3QXIA

Crystal structure of enoyl-coa hydratase echa1 from mycobacterium marinum
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
251
structure length
244
Chain Sequence
PEVLVEQRDRILIITINRPKAKNSVNAAVSRALADAMDRLDADAGLSVGILTGAGGSFCAGMDENVVVEGRGLGFTERPPAKPLIAAVEGYALAGGTELALATDLIVAARDSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMELALTGDNLSAERAHALGMVNVLAEPGAALDAAIALAEKITANGPLAVAATKRIITESRGWSLDTRFAQQMKILFPIFTSNDAKEGAIAFAEKRPPRWTGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Lyase
molecule keywords Enoyl-CoA hydratase EchA1
total genus 83
structure length 244
sequence length 251
chains with identical sequence B, C
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3qxiA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3qxiA01
1OD4A 4B3JA 3Q0GA 4FJWD 4JJTA 2WTBA 4Q1IA 3IBBA 4GHNA 4JYLA 3N6RB 5IKLB 2PPYA 2A7KA 3ZWCA 5DTWA 5DU6A 4EMPA 3T8BA 3T3WA 3PE8A 4L6WA 2EJ5A 3HLN1 1EF9A 4MXIA 3HRXA 3GF3A 3T8AA 4Z0MA 1XNWA 3K50A 1YG8A 3BPPA 3WG5A 3KTIA 2FZSA 1X0UA 3MYBA 1K32A 1O8UA 2HW5A 2IEXA 3RSTA 2BZRA 2X58A 2ZL3A 2VSUC 4KPKA 3KTHA 2J5SA 5INGA 2ZQRA 4I4ZA 3V5EA 1N6FA 3PEAA 5DTPA 3KTJA 3GMAA 1Q51A 3U9RB 4IZCA 2Q35A 5G1QA 4ELSA 3M6NA 3RSIA 1PJHA 4QIIA 4K29A 4L8KA 4KD6A 3LAOA 5DU4A 1UYTA 3R9TA 3OMEA 3TT7A 4WCZA 1UYVA 3ZW8A 2VSSA 1FCFA 1FC7A 3DORA 4I42A 3KTGA 2VSSE 3R6HA 4FN8A 4FNDA 4ZDFA 1FC9A 1NZYB 4RCNA 4FN7A 3T89A 2VSSF 3LKEA 5INFA 3R0OA 3QKAA 3ISAA 1EF8A 3V5IA 3VIVA 3MT6A 1K39A 4KNPA 1WZ8A 2F9YB 4WYOB 3QREA 4B3IA 5DZKH 3TLFA 2VX2A 2QQ3A 4DI1A 3Q0JA 2D3TA 3R9QA 2W3PA 3T88A 3NJBA 5KDRA 3R9SA 5FUSA 5JBXA 2A81A 3KTKA 2ZL0A 4G2RA 4JOTA 1DUBA 3ZWAA 4ZDDA 2PBPA 4U0GA 2J5II 5C9GA 1UIYA 3MFMA 5INIA 3JU1A 3P5MA 3SWXA 3TT6A 4WZ8B 1MJ3A 1YG6A 2F9YA 4JCSA 4LK5A 5CTCA 5E0SA 5G1RA 2J5IB 1RJMA 4MOUA 4OLQA 1N6EA 3GKBA 4YLHA 3FDUA 4JVTA 3OC7A 3Q7HA 2GTRA 4MI2A 2C8TA 3QXIA 3TZ3A 2F9IA 2F9IB 1TG6A 4OMRA 4B3HA 2FW2A 1W2XA 1XNVA 2CE3A 3HE2A 4U0HA 2PG8A 1PIXA 2CBYA 4Q0GA 3NJDA 4JCTA 1ON3A 3H0SA 5DL1A 4RYFH 4IZDA 2J5GA 4JCRA 5FIFA 1WDLA 4JWVA 3HP0A 4JYJA 4U0GH 3ZWBA 4IZBA 3P85A 4ELXA 1ON9A 4FNBA 4KWBA 5DUFA 1UYSA 3QMJA 4ZDEA 1DCIA 1Q52A 2A7SA 3TVUA 4I52A 5JBWA 3H81A 1HNUA 4ZDCA 4NEKA 4K2NA 2NP9A 2DEOA 3QWDA 3ZW9A 5CTBA 1OD2A 2ZL4A 5E0NX 3PZKA 4RYFA 5E0SH 3H0QA 3L3SA 3H02A 4U18A 4JFCA 3BEZA 3RRVA 4ELWA 5KDRB 3TDCA 5DU8A 1XNYA 4ASIA 4QFEA 3ST9A 3QK8A 3STAA 1XO6A 4HC8A 4U19A 5C90A 2VSUA 4HNKA 3BF0A 5G1SA 4QIJA 3I47A 3HINA 3MOYA 5MGBA 3PGQA 4NNQA 1WDKA 3U9TB 2VSUF 4F47A 3P2LA 3IAVA 3H0JA 3FF6A 1SZOA 1JXZA 4K3WA 3GLMA 2UZFA 3M6MA 1Y7OA 1FC6A 2Q2XA 4U1AA 3K8XA 3KQFA 1HNOA 1TYFA 2J5IA 1RJNA 2FBMA 2VREA 2Q34A 4EMLA 1EY3A 3TRRA 3GF7A 1XX4A 4FB8A 2X24A 5DUCA 2ZQQA 2F6QA 3TV5A 4GM2A 3H0UA 3U9SB 2J5GD 1N6DA 3Q1TA 4JSBA 2VSUE 4ZU2A 4EMMA 3IB9A 1SG4A 3OT6A 2DUBA 1HZDA 1J7XA 5DZKA 1WDMA 3TVWA 5DKPA 4ZDBA 4OG1A 3SLLA 1UYRA 5KJPA 4JCQA 3G64A 4FZWC 2F6IA 2ZL2A 1NZYA 4FZWA 3QYRA 3QXZA 1VRGA 3DJAA
chains in the Genus database with same CATH superfamily
1OD4A 4B3JA 3Q0GA 4FJWD 4JJTA 2WTBA 4Q1IA 3IBBA 4GHNA 4JYLA 3N6RB 5IKLB 2PPYA 2A7KA 1Y64B 3ZWCA 5DTWA 5DU6A 4EMPA 3T8BA 3T3WA 3PE8A 4L6WA 2EJ5A 3HLN1 1EF9A 4MXIA 3AJMA 3HRXA 3GF3A 3T8AA 4Z0MA 1XNWA 3K50A 1YG8A 3BPTA 3BPPA 3WG5A 3KTIA 2FZSA 1X0UA 3MYBA 1K32A 1O8UA 2HW5A 2IEXA 3RSTA 2BZRA 4J2UA 2X58A 2ZL3A 2VSUC 4KPKA 3KTHA 2J5SA 5INGA 2ZQRA 4HDTA 4I4ZA 3V5EA 1N6FA 3PEAA 5DTPA 3KTJA 3GMAA 5HUQA 1Q51A 3U9RB 4IZCA 2Q35A 5G1QA 4ELSA 3M6NA 3RSIA 1PJHA 4QIIA 3A4NA 4K29A 4L8KA 4KD6A 3LAOA 5DU4A 1UYTA 3R9TA 3OMEA 3TT7A 4WCZA 3IRBA 1UYVA 3ZW8A 2VSSA 1FCFA 1FC7A 3DORA 4I42A 3KTGA 2VSSE 3R6HA 4FN8A 4FNDA 4ZDFA 1FC9A 1NZYB 4RCNA 4FN7A 3T89A 2VSSF 3LKEA 5INFA 3R0OA 3W8IB 3QKAA 3ISAA 1EF8A 3V5IA 3VIVA 4NARA 3MT6A 3AM1A 1K39A 4KNPA 1WZ8A 2F9YB 4WYOB 3QREA 4B3IA 5DZKH 1UX4A 3TLFA 2VX2A 2QQ3A 2YJGA 4DI1A 3Q0JA 2D3TA 3R9QA 2W3PA 3T88A 3NJBA 5KDRA 3R9SA 5FUSA 5JBXA 2A81A 3KTKA 2ZL0A 4G2RA 4JOTA 1DUBA 3W8HB 3ZWAA 4ZDDA 3L8JA 2PBPA 4U0GA 2J5II 3ADCA 5C9GA 1UIYA 3MFMA 5INIA 3JU1A 3P5MA 3SWXA 3TT6A 4WZ8B 1MJ3A 1YG6A 2F9YA 4JCSA 4LK5A 5CTCA 5E0SA 5G1RA 2J5IB 1RJMA 4MOUA 4OLQA 1N6EA 3GKBA 4YLHA 3FDUA 4JVTA 3OC7A 3Q7HA 2GTRA 4MI2A 2C8TA 3QXIA 3TZ3A 2F9IA 3L8IA 2F9IB 1TG6A 4OMRA 4B3HA 2FW2A 1W2XA 1XNVA 2CE3A 3HE2A 4U0HA 2PG8A 1PIXA 2CBYA 4Q0GA 3ADBA 3NJDA 4JCTA 1ON3A 3H0SA 5DL1A 4RYFH 4IZDA 2J5GA 4JCRA 5FIFA 1WDLA 4JWVA 3HP0A 4JYJA 4U0GH 3ZWBA 4IZBA 3P85A 4ELXA 1ON9A 4FNBA 4KWBA 5DUFA 1UYSA 3QMJA 4ZDEA 1DCIA 1Q52A 2A7SA 3TVUA 4I52A 5JBWA 3H81A 3RQFA 1HNUA 3A4MA 4ZDCA 4NEKA 4K2NA 4GEHB 2NP9A 2DEOA 3QWDA 3ZW9A 5CTBA 1OD2A 2ZL4A 5E0NX 3PZKA 4RYFA 5E0SH 3H0QA 3L3SA 3H02A 4U18A 4JFCA 3BEZA 3RRVA 4ELWA 5KDRB 3TDCA 5DU8A 1XNYA 4ASIA 4QFEA 3ST9A 3QK8A 3STAA 1XO6A 4HC8A 4U19A 3A4LA 5C90A 2VSUA 4HNKA 3RQEA 3BF0A 5G1SA 4QIJA 3I47A 3HINA 3MOYA 5MGBA 3PGQA 4NNQA 1WDKA 3U9TB 2VSUF 4F47A 3P2LA 3IAVA 3H0JA 3FF6A 1SZOA 1JXZA 4K3WA 3GLMA 2UZFA 3M6MA 1Y7OA 1FC6A 2Q2XA 4U1AA 3K8XA 3KQFA 1HNOA 1TYFA 2J5IA 3RQGA 1RJNA 2FBMA 2VREA 2Q34A 2P63A 4EMLA 1EY3A 3TRRA 3GF7A 1XX4A 4FB8A 2X24A 5DUCA 3O4XE 2ZQQA 2F6QA 3TV5A 4GM2A 3H0UA 3U9SB 2J5GD 1N6DA 3Q1TA 4JSBA 2VSUE 4ZU2A 4EMMA 3IB9A 1SG4A 3OT6A 2DUBA 1HZDA 1J7XA 5DZKA 1WDMA 3TVWA 5DKPA 3ADDA 4ZDBA 4OG1A 3SLLA 1UYRA 5KJPA 4JCQA 3G64A 4FZWC 2F6IA 1UX5A 2ZL2A 1NZYA 4FZWA 3QYRA 3QXZA 1VRGA 3DJAA
chains in the Genus database with same CATH topology
1OD4A 4B3JA 3Q0GA 4FJWD 4JJTA 2WTBA 4Q1IA 3IBBA 4GHNA 4JYLA 3N6RB 5IKLB 2PPYA 2A7KA 3ZWCA 5DTWA 5DU6A 4EMPA 3T8BA 3T3WA 3PE8A 4L6WA 2EJ5A 3HLN1 1EF9A 4MXIA 3HRXA 3GF3A 3T8AA 4Z0MA 1XNWA 3K50A 1YG8A 3BPTA 3BPPA 3WG5A 3KTIA 2FZSA 1X0UA 3MYBA 1K32A 1O8UA 2HW5A 2IEXA 3RSTA 2BZRA 4J2UA 2X58A 2ZL3A 2VSUC 4KPKA 3KTHA 2J5SA 5INGA 2ZQRA 4HDTA 4I4ZA 3V5EA 1N6FA 3PEAA 5DTPA 3KTJA 3GMAA 5HUQA 1Q51A 3U9RB 4IZCA 2Q35A 5G1QA 4ELSA 3M6NA 3RSIA 1PJHA 4QIIA 4K29A 4L8KA 4KD6A 3LAOA 5DU4A 1UYTA 3R9TA 3OMEA 3TT7A 4WCZA 1UYVA 3ZW8A 2VSSA 1FCFA 1FC7A 3DORA 4I42A 3KTGA 2VSSE 3R6HA 4FN8A 4FNDA 4ZDFA 1FC9A 1NZYB 4RCNA 4FN7A 3T89A 2VSSF 3LKEA 5INFA 3R0OA 3QKAA 3ISAA 1EF8A 3V5IA 3VIVA 4NARA 3MT6A 1K39A 4KNPA 1WZ8A 2F9YB 4WYOB 3QREA 4B3IA 5DZKH 3TLFA 2VX2A 2QQ3A 2YJGA 4DI1A 3Q0JA 2D3TA 3R9QA 2W3PA 3T88A 3NJBA 5KDRA 3R9SA 5FUSA 5JBXA 2A81A 3KTKA 2ZL0A 4G2RA 4JOTA 1DUBA 3ZWAA 4ZDDA 2PBPA 4U0GA 2J5II 5C9GA 1UIYA 3MFMA 5INIA 3JU1A 3P5MA 3SWXA 3TT6A 4WZ8B 1MJ3A 1YG6A 2F9YA 4JCSA 4LK5A 5CTCA 5E0SA 5G1RA 2J5IB 1RJMA 4MOUA 4OLQA 1N6EA 3GKBA 4YLHA 3FDUA 4JVTA 3OC7A 3Q7HA 2GTRA 4MI2A 2C8TA 3QXIA 3TZ3A 2F9IA 2F9IB 1TG6A 4OMRA 4B3HA 2FW2A 1W2XA 1XNVA 2CE3A 3HE2A 4U0HA 2PG8A 1PIXA 2CBYA 4Q0GA 3NJDA 4JCTA 1ON3A 3H0SA 5DL1A 4RYFH 4IZDA 2J5GA 4JCRA 5FIFA 1WDLA 4JWVA 3HP0A 4JYJA 4U0GH 3ZWBA 4IZBA 3P85A 4ELXA 1ON9A 4FNBA 4KWBA 5DUFA 1UYSA 3QMJA 4ZDEA 1DCIA 1Q52A 2A7SA 3TVUA 4I52A 5JBWA 3H81A 1HNUA 4ZDCA 4NEKA 4K2NA 2NP9A 2DEOA 3QWDA 3ZW9A 5CTBA 1OD2A 2ZL4A 5E0NX 3PZKA 4RYFA 5E0SH 3H0QA 3L3SA 3H02A 4U18A 4JFCA 3BEZA 3RRVA 4ELWA 5KDRB 3TDCA 5DU8A 1XNYA 4ASIA 4QFEA 3ST9A 3QK8A 3STAA 1XO6A 4HC8A 4U19A 5C90A 2VSUA 4HNKA 3BF0A 5G1SA 4QIJA 3I47A 3HINA 3MOYA 5MGBA 3PGQA 4NNQA 1WDKA 3U9TB 2VSUF 4F47A 3P2LA 3IAVA 3H0JA 3FF6A 1SZOA 1JXZA 4K3WA 3GLMA 2UZFA 3M6MA 1Y7OA 1FC6A 2Q2XA 4U1AA 3K8XA 3KQFA 1HNOA 1TYFA 2J5IA 1RJNA 2FBMA 2VREA 2Q34A 4EMLA 1EY3A 3TRRA 3GF7A 1XX4A 4FB8A 2X24A 5DUCA 2ZQQA 2F6QA 3TV5A 4GM2A 3H0UA 3U9SB 2J5GD 1N6DA 3Q1TA 4JSBA 2VSUE 4ZU2A 4EMMA 3IB9A 1SG4A 3OT6A 2DUBA 1HZDA 1J7XA 5DZKA 1WDMA 3TVWA 5DKPA 4ZDBA 4OG1A 3SLLA 1UYRA 5KJPA 4JCQA 3G64A 4FZWC 2F6IA 2ZL2A 1NZYA 4FZWA 3QYRA 3QXZA 1VRGA 3DJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OD4 A;  4B3J A;  3Q0G A;  4FJW D;  4JJT A;  2WTB A;  4Q1I A;  3IBB A;  4GHN A;  4JYL A;  3N6R B;  5IKL B;  2PPY A;  2A7K A;  3ZWC A;  5DTW A;  5DU6 A;  4EMP A;  3T8B A;  3T3W A;  3PE8 A;  4L6W A;  2EJ5 A;  3HLN 1;  1EF9 A;  4MXI A;  3HRX A;  3GF3 A;  3T8A A;  4Z0M A;  1XNW A;  3K50 A;  1YG8 A;  3BPP A;  3WG5 A;  3KTI A;  2FZS A;  1X0U A;  3MYB A;  1K32 A;  1O8U A;  2HW5 A;  2IEX A;  3RST A;  2BZR A;  2X58 A;  2ZL3 A;  2VSU C;  4KPK A;  3KTH A;  2J5S A;  5ING A;  2ZQR A;  4I4Z A;  3V5E A;  1N6F A;  3PEA A;  5DTP A;  3KTJ A;  3GMA A;  1Q51 A;  3U9R B;  4IZC A;  2Q35 A;  5G1Q A;  4ELS A;  3M6N A;  3RSI A;  1PJH A;  4QII A;  4K29 A;  4L8K A;  4KD6 A;  3LAO A;  5DU4 A;  1UYT A;  3R9T A;  3OME A;  3TT7 A;  4WCZ A;  1UYV A;  3ZW8 A;  2VSS A;  1FCF A;  1FC7 A;  3DOR A;  4I42 A;  3KTG A;  2VSS E;  3R6H A;  4FN8 A;  4FND A;  4ZDF A;  1FC9 A;  1NZY B;  4RCN A;  4FN7 A;  3T89 A;  2VSS F;  3LKE A;  5INF A;  3R0O A;  3QKA A;  3ISA A;  1EF8 A;  3V5I A;  3VIV A;  3MT6 A;  1K39 A;  4KNP A;  1WZ8 A;  2F9Y B;  4WYO B;  3QRE A;  4B3I A;  5DZK H;  3TLF A;  2VX2 A;  2QQ3 A;  4DI1 A;  3Q0J A;  2D3T A;  3R9Q A;  2W3P A;  3T88 A;  3NJB A;  5KDR A;  3R9S A;  5FUS A;  5JBX A;  2A81 A;  3KTK A;  2ZL0 A;  4G2R A;  4JOT A;  1DUB A;  3ZWA A;  4ZDD A;  2PBP A;  4U0G A;  2J5I I;  5C9G A;  1UIY A;  3MFM A;  5INI A;  3JU1 A;  3P5M A;  3SWX A;  3TT6 A;  4WZ8 B;  1MJ3 A;  1YG6 A;  2F9Y A;  4JCS A;  4LK5 A;  5CTC A;  5E0S A;  5G1R A;  2J5I B;  1RJM A;  4MOU A;  4OLQ A;  1N6E A;  3GKB A;  4YLH A;  3FDU A;  4JVT A;  3OC7 A;  3Q7H A;  2GTR A;  4MI2 A;  2C8T A;  3QXI A;  3TZ3 A;  2F9I A;  2F9I B;  1TG6 A;  4OMR A;  4B3H A;  2FW2 A;  1W2X A;  1XNV A;  2CE3 A;  3HE2 A;  4U0H A;  2PG8 A;  1PIX A;  2CBY A;  4Q0G A;  3NJD A;  4JCT A;  1ON3 A;  3H0S A;  5DL1 A;  4RYF H;  4IZD A;  2J5G A;  4JCR A;  5FIF A;  1WDL A;  4JWV A;  3HP0 A;  4JYJ A;  4U0G H;  3ZWB A;  4IZB A;  3P85 A;  4ELX A;  1ON9 A;  4FNB A;  4KWB A;  5DUF A;  1UYS A;  3QMJ A;  4ZDE A;  1DCI A;  1Q52 A;  2A7S A;  3TVU A;  4I52 A;  5JBW A;  3H81 A;  1HNU A;  4ZDC A;  4NEK A;  4K2N A;  2NP9 A;  2DEO A;  3QWD A;  3ZW9 A;  5CTB A;  1OD2 A;  2ZL4 A;  5E0N X;  3PZK A;  4RYF A;  5E0S H;  3H0Q A;  3L3S A;  3H02 A;  4U18 A;  4JFC A;  3BEZ A;  3RRV A;  4ELW A;  5KDR B;  3TDC A;  5DU8 A;  1XNY A;  4ASI A;  4QFE A;  3ST9 A;  3QK8 A;  3STA A;  1XO6 A;  4HC8 A;  4U19 A;  5C90 A;  2VSU A;  4HNK A;  3BF0 A;  5G1S A;  4QIJ A;  3I47 A;  3HIN A;  3MOY A;  5MGB A;  3PGQ A;  4NNQ A;  1WDK A;  3U9T B;  2VSU F;  4F47 A;  3P2L A;  3IAV A;  3H0J A;  3FF6 A;  1SZO A;  1JXZ A;  4K3W A;  3GLM A;  2UZF A;  3M6M A;  1Y7O A;  1FC6 A;  2Q2X A;  4U1A A;  3K8X A;  3KQF A;  1HNO A;  1TYF A;  2J5I A;  1RJN A;  2FBM A;  2VRE A;  2Q34 A;  4EML A;  1EY3 A;  3TRR A;  3GF7 A;  1XX4 A;  4FB8 A;  2X24 A;  5DUC A;  2ZQQ A;  2F6Q A;  3TV5 A;  4GM2 A;  3H0U A;  3U9S B;  2J5G D;  1N6D A;  3Q1T A;  4JSB A;  2VSU E;  4ZU2 A;  4EMM A;  3IB9 A;  1SG4 A;  3OT6 A;  2DUB A;  1HZD A;  1J7X A;  5DZK A;  1WDM A;  3TVW A;  5DKP A;  4ZDB A;  4OG1 A;  3SLL A;  1UYR A;  5KJP A;  4JCQ A;  3G64 A;  4FZW C;  2F6I A;  2ZL2 A;  1NZY A;  4FZW A;  3QYR A;  3QXZ A;  1VRG A;  3DJA A; 
#chains in the Genus database with same CATH topology
 1OD4 A;  4B3J A;  3Q0G A;  4FJW D;  4JJT A;  2WTB A;  4Q1I A;  3IBB A;  4GHN A;  4JYL A;  3N6R B;  5IKL B;  2PPY A;  2A7K A;  1Y64 B;  3ZWC A;  5DTW A;  5DU6 A;  4EMP A;  3T8B A;  3T3W A;  3PE8 A;  4L6W A;  2EJ5 A;  3HLN 1;  1EF9 A;  4MXI A;  3AJM A;  3HRX A;  3GF3 A;  3T8A A;  4Z0M A;  1XNW A;  3K50 A;  1YG8 A;  3BPT A;  3BPP A;  3WG5 A;  3KTI A;  2FZS A;  1X0U A;  3MYB A;  1K32 A;  1O8U A;  2HW5 A;  2IEX A;  3RST A;  2BZR A;  4J2U A;  2X58 A;  2ZL3 A;  2VSU C;  4KPK A;  3KTH A;  2J5S A;  5ING A;  2ZQR A;  4HDT A;  4I4Z A;  3V5E A;  1N6F A;  3PEA A;  5DTP A;  3KTJ A;  3GMA A;  5HUQ A;  1Q51 A;  3U9R B;  4IZC A;  2Q35 A;  5G1Q A;  4ELS A;  3M6N A;  3RSI A;  1PJH A;  4QII A;  3A4N A;  4K29 A;  4L8K A;  4KD6 A;  3LAO A;  5DU4 A;  1UYT A;  3R9T A;  3OME A;  3TT7 A;  4WCZ A;  3IRB A;  1UYV A;  3ZW8 A;  2VSS A;  1FCF A;  1FC7 A;  3DOR A;  4I42 A;  3KTG A;  2VSS E;  3R6H A;  4FN8 A;  4FND A;  4ZDF A;  1FC9 A;  1NZY B;  4RCN A;  4FN7 A;  3T89 A;  2VSS F;  3LKE A;  5INF A;  3R0O A;  3W8I B;  3QKA A;  3ISA A;  1EF8 A;  3V5I A;  3VIV A;  4NAR A;  3MT6 A;  3AM1 A;  1K39 A;  4KNP A;  1WZ8 A;  2F9Y B;  4WYO B;  3QRE A;  4B3I A;  5DZK H;  1UX4 A;  3TLF A;  2VX2 A;  2QQ3 A;  2YJG A;  4DI1 A;  3Q0J A;  2D3T A;  3R9Q A;  2W3P A;  3T88 A;  3NJB A;  5KDR A;  3R9S A;  5FUS A;  5JBX A;  2A81 A;  3KTK A;  2ZL0 A;  4G2R A;  4JOT A;  1DUB A;  3W8H B;  3ZWA A;  4ZDD A;  3L8J A;  2PBP A;  4U0G A;  2J5I I;  3ADC A;  5C9G A;  1UIY A;  3MFM A;  5INI A;  3JU1 A;  3P5M A;  3SWX A;  3TT6 A;  4WZ8 B;  1MJ3 A;  1YG6 A;  2F9Y A;  4JCS A;  4LK5 A;  5CTC A;  5E0S A;  5G1R A;  2J5I B;  1RJM A;  4MOU A;  4OLQ A;  1N6E A;  3GKB A;  4YLH A;  3FDU A;  4JVT A;  3OC7 A;  3Q7H A;  2GTR A;  4MI2 A;  2C8T A;  3QXI A;  3TZ3 A;  2F9I A;  3L8I A;  2F9I B;  1TG6 A;  4OMR A;  4B3H A;  2FW2 A;  1W2X A;  1XNV A;  2CE3 A;  3HE2 A;  4U0H A;  2PG8 A;  1PIX A;  2CBY A;  4Q0G A;  3ADB A;  3NJD A;  4JCT A;  1ON3 A;  3H0S A;  5DL1 A;  4RYF H;  4IZD A;  2J5G A;  4JCR A;  5FIF A;  1WDL A;  4JWV A;  3HP0 A;  4JYJ A;  4U0G H;  3ZWB A;  4IZB A;  3P85 A;  4ELX A;  1ON9 A;  4FNB A;  4KWB A;  5DUF A;  1UYS A;  3QMJ A;  4ZDE A;  1DCI A;  1Q52 A;  2A7S A;  3TVU A;  4I52 A;  5JBW A;  3H81 A;  3RQF A;  1HNU A;  3A4M A;  4ZDC A;  4NEK A;  4K2N A;  4GEH B;  2NP9 A;  2DEO A;  3QWD A;  3ZW9 A;  5CTB A;  1OD2 A;  2ZL4 A;  5E0N X;  3PZK A;  4RYF A;  5E0S H;  3H0Q A;  3L3S A;  3H02 A;  4U18 A;  4JFC A;  3BEZ A;  3RRV A;  4ELW A;  5KDR B;  3TDC A;  5DU8 A;  1XNY A;  4ASI A;  4QFE A;  3ST9 A;  3QK8 A;  3STA A;  1XO6 A;  4HC8 A;  4U19 A;  3A4L A;  5C90 A;  2VSU A;  4HNK A;  3RQE A;  3BF0 A;  5G1S A;  4QIJ A;  3I47 A;  3HIN A;  3MOY A;  5MGB A;  3PGQ A;  4NNQ A;  1WDK A;  3U9T B;  2VSU F;  4F47 A;  3P2L A;  3IAV A;  3H0J A;  3FF6 A;  1SZO A;  1JXZ A;  4K3W A;  3GLM A;  2UZF A;  3M6M A;  1Y7O A;  1FC6 A;  2Q2X A;  4U1A A;  3K8X A;  3KQF A;  1HNO A;  1TYF A;  2J5I A;  3RQG A;  1RJN A;  2FBM A;  2VRE A;  2Q34 A;  2P63 A;  4EML A;  1EY3 A;  3TRR A;  3GF7 A;  1XX4 A;  4FB8 A;  2X24 A;  5DUC A;  3O4X E;  2ZQQ A;  2F6Q A;  3TV5 A;  4GM2 A;  3H0U A;  3U9S B;  2J5G D;  1N6D A;  3Q1T A;  4JSB A;  2VSU E;  4ZU2 A;  4EMM A;  3IB9 A;  1SG4 A;  3OT6 A;  2DUB A;  1HZD A;  1J7X A;  5DZK A;  1WDM A;  3TVW A;  5DKP A;  3ADD A;  4ZDB A;  4OG1 A;  3SLL A;  1UYR A;  5KJP A;  4JCQ A;  3G64 A;  4FZW C;  2F6I A;  1UX5 A;  2ZL2 A;  1NZY A;  4FZW A;  3QYR A;  3QXZ A;  1VRG A;  3DJA A; 
#chains in the Genus database with same CATH homology
 1OD4 A;  4B3J A;  3Q0G A;  4FJW D;  4JJT A;  2WTB A;  4Q1I A;  3IBB A;  4GHN A;  4JYL A;  3N6R B;  5IKL B;  2PPY A;  2A7K A;  3ZWC A;  5DTW A;  5DU6 A;  4EMP A;  3T8B A;  3T3W A;  3PE8 A;  4L6W A;  2EJ5 A;  3HLN 1;  1EF9 A;  4MXI A;  3HRX A;  3GF3 A;  3T8A A;  4Z0M A;  1XNW A;  3K50 A;  1YG8 A;  3BPT A;  3BPP A;  3WG5 A;  3KTI A;  2FZS A;  1X0U A;  3MYB A;  1K32 A;  1O8U A;  2HW5 A;  2IEX A;  3RST A;  2BZR A;  4J2U A;  2X58 A;  2ZL3 A;  2VSU C;  4KPK A;  3KTH A;  2J5S A;  5ING A;  2ZQR A;  4HDT A;  4I4Z A;  3V5E A;  1N6F A;  3PEA A;  5DTP A;  3KTJ A;  3GMA A;  5HUQ A;  1Q51 A;  3U9R B;  4IZC A;  2Q35 A;  5G1Q A;  4ELS A;  3M6N A;  3RSI A;  1PJH A;  4QII A;  4K29 A;  4L8K A;  4KD6 A;  3LAO A;  5DU4 A;  1UYT A;  3R9T A;  3OME A;  3TT7 A;  4WCZ A;  1UYV A;  3ZW8 A;  2VSS A;  1FCF A;  1FC7 A;  3DOR A;  4I42 A;  3KTG A;  2VSS E;  3R6H A;  4FN8 A;  4FND A;  4ZDF A;  1FC9 A;  1NZY B;  4RCN A;  4FN7 A;  3T89 A;  2VSS F;  3LKE A;  5INF A;  3R0O A;  3QKA A;  3ISA A;  1EF8 A;  3V5I A;  3VIV A;  4NAR A;  3MT6 A;  1K39 A;  4KNP A;  1WZ8 A;  2F9Y B;  4WYO B;  3QRE A;  4B3I A;  5DZK H;  3TLF A;  2VX2 A;  2QQ3 A;  2YJG A;  4DI1 A;  3Q0J A;  2D3T A;  3R9Q A;  2W3P A;  3T88 A;  3NJB A;  5KDR A;  3R9S A;  5FUS A;  5JBX A;  2A81 A;  3KTK A;  2ZL0 A;  4G2R A;  4JOT A;  1DUB A;  3ZWA A;  4ZDD A;  2PBP A;  4U0G A;  2J5I I;  5C9G A;  1UIY A;  3MFM A;  5INI A;  3JU1 A;  3P5M A;  3SWX A;  3TT6 A;  4WZ8 B;  1MJ3 A;  1YG6 A;  2F9Y A;  4JCS A;  4LK5 A;  5CTC A;  5E0S A;  5G1R A;  2J5I B;  1RJM A;  4MOU A;  4OLQ A;  1N6E A;  3GKB A;  4YLH A;  3FDU A;  4JVT A;  3OC7 A;  3Q7H A;  2GTR A;  4MI2 A;  2C8T A;  3QXI A;  3TZ3 A;  2F9I A;  2F9I B;  1TG6 A;  4OMR A;  4B3H A;  2FW2 A;  1W2X A;  1XNV A;  2CE3 A;  3HE2 A;  4U0H A;  2PG8 A;  1PIX A;  2CBY A;  4Q0G A;  3NJD A;  4JCT A;  1ON3 A;  3H0S A;  5DL1 A;  4RYF H;  4IZD A;  2J5G A;  4JCR A;  5FIF A;  1WDL A;  4JWV A;  3HP0 A;  4JYJ A;  4U0G H;  3ZWB A;  4IZB A;  3P85 A;  4ELX A;  1ON9 A;  4FNB A;  4KWB A;  5DUF A;  1UYS A;  3QMJ A;  4ZDE A;  1DCI A;  1Q52 A;  2A7S A;  3TVU A;  4I52 A;  5JBW A;  3H81 A;  1HNU A;  4ZDC A;  4NEK A;  4K2N A;  2NP9 A;  2DEO A;  3QWD A;  3ZW9 A;  5CTB A;  1OD2 A;  2ZL4 A;  5E0N X;  3PZK A;  4RYF A;  5E0S H;  3H0Q A;  3L3S A;  3H02 A;  4U18 A;  4JFC A;  3BEZ A;  3RRV A;  4ELW A;  5KDR B;  3TDC A;  5DU8 A;  1XNY A;  4ASI A;  4QFE A;  3ST9 A;  3QK8 A;  3STA A;  1XO6 A;  4HC8 A;  4U19 A;  5C90 A;  2VSU A;  4HNK A;  3BF0 A;  5G1S A;  4QIJ A;  3I47 A;  3HIN A;  3MOY A;  5MGB A;  3PGQ A;  4NNQ A;  1WDK A;  3U9T B;  2VSU F;  4F47 A;  3P2L A;  3IAV A;  3H0J A;  3FF6 A;  1SZO A;  1JXZ A;  4K3W A;  3GLM A;  2UZF A;  3M6M A;  1Y7O A;  1FC6 A;  2Q2X A;  4U1A A;  3K8X A;  3KQF A;  1HNO A;  1TYF A;  2J5I A;  1RJN A;  2FBM A;  2VRE A;  2Q34 A;  4EML A;  1EY3 A;  3TRR A;  3GF7 A;  1XX4 A;  4FB8 A;  2X24 A;  5DUC A;  2ZQQ A;  2F6Q A;  3TV5 A;  4GM2 A;  3H0U A;  3U9S B;  2J5G D;  1N6D A;  3Q1T A;  4JSB A;  2VSU E;  4ZU2 A;  4EMM A;  3IB9 A;  1SG4 A;  3OT6 A;  2DUB A;  1HZD A;  1J7X A;  5DZK A;  1WDM A;  3TVW A;  5DKP A;  4ZDB A;  4OG1 A;  3SLL A;  1UYR A;  5KJP A;  4JCQ A;  3G64 A;  4FZW C;  2F6I A;  2ZL2 A;  1NZY A;  4FZW A;  3QYR A;  3QXZ A;  1VRG A;  3DJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...