3QX7A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron complexed with phosphate, a closed cap conformation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
224
structure length
224
Chain Sequence
b'HMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 81
structure length 224
sequence length 224
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qx7A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qx7A01
2G07A 2BY4A 2OBBA 4UAVA 3QU7A 3OTQA 2JAOA 2WF7A 2GO7A 3BA6A 2I55A 3ZWKA 5ALOA 5ALXA 1L7OA 2YFYA 1RQLA 4KX5A 3L8HA 1QQ5A 2OA0A 5A3QA 5AW3A 2HSZA 2IA5A 2YJ4A 3U7GA 3N1UA 3ZX4A 4UASA 1YV9A 4BYGA 1Z4LA 2CFTA 2OYCA 5AW0A 1ZRMA 2ZG6A 4YCNA 2FPUA 1ZJJA 3A1EA 4XQ0A 1O08A 2ZOSA 3SLRA 1RKQA 3W5BA 2YMMA 2FPXA 5AI9A 3AR5A 4B6JA 4RETA 5AW7A 3QX7A 4HGOA 4YH1A 3AR3A 2C88A 4CE6A 2FUCA 2YMPA 1QYIA 1K1EA 2FPWA 5AW2A 1KYTA 3QGMA 2HEGA 1XP5A 2Q5EA 3D6JA 5AKJA 1Z4NA 1RKVA 5AVXA 4Y2VA 3WK5A 1Z4PX 5JJBA 4QJBA 3DNPA 5AK5A 3L8EA 4C4SA 1YJ5A 2R8YA 1WZCA 5AHXA 2MU2A 5AKEA 3QUTA 1X42A 1Z4IA 2P11A 3QLEA 5ALTA 3U7HB 3FM9A 1TJ4A 5AKKA 3L0YA 2GHTA 5AW6A 1U7OA 3P96A 1VJRA 3MMZA 4NFLA 2P69A 2WHEA 3A1DA 4OHFA 4Y2RA 3A3YA 4HGNA 3WKDA 3J7TA 2R8XA 4UMEA 1S2OA 3I6BA 3KDPA 5AI0A 2G0AA 1CR6A 2HX1A 3ESQA 2WFAA 2IYEA 1RQNA 3PDWA 3M1YA 1L8LA 4C4RA 4L6CA 5ALQA 4BEVA 5AI4A 5ALFA 3S6JA 2JGAA 4G63A 4CNQA 2PQ0A 5ALUA 2IOHA 1T5TA 4JDPA 5AVYA 4HGRA 2VKQA 3FVVA 4IFTA 5A3SA 4BBJA 3QYPA 4Y3UA 5ALGA 5ALZA 2WF8A 2G80A 1NRWA 2I34A 3L0BA 4ZEXA 1L8OA 3ZI4A 3ZWDA 2X4DA 1XVIA 4EX7A 3DV9A 5AKGA 3ZX5A 2QYHA 4J2TA 4YGYA 5FP0A 4UMFA 3CZ4A 3U7EB 2Q4TA 2B30A 5AW9A 2WF5A 1L6RA 2I7DA 1LTQA 2B1QA 2HF2A 2R8EA 1FEZA 3WK7A 1N9KA 3AR4A 1RPZA 3ESRA 2C9MA 3ZVLA 5ALLA 4MWOA 1Z4MA 3KC2A 3NANA 3M9LA 3VAYA 3QU9A 1Z5GA 2I6XA 1SU4A 1TJ5A 4BEWA 3DAOA 4UM7A 2YJ6A 3ZU6A 2NYVA 3B9BA 5AICA 3AR7A 1Z4OA 1T9ZA 1N8NA 3WKAA 3ZW7A 2FUEA 2YN4A 4UU1A 3UMCA 3NASA 2YJ5A 3L8GA 3SF0A 3IJ5A 3B8EA 3UMBA 4UM5A 3I28A 5IS2A 3EF1A 5AM4A 5AI8A 1TJ3A 4BX0A 2YMLA 4MUMA 3SKYA 2NO5A 4Y2PA 5AK4A 4KX3A 1L7PA 5AKXA 2AMYA 2B0CA 4XPZA 1RDFA 3OCUA 2C8KA 3EF0A 3N28A 4BX2A 3OCWA 4I9FA 2C8LA 4PNHA 1RLTA 3W5AA 3NAMA 4J03A 3KOOA 2MU1A 2ZBGA 3PGVA 4UARA 1S8OA 3SMVA 1WPGA 3ZTYA 1QH9A 5ALRA 1RMQA 5AIBA 3NRJA 3L8FA 1LVHA 3UM9A 5AM2A 4AP9A 3WKBA 3L0CA 3MN1A 5AKYA 1RLMA 4BKMA 3N07A 3SKXA 3K1ZA 3R4CA 5AM1A 3A1CA 3QNMA 2FEAA 3I1YA 3FPBA 5A3RA 3QU2A 3R09A 1EK2A 3U26A 4OD0A 3U19A 1U02A 4UAUA 5AM0A 1TE2A 2OM6A 2IOFA 3KZXA 3WK6A 2WF6A 2RARA 4YIHA 3KBBA 3GYGA 4OFZA 2PR7A 2O9JA 5ALYA 5AM3A 5AESA 2FPRA 2P27A 2AH5A 3L1UA 3FGOA 2EATA 2CFRA 2D2VA 2I54A 3OCYA 2ZBEA 3PGLA 5ALEA 2HCFA 5IT0A 4RESA 2WM8A 3TLMA 1ZD5A 5AM5A 3AR2A 5E0OA 5ALIA 4KYTA 3IRUA 5ALVA 1WR8A 3RF6A 4Y2UA 1QQ7A 2QLTA 3E58A 2YJ3A 4IG4A 3U13A 3MC1A 3MPOA 5ALDA 3W5DA 1PW5A 2AUTA 1ZD4A 2AGVA 3OCVA 4OCZA 4E88A 1T5SA 5AK3A 5T41A 3HLTA 3SHQA 1WVIA 1MH9A 5AW8A 5AVTA 3BWVA 2GFHA 3QU4A 1ZD3A 4NV0A 4DFDA 2B8JA 1NNLA 1ZD2P 2FDRA 1NF2A 4I9GA 4KNWA 3U7FB 3WK9A 2CFSA 5ALHA 4O8CA 4GIBA 4ZEVA 4EELA 4QQFA 3WKCA 1RRCA 2JAUA 5ALNA 5AVSA 4YIKA 2MSNA 4EENA 1Z88A 4GXTA 4UMVA 4BX3A 4KNVA 1Y8AA 2O2XA 5ALKA 2YBDA 5AW4A 2WF9A 4L6AA 5IT4A 1VFPA 2FI1A 2Q4RA 2YMQA 5AVVA 5AVZA 1EK1A 1Z5UA 1CQZA 1RMTA 2G09A 2ZXEA 3E81A 2HHLA 1YDFA 1YS9A 2HO4A 3NUQA 3E8MA 4HAIA 3HYCA 2I33A 3E84A 5AI6A 4L57A 1RLOA 3NIWA 1U7PA 3QUQA 5AK6A 3W5CA 4AS2A 4UMDA 4YCLA 4CF4A 1Q91A 1RMYA 2B82A 3EPRA 4FYPA 4FFDA 3QUCA 2B1RA 4FE3A 4HYTA 1RKUA 3AR8A 3NALA 4HGQA 3UMGA 3L1VA 4G9BA 1Q92A 2W43A 3ZVMA 2JARA 2G1AA 3IB6A 5ALSA 4EX6A 4XE5A 4Y2TA 3AR6A 4Y2QA 5ALPA 3R9KA 3WK4A 1YNSA 1JUDA 1Z4QA 5AI5A 3WK8A 2BDUA 4NAVA 2YY6A 5AW1A 3L5KA 5ALWA 4ZEWA 3SD7A 5AVUA 2GMWA 2BDEA 2RBKA 1ZRNA 1AQ6A 3ZTWA 2CN1A 1VJ5A 2EARA 3ONNA 5AVRA 4CF3A 3L7YA 5AKHA 1Z4JA 2R8ZA 3ET4A 3FPSA 1J97A 1YMQA 1RC8A 3N5KA 2P9JA 4DWOA 4JB3A 1TA0A 5AKZA 4YCMA 4EZEA 2NO4A 2G08A 5ALJA 3B9RA 2HF7A 2JAWA 1U2TA 5AW5A 4Y2SA 3QUBA 2ODAA 2HOQA 3CNHA 4AS3A 1ZOLA 1F5SA 1L7NA 1SWVA 1IWOA 4UATA 4UW9A 4F71A 4H1WA 2DQSA 2HDOA 2W11A 2RB5A 2PKEA 3OCZA 4DW8A 2RAVA 3WGVA 5AVQA 2IOFK 4CF5A 3ET5A 1QQ6A 3FZQA 4Y2YA 3KD3A 3WGUA 2HI0A 5ALMA 4DCCA 3ZUPA 3WKEA 4EEKA 4NWIA 3AR9A 3EWIA 3OCXA 4Y2JA 4C4TA 3F9RA 1Z4KA 5AKLA 2GHQA 4UU0A 3RFUA 3ZVNA 5AKIA 4NABA 3ED5A 2G06A 1U2SA 1ZS9A 2EAUA 3OPXA 5AIAA 1XPJA 2ZBFA 4HGPA 1SWWA 1L7MA 3PCTA 2FPSA 3I76A 3QU5A 5AVWA 2ZBDA 4BNDA 2C4NA 1O03A 4BNDB 4XOUA 3QXGA 4Y2XA 3DDHA 1J8DA 4KN8A 3N8GA 4F72A 2W4MA 2B8EA
chains in the Genus database with same CATH superfamily
4EJ6A 5JS2A 3QX3A 2WU0A 4JKIA 1BWPA 2X1LA 4J4TA 3N1UA 5CK5A 3SENA 3PHCA 5H0IA 1FW8A 2P5UA 2HK6A 3JASA 1W5TA 1PYGA 4JJKA 4MQLA 3LY5A 4OJLA 3Q7TA 1K1EA 3C3EA 1VGVA 5JG7A 4IHJA 1CZHA 3TWOA 2KMDA 3WLJA 3HKBA 1Z35A 4RGVA 2H1CA 1CFJA 1QGOA 3F3YA 1DT5A 4H3VA 3JQ9A 1QZZA 3OFSA 4NDAA 4CU5A 4GAEA 1J1IA 2Q3BA 4D6PA 4Q4HB 3ETJA 3GFVA 5EMNA 5HKKD 2W6JA 5JZBA 1HPLA 3DEIA 3D6NB 4FNGA 2ODEA 4HLUC 1B93A 1QHEA 1W93A 4MQ6A 2P91A 3GGPA 3HI4A 2X4DA 4BLWA 1F1BA 4JFRA 1XPRA 4NPHA 2EQBA 3G5MA 1NLFA 1KC3A 5LKRA 4MXDA 4CIVA 2YNMA 5IW8A 4F5DA 2IV2X 1XZLA 3U0VA 4EUNA 1U3GA 3VJMA 2C4MA 5BOLA 2HF8A 5HSGA 2W2MA 2B21A 5JCXA 2HU5A 1DUIA 4IMPA 1WKCA 1SQSA 3PFHA 3MWKA 4UU1A 3R7WA 3H9EO 1U7WA 4AKGA 1QCYA 1VLZA 2HRDA 5LQSA 3THRA 2YWFA 1YIAA 4DVGA 2DT8A 2HQBA 2GBLA 5FUVA 3H9GA 1U5BB 1QGUA 4AMYA 1PKEA 2NUPA 2QUJA 1T8RA 3M5WA 1T8YA 4JUCA 2OUKA 1E8MA 4ED8A 5C51B 2LIPA 4YJ2F 2IYQA 4P83A 3TNLA 2BW0A 3ZLUA 3TZLA 3ZE9A 1LC0A 1I32A 2JFXA 4JBIA 2Y76A 2FGJA 3UG7A 2Q4DA 3T5MA 3H2HA 2VQFB 3PXEA 4RU1A 4D6YA 1U2DC 3NTVA 5JU5A 8ICEA 5CUQA 4ZI2A 4BFUA 1ZXIA 3MGIA 3TH5A 1DX6A 4X85A 3ZH2A 3LUJA 4JYMA 3TKAA 1JEJA 3SAFA 2JBAB 4UVGA 4WXRA 3O8DA 2BBTA 4WKGA 4PL1A 3RQSA 4TYYA 5AVTA 2EU8A 3EVNA 3H1BA 3P9ZA 1OH6A 4KI7A 2RKWA 4I55B 3RT7A 4M1EA 3F5AA 4TQUS 4K9DA 1EYZA 5EKDA 4LRWA 2O0MA 2PQ2A 5KAFU 4ZT5A 3ANSA 2YWJA 1ZSVA 2W5UA 3PNLA 5IMBA 3G8YA 3AKYA 3TW8B 2HCTA 4KPUB 4WJZA 4KXQA 4MWDA 3L8ZA 4MUHA 3TLCA 5LMUB 2KPOA 3T0GA 4KYIB 4P31A 3GMSA 2ZSEA 4DLBA 2H07A 3FLBA 3GZTB 3GCWA 4P6VF 1K5HA 3NAGA 3MJCA 3DYIA 5I9LA 5A0LA 2HW3A 1BS1A 4YPFA 4F3YA 5FO1A 1FXSA 2ZUTA 1TA0A 1QONA 4NICA 3D3EA 1GQOA 4PYQA 2JD1A 1NJ5A 2GEFA 4MA4A 3RNOA 5BUSA 5KVCA 3WP1B 5DBGA 4JK1A 4JXKA 3Q85A 2TECE 4INAA 1N5JA 1X9XA 1GT91 3ISVA 2X76A 4QDXA 4II3A 4Q9DA 1OPRA 3L49A 3T7EA 4BBPA 2E37A 1EFPB 1X7ZB 1QLHA 4NM2A 2OFXA 1SKBA 3AVQA 3CUVA 1O5IA 4JOQA 1WVMA 3D3KA 2ATEA 1UAYA 4DOBA 1GPWB 1P80A 2CD9A 1YA8A 5JBIA 5ERGB 1J09A 1FXWA 4E2XA 2DPLA 1OZHA 2ZGVA 2ZIGA 1IN6A 4RH1A 3ZQUA 2AN9A 1Q7RA 1YS1X 1QH1A 2HJ9A 5TRTA 1MT0A 1XYVA 3I12A 4FN5A 2ISOA 3L82B 2QPLA 5J0UA 1AF4A 3I9JA 721PA 3NHLA 1RXSA 1FA9A 1TF2A 4OFBA 2ZYSA 2W6JD 1ND5A 1KDOA 1Z4NA 5G4KA 1C2YA 3C3PA 3H5AA 2AN3A 4CHGA 4OA8A 3AB7A 3FX2A 2AD1A 4ARSA 1CY8A 3VC7A 1GPNA 1F7UA 4D79A 4XVHA 3LWMA 1HGXA 1FO4A 3QKTA 4KLEA 2IC5A 3MRVA 4Q7JB 3GP3A 3SYKA 4KMUA 1TZKA 1AA6A 4XEHA 4MPDA 3DUFA 1Y80A 3OE1A 3CEAA 3HEAA 4ZOQI 2P7HA 4OTZA 5J59A 3FYHA 1PQWA 1HIWA 2Z2YA 1E2HA 3LG2A 5CDYA 1BFDA 5G5GA 4B47A 1BHO1 2ZE6A 1S77D 3M6AA 3ZHYA 3SZGA 3AI7A 3D0KA 3LFHA 1ZSNA 4QM7A 1KWKA 3WK7A 4M7RA 1RPZA 1CQIA 3KKNA 3KZKA 1EI9A 1KTVA 1KZGB 5L7YA 2R96A 5LDHA 3D2SA 1K7XB 4LVCA 5AVKA 1W9HA 2RD2A 3AI1A 3LSTA 4LISA 4WJLA 2RHBA 4G1VA 3UYLA 5JS8A 1EDOA 1UC9A 2BQRA 4MFAA 4MRPA 5KFEA 2GAFA 4P98A 2OXTA 4U5QA 3C23A 2HL6A 4UAYA 5LQJA 1OC2A 2XE7A 5KQGA 3RS4A 2BISA 4YFVA 1FNMA 4BKMA 3TVTA 3ROEA 4ZU6X 1XMIA 4N6GA 2PPLA 1SZJG 5EE0A 2AUMA 1NW3A 1P75A 1WIWA 1WUHS 2DJIA 1TYZA 3IB3A 1K2WA 2ODWA 1WCV1 4W5OA 1EGMB 1RPTA 5B2ZA 2CFRA 3I42A 3F7NA 2F59A 5KDDA 4M9NA 1SVNA 3B3JA 5E0OA 1ZI6A 1R16A 4E1VA 5F23A 2IYNA 1O6CA 1URPA 4L5AA 2E5FA 5B7GA 4QBKA 1Z83A 2GWHA 1KFKB 1PUJA 3ELDA 4O4LF 1X8XA 1HUZA 5H3HA 1G38A 1E1CA 1M2OA 2IF2A 2DQ4A 2WOOA 4HQ6A 3SAGA 5SICE 3OMXA 3TIIA 1T8PA 3CG4A 3O0FA 1Y8AA 4JQCA 5M3BA 1TADA 5HK8A 1J7JA 4QYIA 2VTVA 1WPQA 4XM0A 1YDFA 4L08A 1R4ZA 1XWWA 1YFLA 1JHQA 2ZWPA 2R66A 2X3YA 1YDGA 1X8LA 3T1YB 2NTEA 1DOAA 3GXBA 2E87A 1UBCA 2ASVA 4OM8A 5ALSA 1WZUA 1UZMA 4YONB 2BDEA 4MV3A 1QP0A 1QIIA 2OXEA 2DPGA 4F4WA 5CT5A 4JQZA 4B8WA 3GROA 4RU9A 3E48A 1NW5A 4LE1A 3H6HA 1UP4A 3B2NA 1MDFA 4N9QA 3P2OA 5F9NA 3KTFA 1IOWA 2WD7A 4RLQA 2Z83A 1VBFA 5EZYA 3LVBA 3MT8A 3SSAA 3ZG6A 4CMIB 3QPCA 4KFRA 4QUEA 1QO0A 4P35A 3P7MA 3E1SA 2HWWA 4O5KA 3UANA 1UBUS 4C5AA 1ULBA 3PCTA 1C9NA 1E5TA 4X44A 2DBZA 1HT2E 3VNUA 2AKAB 2WAXA 3C3XA 3KXDA 4YP5A 3GIKA 1S9FA 3Q3IA 4YUZA 4OMFG 5F76A 4GPBA 5L4NA 1ZQSA 2BCQA 2QUBA 3O4FA 4KAJA 1SUIA 4TLDA 3KSRA 2A4KA 4L9WA 2YIMA 2LKDA 1KBOA 1V8FA 3T7AA 3BGOS 5M04A 1CNMA 3C29A 2JZOA 4XM1A 3I23A 4HPWA 4IJQA 3OICA 1H2RS 1XTSA 5HXAA 3H1TA 5EPUA 3SAHA 5HFAA 2F44A 3KVRA 4WXYB 3S2UA 2GI4A 2VCYA 1UFOA 3V4RA 4KZPA 3AZOA 3ELBA 4RY9A 3H5WA 1THZA 1L1EA 4MMXB 2CLFB 4BMXA 4YR3A 3K4GA 3WKDA 2RI6A 2PJUA 5E1OA 1FX0A 4RZIA 2QAJA 1W4ZA 4C0AC 2IV7A 2ZUDA 1ADYA 3NC1C 3BDPA 4MQUA 4IXDA 3IT0A 5K8UA 1MC4A 2AFHB 2HXSA 4CNQA 1K6JA 3JYPA 2CLLB 3AF4A 2GZ2A 5J0RA 1D2HA 4CLRA 2WF5A 2OHGA 4M49A 1M0TA 3X1XA 1JGTA 1LI4A 2JD0A 4BWJA 1OF1A 5E8RA 1DEAA 2HK8A 4X97A 4CLOA 4UM7A 1D4ZA 2IYOA 4EF6A 5KFKA 3FOZA 1E79A 3I6IA 5FBLB 2DGZA 1EZ4A 1FVHA 1E92A 4Q1CA 2XZPA 4PRYA 5FI3A 5SZJA 3HM9A 1BQ4A 4Y67A 2WIAA 3GLFA 3WJAA 2HY7A 1RVV1 2ECOA 3TXAA 4W9RA 4NH0A 1U45A 4MYSA 8ICOA 2D3WA 4RVCA 3MMNA 1Q8KA 5I9IA 3PDHA 4U9HS 3LECA 3D2QA 2GF9A 2PTHA 3TQOA 3GGOA 1YE5A 4WQMA 3VTFA 4X1OA 4KZKA 3PSAA 2NAPA 4WMLA 4AF6A 4TWJA 2G4VA 4DBZA 5HJ5A 5BVGA 4DEYA 1Z5WA 5C4IA 2QM3A 1AH2A 1EVZA 5JSUA 2ZS9A 1NHGA 2ZI5A 3E3NA 2H3QA 1SXEA 4P33A 2FZEA 4WZBA 2PG3A 4RY2A 4Z9XA 1W36B 1E1RA 1NBHA 1LSSA 3IQWA 2VPZA 2D7CA 2NM0A 3RW9A 3F67A 4NRDA 1JQEA 5EXXA 3ACDA 2AGPA 4M36A 3V3KA 4Q1DA 4NV0A 4F4XA 3RHSA 1WB5A 4MB6A 1TPZA 4LN1A 2Q29A 2FJ0A 2IW3A 3WAGA 4AZTA 1Q57A 2QV7A 2ALZA 1Z1VA 1GFZA 2C2OA 5C8ZA 2MINB 1PWZA 1KHHA 2W00A 1XN4A 3JQ7B 3OUUA 1KEJA 2FP4B 4JHLA 4LVSA 4MS4A 1L3UA 1SC9A 2ZS7A 3ZOZA 5I3ZA 4DZRA 2QLJA 4ZXPA 3SMQA 1OOEA 2F4NA 4DOCA 4TL7A 4V0MA 1NMYA 2I91A 1PK3A 1QO0D 3F1LA 5JQGB 1N3BA 3CTPA 3EVFA 2ACEA 4LMAA 5E9WA 2BTQB 3GMIA 1NU8A 1F1JA 5KFXA 2BFAA 1Z0SA 3IVCA 1SA0A 1P4JA 1K88A 4EVSA 3RH6A 1IN7A 3KVOA 4DLWA 3LLVA 5TMPA 3ZWQA 1SIJA 2PS0A 4FR2A 1G42A 5K3EA 3CW8X 4Z4EA 3HDJA 4Q4HA 4D8TA 2IELA 2MJLA 3NRBA 4NVRA 2Z8YA 1ZVMA 3EOZA 1YQTA 4TQ9A 1H2HA 3GK3A 2H0RA 1XPJA 3A3OA 3BS5B 3K9QO 4N7RA 1L5RA 2XE4A 3I76A 4JI4B 4L5YA 3VDMA 5JNRA 4H2DA 4K26A 4LV8B 2VAXA 2OV6A 4RKEA 1RPLA 3CVWA 1X92A 4YECA 2B8WA 3NDJA 1YU6A 4KX5A 2PUTA 2JI9A 4WBXC 4P34A 4JGBA 5FBWB 2YV4A 3NYQA 4OUKX 3IQXA 4GMKA 1GG8A 1RYUA 1DAPA 1P45A 4PFJA 2UUAB 1YTUA 3SX2A 4D9IA 1U3FA 2KJ9A 1XRLA 5GWXA 2G77B 5C7YA 4RIHA 5ITVA 4RETA 4RPIA 2XOEA 1UJ6A 2ERCA 3VSBA 4HDMB 1DT3A 3TGWA 2I2BA 4XUEA 4RPCA 1KQQA 4AJJA 2JGRA 1MT3A 5CB0A 2HSWA 3ZBPA 3SX0A 1QDUA 4WKNA 1U7OA 1Q2XA 3NOOA 1J2UA 2X7JA 2YXDA 3K9NA 2Q8NA 3J7TA 1P9OA 4C5CA 1R00A 1E62A 5JMTA 4OA5A 4B9MA 3M9OB 4DWIA 2WRZA 1E79D 1UFQA 2GEKA 2FPGB 3IPRA 2PUCA 4G63A 2F2TA 1NK8A 1JFVA 1LBHA 2YYYA 1KS2A 3A9CA 3M8RA 1ZMTA 1JXLA 3P2IA 1AQUA 5BV0A 3LT2A 2W48A 1CQXA 3AW9A 3L43A 3FMVA 3AR4A 5I01A 4I55A 5DNDA 3THVA 3PGKA 5GINE 2P4QA 3EXHA 4V0KA 2AYXA 2Q0QA 5EP4A 2CXHA 3V34A 1Q74A 3IODA 2R18A 4XQ9A 2RHLA 1H2YA 2J9FB 4WK0B 3QQPA 2EAPA 1JDPA 1OTHA 5L3ZA 3HMKA 3TW8A 4B4WA 5K6AA 5AI8A 4I2CA 2ZJ2A 2R6R1 5B58T 1F2UB 4YRSA 1AN9A 1J8MF 2WJ4A 4N6NA 3CZ5A 3RJFA 4BJ6A 1T0HB 1EFRA 2ZVDA 4TGLA 2QRGA 1E1RD 2FCRA 1V43A 1Y48E 2BI7A 1FJHA 4AU1A 1K8RA 1IBLB 4M7WA 5KOHB 3D8BA 4F4FA 4JH0A 2P30A 5L45A 1TZJA 4LRXA 1RXVA 3FTCA 1VE1A 2XB2A 4DR4B 3UT6A 3ZDDA 2Y67A 2YHAA 3UAZA 2X2PA 2ZIFA 1Z29A 1WEHA 2XT9A 4QL3A 2O9JA 4MWCA 5AHWA 2QLLA 4PIPA 4Q3DA 2H3IA 1ILEA 5FUQA 5KYWB 2PUBA 4IR9A 1CRLA 1AIPA 4DRYA 1ZKMA 3ND9A 3IRUA 2PE5A 1NM5C 4URUR 4TQAA 1YBAA 4PGFA 3TM5A 5IZCC 2QJFA 1V85A 1EFPA 2PUEA 5DYTA 4LY0A 3R6GA 4AL4A 1UL1X 3AHJA 4FWBA 4EHAA 1XQXA 2VUIB 3TEFA 3LXUX 5JD3A 5CGZA 1COKA 4DLEA 1KY4A 4NENA 4TT3A 3HU5A 1O96B 3TR6A 3UJAA 3USES 2I1LA 4GFJA 1NFRA 4DCUA 2HM7A 2C0CA 4Y8VA 3AMZA 5FL7A 2CLMB 3CUUA 3PTZA 1MIHA 3GUHA 4MS1A 4MUEA 5JT1A 4F5YA 1USGA 4PSVA 2COEA 1UZLA 4AYXA 1RKUA 3AR8A 3TX2A 5EIFA 1TMKA 5CX1B 1AKRA 1P2BA 3FCXA 2XQFA 2W7PA 1G7RA 4RNOA 3EZ9A 1JTVA 4MROA 2NACA 4KQCA 1U3TA 4I2IA 1QF7A 4BAZA 2J31A 1ELOA 2FFRA 3AO0B 1Z73A 3OZDA 2H4JA 1WZIA 1QPBA 6REQA 3TECE 2IKQA 1W2GA 4CYMA 4BZPA 2FUNB 2Q3MA 4EI2A 2Y93A 2P0EA 3HY4A 2J5QA 1KAOA 2W2KB 2PKWA 2VEDA 5DP1A 4TWZA 2JLVA 1S2DA 1EJ2A 5H1YA 3H7IA 4ZAFA 1OX4B 3OFJA 3RC1A 1YSCA 3IIIA 5L1JA 5JFGA 4DLUA 2AN4A 3KJXA 3DD5A 4MRNA 3RB3A 5FHQA 3U3KA 1B8NA 5CEHA 3LF2A 2BT4A 1BCSA 2B7CA 8ICWA 5B6JA 5LBTA 1VBKA 1I3OA 4M54A 2V45A 1PEYA 5J2KA 2GK3A 3MIIA 3BXFA 3JASB 5GP1A 2FUCA 4YAGA 3GUVA 3JYOA 2HPAA 3GU3A 4ROTA 2EZ9A 7ICHA 4K4HA 5K0BA 2JZNA 3MW8A 2JIPA 1GKKA 4F85A 4XLLA 2VXYA 2C7VA 2OCIA 1D7OA 5JAHA 1HORA 3VYUB 2OHOA 4L73A 5TISU 5LNK1 1L5KA 3ABZA 3NBYC 3HPQA 3OJCA 2WDZA 1IJBA 3CKKA 4TKLA 4EY8A 2HLPA 1GQRA 4X61A 2CBZA 5F51A 5AHKA 1NUUA 3GJSA 1W47A 3ABQB 3C87A 3KB2A 1SZPA 1FY2A 2OECA 1RI5A 3ECAA 1WDLA 3DPUA 4FMCB 3G2KA 2J07A 3P9RA 4MPTA 2WFMA 2ZCJA 3MYYA 5CT8A 4A10A 2ZATA 3PX4A 1EFRD 4XDGA 4XI9A 1U99A 4NMMA 1XWIA 1WB4A 1N92A 5C80A 2GTHA 4OL0A 4BQPA 4RABA 5DXAA 4RCYA 1I0LA 1AUOA 1KH1A 4B6EA 4EGCB 4JB2A 2HWUA 4QREA 4XWYA 3AY6A 3U39A 1NATA 2GCOB 2BWJA 4JELA 3RREA 4KE8A 3R7WB 1XDDA 3TAUA 3LYUA 1ZYQA 4Q8FA 4MMZB 4Y2PA 2VWGA 2FK8A 1RDFA 3ZWXA 1M9NA 2PFQA 2FQWA 3MFQA 1MLDA 1QGUB 2ZP1A 3RODA 2NUPB 3SHOA 2MU1A 1H65A 1NVVR 5E6RB 5IDWA 3DCJA 2PZJA 5LP6F 4UPVA 1PWEA 1F12A 3WLPA 1K3FA 2CHQA 5A62A 5LZ8A 4M8IA 3A1CA 9MHTA 3LM8A 4HADA 2VWHA 1S8NA 1OMOA 3BE4A 3RRNA 5F98A 4MB0A 4FGJA 4ZCQA 3BJZA 4AZWA 4BO2A 3WIEA 3FPAA 2YV5A 1JYEA 3PHBE 1V8ZA 1WUYA 2XV1A 3OHPA 1EP1B 1O6FA 2HBRA 3IP4B 2D2VA 1KU0A 2E4YA 1SXHA 4EW3A 5GJVC 4TT3D 5SYNA 2ZTHA 1IV8A 2GBFA 5ALVA 1IZ9A 1CVRA 2XUAA 2D8AA 2IBSA 4J9QA 1R66A 3SEAA 1S7GA 5IC4A 4CMIA 3ZN2A 2P6PA 1TUIA 5J5VA 3QE0A 3W0LB 4I9GA 4ONEA 4PZNA 4FYJA 1J8QA 4UM9B 4WTOA 1EXWA 1DWQA 1HI9A 3EJ6A 4PQEA 1BW9A 1V38A 3IHKA 1M2EA 2WKSA 3DEYX 3GRCA 3QHAA 3R0VA 2YIVX 3HILA 4EPWA 5E9JA 1X9SA 1TVMA 3V7NA 2KBFA 4HAIA 2YUIA 5GIOE 1K75A 2QTNA 1IVNA 4QXRA 1BU8A 2ZIZA 4WXPA 4GLLA 4KRXA 3GDOA 1TFRA 3UMGA 3OLCX 4EWLA 1J2NA 1YH3A 3OZSA 1M8GA 3GLKA 1KIFA 2FSSA 1QP4A 4KP7A 1GARA 3JAKA 3WFZA 1VZ2A 1Q3KA 1HEYA 3BWEA 2NO1A 3GMDA 1PL8A 5G53C 2W2QA 3B9RA 1P7VA 2X4IA 5FOWA 5JYEA 1NR1A 2IL1A 3O91A 1XR3A 3ZR4B 5IM5A 4IGIA 1U2RA 2H4XA 4QU0A 2PM8A 4RSMA 4XAQA 1KAGA 2BJHA 3OCXA 1CUCA 3ELYA 5BYAA 1I6WA 1KMQA 4HBZA 2HDHA 3ZCXA 1LPAB 2TSYB 3LUHA 2W83A 5AIAA 3WC4A 3HB9A 5FUBA 2GM4A 2P65A 2R6FA 4Z5XA 5KSWB 4D9EA 1NVEA 3D7SA 2XDQA 3ZWKA 2WJZB 3FZGA 4M9RA 2NQ2C 3UHPA 5ESXA 5BWOA 1N77A 5A3QA 1J23A 1DOZA 4OGWA 3NI2A 3LGAA 5CMLA 4DSAA 5CLIA 1B74A 3HVHA 4CKYA 1E3DA 4NY8A 3TD9A 2B2NA 2ZTUA 1DBWA 2UVUA 4W8OA 1TIKA 1Y88A 3QF4B 3P1JA 2D5LA 5GONF 1Z4PX 2VI5A 3MXOA 3BMOB 4LOHA 1W25A 3HWWA 8ICMA 1YULA 4B85A 3Q5DA 4HAVA 3WV5A 3B1WA 1A5ZA 1FSFA 3PHIA 4WLOA 3M8KA 3Q15C 3HU3A 2WTBA 3ROFA 1H9BA 421PA 3QWIA 2D7JA 2QX9A 1PVQA 3AOGA 1D9ZA 1EFLA 2Q41A 4HC4A 1TM2A 1JA0A 2R2GA 4I3GA 4DRXB 5EEGA 2JCYA 4ZMRA 3TARA 4Q05A 4QZVA 1N9KA 2FMIA 3IQFA 5JNWA 4F45A 4QZAA 3PO4A 4HWRA 1KI1A 4ZEOA 1ZU4A 3EWSA 4KLUA 3GEBA 2DKZA 4DMMA 1TYBE 4ALKA 4M9UA 1BDMA 3A6PC 4QNNA 5AJTA 3O3CA 3JQ7A 1UFVA 3JQRA 3WSVA 2Q4EA 3O38A 2BR0A 4C0BA 4GOMD 1M10A 1H4VB 1OFTA 3C6YA 3CPEA 1JIXA 3KL2A 3TOZA 5EMMA 1OX5A 3PGVA 2KK0A 4KV7A 5EA2A 1SV0A 1VBNA 4B71A 2H1FA 4IGFA 1Y3DE 5LD2B 2BDPA 4BGEA 2EWVA 4J49A 2I6SA 1NJFA 4FT4A 5EJEA 1FDIA 2QTVA 3QWHA 3EUEA 3R5TA 3PX3A 4XTRA 2FZCA 2GVZC 2ZBEA 5JCZA 1HE4A 1GCGA 4TYWA 3E2EA 1QSLA 1X1EA 4MPJA 4ND1A 2GYUA 3AF5A 1ZIYA 1QRUA 3PUZA 1C7FA 4U2KA 5BRNA 1T13A 3ICXA 3O2SB 1SFRA 2FFHA 3HB7A 4Z8YA 4Z6KA 3QFTA 4BNNA 5IC6A 3Q40A 4WLFA 3ISBA 4S1NA 3EJWA 5JEDA 5KSPA 2V4MA 3IUNA 1IMJA 3VC8A 4U7CA 2PSFA 4YMWA 4UCQA 1WVGA 4C4XA 3HJHA 3AH8A 1T4BA 4X8LA 1C80A 1BKSB 1XIVA 5JCJD 1WEKA 4WOJA 4FT2A 5F3XB 4YQWA 1GFIA 3LWZA 4PSUA 3T1TA 3K70C 4DIMA 2BF7A 5EL0A 3QSYA 1RLOA 4G5YA 4FS1A 1PEDA 3OM0A 3H83A 5H80A 4N3GA 5IJXA 1PNVA 9ICNA 3CF6R 3G9XA 3M5DA 3OY7A 4HDMA 1UK6A 3A7EA 1OXSC 2IS4A 4FYVA 3WYNA 1QF9A 4TXHA 3B52X 1MQ9A 1V7PC 3CFYA 4OBEA 2O4CA 1R4NB 1R0ZA 2HBYA 2FN4A 1BHSA 1AKVA 3F49S 4DIDA 3SC2A 5G1PA 1A98A 2WD7B 4H17A 3DZCA 2ZJ4A 2FPGA 1NJSA 3ZDEA 1XZIA 3R6LA 4EHHA 3JSXA 4ZREA 1KDRA 2Z6AA 1DC5A 1YRAA 3QE2A 3H9UA 3AYZB 2ZIUB 1T1IA 4MDHA 3CVYA 2IYVA 1UZUA 1CF4A 4E7OA 2HNKA 3M34A 2G06A 2VP5A 5IINA 1FVXA 3SE7A 1O03A 1G9SA 1VJ1A 5GMOA 4CKBB 2BCVA 1XNRB 1U04A 4UBOA 1U4NA 4XIIA 4JSRA 2WPDA 1WYGA 4RPXA 3O6VA 4F6CA 3MGCA 2UYQA 4RPZA 3HLKA 3N7PD 2NTNA 2PUFA 1RHUA 3I9V1 4P86A 1URJA 2IXFA 1BPXA 1JECA 1JVSA 3GWGA 3IOCA 1MO2A 3OLXA 2EGHA 5IUKC 1FTSA 1RJWA 3BGSA 1BU5A 3KR9A 5TSDA 1W36D 4AXXA 4MGKR 1KPGA 5KOHA 2V98A 3FNQA 4Z0NA 3RABA 1YJ5A 5DOVA 3QLEA 4FKBA 1OREA 4UC0A 2OESA 1JHZA 4XUCA 5G40A 1X7WB 4OHUA 2ASEA 4OHFA 1Z9BA 3KYCB 3TYXA 4RHEA 3H8MA 3CLSD 2BPFA 3EG9B 3PPXA 4QTTB 3IA7A 5I5GA 3KUXA 2PMEA 4OP3A 4PXAA 1GUFA 4LGYA 2G5TA 3S6JA 4P7FA 2JCXA 1GDTA 3GL9A 5JRZA 5J3JA 4MJXA 4CKXA 4DLGA 1SR8A 1ZQRA 1V25A 3FDZB 1OBVA 4G1EB 2A1JB 3TRKA 2D2FA 3ZKWB 4CLRB 4UOEA 3C5WP 2EQYA 9ICIA 4ALNA 3NH9A 4OMCA 5ALLA 4MWOA 2N47A 3QMVA 3BUSA 2MSCB 3WWZA 5KFOA 3O8NA 1NBIA 1VQ1A 3GILA 1TQ6A 2PIAA 4HNHA 1D0IA 1LBEA 4M1YA 4QDTA 1NMSA 1EA5A 3B8EA 1O96A 5J0TA 2H2WA 3GLFB 2EC5A 3BWBA 4YAOA 1VJGA 2X0DA 1DKUA 4QJ3A 3PE6A 4ZVUA 4I27A 3PDIA 4D56A 3V7YA 1O58A 4X3PA 1YD7A 1R6VA 2G40A 9ICEA 2H7VA 3EIQA 2IYXA 1QTRA 1UT6A 5HUQA 5CX1A 3CMCO 1YVPA 2JHFA 3CUKA 2PAAA 4ZJPA 2PKQO 1YI0A 4RQ6A 4L07A 1Z0AA 1DARA 5SY9A 1YUBA 4HAUA 2XGQA 2FYTA 1V2HE 2C07A 4DWJA 5JYCA 2AGOA 4QOHA 3HCFA 1M83A 3MEQA 3AKZA 2HHUA 2HJWA 3S99A 3L6CA 3FB4A 4G0UA 3AHHA 5DM2A 4IKEA 1CC1S 5B1SA 3NGMA 3MC1A 1YQXA 2FSUA 2W2KA 1XTVA 2F67A 4ND7A 1B42A 1Y8RB 3DTTA 1GJRA 3BDVA 3WGTA 16PKA 1GLNA 1U90A 2QIPA 2BM0A 4G6ZA 5AJVB 3G0GA 1T2AA 2RDMA 7MHTA 4B82A 2D0DA 7ICFA 3VYVA 4RANA 5K0ZA 2CE7A 5I7HA 1Y7HA 3E81A 1EM8A 3C3DA 2GB4A 1P81A 4K9RA 3WWPA 4MS4B 5D00A 3U3DA 3F7OA 4ZYTA 3L7IA 4MIOA 4Y9UA 3LKZA 3ND5A 2WJ3A 2Q1WA 2O8VA 4XD2A 3TDNA 1Q92A 2FR0A 3UGTA 1B0ZA 2CNBA 2C9YA 3CEHA 4F9TA 3V1TC 3RK0A 1UADA 1RIIA 2UVDA 1BX1A 2WMYA 1Y4DE 4RHUA 3ZWOA 3VZPA 1J97A 4GX1A 1B3RA 1W88B 5D3QA 1SA0B 4E6PA 3N75A 3KLPX 3CSDA 4P4OA 3H2SA 1CNFA 4I14A 3RIYA 4Y2SA 5DSTA 1KERA 4PG6A 3U09A 4HSGA 4ND3A 1GFSA 5JE8A 3T5KA 5M5BA 3K2IA 3WQHA 4Y2YA 4RKRA 2IPXA 3PL1A 3LV8A 1U8UA 3BXEA 1PP4A 5ERYA 4GC7A 4YO8A 1P2TA 5KYVA 1PF7E 2IMWP 5AJWA 3GGJA 1VSBA 3EXAA 3H17A 3K9BA 1L7AA 4U2EA 3HDYA 2WM3A 3VR4H 4DIKA 1I3MA 1M66A 5JD4A 1G41A 4ES6A 3MWGA 4GWGA 4UAVA 2NV3A 3ZCUA 2VHCA 4KAFA 4KR3A 1LPNA 5EY5B 5CJ2A 3LRXA 1VG1A 2Y92A 4KXFB 2GCOA 3DFUA 4GNRA 1OX6A 1YMVA 3RSLA 2Z09A 1JIVA 2AQ0A 3AHDA 3AESA 3P4UA 3GV7B 4HGOA 2K8CB 1KI4A 4DIEA 3UA4A 2Y99A 3TQ1A 2Q5EA 4MUAA 1U0FA 3O8RA 5IANA 4K3UA 4OBXA 1PZNA 3L0DA 4OHZA 5CM2Z 1F2TB 3VKGA 4RH0A 5E6RA 1X2BA 1LLQA 8AT1A 1X9HA 1MA3A 1N61A 4CQMB 2ASLA 3E6AA 1EHIA 4QTYA 4DG9A 5JJCA 2H2HA 3FWZA 3UOWA 4NU8X 4RH3A 5DLPA 1E20A 3A1DA 2YZMA 4Y2RA 1JWLA 3NPAA 5EXTA 4O2AF 1S2OA 4F5PA 1T3LA 4URXR 2VBGA 4HP8A 2FFJA 3NS7A 1RJEA 3AJDA 1OBFO 4D9KA 1HETA 4KSYA 2X77A 2WD9A 5I9NA 4O5OA 3VPAA 4C4RA 1PHRA 2IPNA 4D4IA 2Z6QA 2Y0PA 4PHHA 4FD3A 3WRVA 2YQ5A 1J4AA 3ZGYA 4Q03A 3ZXSA 1I2BA 2BTOA 1QG2A 3QIAA 3QG5A 3VR5A 3L93A 5TGTA 1J9ZA 4RGYA 1I5EA 1VB3A 3JWPA 5D5QA 1LH0A 3LVRE 2Q2QA 2I4IA 3I6MA 3EXHB 4IWYA 2FSVC 4G5OA 4ASUA 1TCCA 4K0RA 4BKQA 4DUGA 5ESWA 3QW4B 1TK2A 4UM5A 1UAGA 1LW6E 3EPIA 3G7SA 4DPLA 2BHSA 4LV6A 1L5GB 2B0CA 3NT2A 2WZDA 3V4LA 1KRHA 5IG2A 4QWEA 4KMRA 1D6MA 4QOIA 4UARA 4ID3A 3NRJA 2P90A 2WB1F 4HRYA 2ONYA 3BDIA 1ZOSA 3D8UA 1JKIA 5IFLA 3VYRB 1JIIA 4XWWA 1IN5A 5FPSA 4D0SA 1M5UA 3UV7A 3NIGB 1O95A 3H5RA 5AUQA 1L5VA 1U98A 1MGPA 3NLLA 2RHDA 4GP6A 3WO0A 3TF5A 2B2XA 2X0JA 2XMCA 4K3VA 1YAHA 1O97D 2H52A 1E2JA 2FWMX 1S2GA 3I9KA 3QKUA 1N63A 4AJEA 4DF4A 1H66A 2FEPA 4FFWA 2DR3A 1Z0JA 2OG2A 2P9BA 4F5QA 9ICOA 1U8YA 2Z6UA 1NF2A 1SPXA 3JZFA 5HKAA 3TUIC 1RRCA 1X9WA 4KXVA 4OJKA 4LC1A 5H5JA 2WTEA 5I51A 4I28A 3MFYA 2EERA 3HC7A 2I7CA 3IT2A 2FOXA 1WV0A 3V6HA 1N48A 2R86A 4NENB 5T14A 4E3ZA 1NKEA 5E7QA 3L7BA 4PHEA 1F4VA 1TI7A 3N7RC 4XLTA 3T5LA 3N4MB 1GRRA 1OXBB 4TKUB 1CUJA 2AZTA 4MS1B 1SG9A 2JLQA 2XJ4A 4ZT2A 2D5BA 3C3AA 3DL2A 3QF4A 4MCJA 3TUZC 1E2NA 3VBCA 3CEMA 3T5HA 2PJRA 1KN5A 3BMOA 4FXOA 3LDAA 5B36A 3LNCA 3W2GA 4YUVA 1MEJA 1W1UA 1IMOA 4PC7A 1RWPA 4MK4A 1Z0FA 2CEAA 1V45E 2YNMD 2UYYA 1TJNA 1VMKA 1KEPA 1AN0A 2TMKA 6REQB 4JSTA 3EZXA 5KYYA 2VHJA 3DO8A 1NRXA 1N6HA 2P0YA 2ZUWA 1VL6A 1M2KA 3WLQA 1ZQCA 3ZVNA 1CJUC 2L17A 2F77X 2C5HA 4B80A 1I14A 2HADA 1DG9A 2FWJA 4DRXA 1RQGA 4M0AA 4J0EA 4C80A 2FF5A 3B6ZA 2WE7A 2X1MA 4PS0A 4NE7A 1P0FA 1WULS 3IUQA 1M1NA 3LOUA 2F64A 2DUMA 3RRFA 1BCSB 1KQOA 2E55A 3AF1A 2EJVA 4GU5A 4WW0A 4GYYA 3UXOA 3DD1A 4Z8XA 2QTGA 3U62A 3PHLA 5KFGA 4QRDA 2X5NA 2JB9A 5KG5A 5FQNA 3PD1A 2JCGA 5KNLA 3S8MA 3V7LA 1DIHA 2C7GA 3ASVA 1QSSA 4BBZA 2EZ4A 2WQZA 3VR5D 3AFNA 1PT7A 1EEHA 1LSJA 1FUIA 3E7WA 4ICIA 1I4DD 3KZNA 4UM9D 3TTUA 4RS3A 3ILSA 4ASUD 1V5FA 1MFPA 3IXLA 1TZCA 4Q1AA 4DUGD 1TCAA 4AN1A 1YZNA 1LSOA 3TFSA 1YRBA 3W2HA 5DEOA 2E6UX 4E30A 2G80A 4ZT6A 4NL4H 1ABEA 5K2OA 1AXRA 5DZSA 1G59A 2CCKA 4A0RA 3QEJA 3FBGA 3OPYB 4P1ZA 4V24A 5LYJB 1KTQA 2VIXA 4HDSB 2XQJA 4R0NA 1MGOA 3BSWA 3DAOA 3G6WA 3UMJA 5KFCA 1W30A 3FROA 3HCAA 3WBJA 4JC0A 1JZSA 1RLIA 2OGSA 1PO7A 1TO2E 2WG1A 1O95D 3HN6A 5CFMA 4MQBA 2Z9BA 2FOIA 1MC5A 4ZODA 1I9CA 2YVQA 3R5FA 4I9FA 4AN4A 3CLKA 4I4LA 4HKTA 2QW0X 5K7SA 1JQDA 4RD6A 3KKPA 4OHMA 4ECQA 1TECE 5B3AA 4RHFA 3UOGA 2FUKA 4WV3A 3N6XA 3VSEA 1AU9A 1OZ0A 4MDYA 4DY4A 3ETNA 1O9GA 2IDMA 2IPAB 1R4NA 4ETNA 5A1JA 3ASZA 2FWAA 3JR3A 1TQDA 3I9MA 2YH2A 1TDJA 1UP7A 3GBPA 3IS3A 3NOXA 4ZYZA 5LQKA 3TLMA 5AM5A 5LMNB 5CURA 2BC9A 2JK0A 4H7KA 4Q7LA 1QKIA 4PLYA 5DGCA 3F5SA 1HE1C 2E2WA 3BK1A 2ZIUA 3KPYA 2WAQC 3E3LA 1GRQA 4RQ3A 4H16A 1E6MA 4CKBA 4YIKA 1IY0A 4DM4A 4PG8A 2XCTB 1BW9B 1Z88A 5EQDA 3DO5A 3KQNA 3F98A 3E0QA 1GLGA 3LCMA 3GH3A 2Q4RA 1Y0BA 4NJ8A 3BFVA 1JHMA 2OORA 1M5RA 2RB4A 4TL8A 1X7HA 5LQAA 1CS0A 2RHHA 1GG2A 2Q9CA 1OFHA 4ZVMA 4YCAA 2I6GA 3IN5A 3IEMA 4HWGA 1RZRA 1QLWA 2WYWA 4BZQA 4L7QA 1T0UA 3WO1A 3K8OE 4OYLA 1C9YA 3JAKB 1KP3A 2CMGA 3DFMA 4F91B 4TLLB 3S29A 1CRPA 4YBRA 1NYTA 2C03A 3LUPA 1L4EA 2EHJA 4DL9A 1OCEA 1QHYA 1X7WA 4W1PA 2VANA 4KUHA 3DBIA 1A8HA 2GFIA 3GZ4A 3KYCA 2ZYTX 1VI2A 2BCJQ 1K4YA 3F2CA 2WYUA 3EG9A 1HOTA 3OHMA 2O0KA 4QTXA 4F4YA 1MOPA 1YB7A 1QYVA 4X8MA 3MILA 5ARBA 2XYHA 3M3DA 3X1MA 3KWJA 4DQSA 3R7AA 1F2DA 3HDGA 3ED5A 3ZD7A 1WW2A 1EUZA 1KIAA 4YRTA 2G5IB 1Z7EA 5I7VA 3FDZA 4Y1EA 1CYDA 2A1JA 1H93A 3ZKWA 4I4NA 2IP2A 2D3DA 2GPSA 1HKUA 1ZW1A 2GDZA 1XNQB 2WJYA 2GO7A 2XDQB 3FN4A 3MUFA 3H1GA 1SU8A 3QK7A 3A1TA 5A4DA 1MD9A 4IV5A 4EKEA 2LPMA 3HNRA 1KZ1A 2V7GA 3PFFA 4JUAA 4C08A 3G8AA 2JR5A 5IT5A 2GPJA 5EIAA 4HLDA 4BMPB 3AR5A 3K96A 3D2AA 3EFHA 1G9XA 3A4MA 1XZHA 3PENA 2ZJBA 3PNSA 2ENUA 3UXYA 2V1UA 4Y2VA 4ECWA 5E7JA 4OJ6A 1O8BA 4XW2A 4M7OA 3L0YA 2C4UA 3D3WA 3EC2A 4YUYA 3W9BA 3RKRA 3KDPA 5EVJA 2SHKA 1G2OA 2PUHA 1BMTA 2VF8A 3O1JC 4EYHB 4DMRA 1XKQA 3G0BA 1NKVA 3AEVA 4PGYA 1ZPDA 4OJOA 2ZJ7A 1VYHA 1BXGA 2EIXA 5C8XA 2LMRA 3VOBA 3ZKAA 4A03A 3ISTA 1ULAA 2DB3A 4YGYA 3VFDA 3RTCA 3A0HU 3MFHA 3DEKA 1IBKB 1WCWA 1Y8RA 4QTUB 3GEIA 3LHKA 1OYOA 1BEZA 1CP3A 1CQWA 2X41A 5DJ5A 2J67A 2JAQA 4ZVRA 1WXQA 3PQEA 3Q10A 1OFGA 1NK9A 1GU1A 3W4KA 5AM4A 1SGGA 4MVXA 4B3MB 1UC8A 1MJ5A 3OM8A 2OUIA 3DE6X 3GJ4A 4BVBA 1KR2A 3EF0A 3CH7A 3ER6A 5DULA 1Z25A 1Z2OX 1USKA 3I5YA 3TLBA 1SXIA 1YR2A 2C78A 4DJFC 2K7ZA 2BCRA 4KV9A 4YQFA 4QWBA 2VP9A 4IH9A 4J29A 5T4EA 4CKWA 2GUWA 3TLXA 3K15A 1TJPB 1K4KA 1HOXA 2JHGA 1TJYA 3WGGA 3GVIA 3I01M 2VKTA 4EG3A 1W88A 1Q1GA 5AUNB 2QTVB 3EDRA 3BQ1A 3FGOA 4MVCA 2GJKA 3Q2OA 5DW3A 4ZO7A 4IGAA 1ZITA 4I1UA 2YC4C 1ZIOA 3G59A 1CY7A 2NZWA 1T3SA 1PSZA 3CWQA 3N9IA 4O4JB 1RZRD 4NCKA 3SYZA 1IEQA 4QM6A 4CIBA 3BICA 2JFHA 5LQUA 4F3NA 1JE1A 3DXXA 4ZJUA 4X1YA 4ELTA 2W93A 5IF3A 2QTTA 5C8VA 5FPYA 4JUBA 5KFJA 2KVSA 2O7VA 2QTWB 1KEWA 1EB9A 6ABPA 3E84A 3DQPA 1CZNA 2N0SA 3M4XA 4ZOLF 1E4VA 4DCGA 1IG0A 1RRMA 2CJFA 2VJMB 2XKKA 1DUVG 1TAHA 1SELA 1F2TA 1X1SA 3O4VA 5FT9A 3CMMA 4RADA 1X8KA 1M0EA 3WRYC 1FMJA 3Q9SA 4CQMA 2I9GA 1ZK3A 2P1DA 3E9CA 2BMEA 1G1MA 4C7XA 4N76A 3T9AA 3TAXA 1S2LA 4RV4A 3G2LA 1O94C 3SC2B 3RFFA 1R0KA 4S05A 4HFMA 3M1AA 5ICCA 1UPXA 2QSYA 1V1RB 3D5EA 1ZW6A 4KQGA 4I5DA 4D0GA 3KSMA 2RBEA 1Q16A 1J8DA 3WNQA 5LMCA 5JH7F 1UPTA 5JI3E 1E4EB 4Y9SA 1MABB 1R6BX 1KNXA 3UIEA 3E2IA 5JECA 5G0UA 3EHEA 1VJCA 1LJUA 1NUQA 3R7BA 4KVAA 3JQPA 3F8SA 4MGEA 5CB1A 2J3HA 4PO1A 4ZALA 1N2HA 2O57A 5J2IA 3FTNA 3PFBA 3F4KA 4IL6U 2KYRA 1DAOA 1W4RA 2DFPA 2QTFA 5SZHB 3LTNC 3JPYA 2CVQA 3IVGA 3KPUA 1IXSB 2AC2A 4ALJA 2CL5A 1ESDA 1UJBA 1ZCJA 1IE3A 2WZCA 5J1SB 1ZCFA 3G89A 1V16B 2PKQP 4BEJA 2HOIA 1RQRA 2Z7JA 4ZOCA 1HFKA 1A77A 2FPOA 4WH0A 3EWNA 3INRA 1XSEA 5C1BA 2NT4A 2ZI7A 2CFIA 2PQ0A 5ERXA 1PT6A 3V7FA 2DWOA 1NV9A 2CXRA 3FUUA 5ALGA 3NTQA 2QK4A 3MJSA 4G37A 2VHWA 3P45A 3ZU2A 1KJIA 1GADO 1QHIA 5GJBA 3VH1A 2IS2A 1S2MA 2QZ4A 3EIWA 3JQBA 1YZFA 5BYBA 1AV7A 1JHYA 1LV8A 4NOMA 1BE6A 3VMMA 2X8WA 1I7DA 3DDSA 3M6XA 5DI3B 4DV0B 1MNQA 1KWGA 1QH0A 4XPZA 2F6RA 4TKUA 3PDIB 1L5FA 1AUXA 3M6VA 4ZVTA 2X3FA 1ZRHA 3PNYA 4DQIA 1F0MA 4JQSA 2RI1A 4P4NA 1IWPB 4FNMA 2GLEA 1GUZA 3ZBQA 3NKFA 3WB2A 4RFSB 3HO1A 1MW9X 6GPBA 4UAUA 5LJLA 3OX1A 4JJ4A 3S40A 4BJ1A 4JYZA 2GUGA 2H9IA 2AI3A 2GD2A 2G6BA 3M6FA 1AUPA 2VBIA 2CVHA 1GRVA 2GJ8A 1JB1A 4PC3A 4YR7A 1BXRB 2O52A 2ECPA 3WZMA 3KEFA 5EOVA 3TZEA 2B3DA 1KJJA 1F60A 3DEHA 1IWBB 4IQ0A 2W8KA 1M6NA 2R00A 1RU3A 3GPCA 4AJHA 3B53X 3L46A 4X5VA 3MGGA 3DQQA 1OZGA 2SKDA 4I3FA 2N1RA 2H5IA 3JWGA 4D0NA 1MOQA 5JTIA 1SBQA 4YJ3F 3T3HA 1ZDMA 4F38A 4GZMA 1KYQA 4WPGA 2W54A 2W70A 3GRVA 2YBDA 4CQMD 1GZVA 3PRYA 3Q87B 4YALA 2VPPA 4PR0A 5F77A 1QV9A 1N5OX 1EM8B 2P77A 2PBLA 2F3PA 3CX7A 8ICKA 1PR4A 2HZ7A 3VO1A 3I4CA 3LQ1A 5DEIA 2DZDA 5ALPA 3QWFA 3AEXA 2NRZA 2YDXA 5KNCA 1DBPA 4L9SA 1WSAA 4PSKA 2A0FA 3GJ0A 2CF5A 2JLCA 4ZPXA 3A6JA 4W7SA 1JFTA 2CHUA 5L1MA 4E4YA 4QLAA 2HHQA 1H0KA 1Y4ZA 3QLTA 4J9VA 4WZ6A 5ECWA 5ADUS 4KLDA 4UW9A 1VDZA 4S12A 1F4PA 2IGBA 1ZMRA 1J0EA 2PVPA 4X93A 3ONWA 4YK7A 4Q9KA 1JEOA 1OYYA 4BN5A 3O73A 3UUEA 3CY6A 1ZS9A 3LPLA 1ZJYA 4WINA 3TE6A 3OSNA 2R47A 3QENA 1PWYE 3UN1A 1CEEA 3MQFA 3OUZA 3OPYA 1PS8A 5LYJA 2RG1A 4HNVA 4HDSA 5LB4A 4XUSA 2PN1A 1A5BB 2WBLC 2M0NA 3A1EA 1HQDA 3CWZA 3N0VA 1XDUA 3RC8A 3K35A 5C5DA 5JSQA 1VCIA 3W5SA 3AETA 4R1NA 4TYMA 2JF0A 4B3BA 3AESB 2VHEA 1EAYA 4KQEA 3V46A 2V6FA 1RHKA 1GNVA 4IFBA 1RKVA 2VUHB 3F9IA 4M0FA 4N40A 4E5VA 1QFSA 5AXDA 2L0XA 5EKXA 5FV4A 4QGSA 1S0NA 2CVZA 5F3DA 5ICEA 2PMBA 1EIWA 3JPQA 3LCUA 3OZWA 4Q48A 3I6BA 1SXJB 3PV0A 2QD3A 2AXNA 1GSOA 1WBBA 3TTXA 1YHYA 3FMOB 3LUCA 4KN5A 3F2IA 1DUSA 4A82A 1SIWA 3LRPA 5D6NA 1I6KA 1IBSA 1LRJA 1QE0A 2B3TA 3DM9B 4JVOA 2R7MA 5FL7D 5M29A 1X0VA 2ZI6A 3TPCA 3U0BA 1ML4A 3DULA 4I2NA 3LPAA 3VH2A 4CWAA 1L7DA 3QU9A 4KUGA 4M1KA 5CXUA 2NX2A 2BKLA 4Z4IA 2NN3C 1Y9ZA 4QJ5A 4IFEA 3HCEA 5CLHA 1CWUA 4OVKA 3UMCA 5H81A 1M7HA 1ZG3A 2IY8A 3WL6A 2BM9A 3A9RA 5I4KA 3HW8A 2PIDA 4M8KA 1Q0ZA 1PE0A 2VDJA 1Y5MA 5FH9A 1SBIA 1QAQA 1DRJA 2RCNA 3OJLA 5JFTA 1Z5OA 4G0QA 4BX2A 5LR6A 2GVDC 4PZOA 3GVPA 4GICA 2J5RA 2G9VA 2ODTX 1U9CA 4AECA 1FIQA 3WGJA 2A3VA 1Z7BA 3PI6A 1G21B 2WWRA 2OV8A 4MRSA 4FWTA 4TUYB 3C3JA 1OU0A 3BTUA 2R48A 1IQ0A 4RA6B 5CITA 3ZQJA 4RK7A 4R83A 4DBLE 1QCDA 4UEWA 4KOAA 1XLTA 3C2KA 4L8LA 4F5NA 1JF8A 3MTQA 2DFLA 1KOGA 2HCFA 1YL7A 2VR1A 3IAXA 2DH6A 4D81A 3O03A 2AYYA 4IWXA 4NMWA 1M1XB 2EL7A 8ICQA 4XR4A 4O1HA 4Y0AA 3D6UA 4GIBA 4O2RA 4B9AA 4IAOA 4CT0A 2EWMA 2E85A 2J3DA 3ZLVA 3AQFA 3W77A 1MXHA 2HMSA 3LD9A 3WS7A 5KNCD 2X5JO 1NVKA 4MV9A 4X7RA 1I3LA 4EF4A 1AKEA 2O7NA 9ATCA 1DWOA 2F17A 2H16A 3WAKA 5LM3A 1ISFA 2CHFA 4O3PA 5FAKA 3OIWA 4N5HX 4FE3A 1QWOA 5CTAA 5JVDF 3P5BA 4ZVLA 4U6NA 4M4SA 5LZ2A 3VV3A 1Y1TA 2AF4C 1W73A 3GRFA 1A9TA 5AVRA 1XQYA 4CF3A 4P7JA 1RCUA 4UTNA 4QJFB 3BKWA 1T9KA 5IBQA 4YCMA 3DO6A 3ULKA 4GI3A 4XASA 3PCRB 1MN8A 4B2IA 3EA0A 1J25A 3BMQB 2C5GA 1J0BA 2ZJAA 3ZXYA 4DQXA 5KYYB 1LPBB 1OY1A 9ICRA 3IAS6 1YDWA 3PC7A 3MWFA 3QVJA 2HMXA 4Q9JA 3FB1A 4CQJA 3ZCVA 2FE9A 4KLIA 3OOYA 5D5HA 4YT2A 4BNDA 1ZQIA 3G5LA 1OU4A 1P3DA 3GA7A 1XSLA 2VH2A 4L5IA 4OLBA 1SKYB 4OQNA 5K03A 4CODB 1GTJ1 1PJSA 1M1NB 1T8UA 4U8GA 3UJCA 5DGDA 3FNRA 5C5CA 4OK3A 4GRAA 2LD4A 3NDRA 4Q7EA 2Y0DA 2ZOSA 2JJYA 1VIVA 3SLRA 1GZDA 4R64A 4KO2S 2BMVA 2HBKA 2IHUA 1H3EA 1CUWA 3I5AA 4XA8A 3B6IA 5C0OE 3C1OA 3CSUA 4JU8A 4CVNA 3D5QA 3KT3A 4UHKA 3CP8A 1SURA 1LB2B 2GHIA 1NNSA 1Z0KA 3BK2A 3CGWA 2QQ5A 2DKNA 5D51S 1JG2A 4JX8A 1OFUX 3EZ6A 3ZJYA 5AW6A 2QHXA 3P96A 1PTJC 1YS6A 1XJQA 1TMOA 4AYTA 4JLUA 2PX6A 3KG2A 3DZDA 2G1UA 4QZCA 1JHXA 5JNVA 1FDSA 1ZJ5A 4EPVA 4J9KA 1UMBB 3C3BA 4NONA 1F6WA 4AG3A 1TM5E 4QWDA 1I80A 3EC1A 5ALFA 3WL8A 3UB2A 1E8NA 2XQKA 5DHAA 4US1R 3SFTA 4JWKA 3M2PA 1K7EB 4YFKA 1N3IA 4DL2A 1ISPA 5KFTA 5EXPA 1MW8X 5J0PA 1HLPA 2EZZA 3HCDA 4O4JA 1D4AA 1N5WA 2DT5A 4A8JC 3NORA 4O4HF 2HKIA 2XMDA 4BO3A 4GW3A 5TIIA 4MEXA 4DV2B 4C30A 1R6UA 1T5OA 4J2OA 2IEAA 1RXUA 2FG7C 3RUAA 3N0TA 4NNJA 2O2YA 5IS2A 5IHXA 3SZRA 1ZUHA 1K89A 1MKYA 1JDNA 4ZOEA 4PXSA 4QYWA 1RR6A 3EB9A 1RI3A 3X1YA 2GS9A 4FIZA 3BZKA 3LHDA 1HV8A 1I5RA 1ZGBA 3M4JA 4LXQA 1MRZA 4ZMSA 5JPCA 3UOAB 1E2MA 2I5PO 2XCIA 3OHBA 2RH4A 2VJMA 2EFGA 1MVOA 1W5BA 4AUNA 4PVCA 5F7XA 3ERCA 1J2RA 2Q5FA 4IEEA 5L3SA 2GLXA 2MOKA 2O5EA 4KACA 3O2QB 4AP5A 1G8SA 2BKUA 3DWGA 1SKAA 3FVQA 1N7JA 3C70A 1ZGCA 3MS7A 3AG5A 1HMPA 1ZIXA 4D46A 3SIWA 5BSEA 3KQUA 1NSYA 3KZOA 3DONA 1TM3E 1J5EB 4MJLA 2W2PA 4DLXA 5IXSA 5EJAA 1ZK2A 4YMVA 1V1RA 1D9XA 3FDXA 2GTIA 4P7KA 3ZEAA 4ZGBA 3ZC3A 1DK3A 2Y8EA 4TRJA 4F9GA 3KQQA 5B12A 4HYKA 1OT5A 5J2TB 3KJEA 2KBEA 3PEEA 1LLFA 4LZPA 5ES4B 1JHUA 2XWQA 3DHEA 4TTTS 3FWHA 1S0VA 1E4EA 1MABA 3AG6A 1S4QA 4OI0A 5CLJA 3VPDA 5K4HA 3O1HB 3GLVA 1G291 2IZ6A 3KLMX 1APBA 1MQAA 3MWDB 3Q98A 3ZY2A 5AK6A 1CS0B 4WSOA 3DMTC 4B6SA 4R9RA 2BJWA 2W22A 5GZ3A 3URKA 4E7PA 4OV6B 1UBOS 5J2GA 3HBNA 4E03A 3T0IA 4JLWA 1S01A 4MV0A 3JWEA 4QXPA 1ODJA 2B6NA 2WUDA 4F60A 1IM4A 3WE7A 4NJMB 2AUNA 4KWHA 2FW1A 2Z2IA 3OSPA 3GAZA 1TC1A 4BWVA 4F96A 1V16A 2J6SA 5GTIU 4X6UA 5EJ8A 1YB5A 4I1IA 4Z6CA 5K3AA 2OSVA 5F5NA 4M0LA 5E4TA 3KOUA 1QVAA 1Y1RA 3NTUA 4HZUB 3CRW1 1P8JA 2LGJA 5TLSA 1L3IA 4OQPA 4QHTA 3CVJA 2EAUA 2XITA 4ENWA 1V95A 2YYAA 4EDHA 3GJ3A 2XF8A 2NUBA 1ZNXA 2OBBA 3V8PA 1VGRA 2TMDA 3I3SR 2H92A 4DOAA 3OBIA 3OZVA 5TF4A 5FCDA 5IILA 4BRWA 4CN8A 4XB1A 1O08A 2C58A 4OXIA 2VYNA 5IT9A 1RRVA 3JARA 3DF9A 3FF1A 2Z4RA 5DI3A 1NT2A 1R8QA 3KAQA 5FFFA 3RTDA 4NV1A 4JEHA 3IKJA 4IIGA 3SV3A 5CA1B 4J9PA 4LS3A 1F3OA 3HXMA 3VPCA 2LKYA 5B55A 1CLUA 5GTDA 2FZLA 1KJYA 1IZ0A 2HSEA 4IIJF 1IM2A 1G98A 4X71A 3PFWO 3D3WB 2C5BA 4LOJA 4RFSA 1Q7TA 2PTGA 5AWFC 2WKPA 2ZSDA 2PZEA 5JSHA 4DJDC 4DBVO 5HKLA 2QNRA 3BRWA 4B3HA 3EN0A 3OZIA 3SHWA 4ZICA 1TMYA 4V2UA 3SG0A 1SCUB 4LVOA 5IHPA 1BXRA 4FLMA 1B00A 3B85A 1BXGB 1OB2A 2HBLA 3G2NA 4AJKA 1S2IA 2QM7A 1LW7A 4YXMA 1Y9AA 5BSWA 2MT9A 3RIHA 4CKZA 2J87A 2RAFA 3QXXA 3KV1A 3IUEA 5CVTA 3C7TA 3KC2A 3AJ9A 4I2VA 1ONOA 1YIOA 2Z0MA 3P19A 3N0RA 5DSZA 3EWAA 1MB9A 1KZ9A 3NXKA 5FUWA 4MV7A 1MRNA 1VGQA 1DAEA 5AICA 2FN9A 2HC9A 2FUG6 4RL6A 3ROZA 1V71A 4F5EA 4C5BA 4GS5A 3LUBA 4EO7A 4JI2B 3LMKA 4H31A 3WDMA 2EJUA 3ADBA 3R7SA 1I51A 2RHJA 1F38A 5HA5A 3A11A 4UQPA 4HEA6 1R27A 2QD1A 4W5HA 4JFAA 3AY7A 4CKWB 3ZNQA 2BIFA 1CXZA 3A27A 4MVJP 4KJZA 1OWMA 5HDQA 2FLKA 4QAQA 1B8UA 5IMSA 1RYRA 3ZHSA 3JQ8B 2L5YA 3MS4A 2WPDD 4CM7A 2H5JA 2XE8A 4DMLA 3U60B 2W71A 4GZLA 2BKEA 3DMGA 2BPOA 3WJ2A 5ENDA 4QZIA 3RASA 1P2UA 5DT9A 1LFAA 2C3PA 3V9PA 1UBJS 4BE9A 1PX0A 1UAAA 2CZGA 2WTNA 3TB4A 3QU4A 1JTEA 4HPXB 2HA7A 4UUBA 3NYWA 3R8XA 1NQXA 4JASB 4BX9A 4OKIA 3TTSA 2CV0A 1X9MA 3DFIA 1NQTA 5DBBA 4X1YB 4GLBA 2JCVA 2ZDGA 5AVVA 4BZWA 4HT3B 3VU3A 1X87A 3ZY4A 3WIBA 3C7CB 3V2GA 1PAUA 4UMDA 2OVBA 3OQHA 5PGMA 2EDCA 2PCLA 2QTAA 3DOOA 2VA9A 2V9PA 5CHEA 4PLHA 4XSHA 4MI3A 3ZWWA 1XG5A 4YDQA 3ZK9A 2ZRKA 2BZ0A 1X9GA 2JRCA 3PT5A 4PC1A 3T3EA 3OQVA 5JDCC 5L95A 1CUVA 1EBBA 1SXJA 1GY8A 3IV7A 3IURA 1XAHA 4TXLA 2YXLA 3WGYA 1KQ3A 2GK6A 2GBCA 2VYND 4TYQA 4N03A 1P9NA 1LDEA 2B0JA 3TI9A 1NF3A 2ZBFA 3HCWA 1SUWA 4IM7A 4U4AA 1VIAA 3E0XA 3NNSA 1H6AA 1XEWX 4IQGA 1TQ2A 2W04A 4RC9A 3D6MA 3RU2A 1WUIS 1HYEA 3IOEA 4M0PA 1KA9H 3TI0A 3OC0A 4Q7KA 1Z6ZA 3HJCA 2DU8A 4ZK2A 2WV7A 4EABA 3H5OA 5DLGA 4TUQA 3Q8PB 4JY7A 3NTLA 2HIAA 1DO2A 1AHHA 2PANA 3BRWD 4H08A 5DTEA 2VJKA 2AXQA 4JT8A 1DXQA 3QEOA 4DLSA 1BDHA 4J16A 5JY6A 2C84A 1U9IC 4R0VA 4DGQA 1RZVA 1G21A 4ZAVA 4NSNA 3H4DA 4DVJA 4TUYA 4F4JA 3E9RA 2ZCUA 4B9VA 1W19A 4RA6A 1UBKS 3M6MD 5CLFA 3JY6A 4EAQA 3HB5X 2BCUA 5FX2A 2WFAA 3JVIA 5IDVA 4HXEB 3JPTA 5IK2A 2ZR7A 5CAEA 1KJNA 3RS0A 2AOWA 4I1YA 1DLJA 1ZAYA 2IOHA 2NSDA 1C9JA 3DZHA 4KXYA 2C94A 2HHSA 2OLJA 1V37A 4ETIA 3MYRA 3ENVA 3HJGA 1Y1SA 5ALZA 2Q2NA 3IAHA 1G18A 4AG5A 4DMCA 5GGYA 1U65A 3C28A 3ETLA 4TOIA 3CZ4A 5K0LA 3OWHA 4L4YA 3TZQA 2ZWMA 3Q8KA 4EKDA 8ICXA 1KDPA 1KVUA 2Y9UA 2PKYX 4JK3A 1UQUA 1IQPA 4FZNA 3H2JA 4RT3A 4N18A 4BRSA 4KLSA 1ZM3A 1RJGA 2E8OA 1FYDA 3DLIA 2FY8A 1EFHA 4A8HA 1Q1EA 2G8NA 5DXJA 5AK4A 4BO4A 2HXYA 2B8NA 4C78A 4QPDA 4RMIA 4DXHA 3OSZA 1NP6A 2CRXA 3V00A 2X19A 3DCIA 3ROGA 1RLTA 4AMGA 3PXCX 3EGXB 4FSDA 3TOSA 5KYXA 2P2LA 4GX0A 1Y6RA 3BE5A 13PKA 2FEAA 3KFXA 5I7AA 4YQEA 1XL1A 1NX9A 3Q8LA 2FKAA 3O3MB 4OGFA 3PQ2A 5BSMA 3VBEA 5J9FA 1R0WA 5ED4A 3FYUC 4GQBA 3R0XA 2DXIA 1OE0A 3WMWA 4GC9A 3WLLA 5JZMA 2G8LA 2HQOA 1UWCA 4DDUA 2R5WA 1T3ZA 2A5DA 1BG6A 3BMQA 4FQ8A 2XR1A 4NBSA 1ZZGA 3MNFA 3GEGA 2L42A 1WR8A 4CI0B 3U13A 2BZSA 5KDOA 2AUTA 1V7QA 1LRKA 4JBWA 3QVVA 3H0EA 1YR6A 2H1OA 2B36A 1NMQA 2YWEA 3IKLA 5FLEX 2YZNA 1E3LA 4FPXA 3NWEA 5TMEA 4JKOA 1ISRA 5J0SA 2GZAA 2LYBA 4H6PA 2QKYA 4CMCA 3CKYA 2O7QA 3N87A 1USUA 3V8BA 5DBCA 5ALKA 3KKEA 1KEZA 2ZUFA 3C8HA 3FDJA 4GVLA 5TT0A 1E32A 5EHNA 3LXMA 2QIOA 1SXJD 2Y66A 3AU9A 1G20B 3C6XA 2VSYA 3KQMA 3FNIA 4LDZA 1J2MA 2AWOA 1PUXA 1YRHA 1FZTA 2CNOA 1N5KA 1J0XO 4DANA 2F55A 5CD9A 1GGHA 1GQYA 1DC6A 2RGWA 4F2PA 1NK0A 5TGDA 3E5HA 3ZGVA 4KGVA 1Y42X 4AULA 1RZUA 1MXFA 1G1AA 2FPMA 2R8RA 4EZEA 4PXYA 3QJGA 3AKEA 2A0YA 3HBFA 1EQ2A 5IVHA 5LQCA 4IGKA 4Y6SA 1IHPA 4MO9A 2ZDHA 1UMBA 4O08A 5D3ZA 2P8SA 1UP6A 2BEUA 4AO7A 1FS6A 2Z9CA 3JQEA 4Q4CA 1IATA 1VKOA 1GGVA 3WMGA 4UUAA 3CTMA 2ID8A 1GNSA 2M1ZA 4O2LA 1KLNA 4G5FA 3CH6A 1BEUB 2CK3A 2BELA 3QTBA 3LBIA 3IILA 4R65A 3DVSX 1AQNA 5JSYA 2ZJ0A 1BEEA 4GLOA 3ZJTA 3G5UA 1PJ3A 4YMOA 5I9SA 1QQ5A 1PR9A 3VH4A 3NIDB 2VK1A 2IA5A 4R3NA 5D2CA 2A6PA 2GKGA 2ZWAA 4L02A 2MWMA 2UZ0A 3BD7A 4X6YA 2ONZA 1LQ2A 1GPKA 3AETB 4D3FA 2E4AA 3K92A 1GPDG 5IK2D 1SB8A 3JQFA 1IUNA 1HH4A 4KHZA 1XQ1A 2ANCA 5AKJA 2XEDA 1D2NA 3CR3C 3N53A 4E4RA 3SR3A 1XEXA 2GPNA 2HHWA 3BGWA 4O0MA 3B2EA 3SEIA 3SZMA 4KXWA 3M8SA 2YVLA 4J3JA 4PYKA 2IHTA 4LRQA 5C8DA 5CFZA 4CLHA 4QW8A 2R8IA 3VH3A 3UYKA 2AJCA 5T6BA 3UAGA 2XVZA 4FNAA 4B6RA 3K3PA 4XQGA 2C1ZA 1HYGA 3IAEA 1X6JA 2C1EA 1UC5B 3FYTA 8ICJA 4GOXA 3THXA 2KKVA 2GNAA 2I4TA 2CBXA 2O7RA 4LEIA 1PCXA 2EFDB 3GLQA 1A7JA 3SEQA 4TV8A 2HF2A 5GZ1A 2W0SA 4YRPA 2I1WA 1CJVC 3VAYA 1YR1A 3Q9LA 3ETCA 4D82A 3RU9A 3A04A 5J2TA 3QVUA 1L5QA 4FFPA 2BM8A 2JHAA 2JGIA 4PR3A 1Y9EA 2I66A 1M7BA 5M2QA 3CF4A 1P7PA 3DHVA 4GM4A 2OE2A 3I2KA 4A27A 3PHGA 1NQAO 5EHXA 3L6BA 4YR9A 3LA6A 3HM2A 3MWDA 3NJRA 3ENWA 3ANLA 1OLUB 3MSCA 2OGWA 4S24A 4PNHA 1A4UA 2IFTA 1R4MA 5B1IA 3SMVA 4PPXA 1JWAB 4JIMA 4R9VA 5KJ6A 1EUQA 4U5XA 3VM6A 2Z56A 4ZTZB 5IIMA 5FNVF 1S3IA 3JCZA 1HBJA 2XY6A 1RXIA 5EOZA 2QI9C 4LZAA 5CJ7A 4MUFA 2PU5A 2C22A 3ADCA 4NJMA 2PA0A 4K8RB 5CNMA 2GYWA 4I4CA 3SJAA 5E9QA 1WWKA 1SKUA 4B6QA 3U17A 1USWA 4RESA 4LQ4A 1E77A 1K3UB 2W55A 4M55A 1KJWA 1CNEA 1SH7A 5KNBH 4QSHA 4HZUA 4BLRA 3HY3A 1WVIA 5C8YB 2F3NA 2RJNA 1X6VA 4AO8A 5J1TB 4NCBA 4ZI3A 4ED0A 1C9MA 2W7OA 5FOXA 2DPHA 4DNXA 4KEAA 2QVXX 4ID9A 4GF5A 1OGIA 4E70A 4ENRA 4YRFA 3ITEA 1JDVA 5EJ4A 1YRYE 1RCTE 1CDZA 1K68A 1JQJC 1JS1X 4Q4DA 4AX8A 1HDYA 4CM3A 3C7DB 4Z99A 4PG4A 3EQ8A 3U44B 2ZBQA 3DKPA 4O25A 4HL6A 4R5MA 1FYXA 3TSYA 5FA8A 4LYGA 2HUPA 3DOCA 3QVSA 5CA1A 4XCQA 3LYLA 3R3SA 4PFKA 4QQRA 1OXTA 3GGCA 4GRDA 2C54A 3UCXA 2O1WA 4XYGA 1EGHA 3EH1A 3U80A 2PJDA 2CK3D 5A03A 4Z9BA 1JU9A 1G63A 4MW7A 2QLFA 5K3CA 1P17A 1VJ0A 1M1YE 1KFJB 1WMAA 3ABOB 1P7YA 4NBWA 2QL5A 3AUXA 3KKLA 1FL9A 1SCUA 2K8AA 2J33A 3KJGA 5LDGA 4P0PB 5AKLA 4N54A 2XZOA 4BS9A 5K9ZA 1DJMA 1SWWA 4A5SA 2PXHA 4M2YA 2P41A 1GPLA 5KG7A 3JPSA 4BNDB 4MF8A 1RYHA 3W1WA 3RHFA 4US8A 4QX6A 2G07A 3PJEA 4FU0A 4FFBA 4P5EA 4F3TA 2WF7A 4LJ7A 3U7JA 5DYWA 3ZS8A 1YVEI 1PU2A 4X95A 2XUDA 5I45A 3EZNA 3IA2A 4W9NA 4TM7A 1NVVQ 2E1RA 3RB0A 4BYGA 1OUQA 5K0GA 1T4GA 1TO6A 1Y98A 2D2XA 1V11B 3L84A 3L05A 1V48A 4YASA 3AU8A 1PN3A 3FSGA 2FZ5A 2FW6A 3DUWA 4J0DA 4QNLA 4EGQA 4IINA 1ECPA 2FW7A 1GN8A 3QGMA 5JLAA 3PVCA 2YCLA 1T3GA 3KETA 4MPRA 4HX5A 4KK4A 4AICA 1AK9A 2DECA 1H2WA 1NPYA 2NXEA 3WLSA 5JRTA 5JZOA 1Z8NA 4LPKA 4EBCA 1B23P 1ESEA 4ZO6A 4DA8A 1LV7A 2O6HA 4BNTA 3PXBA 4RYLA 4FWIB 3MVEA 2O3TA 1AKYA 1YHZA 5DDYA 5A2QA 4P5PA 3JQ8A 4G0VA 3KALA 7ICKA 3KQVA 5IXYA 3P2JA 1A8PA 1I01A 3CE6A 1WAMA 4AJPA 4H3SA 7ICNA 4LYJA 5AD1A 4M8NE 3NAQA 1HURA 2HA6A 4GQIA 5KFZA 1D8TA 3S7ZA 1QS0A 4MEJA 4QRIA 4Z2AA 5ICMA 4KO8A 2RH9B 2Y4NA 3VZSA 1N8SA 3LY9A 1Z5GA 3W6NA 1MO6A 6PFKA 4DAOA 2GN8A 3N39C 4S2UA 5K01A 1WWUA 2A9PA 3OQ1A 5KFPA 3UXEA 5C9ZA 1U0JA 3P71T 4K9MA 2GEVA 4UOQA 2QOEA 2HQRA 1CUBA 1GDDA 1JH9A 1PQUA 3FIUA 3FR8A 2ILVA 1DFIA 3LO8A 4R63A 5HEKA 3R24A 3PUVA 1C30B 1ZA1A 1BQEA 1SC4A 4JQOA 1OPXA 4CUZA 1FJ2A 5L3SB 2IH4A 4BVAA 3D7RA 1FPMA 3WNCA 3UXHA 3PGJA 3M1LA 2UUCB 4IHKA 1UBFA 2VHZA 1FFXB 4QEKA 3TB6A 3UWKA 4F4CA 3IDAA 2CL0X 4GE0A 4RENA 3RRMA 1GZSA 4MLZA 5AJXA 1VCHA 4JJEA 3GO4A 1DQNA 3QOWA 2R6ZA 1L5OA 1TAGA 3T99A 2P2CA 4FFMA 4IW3B 4D25A 1ZHFA 5SV2A 1MHPA 1G8FA 1KXJA 2E89A 3COVA 4RVUA 1CY0A 3RSGA 1GCOA 4IQFA 1XEWY 1DEOA 1SV4A 4G0MA 3R0JA 1KEUA 3RVMA 1E2KA 1YNOA 1NBOA 4BFWA 4M1ZA 3QJ5A 1E7WA 3KQWA 2QORA 1ZH4A 2QA5A 1M2WA 5CVJA 3V8RA 3W6OA 1NY5A 1EDBA 1LDGA 2VVTA 5J40A 4GT1A 1Q91A 4N5MA 2CHGA 3CUEF 4N3AA 5AJUA 1W35A 4CQNA 1SZHA 3WI7A 4D42A 4KN7A 3R8CA 1QFZA 2F9MA 4PG7A 2CXYA 2E4WA 4OHKA 2QPTA 3RADC 3CRRA 3E8XA 2GZDA 3E3OA 2EV9A 1Z4JA 2I2AA 1ZGGA 5AVJA 3MOIA 1WTAA 5JJLA 3DQZA 3SVZA 3BSSA 2YHIA 4U7FA 1U2TA 1RQ2A 4Y0VA 1EUYA 2PX8A 3NBKA 1KYZA 2P2DA 3MJEA 2KJQA 3FZQA 3AV0B 3AEUB 1KKXA 3AFMA 1YJ8A 4KQ2A 3HXOA 4F2DA 3RS9A 2I7TA 4BNWA 3RF7A 3VDXA 3FSGD 2QLBA 3ROPA 2VEOA 1V5WA 4C3ZA 4ZDKA 1Y6GA 2HHAA 1E7QA 4LHSA 1Z68A 3RUEA 5CD1A 3MDAA 4FONA 5EHGA 1GCUA 1NLZA 3RSHA 5MGNA 4D8VA 2WM9B 3BBPA 1YV9A 3ROQA 5F7OA 2IZ5A 1ORRA 4XQ0A 2HPHA 2H1VA 1VL1A 3JARB 4FCTA 2QJOA 4YH1A 1VHTA 2F3UA 4XSGA 3V6MA 1AT1A 1PVRA 2BAGA 2V54A 3DNMA 1TQ8A 3GFBA 1A9OA 1WMBA 4WAUA 3ON5A 3EGXA 2ESRA 1WZCA 2OCYC 4RACA 4Z4GA 1UPFA 4DR7B 4RUAA 3KXPA 2WINI 4YYZA 2QAIA 1GT6A 1QCCA 1PGNA 5H4GA 1TK5A 4AD8A 3IQZA 3M9WA 2HMVA 2EGUA 3V1KA 1MBZA 2RHWA 2V8OA 3AP3A 2AS0A 5HILA 1TNDA 3RH4A 3NGDA 4IY1A 4US9A 2B4TO 1OZFA 1JKMA 4XIJA 3UW1A 3AVTA 1CF2O 3HACA 3PX2A 1I94B 4L74A 2V6JA 3L8CA 1JILA 3UHFA 3L7JA 3K1JA 3ZX5A 3O9ZA 2RHCA 2JH3A 4JR2A 4DLNA 2OZPA 2RC5A 1XZPA 2B37A 2FU5C 2M98A 4C3UA 3EEFA 4XCVA 3TEMA 2ID7A 5FNZA 5CWRA 4IDQA 2E7ZA 3N74A 2V7VA 4UD2A 2IYFA 5L53A 1FTQA 4JZKA 2GASA 4ZP1A 3OLVA 3HJRA 2X4LA 4G5RA 4ILKA 4BO5A 3BIOA 5ISMA 1G20A 3ICOA 5CG2A 3LZ6A 4WBNA 4KO4S 4UCXA 1E7SA 1M8FA 4J7UA 1EGAA 2OO7A 2APJA 4JC8A 5LWQA 3OFVA 2F8SA 1GO3F 5F5LA 1BPZA 3NHKA 1M75A 2PGIA 4MVJA 3UWSA 2XOXA 2QRPA 1U02A 3W3ZB 4AKHA 3VDQA 2XNCA 3QBEA 2C96A 5EHZA 3QG1A 2WTMA 4ZI7B 3STYA 2FAXA 4MHOA 1R5NA 2XXAA 3GFPA 4XFDA 4RTKA 4NAHA 1CZOA 2I8LA 5IT0A 4JLBA 2PL3A 3KK0A 2ZTLA 4Q6BA 3BHNA 3AR2A 5K4LA 3L02A 4EATA 4GP9A 3AJAA 2R11A 2W7TA 4HN4B 2X6RA 2QAGA 2YXNA 1FTNA 1EWVA 3W06A 2YWGA 1AJEA 4I19A 2C77A 3SHQA 4LHYA 3S4YA 1LGYA 1PNOA 4P4LA 4B9TA 4FINA 4DFDA 3HJNA 2WQ7A 1V9CA 2NTJA 4UBIA 2HHXA 4EO4A 4MA0A 1WPXA 2WYHA 3I6YA 3A4IA 2PFPA 3E27A 4GXTA 4HVLA 2VPQA 4BO0A 4OHOA 4C06A 2HVHA 2JC3A 2EGGA 2BPCA 1TIPA 4KQXA 1R5BA 3H4MA 4B09A 2X9VA 3VR2A 3BQ2A 1VG0B 4LXTA 4X3CA 3DFKA 1YC5A 3CLVA 1O9BA 1H4TA 4G3IA 1L8QA 4YMUA 6AT1A 3MGKA 4AJNA 3BHJA 3HUUA 4WNIA 4EGFA 2ZTEA 1VE9A 1YBVA 1BYUA 1DJLA 1SAYA 1WUTA 2M6KA 2GTPA 3SD7A 1A95A 3DM5A 2X0KA 2ATIA 3I61A 2JFQA 2UZ3A 1BNOA 1ZQHA 4YAKA 1NXPA 1KBQA 3QZ8A 3I9NA 2XTMA 3N7SC 1XEFA 4WFJA 1Q77A 2EFEB 5TX7A 3C21A 2C3OA 3TS1A 1VA4A 4NBNA 2R8OA 4GMXA 1AY0A 1O8CA 4IQUA 1Y8ZA 2DRIA 2VJCA 1HTTA 3CPSA 2B34A 3ER9A 1LPSA 4MITA 3KSBC 4IUDS 3SR0A 3NVMB 4DQ0A 2QRHA 3GPDG 3S1LA 1GA4A 5AVWA 4E07A 2ALJA 1KJZA 4MWTA 4DZZA 2B8EA 4IIVA 4DCVA 5JAOA</