GDJA 1C4WA 1HQCA 4BNXA 4BRSA 3IRUA 1XYGA 1ZMOA 2EEPA 3FVVA 3TZQA 3R5SA 2NT4A 4HLUA 1OLXB 4UHBA 3N53A 5J4KA 5E7MA 1USWA 2R5NA 1N1DA 4PSCA 1ZK1A 3QELA 4JNKA 3JALB 1NXOA 3ETDA 2PN1A 4AJ4A 1UJBA 1HDGO 1VDVA 2CVHA 3UN1A 1GXSB 3KYDB 3IPLA 4IIXA 3EIWA 1I8TA 3TX6A 3IIJA 4EX7A 2GAAA 3TSOA 5FTWA 5CLHA 3LI2A 4RCZA 3NBQA 1S0UA 4DN6A 1YT5A 4X1YA 2YWBA 4XFKA 5AJUA 3WLPA 2Q2VA 1H38A 3SLRA 4NBSA 1LJ8A 4M9SA 1S8AA 3KXLA 2LCQA 4GI3A 3UYLA 5HFJA 5AVZA 3OHBA 2IBMA 4PBRA 1JJ7A 4DIEA 3UJAA 2IU4A 3ROZA 2HBKA 1N48A 4K88A 3GCGA 1M2OA 1JR4A 3HYLA 3T5HA 4OQDA 4TUSA 2GERA 5IAOA 5IARA 5CT4A 2KJ9A 3ZI0A 4RZ2A 1QS0B 1N2OA 4PSVA 2HEIA 1GAQA 5GY7A 5KFRA 4OXKA 1NDQA 1TAQA 3M1LA 1V39A 1M2FA 5J47A 1SQFA 2RDJA 3VC3A 1YA8A 5CDSA 1XCPA 3NVVA 4QNMA 4KXQA 5AHOA 5LA6A 2J07A 3UXEA 5EIBC 1EGAA 2EFDB 2IE8A 1V8OA 5LDHA 1L2TA 5CHGA 3TZ6A 3FOWA 4PCVA 1XHLA 1K0UA 1ONBA 4RFSA 1I2CA 1CF4A 2YWEA 3TFSA 1NKEA 2W6PA 5DVZA 1I24A 2P6MA 4CFZA 2P4SA 3NRJA 3FFAA 1JFLA 2OHXA 4B4OA 4EZEA 1SJ9A 1ZHHA 2GJ4A 2BM9A 4DDKA 3CEAA 2E3JA 4HDNB 2HHWA 1ZI8A 3RS3A 4QZ8A 4KK3A 1XMVA 2GZ3A 5CXQA 5JPIA 4I19A 5LYJF 1WXGA 1SO8A 3PFBA 3DTYA 4XCQA 3CB4A 2HQSA 1WWKA 1ZM3A 1TDJA 1XSPA 2R8GA 1QVWA 1JSLA 3WWDA 2JANA 4OGKA 4CM4A 4NPCA 4FQ5A 5KFJA 1SCNE 4D9GA 1B8PA 5DQHA 4LDZA 4CKZA 2GPWA 1SWWA 3IM1A 2Q2OA 4I08A 2VWGA 2WZQA 5B3JC 4C0QC 3T34A 1W29A 1U90A 3LKBA 3ESDA 1JECA 1ZVMA 2XB2A 3U56A 1I2ZA 1VOTA 3JQ8A 3USZA 5CBPB 2EBUA 3I61A 3L6BA 3IG5A 1YONA 1SKUA 1Z73A 3IUMA 3E2IA 3F74A 4X3PA 4HWRA 2FPPB 3WLMA 1J8DA 1DTWA 3F47A 4M99A 4PGGA 3PDHA 3BSYA 5KPJA 4ENTA 5TV2A 1IDN1 3F78A 3KFXA 5DBHX 4R2KA 1CZNA 2Q1YA 4AQDA 2H5JA 1PZFA 1WW3A 4PICA 3H1FA 5JG7A 2NRWA 4GLOA 1YCGA 5KFTA 2C1XA 2AYXA 3AYZB 2G5HB 3OZAA 1NW4A 3B1FA 3O7MA 1DQNA 3G88A 1P9OA 1WG8A 8ICTA 2FVYA 5F5NA 4CT5A 5J0WA 2BTQA 1D5CA 3KPUA 3WZMA 2YN2A 5B7QA 3T06B 1ODTC 1QHIA 1G8JA 4ALMA 2O8NA 4ZIRA 1U7XA 1YJAA 4U7WA 1XAIA 1P4SA 2AFHE 2O8FA 4AUKA 5JD4A 3O8BA 3K09C 1Y1KE 3D5EA 4U00A 2BLNA 1ZM7A 2OY0A 3RAJA 3UT6A 1SB9A 3SS7X 1UBEA 7ADHA 5ANRB 5K8UA 5IW8A 4EUEA 4WKCA 2W9XA 4B4UA 4NHEA 4MRVA 1QANA 3ZV7A 4J1TC 1GGJA 2MSWA 2IXDA 4LJLA 2P62A 4PNZA 3CURA 3WMGA 4WXMA 2GNOA 5CB1A 4GMHA 4WW0A 5B1SA 4J6EA 4LJAA 1MUUA 4C6RA 3PIDA 3FVTA 1XPRA 3VU1A 5C35A 2O5EA 2JJYA 1Y3FE 1NNSA 4R6XA 1K8ZB 1HEIA 4EAAA 1ODKA 3LT5A 1A7UA 4I1RA 3E81A 5HRAA 4IHJF 2A1TS 5BSTA 2Q1TA 4KLNA 3IVMA 4JUCA 3O21A 1IBCA 1T25A 1D8AA 2H7XA 1FNDA 1ZSYA 2FG6C 4B2PA 3BBLA 4DWWA 3O3OB 4EHNA 4HTAA 5L6LB 1V7CA 5B66U 2VI5A 4EI7A 4CIYA 2HHCA 2R8PA 1PV1A 1UEIA 1HMYA 2FY8A 4DL4A 1VFPA 4WVFA 3MABA 3O3CA 2BIFA 3KOZA 3QFCA 3TQCA 4JJIA 4K9SA 4JI1B 2JFBA 3BXZA 3OOJA 2B98A 2PMEA 2OORA 2GEBA 3TIVA 2QPLA 2AGPA 2WUDA 4UBNA 4QGBA 4YAWA 4E31A 2HBQA 3EGOA 2EFYA 2Y4NA 5HZMA 4LF8B 3SSNA 3LSTA 3VNAA 1MRNA 2J5KA 2WVGA 4KNYA 3U9LA 4XASA 5ES4B 5FTKA 1R5BA 4R51A 1M0EA 5D46A 3HVKA 3IBSA 1MHTA 5K0ZA 1OH6A 5DIFA 4MXDA 4R64A 3ETNA 1I94B 3EVNA 2BR3A 4UM9D 1G291 3HILA 2QVYX 3JQ7A 3REFA 2RHFA 1JQEA 3AT1A 1XF1A 4Z99A 3SS8A 2H1HA 1KU6A 1NE7A 2C22A 4ZOAA 1Z15A 5H59A 1C20A 1YQUA 3JZFA 3D4NA 4BNJA 1HQYE 3B9BA 2PE5A 3OPYA 1WMSA 2XZTA 4BEJA 2H65A 1KARA 2JBWA 3DHYA 4EYQA 3RYFA 1VMIA 3AG6A 5JXWA 1ZX1A 4Q47A 3IT1A 2E1PA 3GCDA 4X5VA 4OH7A 1XZKA 5F23A 4MKHA 5C2JB 5I7VA 2XCPA 5F12A 2OKCA 1NI4B 2Y27A 1Y48E 3LE8A 1G8KA 2H11A 3LTEA 4KDRA 3T3EA 2SNIE 2HVHA 3DO6A 1H93A 2P5TB 1JIVA 3ZLUA 1UEXC 1KBZA 1CRWG 1CT9A 2A3NA 1IIRA 3Q7PA 5E1MA 2O50A 4WLFA 4X6YA 1CHDA 2I54A 2GUGA 4JBYA 2VDNB 4P7JA 2QTRA 1FLAA 1S7CA 5FA5A 1Q21A 2R47A 1YU9A 3CUEF 3GPBA 9ICJA 3C4VA 4AJ1A 2HN9A 5IU6A 3BFJA 1IBRA 4MLDA 2R7AA 1NJ1A 2QM3A 1SAYA 4S1WA 4DPMA 4O3QA 3W2HA 3NS7A 5AI0A 4Z7NB 5J0QA 3VR6D 5C9ZA 1PFQA 5KVQA 4II2A 3N97B 5CXUA 3G82C 2ORYA 4G5HA 4PANA 4GOOD 3FD8A 3DEIA 4MUJA 3O7WA 4AURA 1KYTA 3FTEA 3AU9A 1Z25A 2D1YA 5BR4A 3QUAA 2ERXA 1YL6A 4TLCA 4I55B 3K9CA 2QVCA 2IT1A 1H8EA 4G2NA 3WLQA 1TIPA 1BJRE 4KBFA 2Q6VA 2PEYA 3IIEA 2G8NA 1JHPA 2Y0CA 3IVCA 2JXJA 4KKXB 1PJAA 2ECOA 1XVVA 2P9YA 3PNLA 4PHDA 1JTVA 4YRCA 5BOSA 1CEYA 3F7NA 3J80A 4R9SA 3VKVA 5AKGA 4QZDA 3DZCA 1W76A 5LOVF 2R8ZA 3FNHA 3OEWA 4DRZA 2QRUA 4Y9DA 3KZIU 1M6EX 4D42A 1SIUA 1B0ZA 2G83A 3NH9A 1MORA 1YJXA 1QIJA 4NXZA 2TRSB 3U9TA 1TF5A 4D6PA 1C80A 4EARA 1WCYA 4NLLA 3SFTA 3W6ZA 4LF7B 4DFKA 4LNAA 4I9FA 3IG8A 3RABA 2IY8A 2ZULA 1Z8HA 5CDUA 1F7UA 4EQ6A 1NN0A 1C8BA 1DUIA 1OA1A 3WX0A 3I0ZA 1M10A 5K4HA 4Y9RA 4P2HA 2JHGA 4XDZA 3AU6A 1TMYA 5FB3A 2PMWB 1V26A 1V3UA 4OB7A 2TMYA 3LIIA 4H77A 2R11A 2MT9A 4XGIA 2FRDC 1DO0A 3KOWA 2Z9DA 4WZBA 2CUTA 1RYYA 5CB8A 2VZEA 1RPNA 3TQRA 5C5EA 4GLLA 1NVBA 2GEKA 1PUXA 5IP5A 1K5OA 2C84A 1I3CA 3PHCA 3QVWA 3IMKA 2D7JA 3E18A 4YMUA 1KOLA 2BM0A 2HTFA 3ZDRA 5C18A 4BNLA 3SK0A 3GHHA 4Q9DA 3VDQA 5IIMA 1Q1QA 5DGBA 3WO0A 4K9KA 2P9HA 2VAVA 2H5LA 5HM8A 1TEZA 4WTOA 1RR6A 3RIGA 1DQYA 5I51A 4HB2A 1WDMA 4D26A 2FW8A 4O3PA 3HKCA 1N9GB 4B83A 1E7RA 3KTQA 3ZIAA 4P0PA 3USCS 1VGVA 5AK3A 2J7PA 3SEQA 3O0DA 2NU6A 3E58A 1Z37A 5KYWB 3OX3A 3TIFA 3KS9A 4BVLA 2Y67A 2R18A 2QD3A 4K9RA 4GI7A 2HDHA 1JIUA 1ISRA 1DBSA 1KVRA 3T61A 4BFLA 1XRRA 5MHTA 4IIUA 3G5UA 1JILA 3AMVA 1WHTB 4YRAA 3FCEA 3M33A 5DT9A 2J31A 3GGCA 5A0TA 2EKQA 4Y67A 4RPJA 3NC0C 4UOQA 4NE9A 4B9EA 2VZ9A 2PANA 3RB8A 3FYUB 2W4QA 3ERCA 3KFUF 2Y93A 4HFMA 3A14A 4F4UA 3LQ1A 3I2FA 5K3OA 3O8LA 1DTEA 3E0QA 5DI3A 3SS9X 2WPDD 4J8PA 1M67A 4HGYA 5J0SA 3HKZC 3IKJA 4CEHA 2Z6UA 3GG2A 4NLCA 3PC2A 4NI5A 4K0RA 3CEJA 4BV3A 3BB3A 4IYRA 4ZI7F 3PXCX 2VYVA 2COKA 1E64A 3ISTA 4WJZA 4AS1A 4UE3S 3GFSA 3IUQA 3Q15C 3Q8LA 4QZAA 4JR1A 4L8FA 5GADl 1TAMA 4QEZA 3W9YA 3U7RA 3GI1A 2QROA 4IHJA 2QZJA 3D7KA 1JR3A 4B0OA 3K5HA 3VZCA 4YS6A 4PO1A 2HYIC 4OXYA 2AR7A 3LUHA 2XCAA 3GAZA 1UIRA 2WEKA 4R8RA 5B1DA 5ESWA 2QZSA 3IHWA 4Q4DA 1FDRA 4TVBA 1N92A 4ACOA 3VUFA 1EEXB 4E14A 1G2PA 2PZFA 2XW6A 3MBIA 1YASA 3S70A 1S5PA 4GT1A 3O4JA 4EMTA 3RFAA 4OUDB 3EJWA 4LYEA 2IU6A 4NQRA 2JPDA 4FFOA 5GIOE 2PUAA 4KPYA 3CZ5A 5ALTA 2KP7A 2EWMA 3G5LA 3K94A 3VMFA 5I45A 3U4QA 3PJGA 4CL0A 1GTJ1 2H8KA 4UM7A 1QQ7A 2JAUA 3R8FA 2VLIA 5KOJA 4XQ9A 3A3YA 5AMXA 4UTXA 2IYAA 4ZZIA 5KG4A 1RZUA 1NVKA 3WY9A 4QGSA 4P3NA 3CVYA 4JJ7A 3KUCA 1MG0A 4NMHA 4MS4B 2JJMA 3ESBA 3M9LA 2JLUA 4TOIA 1B93A 3THWB 1J42A 2I2FA 3P2JA 2FQ1A 1T1IA 2VFAA 4YD1A 5BW6B 3LWNA 3NFRA 1X7ZA 1I0LA 3G6VA 2EF1A 3M7DA 1NUTA 3I12A 4IKOA 4TYYA 1SBNE 4JL5A 4ZMBA 3F2CA 1K4YA 1D1TA 1TADA 1RM3A 4Z9XA 4MYSA 3S2ZA 5B3JA 4L8YA 1SU6A 3O74A 2IU0A 3IXMA 1I3MA 4AK9A 1IWPB 3IUSA 3GLGB 1KI6A 2ETXA 4GGPA 3NHKA 1NUSA 2QN2A 1JWAB 3V7UA 4JVSB 1IUPA 1Z9BA 3EW7A 1AO0A 1U3CA 3PUZA 2OYRA 1Z00B 3QLEA 4XVCA 4LZWA 1W34A 2E2WA 1RJGA 1BTOA 4MCAA 2AQIA 5IT9A 1WZEA 4DS5A 2X1VA 4KQ1A 5JS8A 3U19A 1OFHA 2BZSA 4JSRA 3RUAA 3TSCA 2FWNA 2ZAIA 8ICYA 4UHHA 2VRCD 2G3YA 3O4RA 3EVTA 1AK2A 1UDRA 1XLTC 5IBPA 4H15A 1WS6A 1QJ4A 4TROA 4KO2S 4ASUD 3LBNA 2VF5X 2POQX 3NVKI 4ZJYA 3RU9A 1CEQA 1OILA 4LGCA 3QUCA 4UOZA 1WTAA 4WCVA 2ZYSA 5BN4B 4JX9A 2EH9A 1K6JA 4C2BA 1Z5GA 2YXEA 1JXOA 2X1LA 1T15A 4R31A 4PLWA 3LRPA 3K09A 2QE6A 5AHXA 3TNJA 4RKWA 3V2UA 4QSHA 4YJ3A 3L7DA 1RRGA 1G8GA 1TKBA 4UBKA 1EH5A 1OGYA 2F77X 4EKNB 3MD0A 4J9SA 2QN9A 4B9SA 3A3PA 4MAFA 3DR3A 3NRWA 3Q8QB 3UK6A 1ZGCA 4RY2A 2OV4A 4ND1A 2XIDA 3RE1A 2AXTU 4RU9A 4IVPA 5FD8A 1FUIA 2FUEA 1BNOA 4WJ3B 3RS2A 4L5AA 5K05A 1XQ9A 3ILHA 1FSPA 4FS2A 1NN5A 4L7VA 5B37A 4PXAA 1KBQA 4C4ZA 4R2IA 3GH3A 5F76A 2AVDA 1Y8QB 3W5UA 3K31A 2ZBQA 1GO2A 1G17A 4JA0A 4M7WA 4IF6A 4PZPA 3R76A 4YCJA 4NICA 4AXBA 4OHOA 2OCIA 4GXQA 3UANA 1L1EA 5EWEA 3A3KA 4AY6A 1LKZA 1W2WB 1AG9A 3S68A 6REQB 5KUTA 5I47A 3IBCA 5DP1A 4RS3A 4U6SA 2B61A 4ZI5A 4CV2A 5ITVA 1ESCA 2BGRA 2P2LA 4IIBA 3PO5A 1UOQA 3H13A 5J2TA 3GRZA 2XUOA 1YZUA 3VH3A 5L1MA 3K0KA 4JIMA 1BNPA 4PO9A 4GKBA 2BDUA 2E1RA 1I7LA 3BD9A 1A95A 4CF4A 1WB4A 4FDTA 1LDMA 3FIUA 1HEUA 2GZDA 2ZIUA 2WJAA 3K0AB 1DV1A 1KJYA 5JQWA 5C8YF 3RK4A 1G3RA 3Q8RB 8ICOA 4YAGA 1REQB 2MSEB 2PX6A 4EGFA 4ZRMA 1A2QA 4MAMA 1U9IA 1B1CA 4IGEA 2NP7A 2QJTA 3BGWA 4JB3A 1HSOA 2PWBA 4LC0A 5H70A 1ISPA 3E3NA 2B6HA 4J4TA 4MV9A 4RSMA 2I8LA 1JEQA 4YP1A 1T2AA 2AJTA 4KQFA 3S8MA 5FAKA 3OPQA 1VDMA 3QMWA 2FMPA 1PWXA 3AWIA 3PPYA 4A3SA 2J32A 2ZBPA 2GCEA 4HLUC 1ISIA 4I4NA 3VQTA 3MGGA 4ISCA 1ZQWA 2ZEJA 2J9FA 1N57A 1RM5A 4JLVA 3PNPA 3F97A 4XDGA 4XRRA 3NIDB 4WPGA 1IZ9A 1RHRA 3I8XA 4B81A 1U4NA 4IXWA 5KFOA 1I1NA 1OZAA 2Z8XA 5IABA 3PX2A 1V9LA 1AB6A 4HAIA 4QRIA 2CNWA 3ANMA 2CSXA 4OM8A 1PZXA 1XU4A 4JYBA 1YB4A 1XZIA 1F2TB 2O2XA 1FMTA 4OFZA 3RNLA 3TGWA 3GGJA 4G01B 5M04A 3QV1A 5FLKA 5FNVB 4ZD6A 4P84A 2UXDB 3HM9A 4NTZA 5L3SA 1FUYB 3IAFA 2JJ1D 2BR0A 1JPUA 4PR3A 3R6DA 3DKVA 3L7KA 3SZ3A 2YFYA 2ESEA 1Q17A 1L1RA 3QU7A 1FS4A 3V33A 3OWHA 2Z7JA 5HF8A 1UWVA 5JXHA 1D6SA 2FNAA 1J97A 1U31A 1RMTA 3A4NA 3PHHA 2RONA 4ERXA 4XIIA 2A59A 1JXQA 3A1FA 4C4OA 3FA2A 4QVIA 4QJIA 2YTZA 4LJ9A 1KYQA 3VJLA 1WV1A 1PJSA 3ZHBA 1SXJB 4QT0A 3SF8B 3IP1A 3CKYA 1QU2A 2AU0A 4IFBA 4BTEA 3LYSA 3EPHA 1WCWA 2ZB8A 1NXTA 2K8CB 8OHMA 1Q22A 1TA4A 4WL0A 3TFOA 2GEUA 3DD5A 2KNJA 2D1SA 4DT1A 3RJKA 3LZDA 1BE6A 3AILA 4WFKA 3PGXA 2PDAA 3NDIA 3PRHA 4AX4A 4V0NA 1YBMA 1A9SA 4Y2TA 3AR5A 3KOUA 4EBEA 1E6EA 1NVVQ 2QN6A 2ZUEA 4EW6A 2GVZC 1H1TA 2GOLA 3OE7A 1II0A 1RM4A 3CVOA 3VISA 2QTMA 2G0AA 5J4LA 1P75A 4PSAA 1UMCB 4UNRA 1U8AA 4OB6A 1MTZA 3PNQA 3WADA 4YN3A 4FKMA 2V58A 3MGAA 1EX6A 4N6OA 1DT3A 2K2QB 1DKMA 3OFND 2Y0BA 5KOHB 4ZOCA 5IIOA 3KB8A 4I4TF 1NRXA 4KLQA 3GLGE 2O23A 1SVMA 2Y1DA 4DSUA 2HWYA 3WE7A 4JKOA 2G6TA 4OGWA 3MNFA 4P4OA 1PZMA 5BQPA 3UUEA 1U9YA 1FP4A 4DXDA 4PAOA 2YOHA 4QEDA 1SHTX 4XB2A 1L3TA 4UNPA 2LPEA 3QM1A 1Q11A 3HKDA 2YL2A 1TKCA 3CVVA 1CDDA 2EIHA 4I7EA 2D2VA 3G0DA 1GEGA 3PDUA 1XD9A 3BTVA 3V6JA 1DEAA 3ILXA 1CUIA 1Y9EA 1MB9A 3G9UA 4TSRA 1Y5RA 4J7XA 3ZQ6A 6PFKA 4UW9A 5EWGA 4QL3A 1QDEA 2RH8A 4Z4GA 2EEZA 3KK0A 2IEBA 5E3JA 2IUSA 1IJKA 5T4FA 1Q3HA 9LDBA 3KHHA 5ALRA 5FI3A 3TTXA 3K96A 5J5CA 1SVWA 3A3OA 3JARA 1F17A 1WSAA 1NNLA 5F7XA 2FA9A 4Q4HA 3ZZNA 4G5OA 3GVXA 4PLZA 2IUEA 2NOAA 1KI3A 3JY6A 3LQYA 4DDUA 2OXCA 3A0BU 1E0KA 5EJIA 2SHKA 2Q5IA 2JFNA 2ILTA 1UKEA 3MLAA 4BMNA 4YASA 1QQ5A 1I1QB 4BMDA 4RK0A 3L6OO 3MWDA 1CRQA 3JD1A 5AI8A 5CLQA 2D00A 1NUHA 2R6GA 2ZJAA 3FAHA 1C7JA 3B51X 4AJ2A 1EFRD 3IBGA 1ZI6A 3LUJA 2XYQA 3L6UA 4HEJA 3CZMA 4URVR 4GUDA 2CLLB 4CKCA 4QXMA 5IFLA 1EFAA 3NG1A 5EP4A 2WVJA 4A2QA 3SVZA 2E49A 3R7NA 2DTDA 3E8XA 3VC1A 1S02A 3NM5A 1WUTA 2E1FA 1ZM4A 5DCUA 3SYRA 4B73A 4ZV4A 1DAOA 5BWNA 1T35A 4EJMA 1RP1A 5GP1A 2LGJA 7ICMA 4BNVA 2BKVA 2VDOB 4QIHA 1KXJA 5KNCD 2B0JA 5DX1A 1RHUA 1S0NA 5KFBA 2BFAA 4CGZA 1OI7A 4RY8A 3T3IA 2A9QA 3TZCA 1GTL1 3CMMA 2PUEA 4N0QA 4K0KB 4UOEA 4XYMA 2XE4A 3MPOA 4P80A 3T1HB 1XU7A 4GP7A 2IS4A 3IGFA 5IJ0B 4GL2A 1GNQA 2H08A 1ZUIA 5DHUA 2JIZA 1FX0B 1Y9AA 5JZMA 1GQFA 1TTTA 5I7HA 4XX0A 2N9UA 3L18A 2IYVA 2AMFA 3D7RA 1IUOA 3EASA 2OORC 4IM7A 4YT8A 2XGGA 9ICGA 1V3VA 2C20A 4CN8A 1KTVA 2Z2IA 1XXHB 1FFXB 3S5JA 2QX6A 3TOSA 4HADA 5A9TA 2WB2A 3D7LA 1TQ6A 5AOAA 3TL3A 4NX2A 4TWZA 4YCNA 2I65A 2YWXA 5JEEA 3U3RA 4LZPA 2IYXA 2YV5A 4PZOA 5FFNA 5E6SA 3H5WA 3WMFA 4TKVB 3L0YA 3GJ8A 2OK7A 2VF4X 3KE8A 5FI0B 4HVAA 4WUTA 3HV0A 2IH4A 4OFWA 2YXPX 4WLOA 1LGYA 4EPXA 5DNDA 1L7VC 2R5WA 4E4RA 4MYCA 3EG9B 5C8YA 4DSNA 4ECZA 1QORA 1M6NA 1N62A 1VCMA 3QVGA 1WNTA 4D4JA 3EFEA 2KV2A 1D0VA 5H3HA 2M6KA 1WWUA 3H5AA 1QVVA 2XGOA 3WICA 1NQUA 8ADHA 2F8KA 1CP2A 5GPBA 1DGQA 4PHTA 3ZHRA 2ZI7A 1TM3E 1Y1LA 5FUMA 3ENKA 1PDOA 2WAXA 2HIMA 4M0MA 5BR8B 1GL6A 3EXEB 1FFSA 3WK8A 4WOJA 2XWQA 1QH0A 4LGYA 4UHDA 1TCBA 3S2FA 2HMUA 4HS9A 1OBVA 3QNWA 1MW8X 1VJGA 2NO4A 2PYIA 4DR5B 4BKOA 3B70A 4RDIA 3IRVA 2VUHB 1LVHA 5I3ZA 3CNLA 1Y8RB 2K8AA 4MHVA 1SXJE 4IDEA 5B12A 2QIPA 3WGKA 4M0AA 1P5ZB 3FUVA 3M49A 3ZDBA 5HG0A 4JUDX 3FMFA 2PS0A 3RF9A 3ORFA 3RJTA 1S10A 5E95A 3HEMA 1P9WA 2YUIA 3DMRA 4X84A 2A6PA 3HEBA 1VIDA 1PVDA 4FOTA 3QOYA 1KERA 1Z6XA 3L7JA 4YYEA 1BCSB 1G5PA 4FNAA 2AX3A 3STVA 4NPHA 3LO5A 2Y1LA 2NZWA 4ARCA 5KG3A 4R7ZA 3BRSA 4K9PA 4D5GA 2OBMA 5CXSA 2YJ4A 3ICXA 1IY1A 4B17A 3RSSA 5KL8B 1QFSA 5U9CA 3ZD6A 4DCTA 1ZQQA 2HY7A 3M6XA 1X92A 4D56A 4PZAA 2VRNA 3VRHA 4HDMB 3DJFA 2P1RA 1TK0A 3RTEA 4IQUA 3PCXA 3CIOA 4FI3C 5EXXA 2VH2A 1HLDA 4QBGB 4D0RA 1RYHA 2HF7A 3HGMA 5MF6A 3JPSA 1OKKA 4TXJA 4EUHA 1KO5A 4MINA 1A6SA 2Q21A 3NBMA 3HR7A 4N0DA 1ISMA 3NDBB 2YWHA 1XRLA 4UU1A 2JGEA 2E3TA 2ACEA 4MGEA 4ZOHC 1WF3A 2P3QA 2E87A 2RKOA 1IEWA 2C7PA 2DLDA 2QRNA 1FDIA 3NAGA 1YB2A 4DL6A 3H7AA 4LHVA 2H3QA 4J7AA 1BFDA 2WWHA 4B48A 3VDMA 2VDWB 1QR6A 1XMPA 4IDOA 3E9RA 3K8QA 2VZ0A 2AL7A 1ENYA 3PCRB 3UJ9A 3T7JA 1VGQA 4EHHA 2MA1A 3D6FA 5EIFA 5KFAA 2ZSHA 4BAZA 3WLJA 2J9ZB 3PWTA 1ZUD1 4XEUA 1DSSG 3W8NA 5TQJA 3E6AA 2X40A 5FOXA 5AKKA 4C8OA 1J0CA 3IDFA 4RWZA 3CB2A 4UUBA 1MJHA 3MHPA 3KXDA 3QG1A 3ZVMA 4X3CA 1A7AA 4Q9LA 1IPFA 4RV9A 3I04A 3IUNA 5KDOA 4P0TA 4ZA2A 2IYEA 2VPQA 3QEJA 2RAFA 5JS7A 4HCJA 5F9HA 4QNLA 3HW8A 4KB5A 4P81A 3PSTA 4DZZA 1PL0A 3G7NA 5KJ6A 3L82B 4BE4A 4TWJA 1A5BB 3H1BA 1JFSA 1NBIA 4YRDA 4UARA 4PBTA 3GEBA 3HSYA 5ESRA 4ETMA 4F5ZA 2XNCA 2HRZA 4QZ9A 1NG1A 2OHJA 4B32A 1B14A 1N2XA 3UQZA 2GDZA 1WU8A 5I7EA 4RS4A 2RG7A 1IN6A 1QZTA 4CM5A 2OHGA 1PQ4A 1HORA 1KMNA 5J1TB 4KN4A 3CT4A 2NO1A 5TX7A 4G07A 2Q2WA 2ZTHA 3B9JA 1GNPA 1I3OA 4QUEA 1ZK2A 4WCFB 4DLYA 2XCQA 2XEXA 5GZ3A 2WJGA 1B6RA 3IJEB 3FLBA 4CM8B 4IVRA 5I01A 1POWA 3ID6C 3WAKA 2IYLD 3HA3A 4XJTA 3GEEA 1DBIA 5LLTA 3N86A 2DR0A 3F7TA 4MRSA 5JLAA 3MZ0A 4AECA 2QTVB 2OCEA 2MMGA 2K4MA 2OCAA 1NR5A 2RJOA 4AI6A 2UVUA 2VTDA 4TL7A 1MJNA 3H2KA 3IQWA 1OZ0A 2BFDB 3SC2A 3A0UA 1KJJA 3C70A 3PBKA 5KAPA 1JV2B 3IS3A 3T5GA 1KEWA 4EA6A 1ORIA 3PQ3A 4EATA 3N8HA 4TMFA 4LOJA 1H6DA 4EENA 2QENA 4U2KA 1G8AA 4XJVA 3O9MA 1GU7A 1FFGA 1MP0A 5KQPA 4NS4A 5C7LO 3OJ0A 3V46A 3K71B 4P98A 3HB9A 5HW0A 5LZ8A 1MOSA 4ILEA 1QLNA 3QKTA 2FN3A 2J0SA 3DE6X 3KHKA 1E9VA 1U02A 5EE3A 3NGDA 3FLMA 5CLLA 4CHGA 1LB2B 4JD5A 3B5IA 3KLBA 2G08A 1LLQA 3FVWA 4RE6A 2IJGX 1YS4A 1QGUB 2JS7A 2Y76A 1LS6A 1J8FA 7ICOA 1A5ZA 2XKJE 2P2SA 3I34X 1JDBB 1ZQOA 3B3QA 5DISB 2BHNA 2DFTA 4Q9NA 1VA4A 2FPRA 1B73A 2A4KA 3EQ7A 3GDGA 1NX6A 4J2HA 3PF8A 1IMOA 3UGKA 4KFTA 1Q8KA 2GK7A 4C8KA 3NJRA 4NOJA 2W6NA 4F4HA 5C5CA 3TW4A 3DMFA 1VBNA 2N47A 4M1WA 3SPXA 1NFQA 4ZO4A 4AUNA 5AYVA 3TLKA 4Q1VA 2Q9CA 1NATA 1ZRSA 2COUA 1UFKA 2QMOA 3IKLA 4I2CA 4GD3Q 3ZEAA 4FZVA 3WL3A 4F38A 4PNEA 4R54A 3EIUA 2XE7A 2PX2A 3E7FA 5BXYA 5FP0A 4MEYA 4NXNB 1CX9B 1LJLA 1O97C 4I6JA 4GSLA 3EISA 4MVJM 2Z2ZA 4NZZA 2H6EA 3CZQA 3CZPA 1ODIA 4ZRNA 5J2IA 4U63A 1L5GB 3AB7A 1SZDA 2XMSA 3QE3A 3HO8A 4EY4A 1BYUA 1CF9A 1PGQA 3HCFA 3OU6A 3FI0A 1JBQA 4C7VA 4W5QA 3KJHA 3ZQJA 1M2VB 2ZE7A 4DOBA 3DFIA 1Y9ZA 4P2BA 2H3ZA 4YAIA 1C8VB 1XLUA 3RSGA 2WK1A 4BLVA 2DGZA 2WV7A 4K6OA 1E9CA 3QUBA 4MYRA 2W6IA 2BGJA 1VPWA 4CQJA 4RUCA 3IQDB 1KE1A 1I4OA 3RGWS 2HLDD 3A1WA 1Z7WA 4MI3A 3UC5A 3FUWA 2AG1A 4ZICA 3AONB 2HF9A 3R40A 3MK31 3DDHA 1CBUA 3ZDYB 2PCJA 3QELB 3LW8A 3I72A 3M4NA 2W7TA 3TB4A 3WBBA 1HT0A 1QTMA 4JI7B 4ZI3A 1KEEA 4P1ZA 4ARIA 4MITA 2C5GA 1FP6A 1YKFA 4G81A 2QOEA 1C30A 1ML4A 2IIBA 4RKFA 4GWKA 3G23A 1JX6A 4X1YB 3QXGA 1GZVA 4G1MB 1U7WA 1FYVA 3O4HA 1OU4A 1A9XA 1RC8A 4X64B 4UULA 1E2HA 2C94A 1R9GA 4DOCA 3FTQA 1KZ7B 3L5OA 2QMQA 1NIJA 2HHHB 1E9EA 4ZHSA 2BW0A 1AHHA 1K8RA 4YVZA 4PHGA 1TUBB 3GT0A 5DGTA 1W1UA 5JWHA 2PFGA 2ENUA 3W78A 2CT8A 3LWMA 4JODA 3I28A 2EJWA 4GH5A 3DDWA 4M0CA 3GLSA 5C1BA 4P4PA 1ZCZA 3KYCA 3PFIA 2QR5A 3DGFC 1MGPA 2IX3A 2XIQA 1G9XA 3LVFO 2ZUSA 4ZVRA 4F46A 2EJTA 3GLRA 4YT2A 4YJ2A 4PLFA 3A2MA 3NATA 1YH3A 2DJIA 1NC1A 2QGZA 3VZQA 5KFZA 1RPTA 3QU5A 4RFSB 2Q0QA 3P9SA 4AZVA 4UHCA 4K4HA 3EGDA 2M98A 3H6GA 2H59A 1XZBA 4GNRA 1PZGA 5KWEA 1YF3A 1ADBA 3WBJA 4G1UC 1JF8A 1RZRD 3GPDG