3QXAB

Hla-dr1 bound with clip peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
190
structure length
190
Chain Sequence
b'GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Conformational lability in the class II MHC 310 helix and adjacent extended strand dictate HLA-DM susceptibility and peptide exchange.
pubmed doi rcsb
total genus 40
structure length 190
sequence length 190
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qxaB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3qxaB01
1QFPA 5E08H 3G5YA 4PJEA 4L8CA 4C4KO 4ONOA 4G8IA 3P0YH 1DP0A 3BT2L 1LD9A 2V5SA 4EN3C 2HG5A 5BOZG 1EA9C 4ELME 1TZGH 1ADQL 2FZ3B 5FB8B 3L3IA 4PJHB 4JHAH 1BM3H 1KELH 2O93L 4Y8DC 1QRKA 2EDBA 3FRPA 4YO0B 3W0WD 1OLZA 3ARED 1P6AB 1WCBA 3FN9A 3LQMA 1NGZB 3CDGA 5AG8A 3GSXB 4XNUL 1DLFH 2H2SD 2AI0L 3FB6A 2NY4D 4XPHH 4XCNB 3MLZL 5BJTB 1H3GA 5CJ5A 5E99L 4R7DA 1AXTH 2D7TH 3AM8C 5I18H 5FDWB 3BZFB 2PYFB 1E4JA 2VAJA 3J7HA 2BRRH 2DLEA 3RL1A 5K59E 3HZKA 2Z4QB 4N9GA 5EA0L 1Y0LB 1QEWA 3DLQR 3EOTL 3IDYB 4JB9H 2IPTL 3MRFA 4JFPA 3LQZA 3AAZB 5D7JA 2J7LA 4HS3B 2ZCHL 4NNXA 3PWNB 4H0HB 3ZKMC 2J2ZA 3ZT6A 1XMWA 3K1DA 3CFJA 3NFNA 4R97B 4C57C 3CC5B 2P42B 3A6CL 2CJUH 1UM4H 1KFAH 2OSLB 2XN9E 5T3ZH 3UBXG 1ZVSA 3T0DA 3MLSL 4TULL 3HUJE 4IMKC 1DBML 1M7XA 3SGEI 5GJTL 4X7TA 3T0VA 5GRWA 1UH2A 4NN6C 2AEIT 4S1DD 4PRIE 4JQXC 4PJ5B 2Y36L 3SKNA 1BX2A 2GFBA 2NY3D 4YDIH 5IV2B 1K8IA 1DVFC 3DX8B 2BSSB 3Q3GA 4G8GA 5HI3D 3UYRH 2N56A 5IVXF 3QRFM 1SBBA 4TSAH 1T83A 2A6KA 4ZUTA 4PJGF 5LBSH 4U6XB 2WQ8A 2Z8WC 4NBXB 5EBMA 3U1SL 4KDVA 1DQLL 4X7DC 4JFED 5K9QG 1U8OB 3RVVC 5HHNA 4DN4H 2HN7B 1X4XA 1A6VL 1JRHL 4JRXD 1FJ1A 1FZMB 4MX7A 1LDPH 4I0CC 1P7KB 1BQLH 4S0SD 4Y5XC 2DQGL 3MACH 4U7MA 2X7LA 1FAIL 3IDNA 1OAYH 3THMH 5E8OB 4Z7QE 4APQD 1Z5LA 1N5YL 4JFFD 3O6FD 4KH2A 3RWHB 4XCFH 3WFEH 2EIDA 5LKNA 1I3RA 5J3HD 1T04A 2R1XB 3H9ZA 3H0TB 1KJ3L 4L9LB 1ES0B 2QSQA 5L8LB 2PO6C 4BSVA 1HXYA 4APQC 4RAUA 2XNAB 1FVDA 2EDEA 3EYFA 1F4HA 3GMPB 2BC4B 4EI5A 3MA9H 2XZCL 4NHCL 5TPWL 5E5MA 3BIBX 3WS3A 4FRWA 1OVZA 5I71C 3FO0H 5HGDB 2NTFB 3MA7A 1WC7B 4XNXH 3R1GL 4GAJL 2VAAB 4LHUB 2BNQE 3PABA 3MLUH 1QEWB 3BESR 1FNHA 5DTFB 4TUOB 4G8FA 3Q6GL 1FO0H 5IHUL 2NXYC 3UJIL 4P59H 5C08D 4FQCH 2Z8SA 4WW1B 4TPRL 2NY6C 2DYPA 3EUUA 1AGEA 2EDTA 1RJYB 3GSXA 4WI2A 3OHXB 3U0WL 3L3HB 2DMCA 1D9KA 3VD5A 4JPVH 1DJSA 1KCUH 1ZT1A 5T1LA 1Z9SA 4G9DA 4ZD3H 5L8KB 3VXMB 1W0VB 2A73A 1UB5A 4MJ5B 5DR5L 2CO6B 5JTWA 3QG6A 4Z7WF 1F45A 1HIMH 2JF1A 3PL6A 3WUWB 1MCPH 3MROA 2QHRL 2EDNA 4NJAH 1QBBA 2W60A 1BIIA 3U83A 4PRNB 3WFEL 4L8CB 1FNAA 4PJ9B 4H0IA 4XP9L 1YN6B 4P2YA 5FUOH 4U1JA 4KK8D 5ICZB 4ZFZB 3L3GA 5JXAH 1U0QA 5GPRA 4G6KL 4HX1B 4AENB 5IEKA 1JF1A 2Y1VA 3B9AA 3F7YA 5T3XE 1I7UA 2BNRA 5E2JA 5CIPH 5CCKH 4QRRD 2ENYA 5LXGL 1BP3B 5BS0E 1I9JH 3VWKD 3GMQB 1IGFL 5DMGD 2MOVA 4PJAA 4WU5A 1EJOL 4N8VB 2EDQA 2FJFB 4HC1H 4LEOA 1DBBH 4RGNC 4X6CA 3LQAL 4LVHC 2NW3A 3O3BA 3VXSE 4YR6B 1B6UA 3X12B 3JVGA 2V5MA 4NO0A 4P9HC 5AUMA 2BSTB 1BLNB 2I26N 1N7MH 5DUML 5I8CA 5BVJA 1OTUC 3Q1SH 4LDOB 4UTAL 2HTLC 1D5ZA 2X09A 2DYPD 1NC4A 3QJFB 4WWKA 4LCCA 2ADIA 1CXFA 3UTSD 3MFFB 1EFXD 5JW4R 5I1EL 4LLUA 2FYYB 4NKIL 1FC1A 3QDJE 2HTKC 1VESA 4TQEL 3OAUL 4XAWH 4GXUN 4YXLH 3ZKND 3RVVD 5JNYA 3VXUB 4PY8J 1P2CB 5EN2A 3WEXA 2C9AA 4PJCF 1J0ZA 2ZOLB 1O7SA 2P8MA 4CDGC 4N8VA 2WZPD 1SY6H 3HI6H 1MPAL 2GJ6E 2AJ3A 4PUBL 3U7WH 5DJ6B 1U95B 1BFTA 4OIIL 5J56B 3ARBB 3D48R 2ZCLH 3GSNH 1OD9A 5DVKA 1KEGL 4JAMA 1VADA 2VLME 3FFCE 1MF2H 1CK0L 3GIVA 2DQDL 3SO5A 3TT3H 5KN5B 2NNAB 2P5WB 4GT7A 1LEIA 4NQDD 2VMFA 3KJ4B 1EK3A 1WITA 4MXQD 2RHEA 3EOAB 1JHKL 5FF6B 1BECA 3TBSB 3FFCB 2VXQL 3DX6A 2D31A 1A3LH 1U8JA 4Z76A 3CFIC 2VIRB 5DS8B 1MAML 4X5WB 2MHAA 4E41E 1OP9A 1NFDE 1QSEB 4APQA 1BD2E 4A6YA 4S1QH 1ND0B 4HUUA 3O6KH 2A74A 4HUWA 3UO1H 2HWZH 4JKWA 4JDZA 4LP5A 4NN7C 3T2PA 4G42A 2Q3AA 1NLBL 3PJSB 5I1JH 3HE6D 5J0BA 4PJGE 4F9LC 4NZUL 4D9QD 2CIIB 3MRLA 5FM8A 4F9PA 4HAGA 4K9EC 3QT2A 3KXFA 2VTFA 4RGNE 3HMWH 1JTTA 1U41A 1N4XL 1J86A 2B1HL 4UQ2B 4H1LG 5I76B 3MV8B 3TA3A 2IQ9L 2VLKA 1YEEL 5C7XL 4DZ8A 3IF1A 4O5LH 1I1AB 3CD4A 1BVZA 3GB7A 1S7UB 4JFXB 4N68A 5HHME 3WS3B 3IFNL 2EH8H 2QQLH 3L5WB 4WO4A 1CN4A 1XF1A 2AV1A 1T3FB 4GMTL 5I1HL 1UJ3B 2YUXA 4PP1C 4D0DB 3TBYB 4C83B 4KXZH 3C60A 4YHML 5CMAB 1OT1A 3K4ZA 2AI0H 3Q5TA 2R69H 3ULUH 3GBML 4GFTB 4D94A 2W9EL 2JCCB 1Z5LB 4FQXD 3VE0A 3A6BH 4XMPH 4KI5D 3N50A 1FL6A 3REWA 4H1LB 3GMNB 3SDYH 1VERA 1T6VN 2AJXH 2V17L 3WFHB 3WFHA 4EJ1C 3BEWB 3QDJA 2A6DB 2DN7A 1CDGA 5TQ0L 2WAHA 3BP6B 5TF0A 1KIRB 4QRSB 3G6AB 4KJWD 4PGDA 4AM0A 1OWWA 2IG2L 1FC2D 1FDLL 3ROLB 4OT1L 4IDLA 3SKMB 2VE6A 1MJJB 1BFSA 5SX5H 2ORBH 2DQCH 4MDJB 2QHLA 4KVCH 5CLTA 1X44A 5DA0B 1R3HA 5A2FA 3T65B 4LLQB 3EGSA 5DVLA 2P5ED 1NDMB 4KV5F 5FHAL 5GISH 1UKQA 4JZOB 3MV8E 1CVSC 2WSKA 2NY0C 4P3DB 2C4FT 1EMTL 1D6EA 4L29A 3VXPA 4XPHL 3O81A 2VDOL 2YXFA 4L3EB 2MCPH 3D0VA 1EHLL 3MJ9L 2NXYB 2HFTA 3MLWH 5TE4L 5GGTA 2OJZH 5EOQH 1F58H 2VO5A 2OXGA 4UQ2A 3TO2A 1NC2D 2NY0B 1TTFA 4PPTA 4HDIA 5FKAB 3V6OC 3PWNA 3OGCA 4NCC2 1AQDB 3AAZA 1L9NA 5DWUH 2PW1A 3NIGE 3GNML 3F58L 1A14L 4OLYL 2OLDA 2Z91A 3JZ7A 3MUGA 4X6DE 5EZLB 2Z4QA 5CZVH 3WKML 2Y6SD 2VABB 2UZYB 4WJ5B 5DHYB 3O2WH 4IRSC 2ESVD 5T3ZL 1XF3A 1NUFA 4Y1AA 5DS8A 1JWMB 1HCVA 3BMWA 2X7LB 4WRLA 8FABB 3MJ8B 3H9HB 2VLRB 1OTSD 4L4TA 5KSUB 3S35L 4H1LH 2VXUL 4MA1B 1AR1D 5DJ2A 5J4MA 3CZJA 1FO0B 1Q9WB 1MLCA 2XIDA 3D3VB 2F74B 5DD0L 4YK4B 5GGQH 2E27H 2I5YH 1AKJD 3BJ91 2EIZB 2ATPA 3V4UH 4Y4HC 3VI3E 2Q87A 4J3UA 1M05A 4PRPB 4G8GB 1FIGL 5DGQA 2X4QB 5C08A 2BY0A 1F3JB 1WAAE 4M7ZB 3MLXH 2X4PA 1BX2B 2O26U 4K3DH 2Q6WA 1MFAL 2X1WL 2N7BA 4JGUA 3MV8D 1FPTL 2UWEE 3QULB 4I2XB 4PLJD 3TA3C 4OCMC 1MIMH 2BERA 3H8NA 1RUAL 1T89C 4OAWB 4PIRF 4HT1L 1MFBL 1IC4H 2G9HB 4H8WC 3LMJL 2Y9RT 1W0YT 2HT2D 4H88H 3MRIA 2OI9C 4U6YB 2KKQA 3UPCA 3MRJB 4UOJA 4PRDB 3QAZC 2VZUA 3NACH 4ZPVB 1FZJB 3X17A 3H9SA 3P3YA 1U3HA 3ULVC 2ZCLL 4QRPE 5DK2A 4HPYH 3I3DA 1G7QA 1D5BB 1RU9L 2AABL 1NCWH 5DRXA 2VOTA 3DGGB 3S35H 3K46A 2VUYA 1HNGA 2GT9A 1MOEA 1JRHI 5J57B 3B5HA 4MQ7B 1CDJA 3TZVD 3EYQD 2NY6D 4DVRL 5JPMA 5JZ7D 1KCSL 4I77L 3NTCL 2YPVH 1U6AL 5TH2A 2HFFB 4LVEA 4O4YL 4CU8A 1CF8L 3VXSA 4PRIA 1BGXL 43C9A 1JF1B 2HH0L 1RURL 5C09D 1M71B 4Z7UB 4G8GD 1LGVA 4HLZG 4J6RL 5IMKB 4KHTH 1CLOH 4X0KB 2UUDH 4OGAD 3QUYB 2EEDA 4UUJA 4F15B 3KPSE 3S37H 1ZLUK 5EBWB 4P3CH 5E00B 3SKJH 3RU8H 3ZKXC 4KZDH 1KIPB 4OBSA 1MLCB 3OB8A 2AK4E 3WHE1 4OM0L 3SDAC 3RGVA 4LK4A 4OGZA 1XCTA 4G9FA 2ZCKL 4GS7C 2YD9A 5FGRA 1Z3GH 1DBKH 4MNGA 1T0NA 3S96B 4KQ4H 1YMMD 2R23B 4OF7A 4M1CD 1OTUD 2AQ1A 3MZGB 4O5LL 5JXED 4X4XA 5MENE 1F8TH 35C8L 1MLBB 2JB6B 4FQIH 5HD8C 3PDOA 3W2DL 4MJID 4ODXA 1UXSA 4QHMA 3IAPA 3CLEH 1J0JA 4OSUH 3OKMB 4NHUA 4R2GC 1N59B 2UVFA 4TUOA 3KPPB 1QSED 5C6PB 4Y89A 4F33A 4LSVL 5FYKU 5MHSE 5KVGL 2ZUXA 3HZYB 3IETB 5CAYB 2HP4A 1R5VA 5IUSA 1NUGA 3QUZB 1MCPL 3H9SB 1P7QD 1KPVB 3EO0B 5FYJE 3RVWD 2EDOA 1IGCL 4QHNA 2VDRL 3GO1H 3GHBL 2IFFL 2HJKA 3MRJA 4PTUA 1HSAB 3MOAL 1I4FB 3UBXI 3P30L 4UT7H 1NGYA 3EYFB 2BVUA 1UKSA 2QQKL 2R56L 1PKQB 5E1AA 3DVIA 5EUOA 3VXRB 2CLVB 4K94L 4XZUA 1KPUA 2AJVL 2RCSH 1EHNA 1RJLB 3FKUS 5F6HI 2VDPL 5SV4A 1P5VA 5E2VL 1U8IA 1T6WA 4ZODA 1REIA 3NCYP 1SQ2N 1C5CL 2ADJB 1CGXA 4WV1A 3ZDYE 2CUMA 3ARFA 2X4PB 5T3ZE 1DBBL 3FTGA 1R3HB 4WY7H 4UT9H 3BPNC 4FMKA 5FYLE 2P8LB 1JZ8A 3VD7A 2I60L 3MR9A 1I7RB 1A6TA 3HZMB 5E8EB 3FO9A 4J3SA 1XIWC 5HYQA 2D0FA 5EFIA 3S98A 1DE4B 4G7YL 1XIWA 3D85B 2J4WL 2IAMA 2XQYG 1OPGL 4WHDA 5F96H 7CGTA 4Y4FC 1K85A 4W4OA 5DZOA 4ZFOL 1T1XB 1QO3B 1JVKA 4H5SA 4WJ5A 2ARJA 5F9OH 2P5EE 3OKLB 1G9EA 3AXLB 4ZOCA 4YHPA 5CJXC 3HI5L 3P30H 3QRGH 3ZYJA 1MCRA 2D2OA 1HIML 4NNYB 5JXEC 5C0GA 2NXZB 2DLFL 2NCMA 4L4VA 1A4JA 1B4RA 1ZLSL 2OL3B 3ZKQD 4NN5B 2ITCB 3B5GA 4GG8A 3JV0A 2H2PC 3WFZA 1ZHBB 4LSVH 3IJHB 5J7CC 4GAYB 1QPPA 5L2JB 4L9LC 3FT4A 3MLUL 3BP4B 1HHJA 4EIZC 4M8QB 4MNHB 4JPKL 2QSVA 1UZ6F 2FEEL 2ZPKL 3B2UC 2W9LA 3NCMA 4UNUA 4W4NA 3L1OL 2A0LC 5GJTH 2FECL 3K7UA 2I25N 4KKCD 4P46A 2D03L 1J1XL 5KVMC 3DSNA 2X4TB 4Z78A 4M1DL 1G7LA 4JRYB 4K07A 5L88L 3QXDA 3O4OB 1XCTB 4G9FB 4MA3A 1N2RB 4A6YB 3C5ZD 4XWOD 3FOLA 2FHBA 1FQ9C 5DJ8B 1X3DA 4JFHD 1G9MH 2NXZC 3QO0B 5H2BA 3BGFB 4U2YA 1K4DA 4G7VL 5SX4I 3VFPA 3VFGL 1FGNH 3L7EB 5DJXB 4NWUH 1XGYH 5GJSH 1J88A 4Y1AE 5HDBF 1OM3H 4MQXC 5EBLA 4KI1A 3VH8G 3U36B 4HV8B 3WFDL 2V9TA 4GMSH 4QXWA 5DZNA 3BSZH 5BVPL 1FLRH 1LK2B 3L3KA 5IB4A 5JPMB 2ZJSL 4XVJL 1X9QA 4N0YL 4MQ7A 2VZTA 2GT9B 2ESVB 2GY5A 4C56D 1J10A 5FOBB 1JNLL 4WDIA 4AK1A 3BDYL 3T1WA 5C0AE 5LAXB 1LO4L 1CU4H 5JNYB 3P73B 1VGKB 1UEYA 4TTGA 2YZ8A 3O11B 4W6XB 1KB5H 5HHQB 3BZ4A 3UJJL 1I8MA 3UYOD 1ROWA 3DHJA 3V4PH 4IOIA 4OCYH 1QFUL 4PRDA 1K2DA 5CSZB 5BS0B 4IMKA 2NYYC 4QRPD 2E7HA 4M7KL 2D7MA 3N85H 3RZWA 1PJ9A 4HPOH 2XPGA 2UY6A 1YPZE 3N1MC 2Y25A 4RDQG 4DW2L 2NYYD 2IPUK 5KOVC 1H8SA 3FRUA 1CDUA 5JOPD 2JJSC 3NPSB 3QHFL 2MHAB 1YMHB 4FABH 4KHXH 1GZQB 2CGRH 4Y2DA 1RUQH 2FO4A 3BRDA 5DD3H 2IPTH 3QWRA 2B5IC 2GK0B 3FFCD 4DOHB 2VDNH 2R0WL 1U3JA 3I3EA 3IDJB 4R3SA 4IIQC 4FFWC 4XNUH 3QCTH 3VXNA 4HG4K 4I18B 4DN4L 3ECBA 3ZSSA 3MBEB 5IVZB 5IVZA 4HHAA 1QBLL 3KGRA 1I9RL 4GOSA 4WUUE 4ZXBB 3VRLE 3WJLC 3V79C 5C09B 1MWAL 3I50H 2H41A 2OTUB 3OKEA 5EZJA 1XR9B 5KSUA 3QO0A 5KTEL 4JY4B 2VDML 3F7VA 3KLAB 1GGBH 1OAUL 1E6OL 3IJSB 4U7KA 5DJCA 3U4AA 2GTWB 4KAQL 2R2EA 5GRXG 2AAVA 4JRYA 1LHZA 1Y18B 1JZ6A 5T33L 4EI6B 2CDEB 5HY9A 3MUGB 4Z78B 2UWEF 4O51A 1TCRB 3CIQA 4FQ1H 4LCUB 4KJYB 2DF3A 3VXUD 4YFLF 4JFZL 1AQDA 1I3GL 4EKXA 2P43B 4O9HL 3AM8A 5T1KA 5J11B 4QRTA 1T5XB 4YHZL 1E28B 2UVEA 4UOW1 5HYJE 1GC1H 3WSQL 5IFHH 4POZD 2ILLA 1U8NB 3HLAA 3QDGD 1H0DA 4JPIB 3KHOA 3LSOA 3TVMD 3WNOA 1WC7A 4WCYL 3QSKB 4LNRA 2P1YA 3BN9C 3GRWL 3QIBA 5E5MB 4HJJH 1EEQA 3LPWA 4LU5H 1ZT7B 1OARH 4GSDL 1UWEH 3HNVL 1T4KB 3VFRA 2N7AA 4RIRA 2C1PA 4HS6B 3KPMA 3DNKA 2G60L 3RX5A 1LQSR 4NT6B 1YQ2A 1UKTA 5ANME 1YPZF 4LCYB 5DT1L 3BT2H 3RPIB 4YHYC 4AEFA 3LCYA 4ZFGH 1XZ0A 5LQBH 3UJJH 5DRNA 2FBJH 4ZG1A 3MRDB 4XP4H 1RUAH 1JWSB 4GW5B 3SKMA 3WS6A 1FVCA 3F12B 4PGDB 3NPZB 4TNVF 3BKJL 3LB6C 4HBQA 3T0AA 4KPHH 1H3VA 1R3KB 5E70A 5EU7E 5DDHB 4HJ0C 2CLRB 5D1QA 1CICA 3T04D 1VPOL 1HQRA 3BRFA 4L8SB 1AE6L 4KK5C 4LRNH 2GJ6B 2DD8L 1UWGL 4X7EC 5HVHC 4M62L 3GMNA 3CLFL 4MAUH 3T4AB 3RUGF 3QO1B 1F90H 4NKMA 1DBJL 1FYHB 3EFFA 5D1ZB 2DS4A 2JCCA 3QXAB 4PREA 1FFOA 1IBGL 2ADFH 3BPOB 5I8KL 1KJMB 4FFYL 4P2OC 3RPIA 1XF5B 4N0FB 1LWRA 3EJYC 5LGHH 3MLZH 5D1QD 1WQVT 4RBPK 3RVXC 4X6EA 4Z0XB 1NJ9B 3MRKA 3UC0H 2ZG3A 3GSOB 3RRQA 3TBWA 4D3CH 4U1SA 2HTKD 4F3FA 1X6NA 4JM4H 5KJRH 4UU9B 3ZKXB 1N4XH 3VG9C 2OTWB 5A3ID 1ZHBA 1S7SB 5DEFA 5KS9B 4PJAF 2V2TA 1I75A 2W9DL 3VGAB 4DTGH 4PJ7A 5A43C 2X4UA 3SCMB 4DEPC 5T33H 2FHFA 1F4WL 3GBNH 1QOKA 4PB0H 4N8CH 5AZEL 4QO1A 4O00A 4Y2DC 1FN4B 3MLWL 1MAMH 3MGTA 4PY8I 4BZ2L 2PYFA 4M1DH 1WWAX 1G1CA 1FV1A 3P0GB 3IJSA 2O5XH 2RFXB 1LE5B 4XVUD 4ZQKB 1RULH 1EEYA 5D2LF 3CXHK 3EOAA 5KVFH 3D3VE 4HUVB 2QL1A 1V7NH 2AQ2A 4NJ9L 4EUPA 1RVFL 3GSRB 5MENA 3CFEB 4YFDB 5KSAC 2FZ3A 5B3JF 1X5YA 4Z0BH 5FYJL 5EC2B 5F6IB 1WZ1L 4GQ9L 1ZMYA 5T1KD 3SO3B 5GGUA 3VXNB 3PWVA 1OP5K 3Q3GB 4K8RD 3EO1A 5FUZH 4CJ0A 5E94A 3X3GH 5I9QB 4CMHB 3IDUA 3IJYA 4IRJA 4XB7A 3NABL 1FNGA 4O2EA 4N0UE 5KAQF 1ZSDA 4PBXA 1H3PL 4M5YL 3H7LA 3BPNB 3O0RL 3D3VD 3KLDA 1RJLA 3L3JB 3EOYG 2FH6A 4RFNC 1PKQA 1QFWH 5E1AB 4Z77B 1T0PB 3HZVA 4HFWA 3GBLA 1NFDF 4EEEA 4JN2A 2VLJA 1IGMH 4J12A 1A5FH 4HWBH 3H6JA 5B38B 1B0GA 4W4OC 3CH8A 4E9LA 1NBVL 2WWKO 5DUMH 3U0TA 2BCKA 4R0LB 2BRQA 2P46B 4HK3N 2AERT 4MCZA 4NRXA 2V2XA 4ELKB 4QKXB 1FZKA 1UZ8B 4CN6A 5C6TL 4F33B 3UTSE 2DQEH 4O2FA 1DL7H 5HTSA 2FJGA 5IJKA 2CR3A 1AIFA 3VGHA 5FDWA 3LB6D 4ZUVB 4WEBH 5BJTA 1QSFD 4PJAB 2PXYA 5D2LA 2A38A 1QZ1A 2C7UB 4X4XB 3G04B 4J3XA 1AR1C 4RAHA 4J8RB 3B9VA 3LKNB 1CXLA 1VACA 1NLBH 4MNGB 3P9LA 5GXBB 5F3HB 3MREA 3RKDD 5L9DH 2X89D 1OSZA 1X5JA 4PLKC 3AMLA 3RI5K 3FHAA 4EDWH 2AJUL 4ZFZA 5ICZA 5IW6A 3BIKB 4LPVA 1OW0C 1BAFL 3MRNB 4Y4HA 1QSFE 5DSCB 3SCMD 4BKLA 4ZTOL 1INDL 3SDAB 1KN2L 4AG4H 5CWSA 4B50A 1K4DB 4QWWC 3PWVB 5ICXA 3EKCA 5DSCA 2IANE 5ICYB 2DQJL 2P24A 4LAQH 4XNYL 3GJEB 3GSVA 4KRPD 1EJ6A 3UX9B 1QRNB 3ARGC 3U9UA 1FYTB 1FNEB 3QIBC 2H1PH 2A73B 2FR4B 2WV3A 3RAJH 2H2SC 4P5TA 4PRIB 3MRBB 2WLYA 5T1LB 2H26B 1MRDL 5KS9E 1VACB 1KXQE 5F7NC 3L3HA 3MO1B 1GOHA 2GEEA 2G5BA 3B6SA 4OZHA 4U3HA 3KYMA 1ZTXL 4IRSA 1RZJL 2KL6A 5C0BB 1XR8A 4YDVB 1NCDH 3UZEA 5IFAL 2OR9L 1LE9A 3RDTC 3LHPH 4C4KT 3DYOA 3HMXL 4UB0H 2GSGA 4FA8A 1L7IH 1G7PA 5DJDB 4FXKA 1MJUL 1EO7A 3ZTJH 4BH8A 1KIUA 5C0CB 4LPYA 3ULVD 1WFNA 1KF9B 2W0FB 3QG7H 3EBAA 1JUFA 4L3AA 4BQBA 1OTSC 3GJFH 3U0TB 3GHBH 5BXFA 2ITCA 4OLEA 5DEGA 5I15L 2VDRH 1A4KB 1FFRA 1Q9LA 4LAJH 4PY7B 4X8XA 3WJJC 3B8YA 4KJWC 1JJUA 3MV9B 2LVEA 4RAUB 4UU9A 3KS0J 4EDWL 4RGMB 3HC4L 5MHSD 5FYJH 4M03A 3QIWC 4N5ED 1I8IB 4FN0A 4EIGB 4X8JA 1N5YH 3WN5B 1TQBB 4HFUL 3QUZD 4PG2C 3VJ6B 3RWHA 1KJ2A 5F3BA 1KG0A 5IT2H 2EYTB 2BVOB 1RFDH 4MWFA 2EE2A 3E0GA 5E8DL 1JGEB 2J4WH 2X10A 1SMOA 3K80A 5CZXC 2FSEA 1TJHH 1BBJA 1SMAA 4QXTA 1CFTB 3U46A 2DRUA 4NQEA 4CJ1A 5JUEL 1G0YR 5C08B 2JJUA 2R1YA 3O6MH 4BA8A 5JPNB 5F1SA 4OD3L 2HKHL 5FYLD 1I1AC 5F9DC 3VXOB 4HKXB 4KPHL 3DURB 1JGVH 3OXSA 4JM2B 2QSCH 1NBQA 1NCCH 3NACL 5HYQB 2EC9U 2GJ6A 3HE7B 1A6TB 3HZMA 3SGJA 3WLWC 4WTZA 3TBTB 4XBEH 3ARVA 1T2QL 4JO4L 4X6BA 2IAMD 2OM5A 2QSTA 2JELH 1H3XA 2F54B 1CD1B 3RWJA 4Z6AT 5ESAA 2B7DT 4YHNA 5HBBA 4XXCC 2XWJB 1A1MA 2R39A 3KPQA 4MWFB 2H32A 2YWZA 3QIBD 2JJWA 4ODHH 3ZE2F 3DMMC 3NZ8A 5J13C 5DRNB 1DQDH 2VC2L 3I75A 5E5RB 1ZGLB 4ETYA 1DDHB 4MB3A 5D1ZD 4ZS7H 2Z91B 4ZD3L 2Z31B 3VXRA 1ACYL 5TE7L 3UTTA 1RZ7L 5HPOA 1E27A 3NFPA 4P2RB 3OGCB 4KI5C 1HYSD 4OKVB 1MY5A 4RIRB 1QR1B 1QRND 5AZ2L 3C2SA 4PY7A 4ONFH 2B8OT 1W8NA 3HI1B 4LIQH 4ZUSB 3SJVB 4JFXA 3BKJH 4S10A 3UJTL 1HXMA 4NGHH 1EO8H 2R8SL 3GSWA 3CXHJ 3RIFK 2GJ6D 3IXAA 4HGWB 2BVTA 4KVNL 1UWGH 4HSQA 3GSUB 5D7IF 5E99H 1QRNE 1KJ2H 3GBNL 3ARBC 1A5FL 4HWBL 4OZFA 4QHMB 1RHHB 2D7QA 5C0IA 1RUPL 1E0OB 2I9TB 2ATKA 5TPWH 5K9JH 1E4XH 1DBMH 4Q6IA 1E6OH 3CU1A 5JR1H 3PJSA 1P4BL 4N0FA 4QRUA 1EGJL 5C1MB 4FQQA 3DUSA 2CH8A 3KR3H 1JCKA 1KJMA 2GW5A 4PJGA 1NFIB 4K3HA 1IE5A 2DBJA 4EN3A 5I71B 4AIZA 3BXNA 4PJXE 4B7LA 3MGOA 5DT1H 4X5WA 5CGMA 2J8UF 3VFUA 1KIRA 4QRSA 3BZEA 1CFVH 3LN5A 4IRZH 4HIHB 3QWRD 5CUSH 1P7QA 5D7IB 3FB8A 2W92A 4U1LB 4E41A 1QLRB 2IAMC 4U6HA 4BFIB 3OR7B 4OLVL 1EFXA 1SHMA 4MB5A 4DAGH 4WGVB 2Q8AL 3WFBL 3DV6B 1AGDB 1CFVL 1TCMA 4NJ9H 2CMRH 4JFDE 2Z93A 4I18A 3RL2A 2DQTH 1BD2A 3GJFA 3CLFH 1BEYH 2UZIL 3OQ3B 4JHBA 4G6AD 5E8NA 3SE4A 1YNLH 5CILL 5C07B 2C1PB 4AY0A 1F11A 2EDYA 3KVQA 4NC2B 3ZT7A 2PW2B 2FEDC 2DWDA 3JWDL 4WHTB 4OFDA 4MZ2A 1FDLH 3V5KB 2XKNB 5D1ZC 3V5DB 2V2XB 3O3DA 2EYSB 5ADPL 1SEBA 3O2VL 1CLZL 1RK1B 2IMMA 1PYWA 5HVHB 1G7HB 1IC1A 5D7LD 4ERSH 4ENEC 3T3ME 2VDNL 4WFHD 3FO1B 3BISA 3ARXA 1ITBB 4LIQL 3O9WA 5B38A 3LRGA 3ILQD 1AFVL 5HHQA 3TH3T 1JUFB 1KTKE 2CMRL 3T08A 5CBEB 3CGTA 2E9IA 3WDJA 1K9TA 3S5LA 2NW3B 2LVCA 1A7PL 4NKDA 4MA8H 3ME0A 1NMCB 1OGTB 2J88H 2XG4A 4GRLB 2IBZX 5E4EC 1U58A 3B6SB 4NZTH 4PFEA 3QUMH 5D2LE 1U91B 3MZTA 3PL6C 3W82A 1U9KA 3DV6A 4KROC 5FM4A 1ZT4B 1D9KD 3ZYIA 1LO2H 1NGPH 3OG6B 5T5FL 3LH2L 2P24B 3MBXH 3OR7A 1S3KL 2PYED 4XCEA 2OK0L 3OR6B 5CWSB 2OXHA 1OQOA 2C3VB 4ONFL 5C07D 4KKCC 2ZSVB 3O6ML 1D5IL 1DSFH 2VDMH 2JJVA 2R9HD 2VXTH 5LCVL 2DMBA 1JF5A 5HHXH 3P77B 3FQTA 5B8CB 5I73B 1KT2A 3QDGB 2R69L 3DX7B 3DMMB 4DVBB 4JY6A 4Z7OE 3U79A 1QQDA 1YC7A 3PNWB 1ED3B 4ELMB 1KSRA 4FQQB 5EZOH 4L4JA 2HRLA 3RVUD 1J8HE 4AQOA 2LAGB 3MXWL 2JELL 4P2QD 5TQ2L 4ZUVA 4O02L 1T66D 4K2UH 1EBPA 2EDJA 4LVNC 1QVOA 2G2RB 1SEBB 4OCXL 4XB8A 4HS8L 1R0AH 4QRRB 1CL7L 4ZXBC 5C0JA 3MA7B 3EO9L 4F3FB 5EC1A 3HNSL 3N06B 2ZG1A 4YR6A 3CDFA 4ERSL 1A7OH 5DD6A 2JK5B 5FOBA 4M6NH 2PN5A 5C8JA 3VFOB 3NAAH 2J6EL 2O5YL 4NSKA 2A2QT 4F2MB 3QHFH 4PJ9D 3QFJB 3NPSC 3RL2B 4HV8A 4YDKL 2MFNA 5ELIA 3VFWB 5IB1B 1QO3A 2AGJH 1MUJB 4PLKD 3FCTB 4N90E 1ZVYA 2OQJB 2WIMA 3IJYB 4IRJB 1HN1A 5F71A 4WI9A 5CD3A 3M1BA 4UTBH 2GITB 2AEQL 2A6DA 3OAYH 5GRUH 1CLYH 3RY5A 4RFNB 2H9GB 3GJFK 4CVZA 3KWWB 2XTJE 5DJ8A 5DHVH 2VH5L 3JTSB 5CSBA 1BFVH 3FOLB 3VXRE 1U3HC 2IBZY 4LHUG 3RVUC 5TJWK 4M7LL 3RQ3A 1DR9A 3GSRA 4NWUL 4GW5A 3OF6D 3UJTH 1E6JH 3KPSD 3MPCA 3S8WA 3MRCA 3HB3D 2E6JA 4XTRC 4CMHC 1U8HA 4Q74A 4TSCH 4GKZA 4TUJB 4QNPF 3W0WE 1S78C 3OMZA 3TYFB 3EJYD 1C1EH 3QHZL 3BPCA 4Q6IB 3RVXD 4ZYKA 5ALBH 3VXQA 3PWPB 1T2QH 2ATKB 1S9WA 5TE7H 3W39B 4PJBE 3VFRB 5J11C 2AJSH 3MGTB 2ZOKB 2VKXA 1CGYA 1PVHA 5AYQA 5KSAB 4TQEH 3QIBB 3GB7B 3LEXB 3O3EA 3L7FA 3L5XH 4XNZC 1VFMA 4KKLC 5DJAA 5A2JH 4ACPA 5BRZB 3BDXA 3HI1A 1I7ZA 4KK5D 2XV6B 3HPJB 4KK6D 1CDYA 2ERJC 4K7FA 3QUYD 4CU7A 5BV7C 3W0WA 2VKWA 2XWBB 4DQOH 3RAJL 4RGOL 3LV3A 4ONGH 4YHPB 4L9LA 1CVRA 4G80B 3KPPA 4JPVL 2VDPH 1J1PL 3WNPA 2HKHH 4F37F 1Z3GL 2DQJH 5DD1L 3KPRB 4GAJH 4OD1H 8CGTA 3P0VH 3HC4H 4APQB 1J1XH 2PO6B 3LPFA 1A1MB 3TN0C 1NMBL 2F8OA 3RWJB 3F7VB 3OAZH 2WIIA 1FO0L 5IHUH 4AT6A 1XR9A 2BXYA 5IESH 3FT2B 3MO1A 4ZDHB 4Y5VA 2H3NB 1UXWB 2VSCA 1U8OA 2CDGB 5D1ZA 5B39B 3RGVB 4HW6A 4P4RB 1TQCB 1NPUA 2W0LA 2GAZB 3OXSB 2N4IA 1WZ1H 1FGNL 1MJUH 3LS5L 4F7PB 1RY7B 4YLQT 3AS1A 5F96L 1ULVA 2KH2B 3VGEA 4MAYA 3QZWA 3WE6A 4AEHL 4GUPB 4OQTA 4Z5RA 4KKBC 3BP7A 4FP8H 1AD0B 4HUXA 4PJ5E 4OFKA 5I75B 4M9OA 1KYOK 1XCQA 3VXUA 5JHDB 4J8RA 5I8OL 1PD6A 1I8IA 1I1AD 1JPGB 1U8LA 3QDME 3D1MC 3WS6C 3RFZC 5J12C 4K94C 3SGKC 2RQ8A 5TDPA 5I1GH 4F58H 4JRYE 5HDQH 3KPMB 4KMTL 4Y4FB 1I4FA 4MCYB 2EIEA 2EXYC 2W1NA 1AIFB 2XZAH 1NBVH 3WHE0 1NC4B 4JO1H 5T5NF 3E6HB 5J6HB 5AYUH 3GMRA 5HYSA 3U1SH 5JIIA 4YHYB 1BJ1J 4GKNA 2X41A 3LQAH 4OUUA 4M43L 3U7AA 2R0ZH 2C3WA 3A67L 1MHHB 1WVZA 1NH6A 1CXEA 4HIXH 4NHUB 4BQ8A 1RUMH 2NY1C 2Z92B 5T1KB 4K7PL 3T0EC 4RMWA 2YMXL 5JHDE 1FORL 1S8DA 1U8LB 1DUYB 3M8OH 5F88B 4OIAA 4XCFL 4HKBA 4DKDC 4HUXB 3I02A 1HOCA 3V4UL 1S9KC 5EBLB 2XA8L 4OZGF 1AXIB 4RX4D 1JE6A 1NBZA 5EUKA 5GRYA 1Y6MR 1PQZA 3H3KA 1QKZH 3LEVH 5EZIL 4XCYB 1B3JA 5EUKB 3G5YB 4BZ2H 1RU9H 3PWPD 2YPKA 5K93A 2YK1H 1J1PH 4EN3B 4P99A 2X05A 3QUZC 1YEHL 4P5TD 3FQUA 1F6AA 4OGXL 3LKRA 3INUL 3VXSB 3SE8L 4RWYH 3VU2A 1L0YA 4MMXC 2HFFA 2F5AH 1X5LA 1H3PH 2F8VA 4D0CA 4QHUB 4ZFGL 3WUWG 2LTQC 2O61A 1S8DB 5DK3A 4L3EE 4PBWD 2HH0H 1GL4B 1QFWL 2XG5A 3AGVA 5HHOA 4LCWD 3BPOC 3CX5J 1HH6A 3MBEC 4UDUB 3RUGA 2J88L 3LD8C 1FN4A 3DRTA 1S9YA 5F7EL 5L2JA 3O3AB 1F97A 3PGDA 1F13A 3C9NA 3GMRB 5ITBH 1BQUA 1FZJA 1TMCB 4P3CL 2NTFA 3Q48A 4JDVB 4LRNL 3VRJB 1R0AL 4I77H 1INQA 1B9ZA 1IAOB 2HFEA 3VD9A 1DQMH 4LGPB 5DEFB 2WUBL 1MELA 2BVEA 4BUHA 1V3MA 4CAGA 2VLJB 1TIUA 4HGMA 4NNYA 2WBWB 3MXWH 1I8LA 4U1KB 1RURH 3S4SA 1RZ8A 4JQXA 4JRXE 4IJ3B 1T2JA 4JREB 4HZLA 1VEOA 4WDIB 5GRVL 3DO7B 4FQIL 2HJFA 1YN7B 4FTVB 4LKCB 3NZHL 5FV1L 3MLVH 3EGSB 3STLA 2E7LC 5E8NB 3VMOA 5FV2A 4KUCF 3T0EB 5JW4M 3GJFB 3RY6C 2FX7L 4P46D 2HJLB 4ALAL 3QXAA 3QNZA 3E6FB 5F9WB 2IWGA 4DKEL 5IHLB 2P44B 1YEDB 3RGHA 2F74A 1N64H 1UB6B 4OCXH 5TGBA 4H0GA 4BZYA 1MIEH 1ZHLB 4IRJD 4NQDE 3QQ4B 5D7IA 3CVHB 2C3HA 3ARPA 1HH9A 1ZLVH 1FZOB 3D25B 2OJZL 5EOQL 5HHMB 3CPLA 4GRWF 4Z7VB 4NUGH 5I8KH 1E4XI 3MSPA 3KPRA 4DKAA 1TENA 4RISL 5HXMA 1PZ5A 3QXVA 5ACMA 4M3JA 4UBDD 4QRUB 3BP5A 4LL9A 4KJQC 4OGAC 3QBTB 1Q9OB 2YOCA 1MHPL 4R2GB 4O9HH 1NGYB 2W0KA 3ARGA 1G0XA 5SX5K 4QTIL 4LVNB 1NUNB 3HE6C 4PJIA 1S7UA 1G9NL 2WP3O 4U3XA 3H2WA 1ZHNA 4DZ8B 3FN0L 4JFQA 3TLRA 4PJBA 4YK4C 3HB3C 4JVPA 4LSQH 3ROOB 3PWJB 1RK0B 2D7PA 1NAMH 4FXLA 5TDOB 3RKPA 5AD0A 4ZOEA 4OFYA 5KANI 1RPQA 1HDMB 2VR4A 1NDMA 1QTYT 3LH2H 3WCYA 3QUYC 1N3NB 4ODVH 5EUOE 1NGZA 3CDGB 5DLML 1QYGH 2I27N 4HBCH 3G6DH 4HCRH 4M00A 1YEHH 4YO0A 2F58H 4F7EA 1T22B 3Q5OA 4PJHA 1KT2B 4ZNEA 1IC7L 1BPVA 4IIQA 3LN4A 4YHMH 1K5NB 5HPMA 3BEWA 2DQCL 4WNQA 3QWOA 3OWEA 5SWQB 4PJEB 5JO5A 2XZQL 4R96B 1UB6A 4K9EH 3AREA 4FZ8H 3MRHA 4XNZB 2GYSA 4XT1C 4G8EB 4RFEB 4QRPB 4YIQA 1HHHB 5I16B 3IU3B 1UQSA 1WZMA 3DWTA 3TBVB 2BK8A 5BZDA 5MEOA 2P8LA 5T3ZD 5FGBC 3Q6FA 2H2PD 5IBUG 1M7DB 1R3LA 3J8F7 1GZQA 4KY1H 4HG4J 3SY0B 2HJFB 2XI9A 3DPBA 5ESQB 4DN3L 4NKDB 5CEXB 1UCBH 4PV9B 2JK5A 5EH1A 3CVIL 4LVOB 3O4LB 2BY2A 4PRHE 5L2KE 4X8JB 1A1OA 4MSWB 5FM5O 3V5HA 3SDDA 1HSBB 3NN8B 4XC1L 1J11A 1U36A 1YMMA 1NGWB 4UV7H 2P49B 1U3HB 2IANB 4PG9B 5GJSL 3QR2A 3DJ9A 3RGVD 5CILH 1OARL 4GSDH 1YEIH 1QLFA 4WWKB 3OXRA 1NFKA 5BXFB 1IAII 4IOFD 2P4AB 2YD3A 1CTNA 4M7ZC 1KPVA 2Y6SC 2WUCH 4LARL 2VSDA 2GTZA 4QY8A 5I15H 3PGDB 2X4RB 5FA4B 5D72L 1KLUA 1PLGL 1L6XA 5IVXA 3TJEL 3DSFL 3QULA 4I2XA 4NZRL 5LAXA 1LEGB 2DDQL 3QDGA 1J05B 4PGBA 2NX5E 3JSSA 4XPBL 2R0WH 3ZDXE 4WU5B 2XTLA 2EZ0D 5LGJB 1ZEAL 4EBQH 1YYMH 3GMLA 3PWPE 3VWJB 1IEHA 2YC1B 2X4NB 3H9SE 3RNKA 5KG9B 3W5NA 4OZIA 1C5DA 4DGIH 4Z7UF 1FNLA 1MWAB 4XBPB 5D6DA 1YDPA 1A0QH 4I1NB 5GSRB 4JQIL 3RTQC 12E8H 2NNAA 4NO3A 3T3PF 5JR1L 2Z35A 1U91A 1OGAB 3MV9D 1KCUL 1YC8A 2ICEB 1K3IA 4P9HH 1F2QA 3OG4B 5I1LB 3ZHLA 2V5RA 4MD0B 5HI5C 3GMMB 2PCPB 4JHZA 3LAFA 2AK1H 3DUUA 2FO4B 5I1IL 5SWSE 3PV6B 3BUYA 4Y2OA 4E5XA 4KVNH 2HLFC 3CXDL 4MD4A 4TTDC 4JJHA 2WBJD 5BVPH 3QNXB 1U8QA 1OSZB 5DHYA 3BZDA 4MA3B 4TSBH 4OCLC 3REVB 4PGBB 3U0PB 2QV2A 2DICA 3QUMB 2WWMC 2YA2A 1KV3A 5DD3L 1EHAA 4KXZI 2VNCA 3ULSB 4CW1B 1EV2E 2VXQH 3D2UB 2BNUA 4JPWL 4UV4L 5BS0A 3NA9L 1ACYH 3U9PH 3MOAH 2R15A 1IAIL 1C12B 1G7QB 3CX5K 1AD9A 2ZZUT 2VLJE 3QEHB 12E8L 4GAYA 2VAAA 5F9OL 3VFVB 1MHCB 4BELD 1FVEA 4LCCC 4QF1A 1MF2L 5GGRB 4YAQB 5KVGH 3ZE0E 2Z31C 3R0NA 5DI8B 4PJXB 1IGTA 1MJ8L 3MRPA 4LSTL 3H9YA 4FFZL 4I0PB 4N1CA 3SE9L 1A21A 5ALCH 4QT5A 2MQ0A 5KSVA 1L9MA 1T1YA 4HH9B 3FL7A 3LKSB 2KDGA 4JFEA 4I3RL 5BZDB 1LDPL 3VRIB 1J8HB 1AGFB 2RR3A 2XWTB 3HR5A 3DSFH 5FGCE 1I7UB 2BNRB 4P2OD 1AD0A 2P7TB 5E8OA 2B4CH 4JG0L 4CVWA 4PRHB 1CLYL 4H25A 1FLRL 3MOBL 2B2XH 4M02A 1BIIB 4U1IB 5L6YL 2IGFH 3PGCB 1ZHLA 2IFFH 4V1DD 1C5CH 1WV7T 2Q86A 2XQBL 4TSBL 3GDBA 2DM4A 4S1DC 1YY9C 2ICES 4X4ME 4EOWH 1IILE 4XP1H 3REWB 5KZCB 2XFXA 3P9MA 3RJQB 4WFHE 4LCIL 3FFDA 3M45A 2JTDA 4PTTA 4B5EA 2BVQA 3S9DB 2ITDB 3MJ6A 1CFSA 2P5EA 3G5VA 2J8UB 1NUDA 5GGTH 3KPTA 5F70A 4IBLT 1CFTA 4RGNB 1EEZA 4HCRA 3ARFB 1RZJH 5B21A 3SBWA 5EBGA 4JJ5B 4LGSB 5D5ME 3NIDF 1BFOB 1ZS8A 3TJEH 1HHGA 1INEL 1UZ6E 5DFWH 4KKAC 4IOSD 5DD1H 4AEEA 2EDWA 4FXGB 4OI8A 5DD5H 2GUOB 2X4UB 2E6QA 5HI4D 3JWOL 4ONHA 1OW0A 5B8CC 3PGFL 4JFDD 1KLGA 4OZ4A 3JV6B 1INQB 4OSUL 4DFIA 1NKRA 4XP1L 1E27B 3NFPB 1BZQK 4NQCA 1KXVC 7FABL 4UQ3B 4NBYB 3IRPX 1WIPA 4WO4C 5LBSL 2PR4L 1RAMA 3Q5YA 5ECJE 4P23A 1VFAA 1AGBA 2FWOB 3MUJA 4P2QE 3VI4F 4Z7VA 5DMIH 1GGIH 2VDKL 4QHLA 3TYGL 5GS2D 4U0QB 2MWCA 2YRLA 2DM2A 1KB9J 2AXHA 3U6RA 4K3DL 1A6WH 1X7QA 5JIHA 4F7TB 1SJEB 3TBTA 3WMSA 3ARTA 3TWCH 4LHUD 2QQNL 3DX9A 4GRLC 4JZJB 1F3DH 2IH3B 1NMCC 5CZXD 2FR4A 5D9SA 1PY9A 3KHQA 3P9MB 3KXFE 3ZE1F 3T4AA 4KKLD 1WK0A 3ZLQC 4LSTH 2JCCF 3IGAA 1G1YA 3QUML 4U1HA 3U30B 3GK8L 5EBWA 1FNSL 1B6DA 3FO9B 2Q86B 1VB9A 3LRHA 1JRHH 3TVMA 3V6BR 2HJLA 4Y16D 5JPNA 2BSSA 4U1IA 3WIIH 4OF6A 4PJFE 3T0EA 2YPVL 1K8IB 4H25B 2GITA 4LEXH 4J23A 2OQJA 3VRLF 1XGPB 1KTDA 3KXFD 3OKDA 1T89A 4NZJA 3F12A 2YXMA 4IOFC 5CINH 2XZQH 2CDFB 3D18B 4X7TB 1J8HA 2QADD 4HKBB 1TETH 1AFVH 3VWJC 3DVNB 4FQJH 4U1KA 5CMAA 1NEZB 2DQGH 3MACL 3TBYA 3MLXL 4C83A 2C1OB 1T7WA 3NIDE 3CDCA 4Y5XB 5HHVL 3RVTC 4PJFF 2B0SL 3DTXB 4OCSL 1KULA 3UTPD 3MLTA 3R1GH 1FPTH 3C9NB 3QUZA 2RJMA 5GRJL 4XHQA 1XGTB 1IKFL 2FO1A 3P4LA 1BLNA 5I76A 1AO7D 3ARZA 1Y0LA 5GS0C 4OCWH 4ALAH 4PS4H 1YA5A 4FXKB 3GO1L 4XXDB 4HXAL 1UJ3C 4Y4FD 3EZJB 1CLCA 1NGQH 1EAPB 1MLBA 3FT3A 2DLHA 2IALA 4L8DB 2O61B 3KYMB 4IRSB 1TCRA 4LCUA 3BKCH 4JR9L 4QHUA 4UAOB 4RISH 3QUMA 3ULUC 4EI6A 4NN6B 3B2UD 2V7HB 4LSRL 1XGRB 2E7CA 5EUOF 5TDNB 4JM2F 1PKOA 1U8QB 3FQTB 2DQHL 4WUUA 1QSEA 4HX1A 4AENA 4C56B 1RZIA 5B8CA 2F5BH 4G6MH 5E1HB 5KVFL 1MHPH 3C2AL 4Z76B 3QZWB 2CJUL 1ZK9A 4RGMC 5DXWA 3ARDA 5EZJB 4P9MH 3EO1B 1HKFA 2NY6B 2ICEA 5INCB 3OR6A 4R97C 4BSJA 4CNIA 2WWKT 5HHPA 1NBZB 3T77A 1U3YA 1NEZG 1QBMH 2UV3A 5IOPB 5K33A 3DXAA 4AEIH 1AHWB 4X6CF 1NCAH 2FLRT 3PIQB 2IH3A 1YECH 4JFYB 4EVNA 3LKNA 4P9ML 5F9JB 4JE4B 3VFTA 1SYSB 3G04A 2EH7H 1TVBB 3C08L 2C4FU 1CDCA 5DQDL 4Y2DB 4AH2B 1CFQA 2HLAA 1IC5L 3GHEL 4MVBD 2YA1A 1BBDL 2VQUA 1AGCA 3GI8L 1LMKA 4JANA 5C08E 3DIFA 1A6ZA 4NDMB 1UM5H 4NQUA 1LK3L 1S9VA 5C71A 4G80A 4MDIA 3VXSD 1KCSH 5DMKA 3BD4A 1DBJH 4ZPTB 2VB5A 3SCMA 4MCZB 1R6VA 5HYEA 2DTMH 1IT9H 1Q9KA 4RX4A 2VDOH 1KJVA 4QRQA 1NAKH 1P84J 4PJCA 3SKOB 2IF7A 3HMWL 5LWYH 2F15A 3BJLA 3SQOH 2YHGA 5K59F 1MCFA 1KTLB 1NKOA 3L9RA 5I8CB 3L7FB 4G6ML 5EU5A 4OT1H 5HVGB 2BSTA 2A1WL 3HE7C 3KYNA 1HILA 3ARFC 2W38A 1F6FB 2VZOA 3HE6B 4DUVA 2FBJL 2ZOKA 2XTJC 3UO1L 2PTTB 3F58H 3FB7B 5HDOA 3OKDB 3HAEH 3SE4C 1H9VA 3V0VB 2R0KL 4Z7NF 3Q6FB 4M6AA 4GKZB 1MIML 5I1AA 4F7PA 2CUIA 1UWEL 3K4DA 1FFPA 2XICA 1I1YA 5DC4B 4FFVC 3TIDB 1MH5A 3BSZL 2BMKB 1QNZL 3QO1A 1K3ZA 3D3VA 4KGLA 5IG7A 3RY4A 3QQNA 4P4RA 1FO0A 5GZNC 3KJ6H 3OKOB 1LEKB 1OQXA 2OR7A 4EUPB 1BIHA 4TNWK 4POZC 4ZDHA 3EYQC 2XRAL 4R2GD 3G08B 2WIIB 1YQVL 5HDLA 3GM0A 3JWOH 4C58B 3UZQA 5D7LB 4LCWE 4NWTL 5EG6C 4PP2B 3QG6B 1J12A 1NBYB 3VXMA 4L4VD 1OAQL 2AXFA 4L3ED 3CMOL 5IB1A 3VFWA 4G6AC 2IQ9H 4KTEL 4DGVL 1PEWA 3QXDB 1YEFH 3O6KL 3B43A 3S3SA 5J3HC 3C8HA 5FK9A 5A2IH 1T1YB 2MMXA 4WW1A 4HPOL 4NZUH 4WI6A 3N85L 2DQUH 4LSPL 3ULVF 2V17H 3H3PH 1DVFA 4ZOBA 5ITBL 1UM5L 1Q72H 1DLHB 3L5WA 3QQ9C 4Y1AD 1KC5H 1F4YH 5EC1B 3QNYB 3KDMA 4F9LA 1OSPH 3L6FA 1KJ2L 4X9IA 4JFPB 5D8JL 1CR9H 1RZGB 2DL9A 3D0LA 1KB5L 3D0VB 1WEJH 3F65A 5BQ7B 4LLAA 1ORSA 1U8NA 5IJVB 5KSAA 5KZCD 3KPRE 2YD8A 3W81A 3ARGB 3BDYH 2DIBA 1J0KA 2X2YA 1Q1JL 4JDTL 1MJ7H 1DZBA 2ED7A 3UTTB 2D9CA 5BZWA 3BGAA 5EOCL 4CADB 3IB4A 3ULVE 2FHCA 4XH2A 5ISZA 1CFNB 3AXLA 5HHMD 1XGUB 3ARFD 1CWVA 2ARJB 2X1QA 1CIUA 3WFDH 4WENB 3L3OB 3ROLA 4KI5F 3S7GA 4MYWB 2VIRA 3CPLB 3X3FL 3BUYB 4NKIH 1T80A 4JLRB 4LF3A 2IJ0C 3H3BC 1YEGH 2LU4A 2R2HB 1I85C 5I8OH 1FFQA 5EWIL 3GK8H 4UTAH 43CAB 5D7KD 1W72A 4ZXBA 2ZUVA 5EIIA 4FS0A 1YDPB 1GCFA 1YEEH 5C7XH 1MUJA 3E6FA 4OUOA 4OZIB 1Y6KR 3GIVB 1JTPA 1INEH 4LSSL 3V6FA 4JGMA 4NQDB 1U8PB 1IKFH 2P8PB 4GLRI 4MAYC 3PQYB 1BF8A 1CGUA 4KV5E 5KS9F 3FRUB 1N7ML 4PJXA 5E0QA 3L1OH 4HZLB 1SEQL 5IFJB 5JW5A 4HWZA 1P2CA 3GBMH 5EN2B 5JQHC 4YAQA 1W72H 4WWKC 3Q0HA 3V8OA 3BI9X 4BK5A 2Q76A 4Z18A 5GS1B 1HKLL 5GSVA 3CC5A 3O9WB 4XVJH 4EN3D 2ICWJ 3PHOB 3PHOA 1MCKA 1A6AA 4KTDL 4FNLL 1C7TA 4OFYD 1MI5E 3TN0A 1JNJA 3MRLB 1NSNL 2IANA 3MRFB 1YMMB 2HFGH 3E8UL 4JQIH 3EYVB 4BQ6A 4WHTA 2L4OA 4QTHB 5JW5B 5IR1B 3IKKA 2NZ9C 2VXSH 5TFSH 3OAUH 2BY3A 3MCG1 4XAWL 2ICCA 1DN2A 5IW1B 4JANB 3PDOB 5ACZB 1MCLA 2WLZA 3PQYA 1F4AA 1PSKL 4M7JL 3STZA 2VN7A 1FG9C 3TBSA 2HWZL 2ZPKH 1BWMA 3S5LG 1ZTXH 3QHTC 4ODWA 4PGCA 2EE3A 1HHHA 2Z93B 5I16A 3F7YB 3UP1A 5E4IA 5ID1A 3K8LA 4NCDA 4JG1H 4LSUH 4CN4A 5ICYA 4PJ8C 1MJ7L 3L7EA 4O2CA 4CMMA 3IDJA 3MOBH 5INCA 4ODSH 3DRQB 3E3QC 1EDQA 4OLXL 3QDGE 1P9MC 7FABH 3LN5B 1AO7E 3RWGB 5BS0D 3IFOB 3MGOB 4DGIL 1TQCC 4TOYH 3BMVA 3VXMD 4ZSOE 4ONGL 2IQAB 3HC3H 4O58H 4U49A 2SEBB 3S88L 3ALWA 1XGUA 2ZUSA 3BYTA 1WBZA 3S36L 2CLZB 2E7MA 1KEGH 1EPFA 4ODSL 4GG6E 1A7RH 2FECI 1FLTX 3L5XL 4X80H 5BZWB 1A9BB 3W11C 4J4PD 2FYYA 2XYCA 5C0NC 3MFFA 2Z92A 1S5IL 5I0DA 1BZ7B 3OXRB 4M5YH 4OLWL 3HI5H 3QRGL 1WZLA 1JGDA 5L2KA 3QDHA 1RZFL 1N5AA 4Z7WA 5C0AA 3QDMA 1TITA 5EO0A 3L6FB 3IDXL 4QOKE 4PJIB 4FG6D 3L5IA 4I18C 4JFEE 1E6JL 2Z0BA 5IKCA 5CBAB 1DVFB 4NZTL 3BDBA 5EPMB 3GMPA 4EI5B 1RZKC 5I0ZA 2Z8VC 5JDJA 2V7NB 5FO8B 2H8PB 2Y36H 4P59L 4OZGB 4EOWL 4BJLA 3SGJC 3W2DH 4G7YH 2P8PA 5FGSA 4RFOH 4NBZB 3LKPA 1K6QL 1T04B 1YYLH 3CSGA 3M07A 3T1FB 3T2NH 3K1KC 2RGSA 1TNNA 3O9WD 4G8EA 2RBLA 5DURB 4GUPA 1MAJA 4Q6IC 2VLLA 4LARH 1T83C 5ESVA 2DQFA 1HZHL 4ZAKC 5ANMB 3CNKA 4L4TD 3CVHA 4XC1H 1MSPA 3UAJC 1GJIA 2FLBT 5HPMB 5SX4H 4NPYA 1ZLUH 3OKOA 4PG2A 2AVGA 3RVWC 2W65A 5D5MF 1Q9WA 1Z0NA 3U7YH 5D5MB 5TF1H 4JZJA 1JPST 3QISA 1QSFB 3V6ZB 4Y5VB 3L3DA 1AKJB 5IB2A 5E7BA 4DN3H 5HI5D 4QXTB 2VDQH 5D6CA 5A2LH 5HDBE 2DYPB 3IRZA 3V0VA 5SWSA 4HS8H 5D4QA 3GUTA 3MTRA 3SPVB 1IT9L 4QHLB 2DDQH 1EERB 3DI3B 5F93C 2FX8L 5FA3A 2PTTA 4M1CC 4M8QA 4CL7A 3C5ZA 4XP6H 3PWUA 3PWLB 3S4SB 2BHYA 3GSWB 2UY7A 4KK6C 5IFHL 2OSLA 4E41D 2HVKA 5CGYC 4OQ1A 2EZ0C 4Q9RL 3KDMB 3S4SG 4JKPL 4MA8L 3DV4A 5DWUL 2YD2A 1DLHA 4KRLB 2V2TB 3CSPA 2AXGA 1A6VH 2Q7YA 3IXTB 3ILPB 4OZFG 3LD8B 5B3NA 2E3VA 3IS0X 4PRPD 1A02N 4JHAL 5DYOA 2B20A 1HXYB 4HT1H 5BOPA 4FFVD 3H0TA 4YPJA 6FABH 5HGBB 4FQ2L 5JW3L 1MFEL 1A7NL 4PGEB 1S9WB 1PFCA 2AEWA 3W39A 5IEHB 1DQTA 1CLZH 2NTSP 3QP3A 3SPVA 5ADPH 5C0BA 1TVBA 4HK0B 1OGAE 3P4NB 4D0CB 1T0NB 1RMFL 3FMGL 5KBNC 5DQ9A 3HE7A 1MCWM 4NUGL 5F7DB 3H3PL 4XRCA 4KY1L 5HGAB 4HGKC 5GS2H 1UEMA 4G6FB 3TV3L 3VXOA 4CNIB 1I7RA 3SGKA 3C60D 5I1AB 4IRZL 5IV2A 1PLGH 4R4FH 5DVMA 2FNBA 1PAMA 3RWCA 2EC8A 2APVA 1RZ7H 2FGZA 2ZG2A 4JRXA 3STLB 1FL6B 1JN6B 1H3TA 3BPLC 4X6FA 1DEDA 3ARGD 3C6SB 2X40A 1OWRM 4DW2H 1JI1A 3UBXA 2YUVA 1VSCA 2CRMA 3KR3L 3HAEA 1YEKL 3AFLA 4NQXB 5F7MC 3WD5L 2BY1A 5JLZA 3KYNB 4FQLH 1KPUB 2FATL 1RJZA 2VZ3A 4F7CB 3JWOC 3QIUD 5LQBL 4NT6A 4OJFH 1S78D 5F9AC 4YGVB 2X5PA 4D0DA 2FB4L 4FTVD 3TPUA 1NMAH 1T3FA 3OSKA 2W91A 4NCC1 4P5KB 5FFLA 4O2FB 1LO3L 3WD5H 1BM3L 1KELL 2PNDA 3AS0A 4GKNB 1TTGA 1UZ8A 3E2HB 1KENH 4XAKE 1B2WH 4P23D 5D2NB 4Z7WB 2ZKHH 3MLTB 4AIOA 1IARB 4MDIB 3ULUE 4OFVA 5J12B 3OKMA 1NAKL 4PJ5D 4UIMB 4BFBD 3WIIL 5D70H 5IMLB 1NDGA 4PV8B 1CD8A 5GS1C 4PJIE 4Y16B 2JJTA 4JKMA 5FYJU 4NQED 2A9MH 3D39B 4YBQD 1EHXA 1IQWH 3O2WL 2A74B 4HUWB 2NXYD 5A2KH 3MQIA 4NO2B 4PJDE 1BF2A 3BH8B 1JTOA 3QEQB 3QNXA 4M6ML 3OKNA 4N8VG 1GOGA 4MD4B 3O4OC 1XGPA 4MAYB 5T1DL 2DTML 2QTEA 3T0XA 3GI9H 3C08H 4PJHF 3FFCA 3I2CL 4YHOL 4X6DF 3BW9A 1MIEL 2X9YA 3D39E 3W11D 4AMKH 3DGCR 5F89A 5F89B 3RGVC 5J8OA 1ETZB 4OGXH 5KSBE 3CAFA 1FFNA 1LK3H 1EXUA 5E24E 4HHAB 1VGEL 1D3CA 3LRSA 3IFPA 2EKSB 3NVQA 4L8BB 5A1AA 4M8VA 2NY2D 3RNKB 3W9EB 5KG9A 3V4PL 4RMUA 1VEMA 1J0IA 2KZ1B 4PJEF 4YWGH 4JAMB 5I6XB 3MRRA 3SDXA 5DJ6A 1A9EB 4I48B 3UTOA 3BOVA 5GISL 5IMLA 1N64L 3ZTNH 1HWHB 2NW2B 4ELMF 4FQJL 4B0MM 2QR0A 5DD5L 3MBED 2R29H 5CSGA 5F6HJ 4IRSD 5GGVL 1A64A 4PRHD 1NCBL 2FCBA 1BJ1H 3FQRB 2W0PA 4PRAB 4JFFE 4CU6A 5IMOB 4QY8B 2YMXH 4LNVA 2W07A 4K7PH 3IS1X 3BO8B 3VGGA 4BFEA 4ZUUA 5C0ND 4MVBC 5EULV 3QQ3A 2NQCA 2AJXL 4YZFF 3V0WL 1G7HA 1I8MB 3LIZL 5IWLC 4NM8H 4C54A 1GAFH 4LLWB 1NGWA 1X5GA 3I6KB 3CJJA 1NCTA 1HSBA 3NN8A 3P73A 2IG2H 5AUMB 4Y4HD 2FDBP 5D7SL 4NM4H 5CUSL 3WLWD 2F53A 1MFCH 4DWHA 3IFLL 2GHWB 2NX5D 3BP7B 3T8XB 1F11B 4HIJA 4U3CA 1NJ9A 3MRKB 1GOFA 4L4TE 1JN6A 3NCYS 4WWID 5B3JE 2NY0D 4TVPD 1JV5A 4RZCB 3RUGE 3FAWA 2HRPH 1MCNA 1VA9A 5GRJH 5IB4B 1T03H 3BYYA 5CZKA 3BKYH 2J8UA 3FO2B 3LQAC 4HIEA 2XT1B 1XF2A 1X5FA 2BVQB 2YKLH 4RFEA 2GAZA 4G6JH 5EC2A 3QPXL 4RFOL 4OIBA 3CFKA 5D9SB 2NY1D 4LASH 1UXWA 1M1SA 1BHGA 4XXCA 5EIQA 3V7MA 3JWNC 4KRMB 1SJEA 1JHLH 3BAEL 1WFOA 4PJCE 4GH7B 4GMTH 5L2KD 2VLRA 4L4TB 4LF3B 1S5HB 4PR5A 3CMGA 5L7XL 5I17B 1JGUL 2EECA 3SDXE 4JM2C 5INDA 1E4WL 1XF3B 1JGLL 1AO7A 3OTTA 3MLPA 3HR5B 4TVSa 3QUXC 2X70A 1A6WL 3MODL 2BNQA 4TRPH 2OL3L 2DBLH 5CD5D 1PG7W 1DN0B 1YJDC 4I0PA 4OD1L 4WVRA 5K9KB 2EDRA 1EBAA 1JF6A 4GQPH 4LHJB 3TO2B 3BP4A 4MD5B 4OF3A 1NCDL 1A1NA 1MREH 5EO1A 3PWJA 4FHBD 3UTTE 5FYKL 1YPZA 3MOQA 1JFQH 5ILTL 1HCFX 1Q38A 3C09C 1BFVL 5EO1B 4UB0L 5CEZH 4F7MB 1OD7A 1JPTL 4MAYD 2H1PL 5C6TH 3BPCB 5F7YC 1ERNA 2VL5A 3EYOA 4TUJA 1QSEE 5IB2B 1KN2H 4AG4L 3MYZA 1ZGLA 1I3RB 4M1GH 2R2EB 2AJSL 4DVBA 4UDTB 1MJJA 2F9BT 4LASL 4AEHH 2GTWA 4BH7A 3ZL4H 2E7LA 4OLUH 4MJIE 3K0WA 1PG7X 4ORGA 3KJ4C 5EU3B 3OL2A 1T0MA 4YHLH 4CVXA 2XZZA 5ESAB 3PV6A 4KK9C 5E8PB 1CLOL 1P7KA 5DMJB 3ULVH 4M6OL 4KUZH 1KGCD 1ADQA 3MNZA 1BQLL 5HHNB 4MNQD 4ZTPL 3SN6N 5CD3B 1N0LA 5IQ7L 2HMID 2CIKA 4NKOA 2P5WA 1WFTA 2DL2A 4TRPL 4U6XA 5I19L 4RNRA 4X5LA 5CD5C 3V2AR 5D72H 3SKUD 2WM0A 3MYJB 5HJ3A 3TESA 4OF8A 1N8ZB 4D9RE 4GBXB 1XGQA 1U2HA 4JFEB 5IHBA 1J1OH 4FNLH 2O5XL 3SDCC 4LHQB 1CS6A 4LKCA 1GAFL 4ODBD 4JFDA 4WY7L 2BSRB 1P4IH 3LIZH 4J3OC 2EYTA 3MJGX 3T2QA 1CXIA 1LO0L 2Y06H 5DI8A 4ZNEE 5DD6B 2PKDA 3EDJA 4PJHE 4J4PC 2XQBH 4PB0L 4XNQA 3RZCA 3KPNA 1KOAA 2DM3A 4GRWB 5H35B 1UT9A 5EUOB 4NQSA 5KVEH 4NQVA 5FYJD 4BM7A 2OCFD 3TA3B 4E42B 5JDSA 5KOMC 5IROA 5JOFB 4MD5A 5E2TH 4PBVC 4D2NA 1JBJA 1QHOA 15C8L 1XAUA 2HFEB 3HR6A 1BZ7A 1I9JL 1H8OA 4QRTB 1KJVB 3RHWF 2OMBA 4JY5H 1TJIH 4GW4A 2XN9D 5IROC 1F4WH 1G9MC 4ZS6D 3U4EA 4CKVX 1KEML 3KPSA 1HYRC 1OAXL 3U4BL 2ZCHH 4PJ7F 5FYLH 4I4WA 1A1OB 1J87A 4MSWA 2GI7A 2X4OA 5DRZA 1QQDB 3FB5B 3HKFA 3PNWA 5D6DC 1TLKA 3UROR 5L0QB 2VQTA 2DJ4A 2DLGA 4UIKL 5L8JB 1A7OL 1UXSB 3BZFA 4LEOB 4GXVH 1C1EL 4L4VE 4YDVA 4V1DA 3D9AH 3X14A 1QP1A 5AAWA 3K2MC 3NAAL 4NRYB 5KSAD 1XF4B 5C6WH 2K9UA 5EU6B 3WIFB 2G5BB 2VR5A 1H15B 1MCJA 3H7BB 3QIUB 4YPGB 2DJUA 1U8KB 1IC7H 1UQSB 3ZSTA 4M7LH 1HHKA 4XCEB 3UTPE 5C09A 2CD0A 2R2BA 3EO9H 4YIQB 2OTPA 5GSRA 3NIGF 2AKRA 5DK0B 4JRWA 3AREB 3G6JF 2AK1L 3TNMA 3TH2T 5CJOL 5I74B 4HKZB 3WNLA 3O41A 3SDAA 4D9RD 5M95B 1JPSH 4K7PY 4JHWH 3CFCH 5FECA 5GHWL 3X14B 4HUNB 2BZDA 2W59A 5JHLH 3WKMH 2VH5H 3HFMH 43C9B 5MI0B 4N8CL 3RTQD 3F6IA 3WEXB 1OY3B 2J8OA 2X4OB 3P40A 5GGSB 5F88A 1RJYA 2C7UA 4HXBH 1F00I 1SVZA 3PE9A 1FAIH 1CQYA 1XT5A 4LBEB 3OKKA 4MJ2A 4IS6B 3ARYA 1A0QL 3C6LA 2ZSWB 3UPAA 1HHJB 3DI2B 3FT4B 4MQTB 1CTOA 1NCWL 1FG2A 4JFQB 1MCIA 4KC3B 4RSVA 1ZAGA 2ZUUA 4PJAE 4NWTH 1MCEA 3VGAC 5KW9L 3QIWA 3WIHL 2CKBB 4PV9A 2F8XC 3TPUB 3TT1H 1IM9B 1S7XB 2FL5A 5J13B 5F1NA 1M7DA 5GS0D 1U92A 3KJ6L 2GJZB 1C7SA 3K2UH 2NLJA 4L3CB 1YY8B 1DDHA 4GBXA 3MCKA 3UTQA 1MRFH 3Q2CA 4RMQA 3AY4C 4XC3L 4NFCA 3WFCH 5KAQG 3C6SA 1FNGB 3I6LE 1ORQA 3C5JB 4O2EB 1VPOH 2A6IA 4JN1L 1NLDH 4JRXB 3VG0L 3OZ9H 2JLLA 3S6CA 5A40E 4XP4L 1QHPA 1G6RB 5LG1A 1FE8H 1IKNC 1I8KA 1B90A 3RNQB 2VRAA 5IIEB 2EIZA 1D6VL 5E8PA 4OJFL 3WIHA 3O45A 4GKSB 3QPQD 3OKNB 3DURA 1CU4L 2F53E 1MCSA 5KTEH 4L8SC 1A7NH 4HUVA 2XKSA 1OL0A 2R1YB 4A2MA 2XY2A 5TE4H 3JWDC 3OHXA 6CGTA 1UA6H 3FTGB 1TQBC 2YA0A 4LGRB 1LO2L 2K7PA 5GQBA 3K2UL 1A7PH 3I85A 1PGRB 4Y1AB 2NMSA 3PL6D 1ZANH 1CG9A 4UIMA 3VJ6A 2F54E 3DXAD 3LZFL 1J7VR 5IB3B 3O9WC 2E8YA 2Y72A 5TQ2H 2VWEC 1XEDA 2CLVA 1IEBB 3D87B 4ZUWB 1RZGA 3D0LB 2DQHH 2WBKA 4TVPE 1UA6L 2PW1B 3DOSA 4PRBA 1VKXB 3NCJL 3ARDD 4RWHA 4B53A 1QFUH 2YPLE 4PTUB 1IJ9A 3AVEA 3JV6A 1I7ZB 1F90L 1FIEA 5JIKA 3SQBA 3KYAA 4NNXB 2DTSA 2MCG1 3VDAA 3WXVH 2VITB 3RDTB 4P57A 4XC3H 1LO4H 4WFED 3BEVA 3F6LA 4XMLL 2X70B 6FABL 2EIBA 3MJ9H 1HHGB 2GY7B 5ERWB 1AO7B 2NY5H 4MJIB 3QXUA 2EDXA 5BRZD 2GCYB 2XWJA 1NAML 1OGAD 5C0FA 1E4XL 3S34L 3BWUC 4OZHB 1KBGH 5GHWH 4ZO9A 2J5LB 4YBLB 5DJ0B 1GPOL 5FO7A 1A22B 3NIFF 4ODHL 4QXUH 5DUBA 1H3WM 1C8PA 3EFFB 1WT5A 4M4RA 4KQ3L 2QEJA 3C8DA 2P47B 2YPKB 2HG5B 4NIKB 4HJJL 3RNQA 2H9GA 3QDJB 4K55A 4Q58C 4R90H 1FFPB 4L9DA 3V6OE 4F57L 1DQML 1CZ8H 5ANMA 3KNBB 4RRPA 4N90D 3MV7B 1JV5B 2AK4D 3BKML 3RTQA 4XNMA 1GC1L 3GSQB 4YE4H 3SDXF 4F37K 2HVJA 2V9RA 3MCKB 3VRIA 5FHBL 4G7VH 5MEND 1LP9A 3HMXH 2B5IB 3T0ED 3LEYH 4X7CC 4NSKB 1OAZL 1RUPH 4I3SH 3BQUB 4P5MB 1V5JA 1AC6A 4R26H 3RWFA 1D5BA 1GGBL 4OD3H 3ZE0F 4QHNB 3QZWG 4LNRB 1FZKB 2NY4C 3KYOB 4KKAD 5DK2B 3N1QC 5KVDH 5D7JB 3IU4H 3WFCL 2VLKB 3MX0A 3GFUA 2YD5A 1UFUA 2W0FA 4IM8A 1PDKA 3PWLA 5C0CA 1EGJA 4NOFA 4LAQL 1T1WB 4HJGA 5CKGA 5CKAA 1T5XA 5FA3B 1QKZL 1B0GB 3SEPA 1JPFB 4TOYL 3RVTD 1CFQB 1CK0H 2CPCA 2MQ3A 3HZVB 4OAWA 5EB9A 1G6VK 5FCUH 3HMXA 1RFDL 1QUNA 2ZUWA 3WO3B 5GGSY 1ED3A 4ELMA 1XCQB 4OV5B 1GH7A 5C0BD 2GKIA 4LVOC 2NXZD 1A47A 1G9ML 5F8QC 4FG6C 1SBSH 5FB8A 1HYSC 3GSNB 1FYTA 3RWGA 5BCAA 4WFFE 1HI6B 3SO3C 1F3JA 3C87A 5F6IC 2VZ1A 4XCYA 3OKEB 1A3RL 3O41B 1JZ2A 1OGAA 1PX3A 3B5TA 2AS5M 3P9WB 2ATPB 4QEGA 3D39D 1DL7L 2YRZA 5ESVB 4UNTA 5GRVK 2AKRB 1BQSA 1ORQB 4QNPE 1P1ZB 4N0RA 4QYOB 5CLWA 2LAAA 4V2CB 3QXWA 5B39A 5MENB 4KJPD 5BMFL 1IAKA 5F3HA 3RWDA 2EDFA 3RZCC 1XGRA 3Q1SL 1RV6X 2X4NA 1KLFA 3GMOA 3LHPL 4M3KB 1DUYA 1OB1A 4Y88A 1OAXH 4M48L 1VCAA 5ILTH 1LO5A 4XBGA 1W8OA 2JCCE 5IT2L 2WINA 3FQXB 4G9FD 2IGFL 1OCWL 3KS0H 4XI5D 2B2XL 1QSVA 1MI5D 5FXCH 5FGBA 3P4OA 5CBAA 4GLRH 3TZVB 4KZEH 1MHHA 2FJGB 3FB5A 2CQVA 3DROB 4PGZA 1A6UL 5JUEH 3B83A 4ZTOH 5EO0B 3VWJD 4FP8L 4NHCH 5C0AB 3KYOA 2VQ1B 4I3GA 2VJXA 4ZPVA 3ALXA 4HDIB 3QFDA 1NAMB 3JV4B 3WHXB 5DFVD 4NQEE 2D4FA 5F7WC 4U6YA 2KZWA 4XPFL 5B4MC 5JDSB 3OJMB 5KSBB 1TPXC 3D9AL 2IFGA 1RIUH 1NEZA 1S7TB 3HCVB 4LP4A 5I30H 5I1CL 4MXWH 2YEZA 5J89A 2YS4A 4DGYH 2O5ZL 1ZXQA 3RZCB 3B4NA 5GZOC 4HWUA 5IFAH 3BGMA 2WBJB 5T3XD 1KEMH 1CGWA 1LP9F 4X6EB 4Z0XA 5I19H 5GIRB 4M43H 2DI9A 1BWWA 3I3BA 4OV6F 1JGUH 1I1RA 4X9BA 2E9WA 1WBYB 2J8HA 4GG6F 1BD2B 1JMXA 1PW3A 3QCVH 5ETUB 5T5NG 1N8ZA 4MA7L 3TO4D 3D2UD 2Y5EA 4S1RL 4FQCL 3F62A 4LLVB 2XZAL 4OZHE 5I8EB 1KIQB 2I9LB 4IHOA 5AZEH 4MS8D 4AM0B 5KVEL 2QQQA 3ARDC 1QSZA 2IPKA 4YHLL 3BP6A 2IADA 1IVLA 5DUBB 4CBPA 1S7WB 3MNZB 5I74C 1QLRA 4U6HB 3VFPB 2V2WB 2PXYD 4UAOC 3OPZH 4M6NL 3V6OA 1P7QB 3H9SD 2P5WE 1HQ4B 1MJ8H 4HK0A 1FL5B 4HIHA 4OZGE 4NRYA 5I30L 1MFBH 1MEXL 2D0GA 4HF5L 4BYHA 1UACH 3VFUB 1Q1JH 4JDTH 4WW2C 3ZE2E 3FCTA 5ACZA 1FV1B 1R3JB 2YSSA 1RVFH 5HI4C 1MCBA 1V7NL 1IMHC 2VLJD 4JKLA 2ZNXA 2J6EA 5D7LE 1MFCL 2APWA 3GIZL 4R90L 1N3NA 5D96B 4F2MA 1S7QA 2X1XR 4AZ8A 2GQHA 1ZWIA 4PJ7B 3VWKB 1OF2A 3JUZA 5IBUB 1RIUL 1GZPA 4MNHA 1YEGL 1Z9LA 3O3UN 2AJYL 1VFBA 4Q9QL 4J2XA 2BOCB 1J9CT 4XPBH 1SYVB 5H94B 4YX2L 4DVRH 4G6JL 4NQSB 4MAUL 1IEBA 3EDEA 3IDIA 3LEXA 1A1NB 4J3VA 3KPNB 1EEUA 1R3IH 5DMYA 3ETBF 1FRGL 4D0BA 2ZCKH 4XNXL 5IFJA 2LABA 3TF7C 2FJHA 2NX5A 4XMLH 1FVDB 4R8WH 3K4AA 4QGYA 5HY9B 2IC2A 1QD0A 4MDJA 4G3YL 3OKLA 3DMMA 4D3CL 2HRPL 1RZKH 3I2CH 4C55A 1KB5B 1G7JA 2YBRA 4NKMB 5INDB 4DUXA 5I17A 4U1GC 1TVHA 4UOW0 2GSIB 3IVKB 3U48A 2LTQB 4X6BB 5K9OA 3NCEB 1R5IA 5I1DB 1AXSB 3BH9B 1GGCH 2R2HA 3T0BA 1S7WA 1HINH 4GS7B 4OQTH 4UI2A 3TN0D 1UM4L 4PRHA 2IADB 3RJDA 4XTRD 3KAAA 4L5FH 5CGYD 2XTJD 3NFSH 4ORGB 3CH1B 5D70L 2OJEB 4X7SH 1DANU 4F8QA 5LGHL 4Q9CA 4HIEB 1T66C 2DB8A 2EYRB 3QUKB 3RDTD 1Z2KA 4TSCL 4WU7B 2AEQH 4JZNA 4NQEB 5GRUL 4F15C 4N0UA 1CBVL 1YEIL 1IQWL 1K8DA 4GRMA 1MI5A 4YDIL 1YMHA 2FL5B 3VFOA 3FB7A 2L7UA 4YNYB 4TYUA 1IBGH 4Y5YB 3X3FH 3BIAX 1CD0A 2WWMD 2ARJQ 5EU4B 1S7RB 2BOCA 5H94A 2C4XA 1AD9B 1MCWW 3VCLB 5C86A 1AE6H 1YECL 4QWWD 1NCBH 5LVEA 4DKFH 2HJKB 1L7TL 4TTDD 1AQKL 2BNUB 3BQUD 4MB4A 1B0WA 3QQ9D 4GW1B 2OK0H 3CSYB 2DQTL 2MJWA 1RIVH 3H42H 3V5KA 5CJXA 4AMKL 1U42A 2DWDB 3MV7D 3X12A 1Y18A 4HMEA 4FZ8L 4YXHL 1JNNH 4OLVH 2COQA 5FUCE 3HS0B 4XX1G 2A9ML 1XR8B 2JB6A 3VGDA 4KDTA 1KC5L 1CICD 4D8PB 5C0EB 1LO5B 25C8H 4XBGB 2JJTC 4JVUA 2AV7A 1AXTL 2D7TL 1MCDA 5CGTA 5FF6A 4PB9L 4JM4L 1V3JA 1WZKA 3NTCH 4O2CB 4CMMB 4X4YB 1KGCE 5ENWB 4P5TB 2WW8A 5E2UL 2WNGA 3UTZA 4K2UL 3PIQA 5GS0H 4O02H 4HBCL 2ENSA 5KN5A 5IOPA 5DMGC 5C0RH 1GXEA 5D1QC 3UTZB 5J9PB 3ULUD 3T77B 4HXBL 1EVUA 1ADQH 1HHKB 1NGXB 2VLKD 3T4YA 4OM1L 5ETUA 5ISZE 4U1LA 4E41B 4IDJH 3H7BA 2Y07H 3QIUA 4LQFL 4YPGA 2X44D 3UDWC 2A9NL 3MROB 3WIFA 4OI7A 4Q2ZB 1MQKL 5IBTL 4UBDC 5I2IB 3IDGB 5B4MD 5JHLL 3WV0A 4KJQD 1GGYA 1KCLA 4Z7OF 4TUKL 4XMKH 2H32H 3SOBH 4WEUD 1ZGLP 4NO2A 3VH8B 2NY5L 3HE6A 3M17B 1G7LB 1MFEH 3QH3B 4NZDA 5FCSH 5IB5B 1KLUB 4AEIL 1WFUA 3NCBB 3HG1D 4P46B 2MCPL 4V1DE 2XA3A 1UYWH 3TN0B 1A6AB 3TO4C 4YQXH 4QRQB 1FHGA 4XP5H 1P4LB 4ZOAA 3VFSB 5JA8B 1XGTA 4JFOA 2MTPA 5DQJB 2YN5A 5CIPB 3V5DA 3BD5A 25C8L 4YHIA 3CK0H 3NGBC 1JK8B 1J5OL 1JI2A 4XNQB 3O4LA 3WIHH 2OZ4L 2EDHA 4ZO6A 5DC0A 4KVCL 1K4CB 3NGBB 2ORBL 2J8UE 5F8RC 1KB9K 1WGOA 1LK2A 3L3KB 3FOMA 3CZFA 3QUXA 1EIBA 4M7KH 4OCWL 1WTGT 4Y2DD 3F5WA 5HJ3B 4WI4A 2NY3C 1TJGH 3RY6A 4Y4KC 3T09A 3RTQB 32C2A 1B4JH 3EYUL 5D93B 4NUJB 5I6XC 2X4SA 3WJLA 1FFNB 4A6YL 1SM3H 1CD9B 5E94B 1CT8B 1MQKH 5HHVH 1FZMA 1XIWB 3S88H 5H2BB 5F7HA 3PP3H 3A6OA 4MGXA 2GSIA 3IVKA 3N1FC 1OLLA 3IGAB 1R24A 3IT8D 5EU3A 3DETC 2VUOA 4X6DB 2A6KB 4RWYL 3EDDA 1YEKH 4U6VH 4H26B 1YEJL 5KW9H 1IQDB 1WBXA 4BZ1H 1X5HA 3P4NA 2BXZA 1EEYB 1BBJB 2JJSA 3LY6A 3U82B 3MUZ1 3TIEA 4XP6L 1RZFH 4UINL 2KUTA 3IFNH 2ADJA 3CCHB 1JIBA 4M93C 4S1SH 2FWOA 3KLSA 5T3XH 3K8MA 4XXDA 5L88H 4G8FB 2M8XA 1T1WA 1FNSH 3WN5A 3QDAA 3UPRA 4P2OA 4M6OH 4KMLB 3ZO0A 1JNNL 3B3IA 2VXVH 3IJHA 4OZIE 3QNYA 4FQXC 3ILPA 5TFSL 1G7MA 2YUZA 2BJMH 4OZ4B 3EAKA 1FE8L 5DVOA 3NH7L 4P3WA 4Y5XA 1A4JB 5E2WL 1DCLA 2K3TA 2ZUYA 1T20A 3KLHC 5D93C 4TVPH 1HK6A 1R5VB 4GBXD 3BP5B 3CFCL 2X6MA 3O3EB 1F2XK 3G5XB 5ACLA 4PJ8D 4X80L 3C5ZB 1FCCA 1F02I 4MXQC 1ODAA 2FIKB 5BRZE 4U4BA 2J3SA 4R4BA 3U0WH 4JPKH 3G6JA 1INDH 1QBLH 3HFML 2B0SH 4PJDA 4LLQA 3KNBA 3PQYE 1PKQE 1HQ4A 4NN7B 1NANI 4ODTH 4J4PA 3CUPA 2AK4B 3NA4A 1QA9A 5HDQL 3V6ZA 2VLMD 4N5EC 2Q7NA 5CP7B 1KN4H 4I9WE 5ALCL 1TXKA 3KPOB 1T21A 1TTUA 2W65B 4PYHA 1WWWX 1MQ8A 3LS4L 5H37H 2QQLL 3JVGC 1J18A 5E8EA 1HQRB 5FO7B 3FO2A 2FX8H 3MR9B 3DX8A 3OGOE 3VW3L 3M1BB 2DKSA 3MJ7B 4U1NA 1F4XH 2VLLB 2F19L 3MXVL 4PJ5A 5I1EH 1C16B 1JGVL 1E4WH 3O4LD 1F42A 4RAVA 3KG5A 2RAMA 3WO4B 3QG7L 4DGYL 2Z9TA 5CJQL 4FFZH 4Y19A 3MRDA 4GXVL 3DVFA 4OCYL 1FGVH 1NL0H 5CEYA 5ID0A 3ZL4L 4XBEL 1ZVSB 3CLEL 3LKSA 4LCYA 4N9OB 4P57B 4RRPG 5I1JL 2VLKE 2EEAA 1V3LA 5EU5B 5KSVB 4Q9BA 2K1MA 1OPGH 3B9EA 4ORZC 3O6FA 5E6IB 5E5UB 4W6WB 1UJTA 1IL1B 2AV1B <