3QX7A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron complexed with phosphate, a closed cap conformation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
224
structure length
224
Chain Sequence
HMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 81
structure length 224
sequence length 224
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qx7A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qx7A01
2YMPA 2FUEA 2AH5A 3P96A 3QUQA 1Z4JA 3IRUA 2G80A 3I28A 3L0YA 5ALIA 1NF2A 2BY4A 3AR3A 2YMLA 3E84A 3ZUPA 1XPJA 1U7PA 3ESQA 2B1RA 3WK8A 2YJ6A 3WKEA 4EELA 4UU0A 4BKMA 3MC1A 4CF3A 3E58A 4I9FA 3DDHA 3N5KA 2P27A 5AVTA 5JJBA 2MU2A 1LTQA 2YFYA 2R8ZA 2EATA 2B8EA 1T5TA 4BNDB 5AM1A 3PDWA 3PGLA 3PGVA 4JB3A 4EX7A 2EARA 4YIKA 2ZOSA 3ZVLA 2IOFA 5AW5A 1TE2A 4HGPA 4OHFA 3QUBA 1U7OA 1YNSA 1S8OA 3FZQA 3M1YA 5AM2A 4BEVA 5AKJA 1RLTA 4F71A 5AVVA 1T5SA 3EWIA 1N8NA 2MU1A 4UM7A 3R09A 2FI1A 5ALDA 1ZRNA 1YJ5A 1L7NA 4UATA 2G0AA 4L6AA 1Z5GA 5ALYA 2W43A 4KNWA 3ZTYA 1RDFA 1QQ5A 3UMBA 2JGAA 3L5KA 3WGVA 3F9RA 4KN8A 3DV9A 3L8FA 1CQZA 3QU5A 3WK4A 3ET5A 3L8EA 3U7GA 4QJBA 1L8LA 4BX0A 4G9BA 2R8EA 3WKBA 3L8GA 5ALRA 1TJ4A 2HF2A 4ZEWA 2YN4A 2EAUA 1RMYA 3NRJA 5AM0A 3NIWA 4YIHA 3NALA 4EX6A 3WKDA 4F72A 4NABA 5AI4A 5AM4A 4BYGA 5AK3A 3WK9A 1CR6A 3I1YA 5IS2A 2GFHA 4DW8A 3K1ZA 1PW5A 5AK6A 2B0CA 3QU9A 3MPOA 3B9BA 5AKGA 3NASA 4J2TA 5AHXA 2FPSA 2Q4TA 4ZEVA 2PQ0A 1Z4KA 3FM9A 3TLMA 2JAOA 5AI5A 3QU7A 3MN1A 4Y3UA 3R4CA 4G63A 3IJ5A 4HGQA 5ALZA 2FDRA 2G1AA 3FPBA 3MMZA 3ZU6A 5AW4A 4RESA 3HYCA 1JUDA 3SF0A 3FGOA 2Q5EA 2PR7A 3OCZA 2P11A 4B6JA 4Y2SA 3N1UA 3SLRA 4H1WA 5A3SA 1XVIA 1QYIA 3BWVA 4OD0A 4UASA 1Y8AA 4GXTA 2HDOA 3QX7A 2BDEA 1YDFA 5AKXA 5AW2A 3PCTA 5ALXA 1TJ5A 1RKQA 4Y2UA 3OPXA 5AI6A 1WZCA 5IT0A 1QQ7A 5ALUA 3OCYA 4YH1A 1ZD4A 1J8DA 2DQSA 3QYPA 5ALQA 2HO4A 2CFTA 1ZS9A 4QQFA 5AW6A 2YMQA 2YBDA 3D6JA 5AICA 3QXGA 3SMVA 4EZEA 4UARA 1F5SA 3VAYA 4YGYA 1RMQA 3KBBA 3ZWDA 4BEWA 3RF6A 4XE5A 5AW7A 2HI0A 2FPUA 1L7PA 3W5DA 2GO7A 2WF6A 1L8OA 2AUTA 2WFAA 3R9KA 4KYTA 4CNQA 4XPZA 2Q4RA 4L57A 1ZD3A 2YJ5A 2VKQA 3EPRA 2FEAA 1Z4MA 4FFDA 1RLOA 3QU2A 3OCWA 3U7FB 4NFLA 3GYGA 1ZD2P 3BA6A 3QNMA 5AVZA 5E0OA 4Y2YA 2RB5A 4CF5A 4Y2TA 5AM5A 4UAUA 4UW9A 5AW1A 1U2SA 3B9RA 3L0CA 3OCVA 5ALOA 5AK4A 5ALJA 3CZ4A 1Q91A 2OA0A 1XP5A 2NO5A 2P9JA 4XOUA 4ZEXA 3KC2A 3KZXA 5AVQA 3U7EB 1RKVA 1Z4QA 2AMYA 4Y2XA 2G07A 5ALEA 3NUQA 3SKXA 4IFTA 1RQLA 1Z4OA 3N8GA 4DWOA 4AS2A 3L0BA 5ALVA 3L7YA 2W4MA 1YMQA 2CN1A 3AR8A 5AM3A 2YY6A 1Z4IA 2IYEA 2JAWA 5AKKA 5AVYA 3W5AA 2W11A 2C9MA 4MUMA 4Y2VA 3A3YA 4RETA 2YMMA 3WKCA 1NRWA 3ZX5A 1TA0A 4HYTA 1WPGA 2ZXEA 2JARA 2B82A 1RC8A 2P69A 3I76A 1WR8A 5ALFA 3ZW7A 5AIAA 4YCMA 2G08A 2X4DA 2FPRA 3N07A 2O2XA 5AVUA 2G09A 1T9ZA 2WF7A 5AIBA 3OTQA 3NANA 1ZD5A 1TJ3A 3E8MA 2QLTA 4DFDA 2HHLA 4UMVA 1RPZA 2YJ4A 2I33A 1Z4LA 5AW8A 2JAUA 4HGOA 2HCFA 5AVRA 1S2OA 3EF1A 4HGNA 3ET4A 3ZTWA 2I34A 2O9JA 5ALNA 2B1QA 3B8EA 2WF8A 4UMDA 1VJ5A 2GMWA 2FUCA 3WK7A 1RMTA 5A3QA 5ALTA 3ZI4A 1U02A 1L7OA 1RLMA 3L1UA 2ZBDA 3ZVMA 3ZVNA 5AI8A 4EENA 4EEKA 3W5CA 3QU4A 3KOOA 2MSNA 4OCZA 1IWOA 3L8HA 1ZRMA 2RBKA 2HEGA 3ESRA 3I6BA 1VJRA 5A3RA 1SWWA 3AR5A 1X42A 1LVHA 5T41A 3WK5A 2B8JA 4Y2PA 5AKHA 5AKLA 4UM5A 5AI9A 3A1CA 1AQ6A 5ALMA 3S6JA 3E81A 3AR4A 2R8YA 5ALHA 5ALWA 3WGUA 2CFRA 2OYCA 1SU4A 2IA5A 5AVSA 2WF9A 3DAOA 1ZOLA 1N9KA 2NO4A 3KD3A 4L6CA 4KX3A 3HLTA 4AS3A 3QUTA 1L7MA 1K1EA 1ZJJA 4BX3A 5AKEA 2OM6A 2R8XA 2ODAA 4BNDA 4KNVA 2ZBFA 3FPSA 1O03A 1WVIA 4MWOA 2OBBA 2GHTA 5IT4A 2IOFK 5AKYA 5ALSA 5AW3A 4E88A 2WHEA 1J97A 4YCNA 3WKAA 3RFUA 4IG4A 3QLEA 5ALKA 2PKEA 1RQNA 3OCXA 2I54A 3U7HB 4UU1A 3UM9A 5AVWA 3SD7A 4FE3A 5FP0A 3UMCA 1Z88A 3WK6A 3AR9A 3ED5A 3FVVA 3AR6A 4GIBA 4Y2JA 2YJ3A 1MH9A 1QH9A 3OCUA 4JDPA 4Y2RA 4KX5A 2NYVA 3U26A 1EK2A 3ZWKA 1FEZA 4BX2A 4Y2QA 2HOQA 5AKZA 3L1VA 4NAVA 3ONNA 4FYPA 5AW9A 1O08A 2C8LA 3U13A 4CE6A 4HGRA 1Q92A 3U19A 2I6XA 1YS9A 2WF5A 5AVXA 1RKUA 2HX1A 3M9LA 2ZBEA 4CF4A 4PNHA 3A1DA 5AI0A 1SWVA 5AK5A 4XQ0A 2C4NA 2C8KA 2G06A 2C88A 3NAMA 1U2TA 1L6RA 5ALLA 4HAIA 1QQ6A 1VFPA 3AR7A 2RAVA 4UMFA 3SKYA 5AW0A 4DCCA 3QGMA 3J7TA 3W5BA 4AP9A 1YV9A 1RRCA 3DNPA 4C4RA 3ZX4A 1Z4PX 2I55A 4UAVA 2GHQA 2IOHA 2WM8A 1Z5UA 2CFSA 2QYHA 3UMGA 2BDUA 4UMEA 4C4TA 2I7DA 3QUCA 1NNLA 2B30A 1EK1A 2RARA 3SHQA 2ZBGA 2HF7A 4J03A 4NWIA 2FPWA 3CNHA 2ZG6A 2HSZA 5ALGA 4OFZA 2FPXA 4YCLA 3EF0A 3IB6A 5AESA 3KDPA 2D2VA 3AR2A 3N28A 4BBJA 5ALPA 4O8CA 4I9GA 2AGVA 1Z4NA 5AKIA 4C4SA 1KYTA 4NV0A 3A1EA
chains in the Genus database with same CATH superfamily
1SCNE 3P96A 4PTZA 5ITZB 1GV0A 2RHDA 1XN4A 1GGNA 3JRXA 3RK0A 5CLJA 2FMPA 4RQ6A 1V6CA 3EIWA 1YKFA 4G5OA 4D92A 1E4VA 4IBOA 5LMCA 4LF6B 2R79A 3L0YA 1XMVA 1ODJA 3AR3A 5A6SA 1QF7A 3G68A 4QOEA 4QOGA 2UV8A 1ZQ1C 2UUCB 2VPPA 1DFIA 4FZLA 3AERB 1OZFA 2CV2A 3O31A 1WV0A 4IFEA 3GCDA 4WBNF 3RUDA 5BWOA 4X54A 1O94C 3EGWA 4CM6A 2XGOA 3IKTA 3AMVA 1HV8A 3I9FA 2Y6VA 4BBAA 3KYCB 2V3WA 3AN1A 1A9OA 4NENA 2CXNA 3A6JA 3ZD6A 1P3DA 1I2AA 4I3GA 4QRDA 2BWJA 1M0EA 5C53B 1N2EA 2Y1JA 1OXSC 3I9V6 3GIJA 1BROA 2IS6A 3TRHA 1WLSA 3UJ9A 4G89A 1X1RA 1I7PA 3E05A 4JA0A 4HAOA 5BN4B 5JJBA 2DUYA 1ZCZA 3EDCA 4UVGA 2TMYA 4RD6A 3D2SA 3GIKA 4H6XA 3HA3A 3LQKA 4WCFB 1U7XA 3AONB 3WWZA 4ARSA 1NN0A 2P4HX 2QRZA 1ZIDA 4TKVA 3VJLA 4A2QA 2D5BA 4NLNA 3R2JA 2VRBA 3M9XA 4I8IA 1S9FA 2IDMA 3A0UA 3GRAA 1DUSA 2ETVA 3MT0A 1L4BA 4GOLD 2CXOA 1KO1A 5DX8A 1GRQA 2YRXA 1E4OA 4FOPA 2F1KA 2HF8A 4Z8XA 5FFFA 3X2EA 3S8MA 2HTFA 3COZA 3GGDA 5KC8A 4D79A 2DJ5A 1OI7A 5LQUA 1QO7A 2PFSA 5DSTA 5CRXA 5CP2A 4ECZA 3ECSA 4NDZA 1R15A 4MKGA 1VA4A 2F1HA 2UYYA 5JBNA 4UBNA 4BTEA 5KYYB 1Q57A 5DG7A 1XDZA 2FR1A 2IP2A 1AQYA 3NJ8A 4B2YA 4UATA 1U8CB 3L6RA 4WLVA 1Z5GA 4C4XA 1XMOB 1XSLA 1K86A 4JVLA 2C4VA 3G9ZA 4B7UA 2GKGA 1P0FA 5AOAA 5EPOA 3ACCA 4R98A 4I14A 2P6OA 5L4LA 1ZN8A 4MS1A 3ISCA 5J2DA 3TW6A 3L8FA 3WYBA 3QOFA 4AT1A 1I33A 1DZ3A 1FP1D 3C1AA 3KCNA 3IR5A 3IAM1 3O03A 2VAPA 4GOOD 4J43A 4KJXA 1SKAA 2OR3A 1UJNA 4JT9A 1TU4A 1YQGA 2FGKA 5K0TA 4G9BA 3AFGA 2KBFA 3R5HA 1MGPA 4JXZA 3K5WA 1DZIA 2Q2VA 2PBFA 4H7KA 4DSZA 4F12A 4TQSA 4R68A 3K5HA 2TYSB 4G9EA 2V7PA 1UBUS 1YR6A 2J3DA 1J2TA 2ISOA 2W2MA 3DM9B 4LDQA 4J9NA 3SR4A 4C0HA 3C3PA 2D3TA 5E3JA 4BLRA 3RF9A 2FMSA 2KJ5A 2C20A 4RTQA 1LLQA 2YS6A 3IULA 4LZWA 3B60A 3T06B 4F3RA 3QVMA 3UT5B 5KL1B 4KFCA 1CULC 1V9LA 4ERNA 1R4NA 3O8OB 5IS2A 3K75D 4B4KA 1S3IA 1ZUHA 3UWMA 4ZJYA 4YP9A 2KHQA 1IDN1 3QF7A 1YVPA 2ZSBA 4B4OA 3OY2A 1SBYA 5J5CA 1EX9A 3HKCA 4MKRA 3OOSA 4XUGB 2OHVA 4RHXA 4EUFA 4QUDA 1KS2A 3DUWA 4QIHA 4RTJA 3KZ1E 4BFXA 1YS2X 3HJTA 2K4EA 2VJ5A 4RVHA 2AGPA 4RKFA 2J3JA 4LOIA 4WXEA 4I9NA 4BU0A 3R75A 1KY2A 1Q11A 4CR8A 4OQXA 3GDHA 3QNWA 1RP7A 1WMSA 3BJZA 9ICBA 2Y71A 4IIVA 1K6JA 3CEAA 4L5AA 2X9NA 4OEHA 4ZC8A 5JDCA 2UZ4A 5F76A 1VSTA 3I52A 5EIOA 1H5QA 1P9RA 2KHZA 1X3SA 4U6QA 2DHQA 3N1UA 5LP6A 2GAFA 5DH9A 3VXKA 5EHXA 4IZHA 5A4DA 1HNXB 1UQUA 1E6KA 1XVIA 2HCRA 1PJ3A 2GCIA 2VK4A 3EZ7A 3WZ2A 4D8XA 3AKZA 7ICEA 4DQIA 3HPRA 3ICCA 2RHFA 3L77A 3PUWA 4GXQA 4RZUA 4ELUA 5AKXA 3W6UA 3D3WA 4Z8YA 4PHHA 2BRUC 1WXEA 4KNYA 4EAQA 3AB8A 1AKNA 1NL3A 2GM5A 2J0UB 1RWBA 2X41A 1GPWB 1PNQA 4IDEA 4MS3B 2VJDA 3WJ1A 8ICAA 4WEOA 4MVXA 1QC5B 3OCYA 4TL6A 3X1XA 5CT4A 3VPFA 1ILEA 3R0JA 2E8MA 2BDPA 2IRWA 3H8VA 2P5YA 5EXPA 1KAHA 1BPDA 2GASA 3IJEB 2AQ0A 2J08A 2Z30A 3EQ6A 5ER9A 5BSWA 5HTOA 5KKCA 3SZRA 5JATA 1PVVA 3CH5A 4WBNB 4IV5A 3Q6IA 4JP2A 3GLGA 2P9GA 3VAYA 5F9LA 4EBDA 2R6R1 4WZBB 1F6BA 4B79A 3VR0A 1TVAA 4CWAA 1KDPA 1KPIA 3LQ1A 4P4LA 4AUKA 5EKSA 3TPFA 4WMLA 4QDTA 4I6JA 3T7DA 4D9GA 1AMOA 3IDOA 5JRJA 1RIIA 3G2NA 1DAKA 4NU6A 5C8YA 4LXUA 3G7SA 2Q62A 3KU4A 2QJTA 1POWA 1H38A 1AU9A 3WB0A 4KWEA 4GLBA 5JAIA 4HYEA 4MW7A 3S81A 2C59A 2BP7B 1L4KA 1V11A 3QP9A 3GLHA 3HNPA 2QSYA 4NYIQ 4O29A 2R1TB 3W6PA 3HU5A 3H2ZA 4RE5A 4B7XA 5M7EA 1B73A 3CRW1 7GPBA 1BYUA 4IOKA 3RTCA 1ORHA 4HDSA 1KSJA 1NF8A 3GYGA 4FR2A 1PV4A 1KMHA 1VPEA 3JATA 2R6HA 4HNQA 1GCOA 3C3AA 2HJHA 1QCYA 2ZPAA 3MYRA 3RJKA 1JSLA 4L5BA 2KN7A 4JWTA 4OQZA 3T9FA 4D41A 3TZLA 2W2NA 2R7MA 2PK3A 3I2GA 5KCZA 3QW2A 4OSOA 4TXJA 4ZOHC 3CWCA 4DBVO 1ONSA 1SUSA 4YV1A 4TWIA 4D57A 3GIMA 1SCKA 1TT7A 2IOQA 3AB3A 4L78A 5ISMA 4RTMA 1Y8QA 1R16A 3O83A 3R9XB 1B00A 2LZ0A 4O4HA 2MJLA 2BGMA 2X77A 4GGMX 2WNSA 1MMFB 3LP5A 3OMLA 4PLZA 4CKBB 1JLSA 1E2UA 5F5NA 2QX8A 3ZWAA 4CQNA 1XCLA 3FWHA 3TG8A 1EIWA 3IVRA 3G2JA 2P2YA 4G5SA 3A1UA 1E5DA 3T1VA 1A72A 1TKAA 1XF9A 5LYJB 1JNXX 3AUYA 4RFSB 3QHQA 5FOUA 4PYJA 2QN7A 3RVJA 4AYWA 4CTKA 3L6EA 3ZDAA 2ZJ4A 1JLMA 1Y6FA 1H2YA 4R2JA 1ZM4A 4CM9A 1DCKA 1GP2A 2FP4B 2HA2A 1X15A 3EPJA 4B84A 1HG0A 1Z4IA 1OI2A 1MDBA 4QC2A 5LD2B 4DC0A 1EBBA 1Z07A 2C9MA 4RHFA 4XD2A 1P6UA 4H6VA 1KZ1A 1WQ1R 3DCJA 1QG2A 2E4UA 3I2IA 3ZTTA 1Z5NA 3FVWA 2C3OA 4B71A 3TRDA 3FKJA 3HCDA 3ZDBA 1KSPA 4BB9A 5FD8A 4YY3B 3KQUA 1U3DA 1WCLA 2I6FA 3CKYA 3PWZA 3EYZA 3FPCA 3KTFA 4MARA 3VDRA 2JFHA 4ENQA 1UPUA 4LJLA 4PZNA 3LRPA 1GQRA 4B6SA 1F48A 3N7TA 4M0MA 1GTVA 1O6GA 2QLNA 1NR5A 4R0VA 4CCSA 3BDPA 1BAPA 4CIDA 3GEBA 4Y6LA 1RWPA 2XQKA 5KG0A 4DFDA 1JFFB 2BGIA 4DNOA 1R3DA 5DO9A 1E61A 2YJ4A 1XVLA 3GD7A 5H02A 5KSPA 1DCTA 1FBTA 4AZSA 4TYWA 5D5HA 2AGQA 2NZWA 2R7NA 4B0PA 4D42A 3TGPA 3TKAA 2HPHA 4PC1A 1ZYQA 4G67A 5E4TA 4FOTA 1HDIA 3WNZA 3OQVA 1V8DA 2RGRA 3IIEA 1OH6A 1CF9A 4PSCA 4QT4A 5KOHB 4FI3C 1W2WB 2DY1A 1KJWA 1NNSA 3HJAA 1WRBA 4ZP1A 3IEIA 1ADFA 2GJ9A 2L2QA 3OSPA 3TNYA 4GI5A 5BN3B 4ZICA 2H4JA 4C7JA 4EFLA 1PU2A 2OV4A 2W6ID 4GNRA 4EHLA 2YV2A 1PZFA 1JJVA 2VS1A 3DD1A 3GT0A 4KTTE 2ADMA 3RUCA 3T1HB 4EFMA 4AP6A 4D8UA 1V48A 3EARA 5G41A 3NATA 4PQEA 4DSJA 4QXRA 1CDDA 5ENZA 3TUJC 4B9MA 1WB5A 4TVOA 2QE7A 1YIOA 3L4JA 4YV0A 3DBLB 2N0SA 2WJ6A 4HYQA 3LZ6A 4S12A 3A6EA 1TADA 1GRVA 2ZZKA 4IUBS 3OQOA 5CVCA 2Z2YA 2O3QA 2Q1UA 5FNVA 2ACEA 3EWNA 2CNLA 4Z4CA 4QZGA 2B98A 4K6FA 2W8ZA 4BP9A 3GILA 1HLGA 1YS1X 3H1PA 3K1JA 3K6JA 3MTGA 3O74A 2PRJA 4FD2A 4MA5A 1X42A 4M22A 5L3RA 5GZ3A 4E4YA 3KV3O 3UAYA 1Q44A 1J7KA 1UODA 4MVJH 5E8RA 4QUBA 4K6CA 1Y1PA 1YB4A 5AKHA 5AKLA 2IEZA 2OMKA 3AU9A 3DBOB 4OH1A 5C3UA 1WCXA 1GDDA 4WZBA 3IVXA 2DKXA 2QRPA 3ESBA 2ARKA 3WP1B 5DLGA 3UJ6A 4FYHA 2VP3A 3BAZA 4X1OA 1IEQA 3NTXA 5BNTA 2W04A 1JSXA 1QUFA 3A25A 5FRDA 3GV8B 2IA5A 5IG2A 5JXWA 2PX8A 2PI5A 3KQMA 1DTEA 4DZTA 3UPDA 5CG1A 3FOFC 2NO4A 2VNIA 2CV0A 2YC4C 4NM2A 2Y1IA 1P3JA 2YXLA 3HLTA 3E5NA 5P8WA 1OVGA 1V1RA 3BICA 4PINA 3ZEAA 2ODAA 3OAAA 1R0LA 4ZT6A 1CUDA 1Q0UA 2Q9CA 3DOFA 1P7CA 2V98A 4LDJA 3TDMA 1P4AA 3EUFA 5FWAA 3ZWYA 3RQSA 3U4QA 4DS4A 3AX6A 3EZNA 2X3YA 4OMUA 5DW3A 5JYCA 4BY9E 4C03A 1DQZA 3OO0A 4M0PA 3HKZF 2M1ZA 2IOFK 4EJ2A 5ALSA 4NOMA 3TVYA 1LDBA 2Z7JA 1LI7A 4QZIA 4NATA 3OFVA 3TL6A 2EFHB 3PX3A 1GEEA 3DNFA 3H2IA 4L5IA 1QJ4A 4FHGA 4QPZA 4UQOA 4KO2S 4MJXA 4ND7A 2OBMA 5ARDA 4X8LA 3E5MA 3SEAA 3IIJA 2ZJAA 4BNXA 2ZKLA 5D8DA 5HKLA 1D7OA 4ACBA 1UQVA 3UMCA 1YAJA 1NI4A 1Z0ZA 2A1UA 2JKZA 4OHPA 4Z4EA 3LNTA 1Z1BA 1YTLA 3GRVA 3C43A 1E98A 4UE3S 2GBIA 2ZUFA 1EHIA 1VIDA 1WP4A 2IT1A 3ETEA 2J4FA 3K2EA 3WGLA 3ZCQA 4DEVA 1KEPA 3S2SA 2IDKA 3F6EX 3L2OB 4WAUA 1RRMA 3I04M 5KT3A 2D2IA 1K4MA 2OMEA 4IJKA 3SSAA 1GVHA 5THQA 3WLRA 4LFAB 3FTDA 1SULA 2WWXA 1I1HA 1XF1A 1VJTA 3K94A 4PTYA 1D2GA 4JLMA 4EYIB 4UTPA 3V9PA 1Y1KE 3KJXA 5HW0A 3QUAA 3G8YA 2BHLA 1L8XA 2AKEA 4PXAA 2ZS8A 2XBUA 3LMKA 4UFPA 1JAZA 1OILA 2I66A 2JVKA 1EM8B 1CUBA 1I6WA 3C1TA 3KOXA 3PQ2A 4ED0A 5D51S 2LYHA 4BQNA 2L0XA 4KQ1A 3J81k 3V8MA 4ODIA 1AUOA 2WIJA 5J23A 1G2PA 2HFJA 1EIZA 1D0SA 1THMA 3CXUA 3NAMA 2FZ4A 1FLNA 5HR7A 1H05A 1O5OA 2Z5VA 4UUBA 7ICNA 1H65A 3O8LA 5ALLA 1FJ2A 1JKJB 3MNFA 2QV0A 2L17A 3HJCA 1HO3A 1XD9A 3N2LA 4UMFA 4DCJA 3L6BA 3ZHOA 1A8HA 4F3NA 5JZBA 3WL3A 1CRLA 3NUZA 4BMPB 2O06A 2HPZA 3DZFA 5BVHB 1YV9A 4X63A 1AMNA 4Y9RA 2AKAB 4C4RA 3UGKA 1SPBS 3MT9A 1Z4PX 1MXHA 3KYJB 1AK2A 2XNHA 3R7NA 6ABPA 3E48A 4HN2A 2WU0A 3MMPA 4FOOA 4PTLA 5C8ZA 5DTQA 2H2GA 1AN0A 3N2ZB 3NVVA 1UIMA 4NS1A 2G25A 3N6RA 1K92A 4R2IA 3H7IA 2J5KA 2ODBA 4Q45A 3L4PA 4XM2A 2A5YB 1QAOA 1UJ2A 5F35A 1QO9A 3S27A 3ZG6A 2NPIA 3U61B 2BFCB 2OAQ1 4BJ3A 1W93A 4X45A 4Y2HA 3VOAA 3LWMA 1ZQNA 1E3WB 1FX0A 2GVZC 4B09A 1CUGA 1R9MA 3ESCA 4M1ZA 3EN0A 2ZRJA 4Z2YA 3SQNA 5JO0A 2DFNA 4NBVA 5TARA 3NYQA 2G04A 4O1MA 1S89A 4D0GA 3ZD8A 2AHOA 2HZBA 4LZJA 4W5WA 1EXDA 3TCNA 2I9KA 5A0VA 3DMHA 4X41A 1PFUA 2X1VA 2NU9B 2IHZA 5F78A 5FIUA 1EXNA 3IB6A 3KT0A 2HSDA 1H23A 2H1OA 3PUZA 3V42A 2G9UA 1L8QA 3RB4A 1W47A 1WHTB 4AJ2A 4TQ9A 2ZJ7A 4F3CA 2LXNA 1ZINA 2J8ZA 1HIWA 3QLTA 3OE1A 4UB8U 4LZNA 1RYSA 1KTVA 1VCMA 1DFGA 2PWPA 4MI1A 4KMUA 1Z36A 3A3PA 3VGJA 2ZRAA 1E58A 4CTNA 4KMSA 1WTCA 4HEA1 1Q0ZA 3NBAA 3K71B 1Z2EA 4FGWA 1FVOA 5J2KA 3TZ6A 1U8ZA 4FUTA 4KLJA 1ZBDA 3K0CC 2O8FA 1VE7A 3L1JA 3I28A 4QFCA 4RLQA 3ZLUA 2F8KA 4EZIA 5K3FA 4ALIA 1YTUA 5DISB 2BFWA 2Q46A 1GEGA 2P2GA 1JBQA 2V58A 3EIFA 3GK3A 4FJ0A 4HF7A 4HADA 1T3LA 2C0PA 1BQ3A 1YVDA 3E84A 3GG2A 3IAS1 5I7VA 2B8NA 4IQVA 1Z0FA 3IV9A 1RYZA 3W5UA 4DIEA 2IHJA 4MR7A 4B6OA 4EYQA 4S1PA 2W0SA 1ECWA 2P9HA 3STHA 5NULA 3T5BA 4KW7A 3OZCA 3KSRA 1JHVA 1TEVA 2OC4A 3CZQA 1Q7BA 1M6VA 4L08A 4S0ZA 5IDVA 4D97A 3B52X 2P9YA 5KFPA 4OLBA 4R05A 1BDIA 2VRNA 4FMPA 4IDQA 3OZIA 4CLRB 1F6DA 4EF5A 4D80A 3SX4A 1DRVA 1PTJC 3E61A 3DZ8A 4EPXA 5K0ZA 3I32A 5TVGA 2KBEA 2OD7A 4KLUA 1H66A 4ZARA 1V9CA 5BYKA 2C1EA 5BXYA 1Z25A 5EQFA 2ZOSA 1UPCA 1NW7A 3I37X 1T5BA 5EQTA 4F3TA 4V02A 4QTXA 2OBYA 5L1IA 4OREX 4UJ5A 3WJ7A 4OA8A 4RA6A 1NQXA 1VQ1A 1YNSA 4TVBA 3C3XA 3B53X 1Q22A 2FK8A 2L19A 3CW2A 2HK7A 2IYWA 3DEJA 3KYDA 1JXEA 3L41A 3QKWA 4IEFB 4Q21A 4E5SA 1V1MA 5K2OA 1IXSB 2X5XA 5IUKC 1OF1A 4KLAA 4RQAA 4K4IA 3V7YA 4X62B 4FGUA 3ZV5A 2Y4OA 4MRMA 3M3PA 3Q15C 4BVBA 3OD1A 3M8KA 1NTRA 3R6GA 3GLFB 3H2BA 2Q6TA 3U9SA 3W90A 4UAWA 2DVMA 2IYQA 2VQ6A 4L95C 2J0VA 4ZYYA 1ZJ4A 4JS0A 4PC7A 2NZ2A 2EQ5A 1J7JA 2VL7A 3P9ZA 4V38A 5J2IA 4OJNA 4RLFA 2RDIA 4IQTA 1A7UA 1GNPA 4NZYA 1JLLB 5IAAA 2FN8A 4RVSA 3HDVA 1KQNA 3NETA 1YOBA 3EB9A 5TLSA 3PC2A 5DGAA 3TOSA 1BNOA 2RHMA 5BNIA 1C3LA 4XFKA 3WWYA 4FKZA 5DM2A 1U1GA 3TSAA 4Z7JA 4EJ0A 5A7FA 2JS7A 2DCMA 3G7UA 3GNTA 3R0QA 2LGJA 4R8RA 4ZD6A 2YIMA 3EFEA 3F5DA 4XKJA 3HCCA 2K6GA 2ZKIA 2Q5LA 1N0HA 5IK2A 5IYZA 3VDQA 1EFAA 4C0ZA 5E38A 5TMDA 2I65A 4DQXA 1Q6YA 2A67A 3NO4A 4ZCQA 1XTJA 3TLJA 2PUBA 3QKRA 2M6KA 4M87A 4S1WA 3BFKA 1PEDA 1ZONA 3LL7A 4RZSA 1BD3A 4MW6A 2NUAB 1WE2A 1T1IA 4YROA 3NT4A 1GAXA 4FTWA 1G8JA 1BX3A 2NT4A 3X2SA 4C06A 1GTZA 2A78A 4BYGA 2PUAA 4BXOA 5JC1A 2YB4A 3WK9A 3M9NB 4NEHB 3LW8A 4EA9A 1VB3A 2NTEA 4ECVA 2W8BA 3X2FA 3ZU4A 4DW8A 1CUJA 4Q12A 3D3JA 4J0FA 4AROA 1JSRA 1BE0A 3LDHA 1KNQA 4PX2A 5AHXA 1YACA 4HZIA 2VP9A 2WB2A 1V2GA 2P41A 2WTXA 4DSNA 2CXUA 4OJLA 3GEMA 1XZHA 3NIBA 2YXNA 2IS1A 3P8ZA 3TLMA 4BQPA 3CVXA 3WZLA 4FMBB 3N8DA 3DLHA 1C0KA 4PRKA 4UOEA 4C7BA 4GOJA 3HUUA 5JNTA 1VSUA 4DMGA 4UBCA 1N5DA 3AOGA 4XQGA 3FPHA 3A0RB 1HQCA 5DFAA 5AW4A 1UBFA 3HYCA 3PT5A 2XZDA 3TF5A 3FCCA 2WSYB 3RAXA 4G5HA 2JFOA 2PR7A 1ODFA 1DPFA 4Y7CA 1ZI8A 5J5VA 4JSYA 1RYMA 1E6WA 3DVSX 4LUCA 1W9MA 5TY0A 3VISA 4HO1X 1R3UA 2FN4A 4RA6B 4ESEA 4GXTA 3FUUA 3WIBA 4U2DA 1YDFA 4F6RB 5A02A 3EPHA 1AKRA 3PCTA 3ZE2B 5FX2A 1KK3A 4RCYA 1FY2A 4V3CA 4HTFB 1JLHA 1MBZA 1OI3A 4YHHB 4EVRA 3P0HA 3JPRA 1ZP6A 1RM0A 1IY8A 3HV2A 3LW7A 3R3HA 4ME6A 1F6WA 4YH1A 1F2DA 2CEKA 4YAWA 2O8CB 1U6IA 4NECA 4IDDA 2OV2A 5FBLB 2H7YA 3V1TC 3U37A 3HCEA 2D00A 3D8NA 3O3CA 2QQFA 3NWPA 4FYYA 3H9CA 5TISU 4IQGA 4M47A 4H2DA 3PRJA 4DJDC 3DAFA 1O96A 2SKDA 4YGYA 1VLQA 3RRBA 4GOMD 4DVGA 3O8DA 1TYAE 4AMBA 2D7JA 1Y6ZA 2JC3A 3KVOA 2IH5A 2Q27A 4KR6A 2HI0A 3JPQA 1EVLA 1M1UA 1Y3HA 3OA0A 4O4IF 4RH1A 3E53A 3QPBA 4UPDA 3SHOA 4F2WA 1MOPA 4WX2B 4YRFA 2B83A 5KPJA 1PSZA 2ATVA 5HS6A 2UVQA 1D2HA 4J1TC 3SFTA 3V8EA 1L3CA 4MV4A 3K5IA 4Y9SA 2C4KA 4KQ6A 1ZJ5A 4A0RA 4HB3A 5JJCA 2BMWA 2JIRA 2L18A 1Z0AA 4LXGA 4PYNA 3PGA1 2VRCA 3Q3HA 3TB4A 4C8KA 1RI5A 4G5GA 2Q0ZX 1P7YA 3QNMA 3BL5A 1RYRA 2KE5A 2ATEA 5E0OA 2RB5A 4A8EA 2P0AA 2ESEA 3DZDA 4KIJA 4L73A 4N5NA 5DT2A 3UOGA 4AD8A 4KWHA 4KR3A 4ECRA 3URKA 3I5AA 1BQEA 3FVRA 3WRXA 2VJNA 1P4SA 2BM1A 3FCEA 2KVSA 1R50A 1USWA 3GZNB 5EIBC 1HNZB 4KE6A 3NT5A 1U65A 2AMVA 1YH3A 3CZ4A 2Q5CA 4P80A 2O2ZA 4DLUA 4L4SA 1Y5IA 4Y6PA 4EGQA 2IOYA 1DDOA 1E3DA 1NXWA 4CEJB 1GQQA 3L01A 3RIMA 3D7MA 1Q8KA 1QPGA 5FUWA 5DSXA 5JS6A 2WJZB 3RSSA 5BRJA 4AWXA 4DL3A 4YK7A 4MRRA 4PLTA 3HYNA 4N5DA 1O4VA 1U2EA 3AP2A 2AMYA 3EXEB 4B46A 2H7CA 2GD2A 4Q1AA 2Q2QA 2BZSA 4DYHA 4ELVA 2P5SA 4IRUB 4IZOA 1K8YB 3OZDA 1U0TA 1CIPA 3W2FA 4ZZ3A 2YRFA 4QQ8A 2MSDB 1WSAA 4NMWA 1C1YA 5HKOA 1XALA 2OZEA 4PX3A 2GYVA 3O95A 1RRGA 1WZEA 3O4IA 4CKYA 4AS1A 1E2NA 1JILA 3HHPA 3RVDA 3QPDA 2O8DA 1KQFA 2F1OA 4JB0A 5KNBA 4RETA 1MIOB 3KFLA 3LHDA 5A4KA 3K0SA 4UB6U 1E92A 4DS5A 3UHFA 1W0KD 1XCOA 2IIQA 4NOKA 1ZWLA 5JG7A 3JWEA 2NSLA 3ZLTA 3NHWA 3B9QA 4P4OA 2KZMA 1DAEA 4DV7B 1J9ZA 2YR0A 4NHEA 1UPBA 2BRUA 2RSLA 3SC2B 1UXHA 2V4ZA 3NS7A 1F9EA 3ZGZA 1AS2A 1LSUA 5DT9A 1VB5A 4K9DA 4LSGA 3GOQA 1HT2E 2HADA 2GZDA 4M7RA 3A0BU 3CW2C 1KYQA 4GM4A 5FWXB 4RDIA 2A0YA 4ND2A 4Y9TA 3GLIB 3LPAA 1C81A 3TK1A 2HHLA 1ACJA 3IO3A 2RONA 2ZBUA 4B9NA 4YJFA 3TM5A 5HKKA 2F9MA 4RD1A 4DLNA 4F84A 5GOZA 2JFYA 5F1PA 3HKCB 5EEHA 3ZW9A 4FZJA 4RGBA 1RD4A 3GRUA 4WEQA 1DEHA 5DEIA 3FMGA 5AW8A 1EFTA 3AV3A 1CJCA 3MFHA 4C1NA 2VP2A 5GJVC 1MFPA 1F38A 2KM1A 4AP5A 3EF1A 4XYLA 3PC8C 5CFOA 5JNLA 3EQZA 1QQBA 1KP3A 1OYYA 2G82A 1C3EA 2GZSA 4RPCA 2WD7A 1E4YA 3NTVA 5CH5A 5CFQA 5C9ZA 1P72A 2IYFA 1HNWB 2FG6C 1KFKB 2XE7A 3QITA 2IE0A 2PG3A 1O5IA 4ILEA 4TMFA 1OUMA 4YX9A 2QN8A 5KUTA 3GFKB 2P78A 3OKCA 1EBFA 3SM9A 2GFQA 2VUSA 4GI1A 2W70A 1YRHA 4BTVA 2XDYA 4PONA 3ZVMA 1VGRA 5CK4A 2B4AA 4GLFA 2RE8A 4IQUA 2LKDA 1XYGA 3MJHA 4KPFC 3AI7A 2ZTEA 1KQ3A 5LVAA 2JEIA 4M6WB 2O4CA 2HQ1A 3CRQA 4CV1A 1YA6A 3H0EA 2FRDA 4JCCA 2PSEA 3H6GA 3LDGA 3JXEA 3CUEF 1PFGA 4UFNA 3CF4G 4F4YA 3BQ2A 2E89A 2JI7A 2JV3A 3RIHA 3WNDA 1F0MA 2OYSA 3QOXA 4C5BA 1A4XA 2JRCA 2VJAA 1QO0D 1SCUB 1LVHA 4L5JA 3CT6A 3WK5A 1BE6A 4IOMA 5KYVA 4MRVA 3WGMA 3EJ6A 4EJMA 2DUJA 3ADKA 1LCIA 2CFIA 2Y99A 4FJ2A 2JG3A 2XCAA 4I9UA 1ZMTA 1GU7A 4G9GA 1SV0A 2JZBA 5GQSA 4K4GA 1PGOA 3SENA 4MGKR 1RZUA 4B9VA 2PUHA 3W9YA 5ALWA 3WGQA 4H7EA 1H9CA 4C2TA 2PNJA 2BKEA 4NU0A 3S8EA 1UEXC 1U31A 1U63A 1DHTA 3KELA 3ND7A 1HDOA 1U2DA 4R2LA 4XX0A 2A9VA 2PS3A 4KUHA 2ABWA 2IPAB 4DV5B 2QRGA 3DF9A 1HL3A 4V39A 1U11A 4YMSA 1E4EB 5K3EA 2OM6A 2WAOA 1GSOA 2YB1A 4M49A 4O0MA 3TFRA 5I4BA 1H1LB 2B94A 1NI5A 3HWTA 1FPQA 1OLUB 1KBUA 1Z47A 1SCBA 1QM5A 5I48A 3IHLA 5I6DA 3OJCA 2NU9A 3FNEA 5KFDA 2GHTA 4G41A 2FDCA 3VHLB 1KJNA 2EP7A 4K9LA 4OTZA 4BMVA 1H42A 3LD9A 3TTUA 4EHIA 1RFGE 2WDZA 3ZWQA 1GM5A 3WKAA 1F8GA 4H27A 1RXYA 4P3XA 4UREA 1A0OA 4CHTA 3GPLA 2I78A 5J0YA 2BGWA 4N8SA 1T1RA 3HXLA 4LWPA 2DQNB 3TXYA 3UCEA 4FE7A 1Z45A 2XITA 5J2FA 1K89A 1L1FA 4O3MA 1UJ6A 3CNLA 4TXLA 2NO0A 1P91A 4O0LA 4BV8A 4BE4A 1NJGA 3ESYA 3RLIA 3OE7A 1I6MA 1PK9A 1XLVA 2MWMA 4EGCB 4AG3A 1NG1A 3B3JA 2B1JA 4RSMA 5JWOA 2FSFA 3DEKA 2YJ3A 3H5NA 5JALA 9GPBA 5AHOA 4KX5A 5DB7A 3GGJA 2E49A 5ADUS 1YRQA 3R3XA 4KO8A 4BRWA 3CLUC 5CB8A 2O59A 3ND8A 4FX5A 1Q95A 9ICHA 3JQAD 1Q1BA 1WULS 3PSPA 4CZ2A 3PXCX 4EB3A 2ZQ5A 3SWWA 4MV1A 4QU0A 1XJ5A 2IU4A 2DKNA 3JYLA 1MOSA 2J6HA 3FSRA 1C5KA 1UBTS 2X0KA 1DKRA 1M1ZA 4OIMA 2V7QD 1HTWA 5J58A 3FYUC 4OHOA 4X61A 3HH8A 4Q9LA 1MA7A 1IFXA 3MOGA 5GZ1A 2WF5A 2AG5A 1W76A 4BASA 3KDAA 3VR5D 3HN2A 2PT7A 3VI3B 4M9XA 1H4QA 1M2JA 2Q0XA 5ETJA 1GZ7A 1K68A 1QNFA 2X6TA 2QXUA 5AK5A 4PRLA 4PU0A 5ESDA 3ROKA 3TQOA 1SEPA 4PM4A 4ETMA 5I3ZA 3RIEA 4P84A 4YCXA 4Z4QA 1EJ2A 1WW2A 1VPTA 2FSVA 2KFZA 2PUWA 4HJXA 4QECA 1EQ2A 5DYTA 4KDFA 1W9HA 3WBKA 3HWRA 3AEQA 1MQ2A 1Y1SA 3ZJYA 2BC9A 4AKEA 4GMKA 1RXIA 4U3JB 2ANCA 2I7XA 3GG9A 1KDVA 3DH0A 3D8SA 4AF6A 5DBCA 4FFOA 4Z4IA 3GEIA 1PK1A 2O7QA 3K4HA 1HMPA 1L4UA 1YCFA 5KINB 1TEZA 3GVIA 3GEPA 1XCGB 3EEFA 1QZ3A 4QZHA 3P4YA 2YNMD 3RKUA 2Y0PA 1AXEA 2I7DA 1FTSA 5B30A 1ZQVA 2G9NA 4CR6A 1O9BA 2D0IA 2Z57A 3TB6A 3F5AA 4CKCB 1CEXA 4GBED 1GUBA 4N47A 3BMCA 4C0LA 2C7BA 3RTVA 5TF0A 2JLWA 1YR3A 5EHIA 1I3OA 3JQRA 1LPPA 2XA9A 4ID9A 2D7DA 2DH6A 1I0LA 1MX5A 2C9OA 3AHFA 5BWBA 4YUVA 3L0ZA 4QJFB 4UDOA 2ZAMA 4BQQA 5EUMA 3K2IA 3LUAA 4BFLA 4ARBA 2GZ2A 1IZ0A 4GYKA 1HY3A 3F4LA 3FCOA 3ZGXA 9ICFA 1KEEB 6NULA 2PAFA 4R63A 3PIDA 3RS9A 2BCUA 3KEMA 2PFKA 4FBLA 2EKZA 4HNAA 4B7CA 5CA1B 3L0IB 5IVPA 2VT3A 5TRTA 4I9GA 3EA5A 1GPAA 1V37A 4XIJA 4QBFA 4DRZA 5H7XA 4E1BA 1Z4NA 1WNFA 3B3FA 4XDHA 4C4SA 4GM0A 4GH5A 1GR1A 5TV2A 4CQLB 2YZMA 4A27A 3QUQA 1YB1A 4D26A 1X40A 4I5DA 1SCIA 3C3BA 3FDJA 4KR0A 3VDMA 5CDFA 2XMDA 2ZCUA 3TSYA 4CDNA 4X3OA 5BT9A 1CVIA 1R10A 2IPLA 1BX0A 2LNDA 4FGLA 3UB2A 2YJZA 2NOAA 4KLCA 1VI2A 4FGZA 1AZTA 5JDIA 1Y5LA 3BHMA 1BFKA 4ADSG 4RDXA 3EQ2A 5AVXA 2X8AA 4GZ5A 5HFNA 4U7GA 5CT5A 2G83A 1XPJA 2I8LA 2WPNA 2FSUA 3W1WA 3ESQA 1HYBA 1AVTA 3DOOA 2B34A 3ANLA 2FFAA 3HW8A 2ZB3A 1ZQRA 3G1UA 2CKMA 2VPXA 4E2ZA 4B40A 4F2PA 4X1KA 3L7AA 1JBEA 2F3RA 2ZVQX 5HQTA 3DBLA 2G6TA 1RQRA 3GAAA 1E1RD 1VYVA 1E77A 1JDSA 3IVGA 4WZZA 4EPWA 1NSFA 2HV9A 2NACA 2QMUA 2J33A 2RG7A 3EMDA 4U9HS 4XD7A 5DBIA 3H1GA 3W2TA 3M6XA 1E5VA 2HC9A 3FWYA 3N87A 4PVDA 5IPFA 2E8NA 1TV9A 4N41A 4JB3A 3AINA 2QMEA 2RC6A 1U8TA 4Y6OA 1NK8A 3ZVLA 3DW3X 1OIVA 3OLYA 3ENZA 3TMKA 4CLOA 4CF7A 2FX3A 3NAGA 2I4OA 4MO2A 4TUYA 5FTKA 3IIIA 2HWXA 2O57A 2WFLA 2F48A 3GJZA 3HJHA 5JSYA 3M1YA 1W96A 2FLPA 2PEZA 3LPMA 3ALRA 1ZETA 3DVAB 3C5HA 4RXMA 1J8VA 4AJKA 1YR2A 1PZNA 3PCXA 4TTJA 3FJOA 3UMRA 1A7KA 1T4CA 1OY1A 3BXEA 2CLKB 3R09A 1YB2A 3EF3A 3TS1A 3QENA 3WQSB 1J2JA 4M53A 4Q82A 1NKCA 1E2DA 5DHAA 3ZCSA 3LF1A 5C1BA 1XS9D 2WAMA 4N7MA 3RCBA 2W43A 4O3RA 2WI8A 3ZTYA 1AHPA 3R9WA 2JFVA 2QJFA 4EG5A 4MLPA 4K9MA 5EXTA 5M29A 2D6FA 5HMLA 1Z6AA 4P7GA 2W2LD 1K9VF 3R7DA 1IY1A 4NMLA 4XB1A 4ZU1X 1ZCJA 2I4MA 4MYDA 1AGPA 5ILGA 2GPAA 3V9AA 3JZIA 2VBIA 2VLBA 4KO3S 2MCFA 4LYDA 4BNNA 3S2IA 3TINA 2VDWB 2GN4A 2LBPA 3CN7A 1VPVA 4F5YA 3I9OA 3WK4A 1NP7A 1KR2A 1OKKD 3BK1A 4G8DA 4CN9A 3D4OA 3I12A 2DKZA 3NS1A 2OBLA 4R0NA 4QOHA 5DQIA 3IELA 1B2RA 4UCQA 1CUKA 4IRXA 2P3QA 1DMRA 3PPVA 4CM8A 4DUYB 3CNNA 1AKUA 2ZANA 3U3JA 5JDCC 1SQ5A 4QWBA 3WO0A 3PNQA 5IM4A 3KKQA 4I46A 1H2WA 3E5RA 1OU4A 1E9DA 2W6MA 2CDNA 3AF0A 2FLNA 3VCBA 1JMVA 2R1UA 5C3MA 2O2IA 4M0DA 5K0JA 2PKYX 4G0PA 1PNOA 2PXAA 2PXHA 4LCEA 4KBFA 4PZZA 1K66A 3RO7A 3RB3A 1I1NA 4X6XA 7ICGA 2IUEA 3W9UA 3QMVA 4ECXA 3OD5A 3RBZA 3SC6A 5HOEA 4FEYA 4UPEA 1DKOA 1DRGA 4PHTA 2WUVA 2LKCA 1JTFA 3W6OA 4W99A 5BN5A 3EEYA 1P1CA 3F9IA 3DP7A 5TQVA 1TX4B 2KPOA 4M83A 4IMIB 3THYA 2XE4A 3QU9A 2EFCB 1IN1A 3ONVA 1UMCA 2ZWVA 4G8JA 1VKOA 4BO1A 3WLPA 2J3EA 4DJJA 1DIOB 5DCLA 4M88A 4OXXA 3PCRB 4EI7A 3TZQA 3UUWA 2JKVA 1W0CA 3PFGA 1J24A 2FSIA 2ZFUA 1EM8A 4KL8S 1Y1RA 2EW8A 2FB9A 3X1JA 2WAQC 2IMWP 1Q17A 1D0IA 1P4GA 2WE7A 5IVDA 4A5SA 5KT5A 1K0FA 2FDRA 4MVJE 1ED1A 4UVDA 5TNXA 1OX4B 3SC4A 4B2PA 1LDYA 1J0CA 3CZ9A 1ETHA 1K08A 4XUDA 1I4EB 1YNOA 2HHXA 3SE0A 3K0EA 4PNPA 4WBSA 1ECFA 5FI1B 3U6KA 3BSSA 2WHPB 3HDQA 3DL7A 1I4OA 4HAYA 5HYVA 4Q4CA 4WCFC 3G6WA 2XA1A 3DLCA 3GFGA 1IBLB 4UHEA 3OTHA 1QDEA 1C8BA 3EXFB 3I05A 3P2IA 5FB3A 2D0DA 4GI3A 1G9SA 4MW4A 5EFZA 3UANA 4TTTS 3DNMA 4OHWA 5J2TF 4UAZA 1TK3A 1SB9A 3TIFA 4GLXA 2R65A 3OTWA 4R84A 4G81A 1V1RB 3WWPA 2Z2ZA 5UKDA 4NNJA 2BMEA 2H5IA 3FW1A 2XODA 4NK5A 2XB9A 3E23A 1E5LA 4JUAA 2P6RA 4ZT2A 3U4CA 3LIIA 4QQFA 4B9EA 1Y7PA 2BI8A 3DFKA 3HMKA 5SYNA 3NHSA 3AO0B 1P44A 1NZJA 4YP1A 3IO5A 4QGAA 1CIJA 1KW4A 1F4VA 3NKFA 4CM1A 1YI1A 1H2HA 1KIMA 4FFSA 1UKYA 5L3ZA 1ZOSA 3SHVA 2AGOA 1UL1X 3WVNA 4D0SA 3C45A 3WMFA 4YD2A 2CMKA 2RHWA 2WPDA 4XE5A 3I6IA 1UWVA 1VHLA 1ADBA 4BO5A 5JBIA 1LX7A 2YASA 3UICA 1E2MA 2EH9A 4QWAA 2LRHA 1J99A 2PFNA 2D1SA 3OICA 1Z6QA 5TMEA 4EKGA 5J2HA 3A7EA 4F97A 1GG9A 4KYTA 1P2UA 1JA0A 1B42A 1LW6E 1RWVA 1XEWY 2NUPA 2PV0A 2WLSA 2Q4RA 2Q3EA 3HEBA 4L0CA 3KR9A 2EKPA 2VKQA 4DG5A 4EHJA 2CYBA 2VA2A 1G9TA 1Z4MA 1HI9A 2QXYA 2RDMA 3H87A 4KO4S 4QLAA 4BLTA 4P86A 1WDTA 2JBHA 3KUXA 4I4TA 5KJ1A 4O1IA 4XQ8A 2F4VB 3RRGA 1R5BA 2Y76A 3LO5A 2XY6A 3SAJA 2V9WA 3DUFB 2PH3A 3CLHA 4MP8A 4NZNA 4HPWA 2O8FB 1KOFA 4IXWA 5AVZA 2OV3A 1EFVB 2XZPA 3C7TA 3RBXA 1IN6A 4KQHA 4WXMA 3ESAA 4WZAA 5FCDA 3T7RA 4CRWB 1E60A 2I6GA 1I2ZA 8ICIA 4HWOA 2XCRB 1OFIA 3B9RA 3D7RA 4I1UA 1PR4A 1FF9A 3P9RA 3ZXIA 5ALOA 1DELA 3KSUA 2F62A 5ALJA 2ZJBA 4C8LA 1ZOIA 2P67A 3R5SA 4RDHA 1QGOA 3D7SA 4P2HA 4TQUS 4JVNA 3DD5A 2OA0A 2QUZA 4QUJA 3MCWA 2P9JA 3CX4A 2FKAA 1DBWA 2PU7A 3A9VA 3OHMA 2PKWA 5FOWA 3E9YA 2XV1A 2NSYA 4DAOA 2GEFA 1GGMA 4ZCMA 5C2JB 2V96A 2QXTA 4PS1A 1R6AA 5I7FA 3UA3A 1RPNA 3DZGA 4TTQA 3O2QB 3CO5A 5CB4F 4ZMBA 5F1KA 2JLVA 1TC1A 1U3WA 1PJ8A 4IFTA 2X0JA 3VMFA 1HKUA 3L0BA 5IAKA 5JTTA 4MHVA 1FB5A 1PE0A 2QPAA 4MKHA 4X00A 3RVSA 1A2QA 3SI8A 3E18A 4L2IB 5J0OA 4FZRA 4IP0A 2CN1A 5BV8A 3IBFA 4ONEA 1Y8CA 4JJEA 1W94A 5F51A 2A9QA 1JXLA 4W1RA 3UXEA 2D06A 2W11A 4EB6A 5D6NA 4HVCA 5HDQA 1Z5WA 3EY4A 1FDIA 3A8TA 3NGXA 4JLAA 3WKCA 3VYRB 3L7OA 3FHCB 4M0CA 4CV3A 1WDLA 2HT6A 2JLSA 2ZUEA 4CGZA 3OPYA 1E8DA 3R9XA 2C07A 3EX7C 3ADPA 3LUDA 1PQ4A 4GHWA 5JS8A 1JWLA 1HK7A 4NJMA 3FI0A 1RLUA 3KJFA 3RB6A 1NBOA 1CFZA 2OCLA 2O2XA 4ZTUB 2AVNA 2PXXA 1M54A 4R8UB 3DCYA 4JL6A 4NY8A 3NVAA 4MVWA 5DKWA 4P8RA 1BG6A 1SELA 4F9FA 5K01A 4UXJA 5DHQA 2X4LA 3ZNNA 4R54A 5BSRA 3COPA 4I19A 2ATXA 2YIDA 5KG2A 1G5PA 2R6GA 5DLQC 1TTTA 2I33A 4OKIA 4P81A 3G1WA 3URMA 3WQHA 1JDVA 4NR0A 2TECE 1C8VB 4F3KA 1PSWA 4DLBA 1T15A 3X0DA 3Q2KA 3MZ0A 1QK4A 1S2OA 3H0LB 2GRAA 1CF4A 2EBUA 2J09A 2XJ4A 1T26A 4LJKA 2WFMA 3QF4B 4UUMA 2R00C 4UUQA 3LC1O 9LDTA 1AN9A 2FN9A 4DWJA 3VNAA 5KYTA 3JR7A 3BRWA 1ZM7A 4KOAA 1VGQA 3K1RB 3VR4H 3P9IA 4KG7A 2GEVA 1RR6A 4Q4AB 4C0SA 4MGIR 4X90A 3VU8A 4QW9A 3F3KA 2H3FA 4K2HA 2BL4A 5AUPB 1IYZA 3QI7A 4LMRA 3PD0A 5DGTA 2ZR0A 3ZBUA 3BXGA 1E2GA 3CZMA 3L8YA 2D3DA 4M98A 3P4UA 3VR4A 2AR0A 5EIXA 5AI8A 1M73E 1IRXA 4TM8A 1LS6A 3A31A 4DF8A 3FUXA 1EBUA 3OU2A 1TZKA 5LQSA 4I99A 1W44A 4X3CA 4UHDA 4LYGA 4TL8A 3CEPB 2Z4SA 4NLBA 3E9QA 2FWPA 4K26A 5JVDB 4LEIA 5EYPA 1VRVA 3ZDFA 3P19A 2AWNA 4GGOA 4KE7A 4AN1A 2DLCX 1OAOA 3L0DA 1XTIA 4QHSA 3VNQA 4XTRA 3J81A 1XK6A 1KFSA 2OOKA 4JENA 1DQSA 4KV9A 2QTFA 2B99A 3HM2A 1CU1A 1OXMA 5FYQA 3TL3A 2BFFA 4JP5A 8ICZA 1EFRD 3LCJA 4MVJI 3U5ZB 2DUUA 4HGYA 2VAMA 4MEAA 4YMIA 4ENPA 1LLCA 2WQ7A 1G7SA 2WYHA 3OLCX 1UXOA 5HF8A 1ZGGA 4IKPA 1PK7A 3R0IA 1MVOA 3H11B 2Y2VA 4OJMX 4DLVA 4F4UA 2BE9A 3LM8A 3IKMB 3T99A 1AO0A 2YKGA 1O9GA 3TLZA 3GOHA 3U1VA 3EE6A 1ZOLA 1BN7A 1NT4A 3M6MD 1R0WA 3NX4A 5ELLA 4RK7A 2QX7A 4Q00A 1N6IA 1BW9A 1PJ2A 1USUA 2H57A 1L7MA 1U2RA 2IXFA 2XVMA 3D64A 3LA8A 1E1QA 1O2DA 4H9GA 4QXQA 1TQ4A 4EF6A 4ZOBA 1HX7A 2AFVA 1KU0A 4A92A 4CFSA 1FP6A 2OWEA 1S5LU 4K05A 4R1NA 2FZEA 4XVRA 1YZ6A 1YAHA 1KI3A 3RS8A 3VDNB 2H3ZA 5LQAA 2HQBA 4NK4A 1USIA 1ULUA 4JI4B 4LVSA 2ZSKA 4I55A 2A9PA 4O8ZA 1T1GA 5CA0A 1UDWA 2JLCA 1D1QA 2X9LA 1RQNA 1P0MA 3VAAA 2VDJA 3MJDA 2BV3A 1XVVA 3GJ7A 1JZSA 3IMGA 1A7AA 4XR9A 3ZGNA 2AJDA 4B76A 2XTMA 3UH1A 4KLSA 1RHQA 3GN1A 4DA6A 3VTKA 3LY7A 2I1VB 3GBPA 3TYXA 1OFGA 2VDNB 4CLDA 2WP8J 2LWIA 5KYWB 3B51X 3HO8A 4G23A 1U0BB 2IEBA 3JQ8B 4E5DA 5BUQA 1RXCA 2YTZA 3AKDA 3UQ2A 5EE9A 1E2FA 5H82A 3UKJA 4GE0A 3WLKX 1V6SA 5BOSB 2C29D 1G8GA 3E0FA 3ND6A 1W0KA 4AZ3A 2BUBA 1M6YA 5EKTA 2IEYA 1VHTA 1WD5A 1YDWA 1VL8A 5BVGA 3D6UA 3HA5A 2VATA 4OQEA 3KQQA 5KDOA 3R44A 3WR5A 2IITA 2FEKA 3ABRB 3CM0A 3EZFA 4V0RA 2OFFA 3VA7A 4PHDA 2I6XA 3CPSA 3SZMA 1YS9A 1QORA 4FQ8A 4BNLA 2DSTA 3A9WA 4LISA 2BDTA 2Q9BA 3DXZA 3LUBA 2HX1A 4UAGA 1ODKA 2ZU0C 4N4AA 5EJ6A 4YYEA 4LRWA 3DT6A 1DC5A 1MGOA 3H9UA 4OBXA 5FR1A 3I6ZA 3V2IA 2A88A 3FZEA 3BWXA 3AHHA 2QMYA 1UF9A 3UK1A 4WUTA 2XB8A 3NQ41 1RXSA 2L5YA 5FKJA 1UBKS 5KYNA 2B5WA 1QQ6A 1L2TA 3NTUA 3QBDA 2BEWA 4UTRA 1T6BY 3BSYA 2DQYA 1MT3A 5KNBD 1T0BA 4KQCA 2KVCA 1IJKA 2RJOA 2ZYHA 3QGMA 2WSSA 5G1NA 3X1DA 4YRIA 4XOIA 5LP6F 1M8GA 1T6XA 2NWQA 4RSRA 4KLEA 3OF3A 2EFGA 1IHOA 4RX1A 3R7AA 1AHIA 4CEIB 2QRJA 1CNFA 1LPMA 4EO4A 2JI6A 4DLTA 1KJYA 2HBZA 5KWIA 2ZB7A 1NBMA 1RAEA 2H5JA 2I2AA 4LXIA 3EAQA 1E2BA 4RPHA 3PFHA 1Q0SA 3D1JA 5KQGA 4K1LA 3QEJA 3TAHA 3O4VA 3VR3A 3ZH9B 2ODNA 1WHTA 4PG4A 1URJA 1EEHA 1MC4A 4P0TA 2X5JO 2ONJA 3Q87B 1X8JA 2CCJA 1H22A 2PPLA 4URHA 1RIFA 3WGJA 3WNVA 3ZN2A 10MHA 5HQ3B 3MGKA 4NH0A 2PE5A 1DI0A 2NU8B 2G9QA 2CHGA 2EEPA 2PMCA 3GFVA 3IQDB 3U44B 3QX3A 4C14A 1MN8A 3WIOA 4MV6A 1KDRA 1H0HA 3PEVA 2A5FA 5HIKA 5K3DA 4QUGA 3ZVKA 4QOIA 3RJTA 2I71A 2IPMA 2JGLA 4LF5B 3L40A 1UZUA 3E1KA 2YXEA 3NHFA 4G5YA 5ALPA 3BGVA 3SIPA 1H2BA 3TJMA 2O8EA 5LBUA 1JNYA 2WBLC 2EJUA 4J2OA 1ARZA 3LWLA 1XRNA 3BM5A 2H5XA 2JEJA 3HADA 3LT1A 1MEEA 1OSNA 4PY2A 1JG7A 5AKIA 4EB6B 4M7PA 1Y80A 5D3QA 4RVUA 4NPAA 5ES3A 3NM4A 4IKEA 3E9ZA 4W9NC 3KHKA 1NFQA 1NVXQ 1YZGA 1U1DA 4P7FA 2A5LA 2PL5A 1NV8A 5F5XA 3TQCA 2V4MA 3HA2A 4XI9A 3L4KA 5KYXB 2I2FA 1SCUA 4Y0AA 2YMLA 5FTJA 5FL7D 3RLFA 4UZFA 4YCAA 5J9FA 3ZUPA 3LTNC 4AI6A 1NVGA 2OZLA 5B5EU 2OGUA 3KHGA 3CVYA 4A6PA 2BTQA 3AETA 1N36B 1D09A 2PMEA 5GONA 3AW9A 1YB6A 4JMPA 1NLZA 4YVZA 1LEHA 1UDAA 1T5IA 2VWQA 3EPPA 3ES9A 2CHEA 3RVBA 2ODPA 1CUVA 2OQIA 5DNCA 2B3TA 2I03A 4MF2A 3AEZA 1NXPA 2B9EA 3JARB 2ADFA 1RW4A 5DYYA 1EFHA 3B70A 4G1VA 2R8ZA 1BS1A 5EIAA 5IIMA 1O97D 4CM3A 4EHAA 4M2YA 4YRSA 4EJFA 4MW9A 5C5JA 3FYUA 4TTVA 4GXNA 5LUAA 3L0OA 2OCAA 1VKNA 2NRTA 2O1SA 2Z6AA 1HE1C 1KERA 3PW2A 2FE4A 2X0IA 2BEWB 2J9ZB 4YIKA 4NM1A 4F1JA 5I7RA 5LOVB 5ILOA 2HMSA 4NL9A 1DX4A 3M6KA 5JQWA 1XZFA 2DT5A 2V0NA 1CHNA 3GPDG 5EN4A 5IKPA 3FZQA 2B7BA 4XGNA 4AUMA 3IQZA 2FOXA 4N7BA 5CT6A 4B9SA 3CR3C 9ICLA 3AU2A 4Y9DA 5E6SB 3USZA 3WJ2A 3Q5DA 1AC5A 1D1SA 2R85A 3SX2A 2FUNB 1H2ZA 3V7FA 4GOKA 4ZREA 2B1GA 5KQPA 5K1ZA 1RJGA 2OTCA 3K6SA 1FDWA 1KHHA 1CIVA 2GJKA 2QJRA 5FWYB 4QM7A 1ZICA 1VGVA 2A1JB 4JJIA 1BJRE 3EA4A 3WSWA 3PSHA 2G8LA 1Z0SA 1QV9A 2HA3A 1QGAA 2ZUTA 3EQ7A 2ZB8A 1GG5A 1H6BA 2AFRA 3AG5A 3ZWXA 4AWAA 2AB0A 2F90A 3GLGB 3KQHA 5JNUA 1CY8A 4NMHA 2LW7A 3FDZA 2EP5A 2CZGA 5T4HA 3G0IA 1YBMA 1Q2UA 1NXVA 1YZLA 4H60A 3BZWA 1EGAA 1P1RA 2GFIA 3D6FA 3MWLA 4JJ6A 1WU8A 3NHYA 5ULLA 5C8DA 3QHAA 3T3NA 4WNAA 3O8BA 2O5VA 4C3OB 3D2LA 1SZDA 2BFMA 4I66A 2DLNA 1IQUA 2QAJA 4RF5A 4B5LA 1KKUA 2XRMA 4FUQA 4RD2A 2CSXA 4QWDA 5AJYA 1P5ZB 1I36A 3IV6A 1TK0A 2IX9A 3AJ8A 3DCNA 2L42A 4ZO9A 1HDGO 1NR1A 2JGKA 2H16A 2DULA 4HLQB 5JIBA 4J9OA 3C16C 1ZAYA 1LFDB 2SNIE 2KKVA 3P0RA 3QVUA 3RQIA 4CMIB 4D8YA 4YRAA 4YIHA 4AMVA 1K5DA 4TQAA 3NALA 2XBMA 1MO4A 1OVMA 3C7KA 1GPYA 1G18A 1RP1A 4KFTA 4OH7A 2XTZA 3DMTA 1AH2A 4OQPA 1BQ4A 4JUDX 1AKQA 3HYSA 4I2DA 5KX5A 1RHRA 5HEKA 3I45A 3GLIA 4MVJP 4GLLA 7ICRA 3NDBB 1ZQQA 5LQKA 4WOBA 3K1AA 3TQ1A 3GUYA 4MIYA 1LB1B 2OCDA 4UJ3A 5BSEA 4Z7OB 2ZT7A 4Z0PA 5AP9A 1FP7A 5IIIA 1Z6ZA 4ND3A 3IIKA 1CY4A 4ZA2A 1KRXA 3NC4A 4NJOA 1DAPA 1WMAA 2XHEA 4UCFA 4TWJA 3PSFA 2YFKA 2ON6A 1B1AA 3MTAA 4MUJA 5TT0A 3O0FA 3RRXA 3W77A 4PG5A 1YBAA 2HA7A 3A2MA 4AJNA 1RG6A 4EG6A 5ALZA 3ADOA 5A2QA 3TVDA 2ZBQA 1GFSA 4RANA 3DBVO 3GJ0A 1W36B 1C9NA 3SF0A 2ZJ3A 5EMMA 2I7TA 4EOGA 1XYVA 1GUFA 2GJ4A 4E6EA 5B4VA 2CFCA 3RADC 1P60A 1TFRA 1XZNA 3OCZA 1RACA 1D2RA 1JG3A 4WKBA 4QHYA 3U44A 4ZI7A 4EVQA 5A3SA 3EHDA 4RC9A 3C29A 2H08A 1EH5A 1QYIA 2QRHA 2VCEA 3BWVA 2YHBA 1ETUA 4BFVA 4BFCA 4QT0A 5EFOA 4AW9A 1M6HA 3RKSA 2OHHA 3TAUA 3JPNA 4H1HA 1OR8A 3UK6A 1U7WA 4J75A 1WXWA 5FNVB 4ZQGA 3GA7A 3HMQA 4D2IA 1GZVA 3DV0B 1GRNA 3A2LA 1VC2A 4NCIA 1XTUA 2QPTA 1LNZA 2C03A 2EZ8A 3E3AA 1G6KA 1T4GA 1ZS9A 4MWEA 1BCSB 2XOKD 4PO3X 1Y9JA 3QX8A 3WYGA 1C9KA 3IAEA 4XWKA 1DXHA 1KC3A 1WWVA 3T0GA 3ZLJA 4HFJA 4DJAA 1Q5PA 2D1QA 3UC9A 1R6UA 3UFXB 4DA7A 3EBOA 5IDWA 3K9FC 1E1RA 2CXRA 4KLZA 4NEQA 3LHIA 3I3SR 5A6SB 3LK6A 3UMSA 3KBBA 2XKJE 2RK6A 4BCCA 5T6BA 1SXQA 3IBCA 4QZBA 4DOMA 3OX1A 2O3RA 1I5RA 4ARZA 1XQ1A 3W5DA 2OBXA 1XTKA 1KJQA 2K2WA 3FUWA 1ZA1A 4ZV7A 3VUEA 4YHBA 3RSFA 4HDKA 4A0QA 4AJEA 1I5OA 3NCTA 5DE3A 4EB0A 3M8RA 4Q3KA 3B1YA 2J30A 4UHFA 2FZKA 3HNOA 3ZHBA 2YDXA 1TAUA 1T5HX 2PZMA 1KL7A 1OTYA 2Z4RA 3BJEA 3I1IA 5L3SB 3TW4A 5A2GA 2J5QA 4E5PA 5JYDA 2GK3A 3ABQB 3OEHD 1JJIA 1WIWA 1ODIA 3BULA 2R6CA 4MVJM 1TK8A 4EA8A 3EXIA 2FE9A 1QOZA 5A5DA 1R6XA 3ND5A 4P08A 5JV5A 5KC9A 2W6IA 3BA6A 2P1ZA 1NMZA 5AJHA 1TJPB 1OJ7A 4ARUA 4CLXA 1WKBA 4BE7B 5K09A 1XRJA 4K88A 1WXGA 5FPYA 3AP1A 4I4TF 3LI2A 3VTFA 3PEWA 2E7ZA 4RJLA 3ZZMA 1E2LA 3O1JC 2ES6A 9ICMA 3LFUA 3O3MB 3OQBA 3HVUA 4KXLA 4GE3A 1NVVQ 1QH8B 4QWWA 3QVVA 5E95A 5JBQA 4JI2B 4OHRA 2KP7A 4BJ5A 5AK4A 4F2RA 2AYYA 4K7JA 5IJ0A 2CJWB 4POAA 5IUJC 3KTAB 1MQSA 4ZI5A 2I29A 2OCGA 3HCAA 1NONA 3OPVA 9ICIA 4XXHA 4WSOA 1EJBA 1K8ZB 1DC6A 4I1YA 3ZLBA 4H0FA 3SBDA 1ZUNB 5F9NA 1U99A 3EGCA 4OGKA 2GZRA 4RJJA 3IPYA 5H9WA 1IU9A 3WIUA 1C80A 5FUVA 4BL5A 1E7YA 3PICA 1JLRA 2D4AA 4BNGA 5L53A 1SCAA 2ZWMA 4ZV9A 1ESEA 5BMVF 2C9DA 3KM0A 3TW8B 4KAJA 2JD0A 1ZJMA 4RQ1A 2PLRA 3HTXA 5CHGA 1IOLA 4KWIA 1YKSA 4C89A 5I7OA 4S24A 4YEDA 2Y1OA 4I8XA 2MSKA 1MD9A 5EPUA 3L07A 1JROA 1QFYA 4Z1MA 4B3XA 4MV9A 3ZHYA 4I0WB 3W5AA 3C8DA 5E4FA 4P4PA 1PEAA 3JV7A 3JPWA 5GPBA 4BUCA 2JGFA 1XCBA 4BVAA 2F8TA 1L5KA 4CM8B 2Q4EA 4RYLA 1DAIA 3L4SO 3C14C 3ANYB 3DV0A 4RF3A 5LZ7A 2P69A 4ESHA 1PR2A 1TQHA 3A2KA 1ZVJA 4WW0A 4GS5A 1V71A 5HK8A 1KZ7B 3EEIA 5SY4A 2X9QA 3AQEA 4LSMA 3ZGVA 3TLXA 2IHTA 1S7CA 2QVYX 2E82A 4C04A 3QNUA 5CDYA 2V7EA 1BPYA 2B6GA 2WILA 1UFRA 4QZFA 3C6ZA 3F2IA 3NANA 1U81A 3AL0B 3MLBA 1U1FA 4DM7A 3IP8A 3A1WA 3JWGA 3HVJA 3KQWA 1YHYA 1DTWA 2IYVA 5DMXA 1D1TA 1PGJA 1UR5A 1ZQ9A 2PLFA 5H3HA 4BKQA 4LK2A 2CVPA 1FVFA 1DOZA 1JXOA 4JB2A 2WTFA 2V6FA 3LECA 1E3JA 1FMTA 2RH8A 2RI0A 4NONA 2CUTA 4TX1A 2COUA 2JLRA 3SJCA 3HJRA 4HHEA 4ED2A 4QFBA 1FMJA 4BLVA 2YV3A 1SVOA 3EBLA 1NBHA 3HUTA 2VVTA 1IXZA 2OXTA 2QP4A 3SPXA 3MPUA 4TKZA 3IRVA 2AN1A 2PV7A 5DHPA 4C20A 1I94B 1G6OA 3QKIA 1RMTA 1V26A 1M1NB 4IXTA 4C7XA 1YJAA 3E3MA 4JXJA 1J2UA 5FOTA 3L1UA 3RYCA 5A5EA 1VMIA 4AYTA 3N2KB 3ND9A 4FHDA 4IXDA 4M0UA 1IBRA 2CXXA 1CP2A 4QEDA 5CW1A 5LYJF 1XU7A 1NVVR 2HFKA 5IKXA 4YV7A 3BXFA 2HQSA 4QO7A 1NAIA 1X0XA 1GGJA 2NUTA 1MAVA 4WDRA 2H2IA 4OCZA 1WX1A 1H1TA 4I08A 4LZZA 1CJTC 1IM5A 2DR0A 2VF2A 4E1VA 1GQSA 1LPOA 4JX8A 4DY6A 1CS0A 3GLRA 2X0EA 5E8JA 2PUJA 5C35A 1MHPA 3OA2A 3SLGA 5HZGA 2R18A 4AU1A 2YJNA 4YXJA 3H0MB 2K4MA 4BNFA 1OWLA 2O07A 2VPIA 4RD4A 1IK6A 2ZRGA 3RRHA 1Z26A 2QW8A 1Y6GA 3E81A 1X7ZB 4PZYA 1PUIA 1MLDA 1KAOA 3ONEA 1XZEA 3N2NA 4YRQA 5ALHA 2BR4A 4O6VA 4A1OA 4ENSA 1E32A 3UA4A 8LDHA 2OYCA 4F91B 4O4JF 2A57A 3A6HA 5F7JA 1I7NA 1A8IA 4ON9A 4ER7A 2NXCA 4M1YA 3EOBI 2WTEA 3FGNA 3QKSB 4OBBA 2PVCA 1KK0A 2I6TA 3EGIA 1WW8A 1T8TA 1ZH8A 3WLEA 5DK6A 1XQWA 2WVHA 1ID1A 5D1NA 1LJLA 4ZVRA 2TMDA 4OO3A 3T3GA 3UMVA 2Q3FA 1EFCA 5F98A 3SSNA 1ID8A 1Q0LA 3A36A 3ADCA 2LDBA 1KMIY 3W8RA 4ZEOA 1AGYA 2AKYA 3ZCUA 4FMCB 2O5RA 4E88A 3LCRA 1EHCA 4II2A 3H2GA 2PA3A 2Z1NA 3AJRA 5EMJA 4C2AA 4URVR 5BSVA 3F1KA 1TYBE 4KQXA 4PO1A 4KR7A 3ZDYB 3ZC3A 1CUAA 2E8OA 2ATIA 2IUUA 1TAMA 2I54A 3JYQA 3DDSA 3OEWA 3FIJA 4Q66C 1JHMA 1RWOA 1RTKA 2ISCA 2RGNA 4E08A 4RUCA 2HLDA 2PIDA 4MXDA 3IPCA 3SZUA 2PWZA 4M46A 3ZE9A 4FDTA 3IB3A 5DVZA 1ZIXA 3EPGA 3BZCA 2RCYA 3TXXA 4BNIA 3RSOA 1S0OA 5CPFA 1RQPA 4BCDA 3KPUA 1EG7A 4E7OA 5HJEA 2PUEA 4HXYA 3WFJA 2LMRA 1KZGB 1FFAA 3AVPA 3DGFC 4OK3A 3PIIA 4FNMA 5LYYA 4AY5A 5AKZA 2DPMA 3LOUA 3ZYCA 1U3FA 3DC7A 2QKQA 1HRKA 2CB9A 2Q3DA 5FI3A 5LLSA 5JH7B 4Q4LA 2OZLB 3GH3A 2XJ9A 4IDHA 3WX0A 3W5VA 3F6BX 1UMCB 1F17A 3PV0A 4J0EA 1QXSA 4HGRA 1VL2A 1D2EA 2VRWA 3E0XA 5FLYA 3RV3A 3WLTA 4XLZA 5DSZA 3ZIDA 5CR0A 1M66A 2O4UX 2PR2A 4DA0A 3AKEA 5CLIA 3GGCA 1M3SA 1ULAA 3CCCA 3M9LA 1SUCA 4GPEA 1YHZA 3H3JA 1F2UB 3IKVA 3LUKA 4JEUA 4V3BA 3UJPA 2BMFA 5IJXA 1PJZA 4XDZA 3ZJ4A 5TS2A 2EZZA 4OXQA 1L6RA 2P68A 5CXUA 4KXMA 1YQDA 1NPTO 1JV2B 2O7NA 4LHZA 2NU6A 4NY1A 4F2DA 2HHJA 1WY7A 5F2EA 3SKYA 3N2GA 4U5QA 1Q21A 2HNBA 5KG4A 1COWD 1GSAA 3RWOA 1SUBA 3DMYA 1PVDA 2BFAA 4JD5A 1A96A 2WNHA 3EXFA 3GLIE 4N18A 2OHOA 5DI3A 4EEZA 4LDZA 1GQYA 1WB6A 4MZDA 4AVYA 2BDUA 2AFHA 1U9JA 1J42A 3OP4A 2AJ8A 2XYHA 3GLSA 5FOQA 4MRPA 5IJWA 3PX7A 1O6FA 3DEAA 5LNK6 2OXIA 1YL6A 1RYBA 2XIJA 3BN3A 5SY9A 4D9HA 2W2VA 4C4PA 3BS5A 3GLFA 2Y67A 1PSDA 2BYTA 3DE1X 1HE3A 5SZIA 5JJ5A 1EK1A 3EG9B 1GL6A 3JQBA 1NP6A 2ZBGA 3VPDA 1HQYE 3L46A 4E5YA 1U9IC 1K8RA 2OQ2A 3LPDA 1K6EA 5TIIA 4JFRA 3PRHA 5FOSA 4I1IA 4MWCA 4O2BB 4QRIA 2ZIUA 1FSFA 4G0XA 4B3MB 4G1BA 4B2LA 1R4MB 4J1SA 5C5CA 4RQ4A 1B76A 1S2LA 1J0EA 1WPXA 1C9EA 3AF3A 3OQJA 4Q4AA 5CBPB 4RYDA 3FB4A 4EY3A 4MR9A 1E5XA 3NHZA 4GRIA 3WL6A 5EWJA 5B36A 3HWX1 1G1MA 1PFKA 1I7SB 3HO1A 1IBSA 3R6LA 4N0MA 1BRMA 1F4PA 4M04A 1S96A 1VLLA 3R8CA 5JJIA 4QZAA 1MABA 4UHHA 4DIDA 4UEQA 5AVKA 3NHLA 3D7KA 4MEXA 3Q4GA 2I1WA 4MWGA 4PZ0A 2PZ8A 4IWYA 5G0WA 3SJUA 1QVZA 4DYVA 2VPZA 2W7OA 1Z7BA 5JH7A 5KQRA 3IR7A 5IKEA 3VKGA 3C1ZA 4W8HA 2MRLA 1PVPA 1NZFA 3O26A 3NIGB 3UXMA 3WGYA 4DA9A 1PLLA 2GVDC 1MRNA 5C8XA 1DAFA 1AKTA 1G42A 4QATA 3V1NA 4UBIA 3ZOZA 1X8KA 3O0DA 1AURA 1MC1A 3R24A 2QU7A 4G09A 3HL4A 3RYTC 1TZMA 2QSUA 2QZJA 1G8AA 4X65B 4KVGA 1S1CA 3ETNA 1Y1LA 3SOPA 3WK8A 1N4AA 4E0BA 4ZVQA 1J90A 1UKCA 1S2IA 1G6HA 2P4QA 4GW3A 5KNCH 1LVUA 4UU0A 4G5FA 1A8QA 1HFKA 3NPMA 4S1NA 2IW3A 4CF3A 1BS9A 3QKTA 4TROA 5FHQA 3GO4A 1RCTE 2J9XB 5L7YA 5MN5A 4ZZ0A 2IXAA 3Q0TA 4ZKDA 2P65A 1N62A 1RS0A 5DMHA 3RH0A 2IU3A 4PAWA 1SHKA 1JHDA 2B3DA 2W5UA 4K6MA 4N0PA 1T5TA 4K2AA 4IR7A 1YZFA 1JTVA 7ICSA 3ID6C 3OHPA 4XGQA 1DV1A 5LIPA 3PGVA 4ARCA 1F7UA 2QVCA 3B1JA 4OAOA 1HLDA 1CY2A 1SG6A 3OZGA 3OX4A 3VJKA 4YCCA 1TTHA 3MD9A 2BKLA 3V2HA 4UD6A 3QUBA 3WRYC 1OBOA 3MXTA 3E70C 4KLNA 3H17A 2BD0A 3U39A 3RSCA 1S8OA 2R6FA 2Y0CA 2N46A 4BEVA 2Z4TA 4LE2A 1U0FA 1TCCA 5BW6B 4PJ0U 3GPIA 3HCPA 3K7EA 4XARA 5AVVA 3JQDA 1FP2A 2O48X 1C1XA 1V38A 2JCXA 1N8NA 1U8FO 2ERYA 2QAGC 4R31A 5TJHA 3SR0A 8ABPA 1L5WA 3NTRA 5I7SA 5J2TB 4FDMA 3G6YA 4F8JA 5J0SA 2GX6A 2GUGA 4MQLA 4O9MA 3DS8A 2NO9A 2QA5A 3E2IA 3ZI7A 1BMFA 4EABA 5EI5A 2CNWA 4BLUA 5JSUA 2WKSA 5LR6A 3DP9A 2X8LA 4IYRA 1EXVA 4RUKA 2C77A 4GPTA 4NXZA 3PQ5A 1MORA 3DSRA 3F2CA 2C5FA 1E62A 2FPOA 3D2CA 4FOSA 4N6NA 2IIPA 3TAXA 3D9QX 4RVGA 5B6PA 5J59A 5FUYA 3GJRA 3QQPA 1SD5A 3A4IA 3DV9A 3G5TA 4E6PA 4LC1A 4JI8B 2A5JA 8AT1A 1ZU4A 1H9BA 2VH2A 5DTEA 5AFSA 3L8EA 5DM1A 5CB0A 5DN6D 1U7ZA 2HVHA 2F3PA 3UJDA 4LXYA 4FFRA 2PKQO 5DULA 4DR6B 2WK1A 1C20A 1GADO 4DQVA 3THXB 3K0AA 4NCNA 2HF2A 5KFTA 1HT0A 1Y82A 3ZV6A 2G5HB 5KFWA 2EAUA 4KQMA 5CEHA 3KWLA 3MR3A 1R6TA 1QHGA 4WT7A 3TOCA 3I8XA 3HN7A 4P1ZA 4JLDA 5DQHA 1EFPA 4FO6A 1MJFA 2NXNA 1U7HA 2QI9F 2XUPA 4RD3A 3VBEA 2PJUA 1XQXA 3ZQUA 2BGRA 3TI0A 1AZWA 1PJBA 1XOIA 2F67A 3PUKA 3V8BA 1H85A 3WKDA 4F72A 3SV3A 4I1OA 4BO8A 2G5IB 5T57A 3V4RA 1GR0A 2JJQA 3FNFA 3DDZX 1H2FA 4X85A 4YDRA 5AT1A 4GSYA 4IGKA 5REQB 3WQBA 4BB0A 1B14A 2C3YA 2LYAA 3Q8WA 4FSHA 1BFDA 4R81A 4DREA 2BPCA 3OJLA 3IVAA 1XDDA 1IM8A 4TMTA 4BC0A 3H1EA 2VWHA 4JP8A 3VBCA 4QDXA 1PN3A 4R7ZA 9ICNA 1SQFA 4W1SA 4ZKEA 3OBBA 2F3UA 2W0MA 4KLOA 5CJPA 1ODCA 1KZ6A 4LJ7A 1OGYA 5HFAA 2CDBA 3ESDA 1RCUA 1WCYA 2GWRA 4PZLA 2FTKE 3R6TA 1VXOA 2W8LA 5KTQA 3A28A 2IY7A 1IQRA 3WRYA 4ER0A 3NBFA 5JU5A 3BWYA 4PAQA 2QKYA 3EG9A 5KTMA 4C0WA 2P3SA 2ZR8A 4G0QA 4F8YA 3RF7A 3JPTA 2IP1A 2Q5EA 3EGEA 1ZESA 3CPHA 1RADA 4UPVA 4LNHA 1PWXA 1LVGA 1NQUA 1UUFA 2CD9A 1K75A 2PKXA 3VHQA 4HJRA 4AWBA 7AT1A 1X0VA 1MTZA 4DFMA 1XLUA 3FHJA 4LPKA 4JLSA 2GK6A 3WLLA 2Y77A 5AQEA 1KMCA 4UB2A 1BA2A 2HDOA 3QX7A 2ZI3A 3CW9A 1GPNA 1AQIA 4P2GA 1QR6A 3RUAA 1ZJNA 4EFKA 3H4VA 1VYHA 4HQOA 5EXXA 1HE8B 5ALXA 1V6AA 2IDJA 1SGGA 3IDAA 1ZNWA 1DOQA 2YIJA 2LM1A 2OENG 2QZPA 4HN9A 4O2AB 4IQ8A 3MBIA 2IYXA 2BCSA 4FONA 3WNBA 5KOIA 3FSJX 1TMOA 4RD0A 5EERA 3EUAA 4U9IS 1ZYUA 2DQSA 4LE0A 4RHEA 4PYMA 3LVQE 3VVMA 5BOSA 3RC1A 5E9WA 2C2KA 5DNDA 2VJQA 2HRDA 4S3MA 4RF4A 3QXGA 2XUDA 1MF7A 2EKLA 4IXMA 1NYTA 2OV8A 5LB4A 4Z0TA 3GJ3A 2FAXA 4M1TA 4F5OA 2Z3VA 1RMQA 1QSLA 1WQ3A 1NBAA 2EG9A 5FWXA 3RF6A 2HCBA 2FPUA 3Q7EA 4O4LF 3VKFA 1RC0A 1DJNA 2HO5A 3ANXA 4OSPA 1ZMRA 5A71A 1Y63A 1ZK4A 4NLZA 3D2NA 3FGZA 4LQCA 4C4ZA 3OECA 4ER6A 3TSOA 4QBTA 4BQRA 1CX9B 4TL7A 4FWIB 2NZUG 2ZE5A 4QBIA 4RJTA 2WB1C 2GBGA 1Z6GA 1BDHA 2W9CB 4L57A 5CNIA 1CDZA 5JWHA 1DX6A 1ZX1A 1PNRA 3I30X 4IAOA 4L9SA 2ICAA 1OLUA 2W3SA 2KEYA 3OQPA 4P3NA 3W8DA 1ZQCA 3W8FA 3OCWA 5BSGA 5CCEA 1YIAA 1Y33E 1PHRA 5K8VA 1JF8A 3HGMA 3K9GA 5AOVA 3EC1A 1PL7A 1B4FA 3M6IA 4H7IA 4MINA 2R6ZA 1K5HA 1SU8A 5TGZA 3WWCA 2P6UA 4DF4A 3H86A 1OASA 2G3YA 1KOJA 5H9VA 1O6ZA 4LJAA 2ZQYA 3KDSE 1VZ3A 2KX7A 3EXEA 3IBGA 1WV1A 4A91A 4PGGA 4RY0A 4ALKA 4TPKA 1SBTA 2VDKB 4PWZA 4B33A 2UVUA 1F4LA 3BKXA 3NJ4A 3SVZA 2DBRA 5JYBA 3WOVA 3HC7A 4MRMB 5FV4A 4HDMA 3ROXA 4NE2A 1VCHA 4ZEXA 5TT1A 4LRSB 3VKWA 4RAQA 1IXKA 5FAKA 1OA0A 2B25A 2GBLA 4JBYA 5D46A 2EZ4A 1NULA 1V5WA 2C4WA 3GIWA 3VJMA 2CLOB 4EHHA 2OB2A 5FUQA 1GTL1 4ZJPA 1MEOA 4W6QA 5T64A 5FBVB 2XNDA 1MB0A 1K7CA 4E22A 4NLGA 1G8SA 1U2GA 1UZAA 5JARA 4AS2A 4ML3A 3CNQS 3VH1A 1J06A 1X94A 9ICAA 2O2GA 1AKYA 1K1SA 4N7RA 3R0ZA 4NP6A 4EG1A 1EQUA 1G21B 1T8YA 1HQDA 1SHJA 4DCUA 4A6DA 1R66A 2Z6QA 3F6YA 5BQXA 4CR7A 2OXOA 1OHHA 2HK8A 4YRJA 2GN0A 1QRAA 2KD1A 2Z9CA 3A3YA 4LE1A 1TZJA 4LDPA 1KSFX 3L7JA 3RS7A 3VR6H 3GLUA 4QSHA 2JARA 2VUIB 4MSUA 2B82A 4S2UA 3ABIA 3O90A 1H1LA 1Q83A 3OFNA 1Z0JA