3QXIA

Crystal structure of enoyl-coa hydratase echa1 from mycobacterium marinum
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
251
structure length
244
Chain Sequence
b'PEVLVEQRDRILIITINRPKAKNSVNAAVSRALADAMDRLDADAGLSVGILTGAGGSFCAGMDENVVVEGRGLGFTERPPAKPLIAAVEGYALAGGTELALATDLIVAARDSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMELALTGDNLSAERAHALGMVNVLAEPGAALDAAIALAEKITANGPLAVAATKRIITESRGWSLDTRFAQQMKILFPIFTSNDAKEGAIAFAEKRPPRWTGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase EchA1
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Lyase
total genus 83
structure length 244
sequence length 251
chains with identical sequence B, C
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2011-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3qxiA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3qxiA01
3PZKA 3IAVA 3TVUA 4FZWC 3GLMA 3STAA 3Q0JA 3U9TB 3MYBA 1FC9A 3TZ3A 5FUSA 4HNKA 5INIA 4ZDEA 4U1AA 1K39A 1HNOA 3N6RB 2X58A 2F9YA 5DU8A 3R9QA 4EMPA 4U0GH 5DUCA 3TT6A 1Q52A 4ELWA 3GMAA 3MT6A 3LKEA 3VIVA 1EY3A 3TV5A 4QIIA 4JCQA 3ISAA 5JBXA 1WDLA 1NZYA 4F47A 1WZ8A 1FC7A 2PPYA 2FZSA 4JJTA 1OD2A 3IBBA 4B3IA 3KTGA 4L6WA 4OMRA 2VSUA 4QIJA 2Q2XA 2VSSA 4I4ZA 4ZU2A 3QMJA 3FF6A 3MOYA 3H0UA 4I42A 3TRRA 4YLHA 1HNUA 1FC6A 3LAOA 3Q1TA 1W2XA 4FB8A 2F9IA 5INGA 5C9GA 3G64A 3T8AA 2DEOA 2J5II 3ZWCA 4NNQA 4JSBA 2A7KA 2VSUF 3OMEA 3KQFA 4IZDA 1UIYA 1EF8A 5G1QA 1NZYB 3ST9A 3KTHA 2J5SA 1SG4A 1J7XA 3BF0A 4FZWA 5C90A 4JCSA 3ZWAA 3BPPA 3HP0A 3TDCA 4IZCA 3R9TA 4JCRA 2ZL3A 3L3SA 2ZL4A 3HRXA 3WG5A 3FDUA 1RJMA 3PEAA 3QK8A 4Q1IA 3SLLA 3MFMA 2DUBA 3M6MA 3SWXA 1WDKA 3HE2A 4G2RA 2F9IB 2J5IA 4WCZA 3H0QA 3QXIA 5CTCA 3R6HA 2PG8A 3IB9A 2EJ5A 3RSIA 4FNBA 1EF9A 4JOTA 3QKAA 2HW5A 5G1RA 5DL1A 3RRVA 4EMLA 4KPKA 1Y7OA 4L8KA 4K2NA 3R0OA 4KNPA 4U0GA 3TVWA 4IZBA 3JU1A 4ZDDA 4DI1A 4HC8A 5KDRB 3QWDA 1K32A 3GKBA 4ELSA 1XNVA 3DJAA 3KTJA 1WDMA 5IKLB 2IEXA 5E0SH 2J5IB 4OG1A 1XNWA 1XX4A 2QQ3A 3P5MA 2BZRA 5DTWA 2WTBA 5DU4A 3QREA 3TT7A 1UYTA 4JYLA 5DZKH 3U9SB 3OC7A 3V5EA 3ZW8A 3M6NA 2J5GD 2ZQRA 4JYJA 2F6QA 4QFEA 1O8UA 3H02A 3PE8A 3QYRA 2NP9A 2A81A 4U19A 4KD6A 1N6DA 2Q35A 5KJPA 2F6IA 3PGQA 2FW2A 4WZ8B 4ZDFA 2FBMA 2VX2A 1VRGA 3NJBA 4GM2A 2A7SA 5KDRA 4MI2A 1X0UA 3H0SA 2ZQQA 3H81A 4U18A 3R9SA 2GTRA 5DU6A 1TYFA 4FN7A 1HZDA 4JWVA 3T88A 4RYFH 4MOUA 5CTBA 3KTKA 1DUBA 4OLQA 2VREA 4RYFA 4FJWD 2ZL0A 1XO6A 4NEKA 2Q34A 3NJDA 2X24A 4FNDA 5DKPA 4KWBA 2UZFA 3Q0GA 1YG6A 3OT6A 4MXIA 2CE3A 4ASIA 1RJNA 4U0HA 3I47A 2CBYA 2W3PA 2VSUE 2VSSE 5DUFA 3ZWBA 3H0JA 5G1SA 4B3HA 4JCTA 3T3WA 3DORA 3HLN1 5E0SA 3U9RB 3K8XA 1N6EA 1ON9A 5DTPA 4ZDCA 2PBPA 1N6FA 1FCFA 4ZDBA 4WYOB 5FIFA 1DCIA 3GF7A 3HINA 4JFCA 1ON3A 3T8BA 5DZKA 5JBWA 3V5IA 1PIXA 4K3WA 4FN8A 1UYVA 4B3JA 2VSUC 3T89A 2F9YB 1MJ3A 4EMMA 3KTIA 1UYSA 5MGBA 5E0NX 3P2LA 2D3TA 2J5GA 4ELXA 4GHNA 3K50A 4K29A 1PJHA 4Z0MA 2VSSF 4LK5A 1JXZA 1YG8A 1XNYA 4JVTA 2C8TA 1UYRA 3P85A 4I52A 1Q51A 3GF3A 4RCNA 3BEZA 1SZOA 3Q7HA 5INFA 3TLFA 2ZL2A 3ZW9A 1TG6A 3QXZA 3RSTA 1OD4A 4Q0GA
chains in the Genus database with same CATH superfamily
3PZKA 3IAVA 3TVUA 4FZWC 3GLMA 3STAA 3Q0JA 4J2UA 3U9TB 3MYBA 1FC9A 3TZ3A 5FUSA 4HNKA 5INIA 4ZDEA 4U1AA 1K39A 1HNOA 3N6RB 2X58A 2F9YA 5DU8A 3R9QA 4EMPA 4U0GH 5DUCA 3TT6A 1Q52A 4ELWA 3GMAA 3MT6A 3ADBA 3LKEA 3VIVA 1EY3A 5HUQA 3TV5A 4QIIA 4JCQA 3ISAA 5JBXA 1WDLA 1NZYA 4F47A 1WZ8A 3ADDA 1FC7A 3W8IB 2PPYA 2FZSA 4JJTA 1OD2A 3A4NA 3IBBA 4B3IA 3KTGA 4L6WA 4OMRA 2VSUA 4QIJA 2Q2XA 2VSSA 4I4ZA 4ZU2A 3QMJA 3FF6A 3MOYA 3H0UA 4I42A 3TRRA 4YLHA 1HNUA 1FC6A 3LAOA 3Q1TA 3RQFA 4HDTA 1W2XA 3RQEA 4FB8A 2F9IA 5INGA 5C9GA 3G64A 3T8AA 2DEOA 2J5II 3ZWCA 4NNQA 4JSBA 2A7KA 2VSUF 3OMEA 3KQFA 4IZDA 1UIYA 1EF8A 5G1QA 1NZYB 3ST9A 3KTHA 3IRBA 2J5SA 2YJGA 3ADCA 1SG4A 3A4MA 1J7XA 3BF0A 4FZWA 5C90A 4JCSA 3ZWAA 3BPPA 3HP0A 3TDCA 4IZCA 3R9TA 4JCRA 2ZL3A 3L3SA 2ZL4A 3HRXA 3WG5A 3O4XE 3FDUA 1RJMA 3PEAA 3QK8A 4Q1IA 3SLLA 3MFMA 2DUBA 3M6MA 3SWXA 1WDKA 3HE2A 4G2RA 2F9IB 2J5IA 4WCZA 1UX4A 3H0QA 2P63A 3QXIA 5CTCA 3R6HA 2PG8A 3IB9A 2EJ5A 3RSIA 4FNBA 1EF9A 4JOTA 3QKAA 2HW5A 5G1RA 5DL1A 3RRVA 4EMLA 4KPKA 1Y7OA 4L8KA 4K2NA 3R0OA 4KNPA 4U0GA 3TVWA 4IZBA 3JU1A 4ZDDA 4DI1A 4HC8A 5KDRB 3QWDA 1K32A 3GKBA 4ELSA 1XNVA 3DJAA 3KTJA 1WDMA 5IKLB 2IEXA 5E0SH 2J5IB 4OG1A 1XNWA 1XX4A 2QQ3A 3P5MA 2BZRA 5DTWA 2WTBA 5DU4A 3QREA 3TT7A 1UYTA 4JYLA 5DZKH 3U9SB 3OC7A 3V5EA 3ZW8A 3M6NA 2J5GD 2ZQRA 4JYJA 2F6QA 4QFEA 1O8UA 3H02A 3PE8A 3QYRA 2NP9A 2A81A 4U19A 4KD6A 1N6DA 2Q35A 5KJPA 2F6IA 3PGQA 2FW2A 4WZ8B 4ZDFA 2FBMA 2VX2A 1VRGA 3NJBA 4GM2A 2A7SA 5KDRA 4MI2A 3RQGA 1X0UA 3L8IA 3AJMA 3H0SA 2ZQQA 3H81A 4U18A 3R9SA 2GTRA 5DU6A 3AM1A 1TYFA 4FN7A 1HZDA 4JWVA 3A4LA 3T88A 4RYFH 1UX5A 4MOUA 5CTBA 3KTKA 1DUBA 2VREA 4OLQA 4RYFA 4FJWD 2ZL0A 1XO6A 4NEKA 2Q34A 3NJDA 2X24A 4FNDA 5DKPA 3W8HB 4KWBA 2UZFA 3Q0GA 1YG6A 3OT6A 4MXIA 2CE3A 4ASIA 1RJNA 3BPTA 4U0HA 3I47A 1Y64B 2CBYA 2W3PA 2VSUE 2VSSE 5DUFA 3ZWBA 3H0JA 5G1SA 4B3HA 4JCTA 3T3WA 3DORA 3HLN1 5E0SA 3U9RB 3K8XA 1N6EA 1ON9A 5DTPA 4ZDCA 2PBPA 1N6FA 1FCFA 4ZDBA 4WYOB 5FIFA 1DCIA 3GF7A 3HINA 4JFCA 1ON3A 3T8BA 5DZKA 5JBWA 3V5IA 1PIXA 4K3WA 4FN8A 4NARA 1UYVA 4B3JA 2VSUC 3T89A 2F9YB 1MJ3A 4GEHB 4EMMA 3KTIA 1UYSA 5MGBA 5E0NX 3P2LA 2D3TA 2J5GA 4ELXA 4GHNA 3K50A 4K29A 1PJHA 4Z0MA 2VSSF 4LK5A 1JXZA 1YG8A 1XNYA 4JVTA 2C8TA 1UYRA 3P85A 4I52A 1Q51A 3GF3A 4RCNA 3BEZA 3L8JA 1SZOA 3Q7HA 5INFA 3TLFA 2ZL2A 3ZW9A 1TG6A 3QXZA 3RSTA 1OD4A 4Q0GA
chains in the Genus database with same CATH topology
3PZKA 3IAVA 3TVUA 4FZWC 3GLMA 3STAA 3Q0JA 4J2UA 3U9TB 3MYBA 1FC9A 3TZ3A 5FUSA 4HNKA 5INIA 4ZDEA 4U1AA 1K39A 1HNOA 3N6RB 2X58A 2F9YA 5DU8A 3R9QA 4EMPA 4U0GH 5DUCA 3TT6A 1Q52A 4ELWA 3GMAA 3MT6A 3LKEA 3VIVA 1EY3A 5HUQA 3TV5A 4QIIA 4JCQA 3ISAA 5JBXA 1WDLA 1NZYA 4F47A 1WZ8A 1FC7A 2PPYA 2FZSA 4JJTA 1OD2A 3IBBA 4B3IA 3KTGA 4L6WA 4OMRA 2VSUA 4QIJA 2Q2XA 2VSSA 4I4ZA 4ZU2A 3QMJA 3FF6A 3MOYA 3H0UA 4I42A 3TRRA 4YLHA 1HNUA 1FC6A 3LAOA 3Q1TA 4HDTA 1W2XA 4FB8A 2F9IA 5INGA 5C9GA 3G64A 3T8AA 2DEOA 2J5II 3ZWCA 4NNQA 4JSBA 2A7KA 2VSUF 3OMEA 3KQFA 4IZDA 1UIYA 1EF8A 5G1QA 1NZYB 3ST9A 3KTHA 2J5SA 2YJGA 1SG4A 1J7XA 3BF0A 4FZWA 5C90A 4JCSA 3ZWAA 3BPPA 3HP0A 3TDCA 4IZCA 3R9TA 4JCRA 2ZL3A 3L3SA 2ZL4A 3HRXA 3WG5A 3FDUA 1RJMA 3PEAA 3QK8A 4Q1IA 3SLLA 3MFMA 2DUBA 3M6MA 3SWXA 1WDKA 3HE2A 4G2RA 2F9IB 2J5IA 4WCZA 3H0QA 3QXIA 5CTCA 3R6HA 2PG8A 3IB9A 2EJ5A 3RSIA 4FNBA 1EF9A 4JOTA 3QKAA 2HW5A 5G1RA 5DL1A 3RRVA 4EMLA 4KPKA 1Y7OA 4L8KA 4K2NA 3R0OA 4KNPA 4U0GA 3TVWA 4IZBA 3JU1A 4ZDDA 4DI1A 4HC8A 5KDRB 3QWDA 1K32A 3GKBA 4ELSA 1XNVA 3DJAA 3KTJA 1WDMA 5IKLB 2IEXA 5E0SH 2J5IB 4OG1A 1XNWA 1XX4A 2QQ3A 3P5MA 2BZRA 5DTWA 2WTBA 5DU4A 3QREA 3TT7A 1UYTA 4JYLA 5DZKH 3U9SB 3OC7A 3V5EA 3ZW8A 3M6NA 2J5GD 2ZQRA 4JYJA 2F6QA 4QFEA 1O8UA 3H02A 3PE8A 3QYRA 2NP9A 2A81A 4U19A 4KD6A 1N6DA 2Q35A 5KJPA 2F6IA 3PGQA 2FW2A 4WZ8B 4ZDFA 2FBMA 2VX2A 1VRGA 3NJBA 4GM2A 2A7SA 5KDRA 4MI2A 1X0UA 3H0SA 2ZQQA 3H81A 4U18A 3R9SA 2GTRA 5DU6A 1TYFA 4FN7A 1HZDA 4JWVA 3T88A 4RYFH 4MOUA 5CTBA 3KTKA 1DUBA 4OLQA 2VREA 4RYFA 4FJWD 2ZL0A 1XO6A 4NEKA 2Q34A 3NJDA 2X24A 4FNDA 5DKPA 4KWBA 2UZFA 3Q0GA 1YG6A 3OT6A 4MXIA 2CE3A 4ASIA 1RJNA 3BPTA 4U0HA 3I47A 2CBYA 2W3PA 2VSUE 2VSSE 5DUFA 3ZWBA 3H0JA 5G1SA 4B3HA 4JCTA 3T3WA 3DORA 3HLN1 5E0SA 3U9RB 3K8XA 1N6EA 1ON9A 5DTPA 4ZDCA 2PBPA 1N6FA 1FCFA 4ZDBA 4WYOB 5FIFA 1DCIA 3GF7A 3HINA 4JFCA 1ON3A 3T8BA 5DZKA 5JBWA 3V5IA 1PIXA 4K3WA 4FN8A 4NARA 1UYVA 4B3JA 2VSUC 3T89A 2F9YB 1MJ3A 4EMMA 3KTIA 1UYSA 5MGBA 5E0NX 3P2LA 2D3TA 2J5GA 4ELXA 4GHNA 3K50A 4K29A 1PJHA 4Z0MA 2VSSF 4LK5A 1JXZA 1YG8A 1XNYA 4JVTA 2C8TA 1UYRA 3P85A 4I52A 1Q51A 3GF3A 4RCNA 3BEZA 1SZOA 3Q7HA 5INFA 3TLFA 2ZL2A 3ZW9A 1TG6A 3QXZA 3RSTA 1OD4A 4Q0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZK A;  3IAV A;  3TVU A;  4FZW C;  3GLM A;  3STA A;  3Q0J A;  3U9T B;  3MYB A;  1FC9 A;  3TZ3 A;  5FUS A;  4HNK A;  5INI A;  4ZDE A;  4U1A A;  1K39 A;  1HNO A;  3N6R B;  2X58 A;  2F9Y A;  5DU8 A;  3R9Q A;  4EMP A;  4U0G H;  5DUC A;  3TT6 A;  1Q52 A;  4ELW A;  3GMA A;  3MT6 A;  3LKE A;  3VIV A;  1EY3 A;  3TV5 A;  4QII A;  4JCQ A;  3ISA A;  5JBX A;  1WDL A;  1NZY A;  4F47 A;  1WZ8 A;  1FC7 A;  2PPY A;  2FZS A;  4JJT A;  1OD2 A;  3IBB A;  4B3I A;  3KTG A;  4L6W A;  4OMR A;  2VSU A;  4QIJ A;  2Q2X A;  2VSS A;  4I4Z A;  4ZU2 A;  3QMJ A;  3FF6 A;  3MOY A;  3H0U A;  4I42 A;  3TRR A;  4YLH A;  1HNU A;  1FC6 A;  3LAO A;  3Q1T A;  1W2X A;  4FB8 A;  2F9I A;  5ING A;  5C9G A;  3G64 A;  3T8A A;  2DEO A;  2J5I I;  3ZWC A;  4NNQ A;  4JSB A;  2A7K A;  2VSU F;  3OME A;  3KQF A;  4IZD A;  1UIY A;  1EF8 A;  5G1Q A;  1NZY B;  3ST9 A;  3KTH A;  2J5S A;  1SG4 A;  1J7X A;  3BF0 A;  4FZW A;  5C90 A;  4JCS A;  3ZWA A;  3BPP A;  3HP0 A;  3TDC A;  4IZC A;  3R9T A;  4JCR A;  2ZL3 A;  3L3S A;  2ZL4 A;  3HRX A;  3WG5 A;  3FDU A;  1RJM A;  3PEA A;  3QK8 A;  4Q1I A;  3SLL A;  3MFM A;  2DUB A;  3M6M A;  3SWX A;  1WDK A;  3HE2 A;  4G2R A;  2F9I B;  2J5I A;  4WCZ A;  3H0Q A;  3QXI A;  5CTC A;  3R6H A;  2PG8 A;  3IB9 A;  2EJ5 A;  3RSI A;  4FNB A;  1EF9 A;  4JOT A;  3QKA A;  2HW5 A;  5G1R A;  5DL1 A;  3RRV A;  4EML A;  4KPK A;  1Y7O A;  4L8K A;  4K2N A;  3R0O A;  4KNP A;  4U0G A;  3TVW A;  4IZB A;  3JU1 A;  4ZDD A;  4DI1 A;  4HC8 A;  5KDR B;  3QWD A;  1K32 A;  3GKB A;  4ELS A;  1XNV A;  3DJA A;  3KTJ A;  1WDM A;  5IKL B;  2IEX A;  5E0S H;  2J5I B;  4OG1 A;  1XNW A;  1XX4 A;  2QQ3 A;  3P5M A;  2BZR A;  5DTW A;  2WTB A;  5DU4 A;  3QRE A;  3TT7 A;  1UYT A;  4JYL A;  5DZK H;  3U9S B;  3OC7 A;  3V5E A;  3ZW8 A;  3M6N A;  2J5G D;  2ZQR A;  4JYJ A;  2F6Q A;  4QFE A;  1O8U A;  3H02 A;  3PE8 A;  3QYR A;  2NP9 A;  2A81 A;  4U19 A;  4KD6 A;  1N6D A;  2Q35 A;  5KJP A;  2F6I A;  3PGQ A;  2FW2 A;  4WZ8 B;  4ZDF A;  2FBM A;  2VX2 A;  1VRG A;  3NJB A;  4GM2 A;  2A7S A;  5KDR A;  4MI2 A;  1X0U A;  3H0S A;  2ZQQ A;  3H81 A;  4U18 A;  3R9S A;  2GTR A;  5DU6 A;  1TYF A;  4FN7 A;  1HZD A;  4JWV A;  3T88 A;  4RYF H;  4MOU A;  5CTB A;  3KTK A;  1DUB A;  4OLQ A;  2VRE A;  4RYF A;  4FJW D;  2ZL0 A;  1XO6 A;  4NEK A;  2Q34 A;  3NJD A;  2X24 A;  4FND A;  5DKP A;  4KWB A;  2UZF A;  3Q0G A;  1YG6 A;  3OT6 A;  4MXI A;  2CE3 A;  4ASI A;  1RJN A;  4U0H A;  3I47 A;  2CBY A;  2W3P A;  2VSU E;  2VSS E;  5DUF A;  3ZWB A;  3H0J A;  5G1S A;  4B3H A;  4JCT A;  3T3W A;  3DOR A;  3HLN 1;  5E0S A;  3U9R B;  3K8X A;  1N6E A;  1ON9 A;  5DTP A;  4ZDC A;  2PBP A;  1N6F A;  1FCF A;  4ZDB A;  4WYO B;  5FIF A;  1DCI A;  3GF7 A;  3HIN A;  4JFC A;  1ON3 A;  3T8B A;  5DZK A;  5JBW A;  3V5I A;  1PIX A;  4K3W A;  4FN8 A;  1UYV A;  4B3J A;  2VSU C;  3T89 A;  2F9Y B;  1MJ3 A;  4EMM A;  3KTI A;  1UYS A;  5MGB A;  5E0N X;  3P2L A;  2D3T A;  2J5G A;  4ELX A;  4GHN A;  3K50 A;  4K29 A;  1PJH A;  4Z0M A;  2VSS F;  4LK5 A;  1JXZ A;  1YG8 A;  1XNY A;  4JVT A;  2C8T A;  1UYR A;  3P85 A;  4I52 A;  1Q51 A;  3GF3 A;  4RCN A;  3BEZ A;  1SZO A;  3Q7H A;  5INF A;  3TLF A;  2ZL2 A;  3ZW9 A;  1TG6 A;  3QXZ A;  3RST A;  1OD4 A;  4Q0G A; 
#chains in the Genus database with same CATH topology
 3PZK A;  3IAV A;  3TVU A;  4FZW C;  3GLM A;  3STA A;  3Q0J A;  4J2U A;  3U9T B;  3MYB A;  1FC9 A;  3TZ3 A;  5FUS A;  4HNK A;  5INI A;  4ZDE A;  4U1A A;  1K39 A;  1HNO A;  3N6R B;  2X58 A;  2F9Y A;  5DU8 A;  3R9Q A;  4EMP A;  4U0G H;  5DUC A;  3TT6 A;  1Q52 A;  4ELW A;  3GMA A;  3MT6 A;  3ADB A;  3LKE A;  3VIV A;  1EY3 A;  5HUQ A;  3TV5 A;  4QII A;  4JCQ A;  3ISA A;  5JBX A;  1WDL A;  1NZY A;  4F47 A;  1WZ8 A;  3ADD A;  1FC7 A;  3W8I B;  2PPY A;  2FZS A;  4JJT A;  1OD2 A;  3A4N A;  3IBB A;  4B3I A;  3KTG A;  4L6W A;  4OMR A;  2VSU A;  4QIJ A;  2Q2X A;  2VSS A;  4I4Z A;  4ZU2 A;  3QMJ A;  3FF6 A;  3MOY A;  3H0U A;  4I42 A;  3TRR A;  4YLH A;  1HNU A;  1FC6 A;  3LAO A;  3Q1T A;  3RQF A;  4HDT A;  1W2X A;  3RQE A;  4FB8 A;  2F9I A;  5ING A;  5C9G A;  3G64 A;  3T8A A;  2DEO A;  2J5I I;  3ZWC A;  4NNQ A;  4JSB A;  2A7K A;  2VSU F;  3OME A;  3KQF A;  4IZD A;  1UIY A;  1EF8 A;  5G1Q A;  1NZY B;  3ST9 A;  3KTH A;  3IRB A;  2J5S A;  2YJG A;  3ADC A;  1SG4 A;  3A4M A;  1J7X A;  3BF0 A;  4FZW A;  5C90 A;  4JCS A;  3ZWA A;  3BPP A;  3HP0 A;  3TDC A;  4IZC A;  3R9T A;  4JCR A;  2ZL3 A;  3L3S A;  2ZL4 A;  3HRX A;  3WG5 A;  3O4X E;  3FDU A;  1RJM A;  3PEA A;  3QK8 A;  4Q1I A;  3SLL A;  3MFM A;  2DUB A;  3M6M A;  3SWX A;  1WDK A;  3HE2 A;  4G2R A;  2F9I B;  2J5I A;  4WCZ A;  1UX4 A;  3H0Q A;  2P63 A;  3QXI A;  5CTC A;  3R6H A;  2PG8 A;  3IB9 A;  2EJ5 A;  3RSI A;  4FNB A;  1EF9 A;  4JOT A;  3QKA A;  2HW5 A;  5G1R A;  5DL1 A;  3RRV A;  4EML A;  4KPK A;  1Y7O A;  4L8K A;  4K2N A;  3R0O A;  4KNP A;  4U0G A;  3TVW A;  4IZB A;  3JU1 A;  4ZDD A;  4DI1 A;  4HC8 A;  5KDR B;  3QWD A;  1K32 A;  3GKB A;  4ELS A;  1XNV A;  3DJA A;  3KTJ A;  1WDM A;  5IKL B;  2IEX A;  5E0S H;  2J5I B;  4OG1 A;  1XNW A;  1XX4 A;  2QQ3 A;  3P5M A;  2BZR A;  5DTW A;  2WTB A;  5DU4 A;  3QRE A;  3TT7 A;  1UYT A;  4JYL A;  5DZK H;  3U9S B;  3OC7 A;  3V5E A;  3ZW8 A;  3M6N A;  2J5G D;  2ZQR A;  4JYJ A;  2F6Q A;  4QFE A;  1O8U A;  3H02 A;  3PE8 A;  3QYR A;  2NP9 A;  2A81 A;  4U19 A;  4KD6 A;  1N6D A;  2Q35 A;  5KJP A;  2F6I A;  3PGQ A;  2FW2 A;  4WZ8 B;  4ZDF A;  2FBM A;  2VX2 A;  1VRG A;  3NJB A;  4GM2 A;  2A7S A;  5KDR A;  4MI2 A;  3RQG A;  1X0U A;  3L8I A;  3AJM A;  3H0S A;  2ZQQ A;  3H81 A;  4U18 A;  3R9S A;  2GTR A;  5DU6 A;  3AM1 A;  1TYF A;  4FN7 A;  1HZD A;  4JWV A;  3A4L A;  3T88 A;  4RYF H;  1UX5 A;  4MOU A;  5CTB A;  3KTK A;  1DUB A;  2VRE A;  4OLQ A;  4RYF A;  4FJW D;  2ZL0 A;  1XO6 A;  4NEK A;  2Q34 A;  3NJD A;  2X24 A;  4FND A;  5DKP A;  3W8H B;  4KWB A;  2UZF A;  3Q0G A;  1YG6 A;  3OT6 A;  4MXI A;  2CE3 A;  4ASI A;  1RJN A;  3BPT A;  4U0H A;  3I47 A;  1Y64 B;  2CBY A;  2W3P A;  2VSU E;  2VSS E;  5DUF A;  3ZWB A;  3H0J A;  5G1S A;  4B3H A;  4JCT A;  3T3W A;  3DOR A;  3HLN 1;  5E0S A;  3U9R B;  3K8X A;  1N6E A;  1ON9 A;  5DTP A;  4ZDC A;  2PBP A;  1N6F A;  1FCF A;  4ZDB A;  4WYO B;  5FIF A;  1DCI A;  3GF7 A;  3HIN A;  4JFC A;  1ON3 A;  3T8B A;  5DZK A;  5JBW A;  3V5I A;  1PIX A;  4K3W A;  4FN8 A;  4NAR A;  1UYV A;  4B3J A;  2VSU C;  3T89 A;  2F9Y B;  1MJ3 A;  4GEH B;  4EMM A;  3KTI A;  1UYS A;  5MGB A;  5E0N X;  3P2L A;  2D3T A;  2J5G A;  4ELX A;  4GHN A;  3K50 A;  4K29 A;  1PJH A;  4Z0M A;  2VSS F;  4LK5 A;  1JXZ A;  1YG8 A;  1XNY A;  4JVT A;  2C8T A;  1UYR A;  3P85 A;  4I52 A;  1Q51 A;  3GF3 A;  4RCN A;  3BEZ A;  3L8J A;  1SZO A;  3Q7H A;  5INF A;  3TLF A;  2ZL2 A;  3ZW9 A;  1TG6 A;  3QXZ A;  3RST A;  1OD4 A;  4Q0G A; 
#chains in the Genus database with same CATH homology
 3PZK A;  3IAV A;  3TVU A;  4FZW C;  3GLM A;  3STA A;  3Q0J A;  4J2U A;  3U9T B;  3MYB A;  1FC9 A;  3TZ3 A;  5FUS A;  4HNK A;  5INI A;  4ZDE A;  4U1A A;  1K39 A;  1HNO A;  3N6R B;  2X58 A;  2F9Y A;  5DU8 A;  3R9Q A;  4EMP A;  4U0G H;  5DUC A;  3TT6 A;  1Q52 A;  4ELW A;  3GMA A;  3MT6 A;  3LKE A;  3VIV A;  1EY3 A;  5HUQ A;  3TV5 A;  4QII A;  4JCQ A;  3ISA A;  5JBX A;  1WDL A;  1NZY A;  4F47 A;  1WZ8 A;  1FC7 A;  2PPY A;  2FZS A;  4JJT A;  1OD2 A;  3IBB A;  4B3I A;  3KTG A;  4L6W A;  4OMR A;  2VSU A;  4QIJ A;  2Q2X A;  2VSS A;  4I4Z A;  4ZU2 A;  3QMJ A;  3FF6 A;  3MOY A;  3H0U A;  4I42 A;  3TRR A;  4YLH A;  1HNU A;  1FC6 A;  3LAO A;  3Q1T A;  4HDT A;  1W2X A;  4FB8 A;  2F9I A;  5ING A;  5C9G A;  3G64 A;  3T8A A;  2DEO A;  2J5I I;  3ZWC A;  4NNQ A;  4JSB A;  2A7K A;  2VSU F;  3OME A;  3KQF A;  4IZD A;  1UIY A;  1EF8 A;  5G1Q A;  1NZY B;  3ST9 A;  3KTH A;  2J5S A;  2YJG A;  1SG4 A;  1J7X A;  3BF0 A;  4FZW A;  5C90 A;  4JCS A;  3ZWA A;  3BPP A;  3HP0 A;  3TDC A;  4IZC A;  3R9T A;  4JCR A;  2ZL3 A;  3L3S A;  2ZL4 A;  3HRX A;  3WG5 A;  3FDU A;  1RJM A;  3PEA A;  3QK8 A;  4Q1I A;  3SLL A;  3MFM A;  2DUB A;  3M6M A;  3SWX A;  1WDK A;  3HE2 A;  4G2R A;  2F9I B;  2J5I A;  4WCZ A;  3H0Q A;  3QXI A;  5CTC A;  3R6H A;  2PG8 A;  3IB9 A;  2EJ5 A;  3RSI A;  4FNB A;  1EF9 A;  4JOT A;  3QKA A;  2HW5 A;  5G1R A;  5DL1 A;  3RRV A;  4EML A;  4KPK A;  1Y7O A;  4L8K A;  4K2N A;  3R0O A;  4KNP A;  4U0G A;  3TVW A;  4IZB A;  3JU1 A;  4ZDD A;  4DI1 A;  4HC8 A;  5KDR B;  3QWD A;  1K32 A;  3GKB A;  4ELS A;  1XNV A;  3DJA A;  3KTJ A;  1WDM A;  5IKL B;  2IEX A;  5E0S H;  2J5I B;  4OG1 A;  1XNW A;  1XX4 A;  2QQ3 A;  3P5M A;  2BZR A;  5DTW A;  2WTB A;  5DU4 A;  3QRE A;  3TT7 A;  1UYT A;  4JYL A;  5DZK H;  3U9S B;  3OC7 A;  3V5E A;  3ZW8 A;  3M6N A;  2J5G D;  2ZQR A;  4JYJ A;  2F6Q A;  4QFE A;  1O8U A;  3H02 A;  3PE8 A;  3QYR A;  2NP9 A;  2A81 A;  4U19 A;  4KD6 A;  1N6D A;  2Q35 A;  5KJP A;  2F6I A;  3PGQ A;  2FW2 A;  4WZ8 B;  4ZDF A;  2FBM A;  2VX2 A;  1VRG A;  3NJB A;  4GM2 A;  2A7S A;  5KDR A;  4MI2 A;  1X0U A;  3H0S A;  2ZQQ A;  3H81 A;  4U18 A;  3R9S A;  2GTR A;  5DU6 A;  1TYF A;  4FN7 A;  1HZD A;  4JWV A;  3T88 A;  4RYF H;  4MOU A;  5CTB A;  3KTK A;  1DUB A;  4OLQ A;  2VRE A;  4RYF A;  4FJW D;  2ZL0 A;  1XO6 A;  4NEK A;  2Q34 A;  3NJD A;  2X24 A;  4FND A;  5DKP A;  4KWB A;  2UZF A;  3Q0G A;  1YG6 A;  3OT6 A;  4MXI A;  2CE3 A;  4ASI A;  1RJN A;  3BPT A;  4U0H A;  3I47 A;  2CBY A;  2W3P A;  2VSU E;  2VSS E;  5DUF A;  3ZWB A;  3H0J A;  5G1S A;  4B3H A;  4JCT A;  3T3W A;  3DOR A;  3HLN 1;  5E0S A;  3U9R B;  3K8X A;  1N6E A;  1ON9 A;  5DTP A;  4ZDC A;  2PBP A;  1N6F A;  1FCF A;  4ZDB A;  4WYO B;  5FIF A;  1DCI A;  3GF7 A;  3HIN A;  4JFC A;  1ON3 A;  3T8B A;  5DZK A;  5JBW A;  3V5I A;  1PIX A;  4K3W A;  4FN8 A;  4NAR A;  1UYV A;  4B3J A;  2VSU C;  3T89 A;  2F9Y B;  1MJ3 A;  4EMM A;  3KTI A;  1UYS A;  5MGB A;  5E0N X;  3P2L A;  2D3T A;  2J5G A;  4ELX A;  4GHN A;  3K50 A;  4K29 A;  1PJH A;  4Z0M A;  2VSS F;  4LK5 A;  1JXZ A;  1YG8 A;  1XNY A;  4JVT A;  2C8T A;  1UYR A;  3P85 A;  4I52 A;  1Q51 A;  3GF3 A;  4RCN A;  3BEZ A;  1SZO A;  3Q7H A;  5INF A;  3TLF A;  2ZL2 A;  3ZW9 A;  1TG6 A;  3QXZ A;  3RST A;  1OD4 A;  4Q0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...