3QXVA

Structure of an anti-methotrexate cdr1-4 graft vhh antibody in complex with methotrexate
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
b'VQLVESGGGLVQAGGSLRLSCAASRRSSRSWAMAWFRQAPGKEREFVAKISGDGRLTTYGDSVKGRFTISRDNAEYLVYLQMDSLKPEDTAVYYCAADDNYVTASWRSGPDYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-Methotrexate CDR1-4 Graft VHH
molecule tags Immune system
source organism Lama glama
publication title An anti-hapten camelid antibody reveals a cryptic binding site with significant energetic contributions from a nonhypervariable loop.
pubmed doi rcsb
total genus 29
structure length 123
sequence length 123
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qxvA00
2A9MH 4PJGB 4UV7L 5DD0H 5JIHA 1F97A 5E8EB 2R29H 5D7KE 4BSVA 4LHUA 1K9TA 4ZQKB 4URTB 5I17A 3O6FD 1D7FA 2NYYC 3O3DB 1V7NL 3QJFA 4IOIA 1N3NB 5DJDA 1FZJB 4OZFA 2Z35B 4U1NB 1NDGB 1ZLSH 4MJIA 1P2CB 2FYYA 2ICWI 3DWTA 1HWGB 4M02A 4NYLA 1T7ZA 5K9JH 3D0LA 5I1JL 3NCMA 3KPRB 3QAZB 4N8CH 2W60B 1A6WH 1L0YA 3IFLL 4Z7UB 3ALPA 4FQLH 2A73B 5ADOL 2AS5M 4PPTA 3VXPB 1HCVA 1Q9KB 3M17A 4IDLA 2WWKO 3GSXA 4UBDD 2AEIT 4KTDH 2P24B 3QCVH 4J8RB 4ETYA 4PGCB 3U0WH 2B1AL 4LSTH 1U8OB 2DI8A 1CD1B 4K9EH 2O61B 4JM2F 3UTSD 1R3IL 4I48B 3TNMB 5KVFH 1AGBB 3EIFA 4BQCA 1EEZA 2V2XB 1B0GB 3OAYH 4PREB 4KK9C 1VA9A 4FOMA 4XI5C 2BNQA 3D0LB 3UO1H 4L9LC 3RHWK 1T6WA 3L3IB 5IQ7H 1CL7L 5A3ID 3MA7A 3T0EA 5F8QC 3NZ8B 4JFOA 1BAFL 1BREA 1R3LB 3KYNA 4JO1H 5C6WH 3TESA 1KFAL 4H88H 4G8IB 2R4RH 3OKOB 1JZ3A 3KLSA 5D7IE 2BMKA 1KNOB 2OR7A 3Q2CA 2AV1B 1EJOL 4IDJH 5KJRH 4LNRA 1S9VB 3PHOB 4HS6B 2X9WA 4NNYA 2HTLD 2R1WA 3NABH 4HF5H 3BEVA 1QSEE 2ZSVB 2ADFL 3ARZA 2FGWH 5EIIA 4LDLB 3TT1H 2Q7YA 5JXAL 1RJLB 3R8BB 3C8KA 4LSDA 3BZEB 5FO8B 1NAKL 1YDPA 3PE9A 4HAGA 3MPCA 2H8PB 5DK0B 1YECL 5FEBA 4U1GB 2VLRE 4XCYB 4YNYB 1GYAA 3VG9C 1QSFA 3MLTA 1LEIB 5KN5A 1U3HB 2YR3A 3L3DA 4WWKB 5KS9A 1FFPB 3BP6B 2YPLA 3VXUB 5E08H 3WV0A 2QL1A 1H3PH 2BY0A 3ZKNC 1J88A 5EZIL 2Q87A 5I1LB 3V2AR 2GUOA 3GSQB 3KYKH 4JY6A 1AP2A 4ORZC 2AJUH 3P0YL 4KKLC 4IOFC 1CDUA 3PV6A 4X8JB 4Y4FB 1Q9LA 3FQNB 4KK9D 1OGAB 5C8JB 4ZS6D 1ADQA 5E9DB 1UXSB 1QUNA 5IJVB 2VDPL 1VADB 5E6IA 1BZ9B 1RZGA 3BVNB 3GMLA 3P30H 3N1QC 1AGEB 5FUCC 5I0DA 5I1DB 4OLEA 3DV6B 4OV6F 4CNIA 1VEMA 4NHCH 1U8IB 5IQ9A 4QHMA 2CK2A 2D0HA 1JYWA 5E2WH 3FFCE 5I76B 4FQHB 5GRUL 1JZ4A 3QEHA 1RJZB 5B3JE 5J7CC 5EOCH 3V5KA 5ID1B 3RWEB 43CAB 4HUVA 3MLWH 4MHHG 3SE3A 1A9BB 1ZA6A 3MXVH 3BRDA 1X6LA 4XMLL 1MY7A 4LSSH 3WO4B 2GCYA 3KHQA 1TTGA 1U6AL 2BNRD 4LSRL 1A22B 1E28B 1JHTA 4U1GC 2MQCA 4LCCC 3UTZA 3ARFB 1IGFH 5HYJA 2BSSA 1NAMA 4QRSA 1FGVH 4TVPE 5DVKA 1BBJA 3TCLB 1ZGLB 4LIQL 1QACA 2AVGA 1CFTB 2DQTH 4G42A 4JANB 2EDYA 3RNQA 3TN0C 4Z7NF 5J1AA 2HKHH 3BPOB 2MCG1 4LSVH 3MJ7A 3EFDL 5LAXB 1U0QA 3QO0A 4NKOB 5CJ8A 3IDXL 4NNXA 3QCTL 3INUH 5ESAA 2WP3O 1S7VA 4XC3L 3UTPD 4O2EA 4EOWL 1A6UL 5F6HJ 4OZ4B 1XR9A 1IC7L 4UILL 2HFTA 1DANU 3AB0C 4MCYB 4YHYC 5LGKA 5D70H 5LBSL 1EHLH 4YZFE 4R3SA 2CRMA 2ZUSA 5IMKA 3GSWA 3V5DB 3WFHB 4G7YH 3KXFA 2IQ9H 3OB8A 4Z7UE 3GMMA 5F1NB 2ADJA 2FX7H 2FHCA 5ACZA 5GGQL 5B39G 2YWYA 4QHUA 5EC2B 1HKLH 3PGFH 3SO3B 3QHFL 4DGYL 1JTOA 3H8NA 1UM5H 3PWNA 1INDL 4OD2B 2X4UA 1U36A 1X7QB 5FK9A 3IS1X 5DGRA 2AJVH 1S7WB 3W9DB 3C2SA 3ZE1F 5C2BH 1S7SB 2KPNA 4GG8B 4LSPL 3S35H 2AK1L 1UKTA 3U4EA 5F21B 3KXFE 3UJJL 4UDTB 4XPBL 1S9YA 1AXSA 1AH1A 1MHCB 4U1SB 5FB8B 1HYSD 3QUXC 3OHXA 3C8DA 1NBYA 5DD5H 3K1KC 2BOBA 3VXME 5HDQH 2VSCA 2WINB 4YHZH 1DBAH 2AGJH 3OKKA 4GW4A 4R8WH 5FO7A 5T3ZH 2HJLB 3UXFA 4PJHA 2EDFA 4B41A 1XZ0B 1NGPH 3U46A 3S4SA 3D69B 3AB0B 1T1XA 3PQYE 1RIUH 1ZSDB 1U95B 3IDYC 3FOLB 5DC4B 1HHHA 3ZDXE 1K3ZA 3SKOA 3ZYOA 5M95B 3MRCA 4FFWC 4KK6C 2DKUA 2B1HH 4PRHB 3ARBB 3G6JE 4QEGA 2AJSH 4LGRB 5E6ZA 1OSPH 5I1CL 2JB6B 4X6DF 4X7EC 1A7OL 2P8LB 1RULH 2QSCH 2P8MB 2FH8A 2JELL 1U2HA 1U95A 2B5IC 2BVOA 1JNNL 3LEYL 3SO3C 4JN2B 4QXUH 4W6YB 2HLAB 5JQ6H 4L8DB 4TSAH 5IVXF 5BO1H 1KJ2H 5DI8A 1ZS8A 4G7YL 2NYYD 4OF6A 2OMNA 3VGAC 5C0CD 3ROOB 4KQ4H 3BRFA 2VABB 2AI0L 4J4PC 1PKQE 1OGAE 2R23A 3B9AA 4UT9L 2E5EA 4DOHE 3EO1B 2WQRA 4OCRH 4JFYA 5F7KC 1FN4A 4R0LC 4UTAH 4YXLL 5D6DA 1JHKL 4M43L 4KI5D 1JE6A 1T5XA 2HMIC 1FPTL 1ZANH 3DHJA 4R4FL 4PJEA 3KPMA 1ZHNA 2OL3B 5DUML 4ETQB 5C0CE 2VXUL 3FMGH 2ZKHL 4D94A 5TF1H 4NSKB 4LRNL 2BVOB 2OM5A 1MHEA 1U8KB 2IC2A 3DECA 1NFDE 1F4AA 4JO3H 1JN6B 1GC1C 4GAGL 5CUSH 2IH1A 2CLRA 4Q7DA 4K3JL 3HZKB 4JFED 4POZD 3UJTL 2Y7QA 2OCFD 3R06B 3V5DA 3I50H 4K71B 4MA3A 1M7IA 4Y1AD 4JKPH 3JVGA 3MV9D 1PGRB 3BP5A 4NC0B 4R3SB 1CI5A 1KCSH 1JF5A 1Z9SA 2H2SC 2FJFA 2H9GB 3Q5OA 4Z95H 3FO0H 4ODTL 4HZAA 5EWIL 5FYLL 5D1XA 4XVUD 3SE8L 1F6AA 2AEWA 5FGRA 1M7IB 1JTTA 3JV0A 5ESAB 2H45A 5ITFA 3EJZC 3OF6A 4PRHD 1KTLB 4EN3D 1OAKL 4MQXD 3TZVC 2YPLD 3SDYL 5IM7A 5BO1L 1NKRA 1I1AB 3PP4L 5GS2D 4WO4B 4CW1A 4P5KA 1ORSA 3HMWL 4TNVF 4WDIA 1IFHL 3E3QC 4UAOB 3NCYS 5CINL 4DGVL 2AJUL 1C5CL 3A6OA 3DOSA 2LABA 2VOTA 4OD2A 5CGTA 5FK9B 3DHMA 5LGHH 2NZIA 1U8QA 2EE6A 2OXGA 4LLWB 5EULV 2J4WH 1BX2A 5TDOA 1OCWL 4YFLF 3V6FB 4CUCA 4HS8H 3HAEB 5EU3B 2DQDH 4WUKL 1EVUA 3O4OB 4HBCL 3OL2A 3THMH 3WHXB 4RAHA 4YXHH 5ACMA 4GSDH 1NPUA 2AAVA 1AE6H 2CD0A 4XP9L 1WITA 4HUVB 1A2YA 1CDGA 4GG6B 1YA5A 2YD9A 4RMVA 4IOSD 3LAFA 5IESL 1P6AB 1G7IB 2IGFL 4FABL 5L9DL 3BE1H 1S3KH 2ICWJ 3KPPB 1F45A 5FCUH 2EC8A 2Z8WC 1RZKH 5KSVA 4N0RA 2A0LC 4X7FC 4X4ZA 1QSEA 2NPLX 3CVHH 3MUJA 1I1AC 3QIBA 2OK0L 1GOHA 2XACC 1S7RB 5HDLA 3SE4C 1OAYL 2R56L 3EYUH 4AT6A 5DEZA 4ZMAT 5IOPA 1UGNA 1MWAL 3O4LA 5DC9B 1QSFB 3MLTB 4ZS7H 3BGAA 5FKPA 3SDYH 4HK0A 2P8MA 2GCYB 4RGMC 5EIVA 4JY4B 3MCKB 3OHXB 2BHUA 3SDCC 4PJFF 5HI5C 4HKJB 2EKSB 2R4SH 4M7ZC 4HAFA 1OQXA 3ILQD 5K59E 3PWVA 3VI3E 1YMHB 4AZ8A 3LB6C 4JREB 3V6ZB 3KJ4B 3C6LB 4D0BA 2BHYA 3IAQA 3QDGE 1LWRA 1OB1A 1BD2A 2NY6B 2NLJB 1T1YA 3G5VB 3CFJB 2A9ML 2NNAA 3IU3B 4NT6A 1AFVH 1LVEA 1Q9LB 3FQNA 4UV7H 2VXQL 1YY9D 3QCUH 3SKNB 1A1MA 1MVUB 2QQLL 5FOBB 3ARSA 4KKBC 3GMMB 4JM4H 1IGTB 4JJ5B 5IFHH 1UQSA 3GSWB 3QXTA 3HC0B 3CUPA 3LZFH 4YHIB 5GGVY 4TULH 2JTDA 2CMRH 1EAJA 1ZTXL 3QUKB 2V7HA 3QIWD 2FR4B 2OR8A 4BZ2H 4PRPE 1QEWB 1YQVH 4XPFH 4F7MB 4G6AD 1FDLL 3HZYB 1FNEB 4O2EB 1OAQH 3GBLA 2P5EA 1BLNB 1WEJL 2LFGA 3LN9A 4F8QA 3MV7E 3T4AB 3FL7A 4AMKL 4RGMB 4KJPD 5SWQA 1BQSA 4ODUA 5BS0A 2GK2A 5T1KA 1RAMA 4D9QD 3EYUL 4G42B 1WZKA 2WBJC 4LSVL 1B9ZA 2W60A 3GHBH 5DFVD 3W0WE 5HYJB 2XN9E 4H0GA 4JFXB 4PB0H 3VXQB 3EO9L 3HCVA 5DD3H 1VFAB 2G75B 1FZMA 4QCIA 4HHAB 3SJVE 2XG4A 3IXTA 4JG1H 4YQXL 3NA9L 3T0EB 3P0VL 2YSSA 4HZLB 3TH2T 3O3AB 3S36X 4K94C 3MSPA 4NKOA 1AQDB 2EDDA 3U7WH 5BS0E 3B6SA 1ZV5A 3O3UN 4BSVB 3RIAK 3TVMD 4KVCL 3NIFF 5JHDE 5MP6H 3BIKA 3ECBA 4K8RH 3ARRA 3GI9H 2OZ4A 5MEQB 3ARFA 4L3EA 2H1PL 1CICA 4LCUB 1ZT1A 2J6EA 1NEZG 5IB1B 3BVNA 1YY8A 3IFNH 4OBRA 4AQOA 3SDXA 3KS0H 4AL8L 4FQXB 3LQZB 4LDOB 2NR6C 3QRFM 1IKFH 4G8EA 5ELIA 1FO0H 4NHUA 3EYOB 5BVPL 3EYVB 1T1WB 1EUUA 2IANA 4NOBA 4PJ5E 1SEBA 5DTFB 1SYSA 1JWMA 4IHOB 5KVDL 4OZFH 1QFPA 3HUJA 3VA6A 1BAFH 1K3IA 1YJDC 1I8MA 1VESA 1E27A 2FBOJ 4QHNB 1CE1L 2DB8A 2LAAA 5KSBA 3HE6D 2VDML 1JF6A 3X3FH 3NACL 3O6ML 3QI9D 1YNLL 1AGEA 4JVWA 1FZJA 2Z8RA 1ZK9A 3Q0HA 3SDAB 1QRND 5HYQB 1X5ZA 2L0DA 4YDIL 2VUYA 3TO4B 1WWWX 2JJSC 1BEYL 1OSZA 1XH3A 1YJDH 2P49B 4G6FB 5E8EA 1JGUL 1N5YL 2XA8H 1G0YR 4QXGL 5F7FA 5KG9B 4P2CG 4NQTA 2XXMB 3QEHB 1KXVC 2HTKC 1D6EA 1S9WB 3QUZA 2WIMA 4J3UA 2Q76A 2J8OA 5C08A 3UDWC 4OCWL 4NZUH 1BQUA 3PP4H 2BNRE 5BZWA 3GMLB 2ZOLA 3D0VB 2YA1A 4RWYL 1J0KA 1UXSA 1JZ7A 3BWUC 2FLBT 4OLZH 2BCKB 2V5YA 3H0TB 5EZOL 3O6FB 5E9DE 1K5NA 2BNUB 2BVQB 4Y19E 1DCLA 2GJ6B 4NRXB 4F7PB 4FG6C 5BRZA 1B0GA 2B39A 1T66C 1U8JB 4TYUA 4Y5XA 4HH9B 1C5DA 3C60D 1VPOH 3RTQD 1QLRA 4ZUTA 4FQQB 1JHKH 4M43H 5DZNA 1GGCH 1XF5B 5C08E 3PWJA 1CD1A 3P0YH 4DK3A 1L9MA 3E3QE 4J8RA 4LCUA 1H3WM 1S78D 2FB4L 2NY2B 3L7EB 3FT3A 4D2NA 2ZKHH 5I71C 3BUYA 1QRNA 2JLLA 2NZ9D 4LKCA 1IZKA 2VKXA 3T2QA 5BV7B 2VDNH 2VISB 1MRDH 3O2WL 5F7NC 2W9DH 4FA8A 2ITCA 1QFWH 2OJZH 3WIFA 4YLQT 3CXDL 1ZT4B 4QGTA 4OF7A 1XIWC 3FO2A 4LCWB 1MJUL 1KNOA 1NLBL 3MLPA 5I1IL 1N6QL 2VXTL 3PGCA 4DFHA 1SYVA 4Q2ZA 3NZ8A 1BEYH 1YJDL 2AK4B 4YHLL 4NGHL 1WFOA 4I3SL 3DTXB 3QHZH 4OGXL 4PLKD 2FBJH 4Z77B 3U0TB 3ELAT 1AKJD 1AGDA 4DN3L 4DZBB 3T3PF 4DCQB 1UKSA 4FTVE 1IT9H 3LQMA 1UVQB 2FSEA 1SQ2N 3NCCB 5FECA 1MAKA 4ZFZA 4M61B 2EDXA 3I9GH 4ELKB 1GCFA 4MJ5B 3NN8A 3VFTA 2OTWB 3EUUA 3SDCD 1T7XA 2SEBB 4OFPA 2NY2C 2CKBB 1RD6A 3V0VB 1TIUA 1WT5C 1N6VA 1E6JH 3QBTB 4N0YL 4PG9A 1QP1A 4HPOH 3TN0B 4JB9H 1I9IL 5KW9L 5CEZH 1NANH 4HFUH 4DGYH 2V6HA 1EO8L 4ZTOL 1PZ5A 4KH2A 3G9AB 4P5TD 4KROC 1MFCH 4WFFD 3WKML 2FYYB 4KRNA 4J6RH 5H35A 5I9QB 2NLJA 4PJAE 1AJ7H 5HXMA 1F4HA 3VWKB 3TFKC 1FL5B 3AY4A 5I17B 5H94A 2PN5A 5FGCB 2CUHA 3SCMB 3BZ4B 3MV8B 1J8HD 4UTBH 4JO2H 4ZXBC 5HHNB 2GY7B 4M4PA 3VWKA 4C54A 3EHBC 5HHQA 5HVHB 4Q6IC 1XCQA 3MNWB 4QTHB 4Z5RA 4F15B 3B83A 3CSYB 3KYOA 3ULVF 1MLCB 5KSBF 1F3JB 1MRFL 4OCSH 2BY1A 1QLEL 3MRBA 4Q9BA 4DUWA 5K59F 1LDSA 5FYJU 1HQRA 3TO2A 1KYOK 1RHHA 4ELMA 1RK1A 5ID0A 1RZJL 1FYHB 1UT9A 5HPMA 1PSKL 4P5MA 2Y36H 3OKLA 5B39B 1B90A 1UG9A 5JW5B 2FH6A 4UIMB 4PJ9B 1BOGA 4KROB 4X7SH 3U9PH 1RUMH 3QZWA 4LARH 5D1XC 4Z0BH 5HYSG 5KZCB 5I9QC 1OSPL 3OJMB 4I8DA 4NFBA 4YGAB 1RUQL 2EEBA 5I1CH 5FECB 2IFFL 1CU4H 2AI0H 5AAWA 5FO9B 5F7WC 3X12A 4TTDD 4NJAL 3IDYB 1H3VA 4TSAL 4BFEA 3MRKB 4RAVA 4KXZI 2D7MA 4PRHE 5F1KC 4M1CD 3IGAA 4OIIH 3QQ9C 1YPZB 4JKPL 1YEDA 2EICA 4PRIB 3LKNA 1RY7B 1HK6A 5E00B 5FYJH 5GGSY 2DKMA 2ATPA 4R7NB 1M6OB 4QRQA 1WK0A 4UT7L 3E8UH 3WS3B 3C2AH 4HDIB 2OP4H 2H26A 1YPZA 5E8NA 4L8BB 1AIFB 1OAQL 1MFEH 2ESVD 1INEL 4WHDA 1NGXB 5D7SL 5F8RC 1CXKA 5DHVA 3MJGX 1LO4H 4AIXA 5JLZA 1DLFL 3E6FA 5GJSH 4XWOC 5E8DL 4L8CB 3RNKA 4PJFA 4Z7QE 1F11A 3MXVL 3GHEL 2AJ3B 4J4PA 3HPLB 4RAUA 4KZDL 3TNNA 4QXGH 1JNHB 3FO9B 1OW0C 1F2QA 3NGBB 2ERJB 4EDWH 5EZJA 1CDHA 1YUHB 5SWSD 5KOVC 1S78C 1J05A 3U9UB 2R0KL 4PJDE 1HHIA 3QUZD 5A2JH 2JF1A 1CTOA 4HS8L 3MRFB 2UYLA 1JZ5A 2IBZY 1CT8A 1F02I 3G6AB 4ELMB 5FIEA 1U8LB 4P46A 3QFDB 4WCYL 1NSNH 4FXLA 1IFHH 4PRID 4YXKH 4ZSOB 1C5CH 5CIPH 2FWOA 1K8IB 5TQ2H 1N64L 5I1KH 2CO7B 4KVCH 3V0WL 1IQWH 3QDJE 5IVXA 4KK6D 5HHQB 1G0DA 2IALB 3B8YA 4M5ZL 3O0RH 4XPAH 4X4YA 1DBBH 4M48H 2YEZB 3L1OL 1XIWA 3QUXA 1TZHB 5C2UB 3O8XB 4P2QD 4JFYB 2YD4A 3TZVB 1IAMA 2HLFC 2RR3A 4HXAH 2D4DA 4RISH 3HG1E 4I9WE 4G6ML 3T77A 3P73B 5EU6E 4XXCA 3IXAA 4NO5B 5LCVL 3QQNA 2RGSA 2DQEH 5IG7A 3RZCA 3PUCA 4LL9A 2XFXB 5KSBB 4Z7WE 4WI6A 4P9MH 5C0DA 1JWSA 5HJ3A 1DFBL 2R29L 4QRUA 1CFQB 3HB3C 1G7MA 3H3KA 3OKEA 2HA1A 5L2KD 4K8RC 3UTSB 1RSFA 2D7OA 4YR6A 5I1GL 2XWBB 2H3NB 3MXWL 1R5IB 2DLFL 4HWZB 1Q1JL 4MXWL 4YDKL 5HD8D 4J1UA 4N90D 4OQTA 4FQ2H 4HV8B 1T1XB 2APTA 4S11A 2NW3A 1AR1C 2DLTA 4JPWL 1UEYA 2MPAH 3WDHA 5D2LF 3MZTA 5AWNL 1ZXQA 4GW1A 1Z2KA 3O11B 2MHAA 3D39B 3U83A 1AFVL 4U1HA 5EN2B 1QFUH 4L3CB 4XNYH 3T0AA 3G6JF 5EZOH 1HHKA 5L2JA 1NBVL 3SDCA 3O8XC 1KT2B 2VLKA 3MRLA 4U6VH 3GK8H 1SJXA 1WTGT 1W72A 4FHBD 1G7HB 4NBYB 3UCRA 3T2PA 3IJSA 3PGCB 5TE6H 5EBMA 1I8KB 4GAYA 2B4CC 2DQJL 5D7JD 1WEJH 5J3HC 2LU4A 3PL6D 3TYFB 1E4XI 3VFSA 3BZFA 4ZYKA 5TF1L 1AO7B 2EDNA 3MV11 1FZKA 5AZEH 5F9DC 3GSNL 4PJIB 1CDBA 4XP1H 5HTSA 1CGVA 4DKFL 3V95A 1NFDB 4M7ZB 4H88L 4WFHE 3HE7B 3SGEH 3QWOA 3T4AA 1DQDH 4OBSA 5DO2D 3W9EA 4MD0B 5IWLA 2J7LA 1F90L 1MOEA 1N7ML 3HR5A 1MI5A 4XHJC 5CFHA 4JREC 1CLZL 5JHDD 3S37L 5GZND 2WUBL 1TZGH 2OL3L 3CNKA 2F53A 5HHPB 5SX5K 1TETH 2IADA 4HC1L 4M6AA 2ZUUA 3AREA 3H9YA 3EDFA 4JR9H 4E42A 4LRNH 3IDIA 3VFGL 1KIRA 3BN3B 1IAIL 3T2NL 3RWJB 2YK1H 5C09A 3QO0B 2Q6WA 3HC3L 5JPMA 3QDHA 4KRPC 5DYOA 3W0WD 2X4NA 3P77B 4JQXA 4WW2A 1G7QB 5HHOA 4LCWD 2VLKD 1FHGA 3ZYZA 3F62A 1ZGLA 4NM8H 4P2OA 3I6KB 1GGIH 1OAZH 3C6LA 1A5FH 3D3VE 2BDNL 2BVEA 3JWOC 5E8PA 1UWXK 2DMCA 3HI5L 5F7DA 2JJVA 2ADGB 5E2JA 1WWCA 1JPSH 3WLBA 1DQLH 5DK3A 1ITCA 1OSZB 4U1JB 2BXZA 3BRGC 3MV7B 1ETZA 3QXUA 4YXHL 4RRPG 5FFLA 3WLBB 5JW4R 4KDTA 5KW9H 3MJ8A 3LQAL 4YC2C 5F7DB 2DM3A 2FJHA 5EU5B 2HFEA 3FTGA 2HFFA 3UPAA 4MS8C 4TSCH 2PYED 1DUYB 4L4TE 1QSED 4B50A 3G04A 1BZ9A 1RZGB 3MROB 5TF0A 3T0EC 3WNOA 1K4CB 3D25B 1TCRA 3L5XL 4OLWH 2AV7B 4UNTA 4P5TB 1NLDH 5F9JB 2AV7A 1A7BA 5E70A 1K2DA 5EU4A 3SCMD 1P4BL 35C8H 2FATH 3REWA 3H42H 4FTVD 2ZUWA 2E9BA 4YO0B 3H9HB 1FNFA 5CZXD 2DQTL 1RK0B 4NUJB 5ESVA 1TNMA 2KDGA 1QLFB 4TRPL 5CJXC 1FG2A 1T7VA 3CX5J 1IC4L 4S1RL 1UCBH 1T04B 3C8KB 3TGXA 4MXQC 3MRIA 2YN3A 2WLZA 3O3AA 4G5ZL 3TPKA 2QQNL 1PYWA 1BF8A 5D1QC 4WI4A 3N85H 4PJIA 1OWWA 4TPRL 4JFFA 3WFCL 4FQIH 2X89D 1MUJB 3TN0D 1CR9H 1FNLA 3MBXL 2X40A 3WMSA 4YWGH 2BMKB 1WIPA 3MJ9A 5GISL 3KYMB 3W5NA 3HR5B 1IEBB 3D48R 4QRPB 3C5SB 3CFEB 4EI5A 3OKYA 3JV4B 4NKMB 1NFDA 4Y19A 2X42A 1IGJB 3IDUA 5CD5D 4ZPTB 4KFZC 3V5HA 1AHWB 3GIZH 3DUSA 2NXZC 2PKDA 5IBTL 1GC1H 4V2BA 2OTUA 3AREB 2Q3AA 5DJZB 1KEMH 3F6IA 3ULVE 3KR3L 3I3DA 5DRNA 1EVTC 1U92A 4HH8A 4Q6IA 4YHIA 3VRJA 4MD0A 3W9EB 4Z7VE 2VZVA 4MZ2A 3M8OL 4OCYL 4ZPVB 3RIAF 1E4KC 3GBNL 3BP4A 1DBAL 1JHLH 3MACH 3BQUD 5I1IH 3W82A 4WI2A 5BOPA 1NGYB 4IRJA 3GHEH 4I3RH 1IGCL 2VDLH 4ETQA 4JZOA 4YDVB 3DGGA 3P9MA 2IH3A 5AZ2L 1GOFA 1Q9OB 1DEEB 4PJCA 3RVVD 2R0KH 4M6OL 4AMKH 3O3DA 2F58H 1IBGL 1JNLH 4NQCD 1V7ML 3UTSA 1UM4H 1F4XL 1CL7H 3MCKA 4ZQKA 3TZVA 2F5BL 4HFUL 2E6PA 3HNVH 3OXSB 1X5XA 3DGCR 1Q38A 1S7XA 5HYFA 1R3JB 4OZHA 4XBGA 2QADC 2NW2B 2HFGH 3QXDA 4PGZA 1XIWB 5L0QC 1CDIA 5GGUA 5FXCH 4ENEC 4H1LH 4Y5YA 3QIBB 5ILTL 3CH8A 2HLAA 2VLMD 5I0ZA 4JFHE 1IJ9A 5C7XL 3IFNL 1GIGH 3JVGC 4XNQA 3BH8B 5IB3B 4BFGA 2H32A 5DJ6A 4G6JL 4FFWD 4JHWH 3OG6B 2BK8A 1QYGH 2VNCA 3LPWA 4IRZL 1ZEAH 5GISH 3RPIA 5DQJB 3QZWG 4KKAC 6FABL 5DEGB 2G5RA 5F7LB 3X11B 4KKAD 2ZCKH 5E7BA 2DQGH 4JG0L 4ZAKB 1W0YT 1SHMA 3PHSA 5L7XH 5DJ2A 1EXUA 1F3DJ 3H6JA 4WTXA 1JPGB 4RNRB 1TZGL 3FN0L 2Q8BH 1DFBH 4P46B 4NO2A 3ZTJH 2IAMC 3HAEA 2A1WL 1OLLA 1IGFL 4M9OA 1T2QL 5IB5B 4JPIB 1CK0L 2HT3D 3F7VA 1J0IA 2P5WA 5TE4L 2DIJA 2FDBP 3IETB 1LE5B 1U6AH 2DLFH 4HX1A 4YZFF 4KWUA 3MV9E 1W0VB 2C5DC 1EFXA 5GGTA 1RZFL 3PWNB 4WNQB 2ENSA 4RMTA 3WSQL 4F58H 1SMOA 1F4XH 2XTJC 1FYTA 4W4OA 1YC7A 4HSQA 4LF3B 4I18C 4LASH 1F11B 4OLZL 2J3SA 4HKZB 4WY7H 1G7PB 3X3GL 3G6AA 1P7QD 3MNZA 3CLFL 1UM6H 4CMMB 1OPGL 3MRRB 1J0HA 1FFNB 4CADB 2QEJA 1GOGA 4PGBB 2R69L 2WW8A 4LPXA 4X6CE 4ZUSB 5DWUL 4OV5A 3K4AA 4ZG1A 3JUZA 4NDMB 2BVPA 3BXNA 4E5XB 5FYKL 1V7MH 5DLML 1CIDA 4PJ7B 3WUWG 1A7PL 3HG1B 4NQSA 1CGSH 4ZFOL 3CMOL 1I1YA 2LQRA 4NZTL 4M3JA 3FB6B 4UZGA 3E6HA 3IU4H 4MNQB 4YHOL 3RZWA 5ILTH 5J57B 2IGFH 5TQ0L 4NSKA 4XC3H 1AIFA 4NQXB 3WHE0 5ENWB 4F37F 1PLGH 4PFEA 3V6OC 4ZO9A 3P2TA 2ZZUT 1SJVA 4O58L 4PJBF 3F6LA 3TBTA 1I7TA 1MELA 3LHPH 4ONHB 5E94B 5A3IC 4WWKD 4N0UB 4R8WL 1MREH 3G9VA 3KPQB 3PWUA 1RZFH 1RHHB 2UWEA 3EDEA 1KTRL 3TBWA 2F74B 3MX0A 1W72L 3TO2B 5EU6A 2M2DA 4Q9QL 4X9IA 4K3GA 4PJDB 5DURD 1HINL 3ZL4L 5H94B 3BESR 4UQ2B 4PJAF 4FQHA 2IAMD 2QQNH 3C5JB 4FNLH 4JFPB 2ZG3A 4QYOB 2Q8AL 4F9LA 3KYOB 3CU1A 4EEEA 2A6IA 1PAMA 1VACB 4XB7A 4QRRA 3ZDZF 2FEDC 5A2LH 4BJLA 4ZDHB 2AXHA 4X4XB 4F2MA 2G60L 1EPFA 1YECH 2XZCL 5CZXC 1DN0A 3FAWA 3O2DA 4OZIA 2DWEB 2FL5A 4WO4C 5F88B 2HJFA 1KJMA 4NKIL 4JGMA 1S5HB 3PQYB 1BVLA 2CKBA 3VDBA 4JHZA 5D2NA 3UPRA 3QYCA 1T0MA 2WIIB 5IVXE 4HWEH 3K8KA 2IPTL 4S10A 1EEYB 4YXLH 3HE7D 5HGDA 3RWCA 5I6XB 5DK0A 3NAAL 1UH4A 2PYFA 4RGNB 4EIZC 1KULA 3I75B 1YDPB 5IV2B 4QY8A 1HIML 4Y5XC 1S9YB 4TSCL 2WBJA 2E9IA 1WBXB 3QUYB 3FB7B 4MS8D 4CN4A 2B0SH 1HWHB 2X5PA 1IAKB 2R0ZH 4NC1C 3SY0A 5DWUH 4LEXH 4BK5A 2JE8A 4BKLA 5HHME 2CLZA 3QIUA 1CXIA 3NFSL 3U4AA 2Y5TB 2VLLA 1CS6A 1CYGA 3ZE0E 1J0YA 2VZTA 2CRYA 4D9LL 4OM0L 1YN6B 4W6WB 5EPMB 3WKMH 2X2YA 4RX4D 5BV7H 3EDJA 3QEQA 1IAIM 4ZFZB 2AK4A 2GAZB 3RZCC 2PCPA 1H3TA 5F9WC 1ZMYA 1UVQA 1I1RA 4X6CB 3N50A 3B2UD 4JO3L 3KVQA 5E1HB 3SN6N 4F9PA 5SWZE 4KC3B 2GJZA 2NY3C 4H1LA 4LKXA 4CJ0A 5B38A 3VE0A 3H3PL 1QFWM 1KB5B 3RKDC 1HOCB 4FNLL 5MEOB 4XI5D 1TPXB 3FT4B 1VFMA 1NEUA 2FO4B 2A6DB 4LNVA 3NN8B 2ORBL 3VFTB 3RVTC 3N06B 4Q2ZB 5IVZA 2EYRA 4FZ8L 1RU9L 3SKJL 5C86A 4PRAB 3UPCA 1BJMA 1NQBA 3D85B 4XWGL 1PY4A 2QKIB 1MRFH 4OCSL 1MRCL 4K55A 2BSTB 5JR1L 3RBSA 5MEPB 1KJ3H 3Q3GB 5JXEA 2Z4QB 3F7QA 1T4KA 3O2VL 2EECA 1KOAA 4NM4L 3U30C 4PG2C 1HEZB 2EEAA 3ARGB 3DRTA 2BSSB 4TUKL 4F80A 3KPLA 2OLDA 4G6JH 3D6GA 4WVRA 3SE9L 1CG9A 3V4VL 1I3RA 1DBKH 5BZWB 3D2UA 2J4WL 5EB9A 2ZP0T 2X4RA 4HUXB 5E7FA 2A6JA 1HYRC 2Z0BA 4I0PB 4TVPH 3UC0H 2MCPL 2PO6A 5C6TL 2BOCA 3VXRA 5T1LA 4OF8A 2UZIH 4RRPA 4U6YA 43C9B 3DUUB 3IKKA 1XH3B 3QNYA 5AUMB 1N7MH 4APQA 3EO0A 1CFSA 4HUNB 3FFCB 1FZOA 1BFSA 3PWJB 4DWHA 5C0CB 1SJEA 1OCWH 4Y1AE 3SDDC 1YNKL 3QAZC 1JMZA 2D4FA 1IC1A 4QRTB 3GI8H 2VQUA 43C9A 5J6GB 3UX9B 2OL3H 1MFEL 4S2SA 3ZTNH 4I5BA 2VO5A 1PX3A 3FQRB 2D9QB 1F8TL 3ARGC 4I18A 3X3GH 3QHFH 4RQQB 3HC3H 4Z78A 1NH6A 1NCBL 3PIQB 4WIQA 1X5IA 4XC1H 4YAQA 5E1AB 4JCMA 5D5MB 4E41B 2Z93B 4ZO6A 3VFMA 3RL1B 1ODAA 5CIPB 1ZVSA 4I5BB 1JIBA 2EIBA 3T1FB 1VERA 3CDFA 3AS1A 4PJIE 1S9VA 4QTIL 4F7CA 3CIQA 4PY8J 1Y6MR 3HS0A 1J12A 1N6UA 3WN5B 4KK8D 5GSVB 1IAOB 2VC2L 1CDYA 5I8KL 1CICB 1H0DA 1YYMH 4GKSA 4XBEL 4KMTH 3ZTJG 1FC1A 3VRIA 3OGCB 3L5XH 1PKQA 1X4ZA 4Y5VA 3NCJH 3SDDB 2W59A 3TWCH 1I8LA 2DLIA 3FT4A 1SYSB 4IHOA 2QV2A 3IDGB 5T5FL 1MJUH 3BKMH 5DUMH 4MD4A 1B6DA 5KAQF 3O3BB 1MHPH 4WU7B 2X41A 4EN3B 4RDQF 5BZDB 4KTYA 4PJEE 1YY8B 2JJTA 1NLDL 4PRAA 3TA3D 3SPVB 3MV9A 5E99L 3MYJA 1RV6X 1FNAA 5MEQA 3RUGE 4E0RB 3ARGA 5AWNH 5T1MB 3WSQH 2I5YH 2W0KA 4NCDA 2Y1VA 4R4BA 4JG1L 4O02H 5FDWA 5GZOD 4AENB 3NPSC 2PTUA 2XWTA 2VR5A 4PB0L 3G5YA 3K2UL 3EZ8A 5CEYA 3SKMB 2R0WL 3GI8L 4KROD 1ACYL 2D7QA 1YEJH 5ICYA 3HI1B 1N3NA 5HGAA 4IOIB 5EO9A 5FM8A 1YPZE 1S9XB 1A6PA 2IPKA 2YXFA 3MNVA 1MFBH 4XPGL 1KJ2A 4NQDE 1KCUL 4A6YH 4H20H 1JHLL 2NX5A 2YBRA 2F8XC 3WO4C 1GC1L 5AD0B 3ZHKA 5F6HI 1YYLL 5HGHA 1R3KA 3L3KB 3JV6B 4FZEL 4HK0B 1C08B 3HPJB 3DMMC 1QEWA 3DRQB 2L4OA 2VLLB 5D72H 1J8KA 3A6CL 4AT6B 3SDDD 1AGFA 1KCLA 3BP7B 1RUAH 4PJDA 4HJJH 3T0WA 2ESVA 4Y16D 4JR9L 1HHGB 2UWEB 3HC0A 1UQSB 1FGVL 2XKNA 2I24N 4PG2A 2BY3A 2DKSA 4JFZH 4PJ8A 1YEGH 4ERSH 2WAHA 4HKJA 5IV2A 1AHWC 1UZ8B 4J4PD 3HNTH 4Y5VC 1I9EA 2ZCLL 5EBWB 3FN3A 1XCTA 3LH2H 1BD2B 4LSUL 2XPGB 3T8XB 1T21A 4XCFH 3TP4A 3HE6B 5EUOA 5T5FH 3MLUL 3WUZA 2F19L 3B5GA 1UYWH 4HC1H 4LSQL 4EI6B 1IC7H 2FNBA 1O7VA 2F74A 4EQ2A 1A4JA 3HNSH 1IILE 3VH8A 3SHSA 4I0KA 1A6ZA 1Z0MA 3VXUD 1MJ7L 2RFXA 4J12A 2FX8H 4LP5A 2WK2A 4Z7VB 1J18A 1QTYT 5GGQH 1S7QA 4D3CH 5TDOB 1ED3A 1BX2B 2AW2A 1FBIH 2DQUL 3L6FA 5ADOH 4NKIH 4PD4K 2R0LL 5IB2A 3DO3A 2ZOKA 4ZUSA 1A6AB 3TBSA 2HN7B 2ZWLT 1JJUA 3BPCB 1RIHH 3CC5B 2FZ3B 4DGIL 1EGJH 3FRUB 3MRHB 3QFJE 2D31B 4X5WB 4P2QA 1FFRA 4P5KB 1UXWA 4HUWB 3RAJH 4L8SA 3EJJX 4F33A 1ZVYA 2YD3A 3E6HB 5FYJL 4G8FA 2YD7A 5IT2H 5HHXL 4ODVH 1GHFH 1KLGA 4NZUL 3NFSH 3O8XD 5BCAA 5DSCA 9CGTA 4JQVA 3RTQB 1SJHB 4U4BA 4G9DB 1ZEAL 2ITDB 3MJ9L 1NGWA 4YK4C 5K9OB 1A02N 1GRWA 1PG7L 3P40A 3DPBA 4OLUL 1FNSH 3FQXA 1F6FB 5BVJA 4Z76A 4LMQE 5DUPL 1CXFA 2DQFB 4JFFD 4XXDA 3M1BA 4FZEH 4IDJL 1I1YB 2EDQA 5SWZB 3N0PB 3M1BB 2GKIA 5E56A 4X99B 3OZ9L 4D8PB 4EDXB 1JGVL 5BVJB 4MQ7B 4KHTL 4AM0A 3TT1L 3TBYA 5JXAH 3PL6B 4NZDA 5J12B 3S34H 2EZ0C 4U0RB 2VZSA 4JDTL 3LKSA 4JAMB 3DBXA 4CVXB 1NBZA 1ZOXA 3KPNA 4E41D 1HE7A 1IEAB 2RCSL 3R0NA 5AG8A 1AD0A 1MPAH 3WFZA 1A7QH 1DBML 3L5JA 3MGTA 2XZZA 1VSCA 1EBPA 2ADFH 3K8MA 4JB9L 4FQIL 5D1XB 1SBSL 3TVMC 4L3ED 4O5LH 4M62L 4EUPG 2GSIA 4O00A 2VZ3A 3G5ZA 2VB5A 5HYEA 5IB5A 4B7LA 3HRZB 3NBNA 5EUKA 2DTML 1KCRL 4MA1B 4QXUL 2H1PH 3GEWB 4FQXD 3L3GB 5SWZD 2NY1C 3CK0L 5ANMB 3EOAA 3VH8B 2IAND 4PJCB 1NCAL 1DSFH 3GFUA 1QSFD 1Z9MA 3HMXL 3DO7A 2EE2A 5D96C 3G6DL 1KBGL 1UADC 2BVYA 4HIXL 3MO1A 5I16A 2C1PB 3PL6C 3DO7B 1A3RH 3CXHK 5IFAL 3L5IA 1T21B 4HK3N 4OCRL 4WW1A 3QIUC 3WHE1 2DDQH 4K07A 2VN4A 4WI5A 1VKXB 1AI1L 4PJ9D 5HHOD 1CGYA 2CH8A 3NCFB 2FO1A 2WM0A 3STBA 2D7TH 3RJQB 1Z3GH 1TQBB 1OP9A 1YEKH 3AUVA 4NO0A 1BBDL 3EFDH 4I0PD 3VXSA 4DQOH 3DX9A 5DJCB 2H32H 2DAVA 2ZCHH 3BGMB 4PJ7F 2VIRA 3C5ZA 3MR9A 1AXTH 1U8MA 5GGSB 3VRLE 4QHUB 4UV4L 1VCAA 4P0DA 5E4EB 4ZPTA 4HIIB 3TJHD 4V1DB 4PB9H 4M1DH 3MRQA 4P4KA 1OARL 1M1SA 4POUB 1JYNA 5DA0B 2NY1B 2GSGB 2R2HA 4XP6H 3GMQA 4HFWA 4JZOB 4YDVA 2HKHL 3MRNA 2XWJA 3OMZA 3I3EA 4ZAKD 1U3ZA 1FVCB 1IE5A 1NMCC 2RIKA 4QWWD 1B2WH 1CGXA 5I8OL 4XAWL 4BYHA 4X99A 3NCEB 3G5YB 4NNPL 4KMTL 5DQ9B 4HWEL 5HHMD 3TIDA 4K3EL 2WZPD 4N90E 3TT3H 4DOHB 4MAUH 5DD1L 1MFDH 4Y19B 5E5MA 5GJTL 4CGTA 1J10A 4HJGB 1R24B 1PKOA 4XP5H 4C83B 2VDKH 1FYTD 1TJIH 2GK0A 2B0SL 3H9HA 5DJZA 4E0RA 1U3HD 3EFFB 2C4FT 2OTUB 1Q0YH 2DQDL 3MV9B 3V6OE 1IVLA 1EX0A 1F6LL 2AXGA 1XGTA 1KLGB 3FOMA 5IR1A 3QUYD 5FYKD 2NY1D 4PV9A 5FA3A 1MIML 2ZPKH 3F12B 3QUYC 4Z0XB 4V1DD 1RZJC 1ZAGA 2NY5H 1T0PB 1H8OA 1I8IB 3HN3A 4ESKA 2NTSP 5IESH 3LEXA 1OF2B 2X89A 3SO5A 1MJJB 4XPBH 1MAJA 4PGDA 4M5YH 2VRAA 2HFEB 4HWBL 4OZ4A 1SMAA 3GIVA 1WUNT 3QISA 1HSBA 1T20A 5KVEL 2ZSWB 3ZKMC 3W0WB 3RKPA 4OD1H 2MOVA 3PJSA 2ZJSH 2X70A 1T04A 1EGJL 3GGWB 3R4DA 4F57L 3NH7L 1CFTA 4JANA 3CZFA 1A4JB 3CDGB 5ESVB 3I84A 1YC8A 4F3FA 4W4OC 3RGVD 1V3JA 4LEOB 4BQ6A 5E5RB 1PJ9A 3BYYA 5DURB 2WP3T 3REWB 1ZTXH 4HF5L 3DVGA 5CBEB 3DXAD 4JRXB 1INQB 3IDNB 5EU4B 4UNUA 3IVKA 1U3HA 3LN5A 2CIKB 3UYRH 1E4JA 4MAUL 4BUHA 2WANA 3DYMA 3JWNC 4HKXB 4GAJL 5C07B 1HXMA 2EO9A 2HTLC 4OFYA 3C9NB 1DBKL 4OLUH 1MCEA 2IAMA 1TCRB 1BF2A 1NCCL 4NIKB 4O9HL 5JNYA 4RMRA 1F3RB 3HE7C 1YPZF 3VXMA 5GGRA 5J11B 4X9BA 1OGTA 2BJMH 4WHTB 5D93C 3JZ7A 3MRDB 3BJ91 3F7YB 3QDMB 1MCBA 1M71A 3LKPB 4OTXL 5HI3C 4XGZA 2J8UE 4XNZC 1KN2H 5IHZA 3QA3B 5MI0B 1NCUA 2O93L 2X4NB 3P77A 5ICZB 2KQMA 2VXUH 3LEVL 5I15H 5FYLH 4X5XB 1M4KA 3DARA 2H6PB 5IK3A 3RWFB 3DX6A 4TVSa 4AEIH 2XT1B 2P8PA 1U42A 5GRJL 3DYOA 2UVEA 4GG6F 1J7VR 2V2XA 5C0RL 4K23L 1U41A 1JGDB 2DQHL 5EOQH 1FFPA 4RFEA 1W8NA 1I8KA 1X5GA 4GXVL 3MLWL 3TBVA 4XCYA 5GGTL 2ARJQ 3NH7H 2XWTB 4JZJA 2J8UA 4GW5A 4TTGA 1G7JB 1P7KA 3DRTB 4M62H 1RUML 12E8L 4OFYD 1VEPA 4IIQA 4X98A 2FD6H 1IRAY 5ALBL 3AY4C 5FAAA 3X14B 2VDQL 1ZGLP 3D3VB 4BH8B 5SX4I 4PJXB 4ENED 3EJYD 2D2OA 3BKCH 3UJIL 1U8OA 1FO0A 4PRBB 3ULVD 5CJOL 4UOW0 4PJAA 1FQ9C 2R2HB 1GZQA 2Z35A 3K8LA 4U1NA 3D18A 2NY6C 1V3MA 1NDMA 2YS4A 2YD6A 1NUNB 2DIAA 4XNZB 1R5IA 2EYTB 3FB8A 4Z7OF 5LWYL 4FABH 5C3LD 2AQ1A 3GI9L 5L9DH 3PWPE 4LPTA 2IJ0C 2YA2A 1QBLL 3E2HB 3VXUE 4XCCL 3QPQD 7FABH 4RSVA 1VGEL 4RFNC 3A67H 1MH5A 2DICA 5TDNB 2BNQD 4MJIB 5I30H 3WS6A 4PJXE 3PABB 5FGBA 4BH7A 2XA3A 4OZFB 4YBQC 5J3HD 2D7PA 3T2NH 3QHTC 2A9NL 4OKDA 1T03H 4L4VB 5D9SA 4R7DB 2LV4A 1BM3H 3MUY1 1Q8MA 3QR2A 4K2UL 5DUBA 3JV5A 3T1FA 5CHNB 3O3EA 4BKLB 3KGRA 4X6EA 1OVZA 3MGOB 2APVA 3FB7A 3KPRA 2RCSH 2Y07L 2X4TA 3DVNB 4M7KL 3CFBA 5C0DB 4Y4KA 1ULVA 2QR0B 2BZDA 3PIQA 3BW9B 3GUTA 4ZFGH 5HGDB 3R1GH 3WIIH 5I73B 12E8H 2A6KA 4EZMA 5FYLD 3L3GA 2YRZA 4HWZA 4ODBD 5BJTA 3GSVB 2IBGA 2ZG2A 1FNGB 1FIEA 3L5HA 2VXVH 1V05A 4JPVL 4XAWH 1P1ZB 1XIWD 2ADIB 3PWLA 5CD5C 5GS0D 3AAZA 1MCQA 3MCLH 1OM3L 4J3VA 4P9HH 1D5BA 3N1MC 5FKAA 3V7MA 2A74B 4NWUH 2VDNL 3C5ZC 2XKSA 2HMID 2VERN 3UTTE 5ESQB 1QFWL 3JTSA 4PJBE 1H3UA 1CFBA 3TA3C 3FN0H 3CX5K 4FMKA 2JK5A 5D1QD 1WISA 4NGHH 4QT5A 1TVHB 5IFAH 4Y88A 5I1JH 3WJLA 1FDLH 1H5BA 3TBWB 5JQ6L 1NJ9B 4MNHB 4R2GC 1T66D 3O9WC 2Y4SA 1AGCB 5DJ0A 1I4FA 3E0GA 5EOTB 5BXFA 3DROB 1D5IH 3ME0A 3GJFA 4P3WA 4PRNA 4DN3H 3T0EE 1F8TH 5IMMB 2EDEA 5IFHL 5DHVH 3OWEA 5FUZH 3N1PC 5JW4N 1D3CA 3FO1B 3H9SE 5C0AB 3BUTA 4JM2D 2AJ3A 4RAUB 3MRMA 2IG2H 3LKQB 1B3JA 5DVMA 2NTFA 4BZ1H 1TVBB 4LLUB 2JB5H 5F96H 3VRLF 5JW4Q 2A2QT 1N6QH 4Z76B 3ABZA 4OFIA 4DZ8B 3I6GA 2Z4QA 5KANI 3FB6A 3RX5A 3RWDB 4RISL 5F3BB 3LKQA 3T65B 4F57H 3BIBX 1TTUA 4NQVA 1HXYA 1F2XK 3FFDB 2NY5C 3AU1A 1WCQA 3RWGB 3TA3B 3O6KH 2VXVL 4JFDA 3QUZC 4WV1C 3UDWA 4M6NH 4PRPB 4GAFB 4XBEH 2C3VB 3RWDA 2HJKB 1QVOA 2FJGA 4C56E 5F6IB 5FM5M 3GMOA 4Y2DC 2V7NA 1U2CA 3BHBA 5EO0A 5JIKA 1AO7D 1PLGL 2V5MA 1C12A 1G7LA 3OKNB 5HGGS 5ICXB 1CD8A 4HKZA 4HGKC 2HJKA 2B2XL 4JO2L 5C6PB 4MQXC 1WC7B 4KHTH 2WNGA 5DJYA 3BT2H 2RHEA 3GBNH 2PCPB 4JCLA 3K0WA 5TH2A 4NQED 3LHPL 4O2FB 4RMSA 4YX2H 3WJJC 3ARBD 3FB5A 4HPOL 1G1YA 3T65A 5JW5A 4IMLA 3ESUF 5EO1A 3OJVC 5B39A 1JF1B 1WCBA 5DZOA 3RVWC 5C09D 3BWAA 4EI6A 1A9EA 2AJXH 3K80A 1GGBH 1XF4A 3IJHB 3RA7L 3VFRB 3UBXA 1Q9WA 1UFUA 3IFPB 3S7GA 1XCTB 2H2PC 3U7YH 2X9YA 3ARXA 5D2NB 3JTSB 5ESQA 4MQSB 1X5YA 1XF4B 4L1DA 2ARJA 5C08D 1JWUB 4P4RA 1B4JH 5DS8B 5KVEH 4PJ8B 5FA4B 3RWIB 3AAZB 4LBEB 4XNUH 5BQ7A 3ZE1E 2VLKE 1T5WA 1PDKA 4G43A 3BQUB 1UC6A 5JUEL 5DD6B 3S4SG 4PRPD 4I3GA 1Y18B 3FRPG 4OKVA 1T5WB 3VFPA 4DTGH 1JPFA 3DVNA 2YBRB 3OJ2C 2WV3A 3IFLH 3OQ3B 2GIYA 2VJXA 5D70L 5LBSH 3RGVB 2R2BB 1RZ8B 4PJ5A 4OLYH 3U4BL 4D9LH 1P5VA 2ZG1A 3RVWD 4JHAL 3HMXH 4WFHD 3B3IB 4GH7B 1JYXA 1NGZA 3HI1A 4XNMA 4N9GA 1DEEA 4GLRI 4NJAH 2Z9TA 1GZPB 4FFZH 1TLKA 5KZCD 2FSEB 1GVIA 1OL0A 2R4SL 1AXTL 4YPJA 4K7FB 4XX1G 3C08L 1EGJA 4M8QB 4DZ8A 3P4MB 1KGCE 1MHHB 1MCRA 1J0JA 3HB3D 1Z3GL 3ET9F 1HYSC 2F54A 1YMME 3VXNA 3ZDXF 2FX8L 1FORL 3DX8A 4L4JA 1KIQA 1U92B 5D96B 5GGVH 3DMMA 4NDMA 1MQ8A 3D3VA 3MMEA 4LASL 1EMTL 4S1DC 5D7JB 1X5JA 3GJFB 4EUPB 4ZFFB 1RIHL 4PRIE 1FL3A 3T3ME 2O5YH 4ZFGL 4OFVA 3EOTH 1OP3H 3LSOA 3O0RL 4XPAL 3T3PE 2V7NB 1MFAL 2W9EL 4WFED 1N0XH 4F7PA 1DBJL 3CFKB 1ITBB 3UROR 3SE9H 3U7YL 2R1YB 4YFDB 5F1SA 1ZKAA 3IRPX 1G9NC 3H0TA 5C0NC 1KB9J 3ISWA 3L7EA 1TQBC 3ZKXC 4KZEL 1FL6A 1QR4A 4ZD3L 3VGBA 1ORQB 1IAII 2FGWL 4WFGD 3WJJA 4JY5L 5KS9E 5KTEL 3V8OA 2MKWA 2P48B 5C6TH 1OTSC 4GUPA 4ZUTB 1KJVB 1HQ4B 2VAAB 3GKWL 3I6GB 1LK3L 4MLIA 3HG1D 4I9WD 2VDRL 4HUUA 1QRNE 3PF2A 4JFFB 4IIQB 4X98B 5GS1A 3BOVA 4UINH 2FEDD 1P1ZA 1R0AL 1MLBA 1T83C 4MNQD 1U58A 2XTJE 3C9NA 3DX7A 4O4YL 2DJUA 3QFJD 2E7CA 1C1EL 5C07A 2G5BA 3O45A 5DJ2B 3OZ9H 4KJQD 4NUJA 4Z78B 4WV1A 1OD9A 4YO0A 1FAIH 2HVJA 1XR8A 1KGCD 1J9CT 1U8JA 5K33A 3C87A 3IKCA 5CLTA 2BFVL 2W92A 3DV4B 3ARDA 4MNQE 1EAPA 1Q0YL 4ISVA 2DM2A 5GS0C 3IDJA 5GGVL 1UZ6E 3VGGA 4Q9QH 4JZJC 1P4IH 5GGRY 1MPAL 4EQ3A 3WUWB 4EJ1C 4P2RD 4WUUB 1UB6A 3HMXA 3KPRE 3RWHB 3KLAA 3WNKA 5EC1A 3RQ3A 4U6VL 1FO0L 1FSKC 5CILH 2Y23A 4CAGA 4NBZB 4KKCC 1UH3A 4ALAH 2ED8A 1EHLL 4Q6YA 4N8VG 2OXHA 4TOYH 5GGRB 3S96B 3DSNA 1C7SA 4MCZB 5T3XE 3QWRD 4HWBH 2Q1EA 2P44B 2UUDH 1UJ3A 5AEAA 3QG6A 5CEXA 1Q94A 5FUOH 3S37X 4EI5C 3PGDB 2VZ1A 2V9TA 2AQ2A 4FRWA 4CU7A 2NY2D 4NQUA 5CZVL 1OT1A 2CDEA 4LEXL 5E8PB 1ZT1B 2Y36L 4GQPH 3V0AC 4WI8A 3UZEA 1KLUB 2XA8L 1I8MB 3UTTB 4OB5H 5B8CB 5JIIA 1Z0NA 2G60H 1HEZA 3CH1A 3GSNA 3CMGA 3LEXB 4UT7H 5D6CA 1T1WA 2NMSA 1FVDB 2F15A 1RZIA 4JFQB 3REVB 4ELMF 1BD2D 4KRPB 4N5UA 1LD9A 3Q3GA 5IMLB 4JG0H 1G7JA 5FA3B 5HI4D 3RX8A 3BSZH 1D6VL 5I8CA 2UVFA 4R97C 5IVZB 1MH5B 3GBMH 3WNLA 3QUKA 1HIMH 4AEHL 1KPRA 1NCDL 2DM4A 5EU7E 4ORGB 2R8SL 1IZJA 3L9RA 5GIRB 2V5TA 3Q6FB 4WHCA 1P7QB 4KAQH 4U31A 4ZOBA 5H2BB 5T1KB 5D7LA 1W8OA 2HG5A 4Z6AT 4KI5E 2QQKH 1A7OH 1TITA 3QQ3B 5D8JL 3MLXL 2Q20A 4R90H 3UBXG 1NMBH 1VFOA 2D7TL 3GSRB 2VDQH 3OR6B 4RA0C 4O2CB 1S7UA 5I15L 2XZAH 4U2YA 3CVHL 3LKOA 4GS7C 1MCCA 3WS6C 3V6ZA 4GAYB 2BVUA 1KCUH 4NWTH 4UT6L 1UCTA 2BP3A 4R96A 3BE1L 4LOUC 2E6JA 3O2VH 3P4LA 1WVZA 1PYWB 1NC4D 1D9KA 3LRSA 4ZO8A 5BS0B 1B4RA 5JOPE 1N2RA 1ADQL 5CILL 4AG4H 4QY8B 3SGKA 1KN4L 5C0GB 1OP3K 3I2CH 2JELH 4AH2A 3CDYA 1CGUA 2CQVA 3K7UA 2HH0L 4D0DB 3BKJL 3QDAA 1EEYA 2VSDA 5FKPB 1DLHA 5A16A 4ODHH 1DVFC 4JRXA 1QBBA 5DK2A 2V7HB 2K7QA 5KVGH 1NUFA 3MBEA 2AJZA 2C7UA 4Y16C 2MCPH 4P49A 5E08L 4OZIB 1IQWL 4ODXA 3ULSB 3BJLA 3VWKD 3T4YB 2DWDA 4TRPH 2EXYC 4HIIA 4F2MB 1LNUB 3I9GL 5D1QB 5IHZB 5EUKB 2PW1A 2Z92A 1PQZA 5TPWL 4ZNCD 1OB1B 1B0RB 1K6QL 3QDMA 4WTWA 2VDKL 1NC2B 4NP4L 4PLKC 1UA6L 5DJCA 3HFMH 4GS7B 3IFOB 2EC9T 1X9QA 1WAAF 3BPNC 2M1KA 5KVMC 1A2YB 4GG6A 3RWHA 2IFGA 3OAZK 5M7QA 4JPWH 4S0SD 3EGSA 1KTDA 4OT1H 3F5WA 1JGEA 3OV6A 4K3DH 3JWOH 1CD0A 1DQMH 1IQDA 1T1ZA 4XMLH 1N0XL 4IMKA 3LKSB 4JAMA 2MKLC 1JK8A 1LDPH 3U82B 5FYLE 1WZMA 1A0QH 2K9UA 4FTVB 3KR3H 4ZSOA 1AC6A 5MEND 4G9FB 1WBYB 1KIPB 3FO0L 2MPAL 1YYML 2Q6WB 2Q86A 1D5XB 1GPOL 2G9HA 1CR9L 2VITA 4MA7L 3UAJC 4GJTB 4NBXB 3D9AL 4L4TD 3HG1A 4NQSB 3AGVA 3CVHA 3QH3B 3GIVB 1A7RH 2KH2B 3MACL 4S1QH 5LJYH 1OM3H 4JFDE 1U3HC 2FJFB 2H9GA 4L1HA 4WWKC 5F44A 2R0ZL 4PRDA 4PV8B 4JRYB 3C60A 2YHGA 5DDHB 1L6XA 1EHNA 5DMKB 3MGTB 3WXVH 1OAXH 4PGEA 4HIHA 1FVEA 4PY7A 1G0XA 2E8YA 4PJGE 2Q86B 1IEAA 2IH1B 1OTSD 4NP4H 3V52L 4X6FA 4XXDB 2WSKA 5F72S 1DP0A 1WIOA 4PP1D 1CLYH 3O9WD 4MAYD 3FQXB 5DMKA 4H0IA 3SBWA 3OTTA 5LXGH 2DL9A 3C60B 5D7JA 4WTZG 4EUPA 4ZFFA 5MP6L 3ESVF 2H26B 2HFGL 3HE6C 1HSAB 3TH3T 2GK0B 1JBJA 2VQ1A 4PY8I 4DW2H 5DD0L 5CCKL 2D3VA 4RA3A 2YRPA 3NAAH 2KBGA 4HT1L 4WEBH 1YNLH 4KTEL 4M1GL 4KDTC 4JDZA 3WIHH 3LKRA 2NQCA 4P4KD 4UIKL 5DT1L 1MIEH 5JXED 3IGAB 5ITFB 3RDTB 1BHGA 3FCTB 2C26A 4OZIE 4OZGF 2F5AL 1YEIH 4GBXB 3VGEA 1MI5D 3D39A 2MHAB 5KVDH 2R0WH 5HDQL 1XGQB 4H20L 3GMPB 1MCSA 1LGVA 1BQHG 5D7SH 4KGJA 4XH2A 5IWLC 3VI4F 5C71A 4Q74A 3T8XA 1FCCA 3D85D 4J1UB 1PQZB 1VENA 4YH6A 4P46C 4U1KB 1IKNC 1NUDA 3BPOC 4J23A 5BV7C 4L8SB 5ECJE 3MRCB 5F71A 4F33B 1TCMA 1N59A 2VIRB 1BGXH 2C7UB 5CD3B 3D69A 3C6LD 2HT3C 2HJLA 3BPCA 4XCCH 3RTQC 3UC0L 1RJCA 1JUFA 2D7NA 4DVRH 4P57A 1SEQL 4OKVB 2MSPA 1YEHH 3CFCL 2W07A 5T33L 4LCIL 5HVGB 4XWGH 2EEDA 2JB6A 4U1SA 5FB8A 3VFVB 3EYFA 4XCEB 1JMXA 2HRPL 2ZUVA 4KXZH 1RIVH 2WQ8A 1UYWL 3G5XB 3U0WL 3MV8A 4GG8A 2EH8H 1HHHB 2J88L 2PTTB 5I74B 4GBXC 1UM6L 2IPKB 1ZS8B 3BEWA 3S88L 5CLWA 2X4UB 3BFOA 4BQ9A 4AM0B 5IVXB 4RGOH 2XZQL 5I1EL 5ICYB 1T0NA 5EDXA 1A7NH 5J6HB 3NA9H 4XX1E 4PR5A 1HHJB 2N7BA 4Z7QF 2YD8A 3HNSL 5ADPH 4K7PH 1YQVL 4TOYL 1GSMA 2R2EB 3CVIL 1K8DB 2DMBA 3Q6GH 2UY6A 4N1HB 1NCBH 2VZOA 1YY9C 4NN5B 4NPYA 1CZ8H 4PG9B 5KSAB 2GSIB 4LVOB 4P9HL 4ODWB 2QSQA 2K7PA 4G5ZH 5K9OA 3HZMA 3B2VH 3TVMB 2G2RB 4DTGL 4JRWA 3QIBC 1R3KB 1ZT7A 2GQHA 3L3KA 5I19H 3HPLA 1NCWL 3GSRA 1YNKH 5EC2A 4X6FB 5C0GA 2NX5B 4OI7A 2X10A 4K8RD 3KPTA 5J1AB 3P30L 4I2XB 3CPLA 3AROA 1NBZB 4ODVL 1IL1B 1FAKT 2M26A 4PP2B 4M7LL 4L29A 4JM2A 5CEZL 1JFQL 1N4XL 5IROC 4OLYL 5F3HA 3LCYA 3DTXA 5IF0B 4LGSB 1KUMA 1VGKA 3CVHB 1JGLH 2NY5L 3KJ6H 3LQAC 1BP3B 3WN5A 2B20A 4AEHH 3D87B 1IM3B 2V17H 3CFDA 5AZ2H 4V1DE 1A6ZB 4QKXB 4OF3A 1QNZH 3WO3B 2VISA 5T3XD 5D7LE 4M5YL 4NQEB 1M7XA 4MCYA 1RK0A 3STZB 2XKUA 3GMRB 3OGCA 4XP9H 4R4NC 3VFMB 3QDGB 4U6HB 4MAYC 1JNLL 3PP3K 3KDMB 4OD1L 1DVFA 2EDLA 1F4WL 3IJYA 4MDIA 5E6IB 1FV1A 3HS0B 2AEQL 2VDMH 4OZGA 5IEKA 4R2GD 4BSWB 2DJSA 1SBSH 5E0QA 4HUWA 1UJ3B 1ZHBB 5C0BA 4OAWA 4MNHA 1YEJL 3DV4A 2EDJA 2Z93A 1ADQH 2X1PA 1PKQB 4U3XA 3L3OB 5E1AA 1CE6B 1QBAA 4QHMB 4RGND 4C4KT 3HHRB 1MFBL 4XPGH 5KSAD 1CIUA 1WZ1L 4FQJH 5EC1B 4YDJA 3GKWH 4NRYA 3DIFA 1UEMA 5BW7A 5EORL 4WUUA 4OUOA 4PJHE 5E9DA 5DR5H 1U9KA 3PV6B 1FJ1A 5KG9A 2AKRA 3HC4L 3ULSA 1A64A 3B2VL 3W39A 3PWLB 4ZNEE 2I07A 3IF1A 4LVNB 4F8TA 2YD5A 5IQ9B 3V52H 1CFNA 3ZKXB 4F7TA 5JZ7D 1J87A 2DI7A 5KN5B 3LIZH 4G8GE 2V17L 3IAPA 1Y0LA 3WFBL 1RJYB 3EKCA 5H35B 4WFEE 1CLOH 3OKDB 4HC1A 3C2AL 4LCWE 5DA4A 1AP2B 3MQIA 1ZA3B 4PS4H 2D03H 4NQEE 3PNWB 25C8H 5L7XL 3O4OC 1TENA 4QNPE 4LVHB 3RWJA 3NFNA 4P2YA 3KPRD 5J6GA 1REIA 1RURH 4WGWB 1DLFH 5GJSL 1MJ8H 3MLYL 2W0FB 4FP8H 3RY6A 3TNMA 5F7EL 3DRQA 4JO4H 3GMNB 3LDBC 1NUGA 5EUOE 2O5XL 4KU1A 1E4WH 1UWGL 15C8L 1FL6B 1BFOA 5AD0A 4GKZA 4MHHI 1OOAA 3KPLB 2X4OA 1JP5A 2UZYB 2A73A 1DN2A 5GIRA 1K4DA 4F7EB 1WJ3A 5GZOC 3LSOB 5HBBA 3MRJB 2JCCE 3FB8B 2XQBH 5EOCJ 4HGWB 4JO1L 2A6JB 3D9AH 4LVNC 1BQHA 4HZLA 1P53A 5E5UB 4GKZB 1P9MC 3EJYC 1HDMB 1I3RB 2PF6A 3ULVC 2B1HL 3MLUH 3U6RB 5I6XC 3L3IA 5EPMA 3PDGA 3MOAL 3SDCB 4RGNC 1SEQH 5C0JB 3QNZB 1ZHLB 1EEZB 5EN2A 2NY4B 3ROLA 3LV3A 5FGCE 5F70A 5DO2C 5I30L 2UV3A 1CLYL 1J5OH 5DMYA 1P2CA 5GS0H 3I6LD 2P7TA 1FNEA 4LFHG 3RWCB 5EU6D 3VGHA 1GL4B 4FQQA 4YHML 4OIBA 3NPZB 4JFEB 4JLRB 1MQKL 2N56A 2R9HC 5CEXB 3E1F1 5BQ7B 2W38A 3TEUA 4GRWF 1CFVH 3G6JA 3IDGA 2P8PB 4LBEA 2OJEA 4YGVB 4PJ5B 1RZ8A 5IK3B 3S96A 4DEPB 4OSUH 2I9TB 4QHKI 3EDKA 5JW4M 3KHOA 1L7TH 3I75A 4ODHL 4FXGB 4GKSB 2J12B 4JRYE 1MREL 4X6CA 3QDJD 3FQUA 4QTIH 4R97B 4XGZB 3DIFB 4PR5B 1C7TA 4N9GB 3HI6H 1EEUA 1MSPA 1NGZB 1Q9WB 5CUSL 4QRPD 4F7TB 4WI3A 3VMPA 4IOFD 4P2OD 2OR9L 3P3YA 3L3OA 2HJFB 3O41A 4X9HA 3W39B 5LVEA 2CPCA 1U3JA 4P2QE 4UILH 3PWPA 1KCSL 5T1LB 4QOKE 3BMWA 3AS0A 1ZA3A 1CXLA 4WWID 1I8LC 3OKDA 3OBAA 5BS0D 4ONHA 5E94A 4MD5A 1U3YA 3KLHD 2DQIH 5DD6A 1T3FA 3ES6A 4HJ0D 1LO5A 5CSGA 4FQLL 5KOMC 1OAKH 1DQJB 4XBPA 1KENH 3L95B 4OF0A 4XPTL 3MLRL 1JWMB 1INDH 1YNTA 1MCOL 5ISZD 3BWAB 2ICWA 2IFFH 2OBGA 4HIEA 1QSEB 5IBUB 2GTZA 2VC2H 5GRXG 5T5NF 2XQYK 4J3WA 5FUZL 4DEPC 1MCIA 2BSTA 4J7RA 3TBTB 3RUGF 3SQOL 3BD4A 2EXWC 4RFNB 4UMGA 2GFBB 3ZDYE 2HLFD 4O2FA 3ULUF 3ULUC 1JNHA 4PJEF 1O0VA 2AP2A 2J8HA 4IRZH 1WFNA 1N0LA 3QDGA 4LLAA 32C2A 5AUMA 4GG6E 2HKFH 3S5LG 3TIEA 1I7ZA 1DE4B 1BQLL 1I8IA 2BNQE 3HI6L 4CVZB 4GMSL 5EA0L 2W9DL 4HUXA 2BJML 1II4E 5F1OB 1TJGH 1I7TB 2IQAA 4QF1A 4JFHD 3V0WH 3H3PH 2YPKB 4RFOH 3HZVB 3IJYB 4HHAA 3DMMB 2LAGB 3UAJD 2Y06L 4YC2B 4LLWA 3ULUE 3U0PB 4KJWD 1HXYB 3FFDA 5F3HB 1QFWI 1BJ1H 3L1OH 2DBLH 5HGBB 3ARED 4V2CB 3A6CH 5IJKA 1KJ2L 5KSAA 4CW1B 1A21A 4LQ1A 2VLJE 2NXYB 3QI9A 3LMJH 5ITBL 2GHWB 5IM7B 2R56H 1EFQA 4QNPF 3T08A 4F37K 4G6MH 2C3VA 4NO2B 1KPUB 1N64H 1FVEB 3ARVA 4PY7B 4AK1A 1MVFA 4X9GA 5T1LD 2P5EB 1IMHC 5KSBE 2ED9A 4WNQA 3DETD 4ZTPL 5F3BA 5FUCE 1S9KC 4KTEH 3QSKB 2VTFA 3F8UB 3B9KB 1BJ1J 3HI5H 3LVEA 3OGOE 4HFWB 4HIJA 4WRLA 2P5WB 4HJ0C 1JGLL 3KJ6L 2JIXA 4MA3B 4U0QB 5B38B 1YNTB 2QSTA 3QI9C 4M5ZH 1RULL 2DD8H 4PTUA 4U33A 1A1MB 1DEDA 2F5AH 2G9HB 5HPOA 2APWA 1N5AB 4FXKA 1JNNH 3VFPB 4XPFL 1HH6B 1KC5H 1I85A 4HD9A 4I13B 4WJ5A 2XXCB 1L9NA 2P45B 1B6UA 3D3VD 2BNRA 3FQTA 3BQUA 3ZDYF 3TJHC 5I2IB 3BEWB 1CCZA 4NJ9L 4BA8A 4DAGH 4OLXL 1J86A 1A6TA 3O6LL 3N9GL 1LO2L 4Y2DD 1EV2E 3KYAA 1HZHL 1JGEB 2OI9B 5EFIB 5DD3L 3DI3B 5HI5D 2NXZB 4POYA 3D39E 2R23B 4MGXA 5ETUA 5F9OL 3B8SA 1U8NB 5E2UH 3O4LB 4UIKH 3SJVD 1R6VA 3WFCH 2QJDA 4ZUVA 2C1OA 3ARTA 4ZODA 4PJBB 2EDTA 2YC1A 1QFUL 4NQXA 3Q5YA 2IBBA 4FFVD 1JYVA 4UT6H 1KG0B 3DURB 4ZUUB 3BPLC 1Q72H 3VFWA 4XC1L 2P8LA 5FYKU 3QDMD 2V2WA 4MNQA 1DANT 1FBIL 3GK8L 4XHJD 1VFBA 4UB0L 1KPVA 4H5SB 1F90H 5GHWH 3N85L 3OPZL 5HDOA 4PJAB 4XNXH 4MNGA 3QUML 2VR9A 4XPHH 3KYKL 3S35L 1NGYA 5CBAB 3OKMA 4PGBA 4PBWD 3C8HA 3C09C 5TE6L 1EHXA 3RDTA 3GMOB 1BJ8A 1YEHL 4FS0A 4R7DA 1N2RB 4BELD 2OI9C 3LN4A 5GPRA 5BRZE 3U6RA 2CUMA 2XN9A 5J13B 4HIHB 4HBQA 2VKWA 4CMHB 2QSVA 5GRVL 3BKML 1V7NH 3AU1B 2X7LA 5TDNA 3QPXH 5GSRB 1HSAA 4YEFA 1EFXB 1BQHB 1X7QA 5K9KA 5I19L 4IMKC 4HGWA 1JPSL 3VH8G 3UYRL 4G3YH 4ONFL 3QH3A 1ZLVK 3ZLQC 1I1FB 3FCTA 2W91A 5IHBA 3ARBC 2B4CH 3SCMC 4QGYA 5J9PB 1IM9D 4X8XA 3QQ3A 1I75A 1KTLA 3BH9A 5DFTA 2RBLA 5T3ZL 3O6MH 3O2DL 2J2ZA 4LLVB 3JWOL 2BC4A 2CO6B 4Q6IB 4OZHE 3VRJB 1M71B 3KYMA 4CVUA 2VL5A 4U6TA 1CVSC 4O02L 4EIGB 2Z91B 4NN6B 1NGWB 4IRJD 3VXOB 4YHKL 4YBLB 1JGDA 1J1XH 3ZT5A 5DJAB 2YPVL 3LRHA 1IC5L 1YEEL 3FAXA 1ACYH 3DUSB 3WXVL 5F9OH 4Y4HC 2IAMB 2BVQA 2OSLB 4I4WB 3JTTA 4QT5B 3F5WB 3BKCL 4GW5B 4QXWA 3UJIH 4NKMA 3OAZH 4P5TA 1YMMA 4XP4H 1C16A 4JGJA 1QYGL 3BT2L 3CFEA 2R15A 4B7IA 4TUOB 5C0RH 3LN5B 2NY0B 5F1IA 4FTVA 5FM5O 4G8GB 2FX7L 5B8CA 3PG2A 5INCA 1A6AA 3UTZB 1IM9B 5DRWA 2N7AA 3EDDA 4NCC1 2XTJB 3MJ6A 5L8JB 1UACL 1R3JA 1EJOH 1DBBL 4M48L 5L6YL 1UCBL 3C6SB 3DX6B 3ZYIA 3HA0A 4JKMA 5D7LD 4JFDD 1FJ1B 4OD3H 3OX8A 4Y4HA 1MCFA 1KTDB 4NZJA 4Y89A 1GGCL 1Q94B 5HYQA 4ZNEA 4K9EL 4JVPA 2IMMA 4WFGE 2FATL 3C6SA 2D0FA 1KACB 3K81A 6FABH 3DGGB 3P9MB 4A6YA 2AXFB 1FLRL 5H37H 4GMSH 2QLVB 3T04D 4OLVL 1A3LH 1NMCB 1Z6JT 1A4KA 1MWAA 3WFDH 5JOFB 4Y4KD 4K3JH 3PHQB 5CJOH 2CJUL 1A3QA 1D5MB 4YBLC 4EBQL 5DTFA 2LU7A 1VADA 3EYVA 2AGJL 2E7MA 5JO5A 4JKLA 4KHXH 3ARBA 3QPXL 5FM4A 4N0UE 3VWJC 1TQCC 1FGNL 2FIRT 2CKBH 3ARDB 4JFFE 1MFDL 3S3JA 3PABA 3RAJL 1BGXL 1FIGH 2CXGA 5GGUB 1A4KB 1MWAB 4RIRA 1R3HB 2FGZA 4LEOA 4AQ1B 4P2OB 2ZUQB 3V4UH 1S7XB 3MV8D 1FFOB 3LOWA 2CR6A 1WFUA 5DJ8B 5D1QA 2EYTA 2X70B 5EOCL 1IM3A 1U58B 2XRAL 1UJ3C 4P99A 2HG5B 4NUGH 5ALCL 4R26L 3RU8L 4R96B 4G9FD 4Q9RL 5I66A 3ILPB 2B5IB 3GNMH 4LNRB 3L7FA 3CCHA 3VD5A 2Q3ZA 4G8GA 4JM2B 4WUKH 3SGDI 3CDCA 4IJ3B 5I1EH 1A8JH 1B88A 4YUEL 3VGAB 2C3WA 5FV1L 4LCIH 1QBMH 1D5ZB 3MJ9H 4R0LA 2ADJB 2VWEC 3PDOA 3QULB 2DOCA 3Q6FA 1PG7X 4JZJB 3MLYH 4FP8L 4K8RL 2V5SA 5L2KE 3QPQC 3BZFB 4E42B 2J88H 3RIFK 1JGUH 1JRHL 3TYFA 1N5YH 4MWFB 4GW1B 4U1LA 3MUGB 3QIBD 5EZLB 5JDJA 5FCSH 5A2IH 1EERB 3LKOB 2VMFA 3KWWB 3NTCH 1S7UB 4PBXA 4JQXC 2ESVE 4Y7MA 3TJEH 4JJHA 3GSXB 4ZXBA 5C3TA 1IGJA 3TIDB 3S34L 4O5LL 4OFKA 4EI5B 1LK2A 3V4PL 4L3CA 4U6XB 2JCCA 3MROA 1NMAH 3VFWB 5IW6A 3EHBD 5L2KA 4OJFH 1IBGH 4UINL 2OZ4L 5CEZE 3U1SH 1RVFH 3UTTA 1XGUB 1JCKA 1DBMH 3DX9B 1I7UB 5I1HL 3BAEH 4ZUVB 4Z7WA 3IJSB 4JM2C 1MQKH 2O5YL 3VXMB 5LQBL 2I25N 4NKDB 2WMPA 3GRWH 4KMLB 1T83A 4P4KB 2AEPH 2H2PD 1RQ5A 3DYPA 3J8F7 3WUWA 4XCEA 3EYFB 5LGHL 4ZOCA 4ONGL 4JY4A 2GT9B 43CAA 4X80L 1RJZA 2ADGA 2DTMH 3TCXA 3PGFL 3PHQA 5CBAA 1JUFB 5CJQL 4L4VD 4M3KB 5JOFA 1V3KA 5CS7A 1JZ2A 1INEH 4A6YB 2ID5A 4MNGB 4APQD 4PTTB 5DXWA 2FWOB 4LSTL 1J5OL 1G7QA 3BO8A 1HH6A 3AXLA 3IDMA 5JPMB 3QG6B 4B0MM 1U8LA 3RKDD 2Z8VC 1NLBH 3H7LA 3V7AG 2QBWA 4S2SB 2Z31D 1CFQA 4N0CD 3V7AE 8CGTA 4JRXE 4LCCA 4M1DL 5DGQA 5TE4H 1MJJA 4RX4A 5IUSA 4GBXA 4EDXA 1GPOH 1HNFA 1RU9H 4D8PA 3V6BR 3TO4D 5EORH 3BH9B 4P4KC 3NA4A 2R1YA 4U1JA 3LKRB 4UQ3A 3ZO0A 1KEGH 2DQHH 5EOQL 4RMUA 5JUEH 5L88L 2E7LC 4S1QL 3KPNB 4KRPD 1I1FA 3GDBA 1XGTB 3E2HC 3VXRB 1BPVA 4LHUD 3SQOH 4GMTH 1AY1H 3VFSB 4M1CC 5EO1B 2VQ1B 3VI4E 1HCFX 4GUPB 3VXOA 4CDHA 1OARH 3O4LD 5BMFL 3SE4A 4WDIB 5JOPD 1BZ7A 5EBLB 4ONGH 2IMNA 4XPTH 1UKQA 2EH7H 2VN7A 4OCNC 4Y16B 3MODH 3BGFB 4OF5A 2BC4B 5E5MB 2GTWB 4OZIF 3JTTB 1GH7A 4G8FB 3AFLA 1TMCB 4PYGA 4YIQA 4PREA 3S8WA 1HHKB 2I27N 3STLA 1A47A 3BAEL 3MRFA 3R8QA 1MFCL 4P3DB 4IRSC 4L8BA 4QRPE 5HHPA 4HDIA 5D7IF 2VL5B 4UT9H 5D8JH 5HVFB 5D93B 3WE6A 2X7LB 3WIHL 3CJJA 5JOEA 5LWYH 3FO9A 3SDAC 2HWZL 3WFBH 2CRIA 5DT1H 4N0YH 4RZCA 4LLYA 3LN4B 3MRGB 4HKBA 3DI2B 1CE1H 1YN7B 4FQ2L 4O58H 4QXTA 5DHVB 5JLZB 1VGEH 3X3FL 4AIZA 1EO8H 3QQ4A 2JJSA 5C9KA 4P2QB 4X5WA 2YN5A 3QO1B 3UMTA 3C5ZB 3HUJE 3MR9B 4XAKE 3BGMA 3UYPA 3MCLL 2XZAL 1RUPL 5A2FA 1QSFE 3O2DH 4G9DA 4AG4L 5IGXL 1SJHA 4LHQB 2ZOKB 5C0AA 1A1OB 1BM3L 3T1WA 5EA0H 4LCYB 3GSOB 3MUHL 3O6FC 2EXWD 3MNWA 1S7QB 1O7SA 3B3IA 4QTHA 5T1DH 3VXNB 2KQNA 1NC4B 2JCCF 3C08H 5M94B 3DROA 2X4QA 3EO1A 5CSZB 3BZDA 2D31A 1I7ZB 1L0QA 3P4NB 1QQDB 5CJBA 3WEXA 3KG5A 4X0KB 2E27H 3R0MA 1HQRB 3FRUA 3MRHA 5EWIH 3ROOA 5JXEC 4XB8A 4L5FL 1EZVX 4LARL 1FL5A 4IRSB 3HMWH 4NUGL 5ALCH 4WU5B 3VFOB 4CVWA 3HPJA 3UBXI 3GSNH 1KEGL 4MQTB 5HGHB 2GFBA 4PJ9A 5C92A 4DKFH 1KPVB 3UBXB 1GAFL 3MFGB 1G84A 3N1GC 1MNUL 1OTUD 3QFDA 3ARUA 3E8UL 3ZSTA 2V2WB 5F88A 2FL5B 2VWEE 4OTXH 2FIKA 5FYJE 2XTJD 5KANG 4BM7A 2DQJH 3U9PL 1A6TB 1OQOA 3RUGB 2EDBA 3MUZ1 2LTQC 5TE7H 1DVFD 2NY0D 1I9JH 2Y6SC 5ADPL 4XP1L 5CWSB 3NZHL 5GRZA 4Z5RB 2DM7A 2VLJD 3Q6GL 3F58H 3C5JA 4W4NA 4TSBL 1M05B 5D6DC 2E9WA 1AD0B 1T22A 5I75B 1RMFL 5ICXA 4FMFA 3OKNA 1C12B 1A0QL 1G7LB 1OWRM 3LRSB 3U7AA 2BRRH 1Y6KR 1ZLUK 3PWUB 5DHYA 3MNVB 2VQTA 1MCWM 2F53D 2PXYC 5E2UL 1RHFA 4AEFA 5D9SB 4KUZL 1A1NA 5F89A 5D2LA 2CKBL 4K94H 3U0PA 3VDAA 1OLZA 1CF8L 4ZFOA 5T3XH 3RY6C 1X5FA 4F58L 2PW2B 3EYQC 2R2CA 4XRCA 2IQAB 4QF1B 4LU5L 4LCWA 4PTUB 2OR9H 1F4YH 4OCWH 3VJ6B 2I9TA 4MD4B 3KXFB 3WIFB 1DE4A 3ARWA 1LEGA 2OJEB 1K4DB 4YGVA 3B9KA 4HIJB 3IB4A 1H3XA 2FLRT 4OGZA 3HRPA 4MXQD 5L0QB 3WFEH 1CDCA 5C0FA 1BVKA 4TVPD 4HPYL 3QDJB 3HAEH 4UV4H 3T0BA 2P7TB 4UTAL 4M61A 2YUXA 3GRWA 4N5EC 5C0EB 4ONOA 2DYPA 3HUJF 4PRNB 5IKCA 1OTTD 2ITCB 1EH9A 2MTPA 1FFNA 5B21A 4M7LT 4P48A 5TE7L 1P4BH 2N1KA 4GOSA 1PX4A 3O9WB 5HGBA 4TTDC 1WWBX 3DUHA 3MRPB 3KPSA 4XNUL 3VD3A 3HNTL 2J8UB 1TJGL 4F15C 2QQQA 1DQJA 3K4DA 1FYTB 1YYLH 1KB5H 4UUJB 1T3FB 4KAQL 2VR4A 4JGUA 4J3TA 4WO4D 1IAOA 4MD5B 4Y1AA 2QQKL 4WU7A 1T2JA 3MLSH 2E7HA 2W0LA 3M07A 5ANME 4WI7A 4WW2F 3NTCL 2A74A 4F7EA 1Z9OA 3SE8H 2PYEB 3SCMA 4HIEB 3SOBH 1D9KD 1ZVSB 2BERA 2BNUA 1CF8H 3F7PC 5D1ZD 4L4TB 3TO4A 4LLMB 1W72H 4LVOC 2DI9A 3L95A 4XTRD 4CNIB 3DV6A 3L3HA 1LO5B 4MMXC 2ICEB 4GT7A 3W81A 3A6BH 4HT1H 2Q76B 2XIDA 1QR1B 3QUZB 2DLGA 4X6BB 4CN6A 1QPPA 1PZ5B 1UWEH 1NCDH 4JDVA 4KI1A 2GTZB 1D5BB 1I4FB 3FQRA 3QB7C 5ID0B 3UTPE 2CDGA 2CGRH 1RUQH 1E4KA 4CU6A 3MTRA 1JI2A 3IDMB 4BSWA 4E41E 5TDPB 2YXMA 4WEUD 5JORB 1QR1A 1E6JL 4FQXA 3EYQD 4PGJA 2O5ZL 2ICEA 1FZOB 1XCQB 3BDXA 3ZYJA 2X1XR 1CFSB 3TC9A 5C9JB 3W2DH 1J0ZA 4KJQC 4U0RC 4NWTL 4XNYL 5AZEL 1CDJA 1PG7H 1S5IH 1EMTH 3DUUA 2XQYG 3LV3B 5TJWK 1P6FA 4HUUB 4NC2B 3BMVA 2PO6B 4I0CC 1L7IL 1T80A 2VAAA 4FFZL 2NY7H 3QUMA 4EVNA 2QTEA 5F96L 3D18B 5GRWA 5B22A 4KK8C 3UYOD 3TH4T 3BW9A 1HSBB 1N26A 3EO0B 4UUJA 3WDJA 4APQB 2W65A 2P46B 1SBBA 4DN4L 3M45A 3LD8C 5SWSA 4JFXA 3VXQA 1LO3H 2X4TB 4RWYH 3VWKC 4OLVH 2YD2A 5D4QA 1MWAH 4G7VH 3G6JB 1ZHLA 3QNZA 2FCBA 5HYIA 5E2TH 4MA1C 4XMKL 1VHPA 5C0JA 5IKCB 1GGYA 1XF3A 4ZXBB 5J1SC 2V9QA 5BW7C 4NM8L 2DYPB 2QKIA 3F7RA 4QHLA 4MDIB 2E27L 3U48A 1FZMB 4LAQL 4JRYD 4YDIH 2I26N 1F3DH 2F58L 3SOBL 1LHZA 2CGRL 3MUGA 1XF3B 4HH9A 5SWSE 3QIUB 4ODWA 4NQEA 1CWVA 4NQDA 3P4MA 1MEXL 4M6NL 1T4KB 3NFPB 1KB5A 2ATKA 4N0CC 5B4MD 1ONQB 2O5ZH 2H6PA 4K7FA 3WXWH 1TQCB 4R0LB 2PO6C 5ICZA 5KTEH 2YSSB 1A7QL 5JDSA 1D5ZA 3QA3A 5IBLD 5T3ZD 3IXTB 1RJYA 3CXDH 1BECA 4PJ9C 1R5VB 3AM8A 3RI5K 5GSVA 2AJXL 1YN6A 3VXTB 4MB3A 4APQC 3MRDA 1D6EB 1S9WA 1ZT4A 3QIWA 1OGTB 1I9JL 4LHUB 2R2BA 4PJGA 3N1FC 2AKRB </