3QXVA

Structure of an anti-methotrexate cdr1-4 graft vhh antibody in complex with methotrexate
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
VQLVESGGGLVQAGGSLRLSCAASRRSSRSWAMAWFRQAPGKEREFVAKISGDGRLTTYGDSVKGRFTISRDNAEYLVYLQMDSLKPEDTAVYYCAADDNYVTASWRSGPDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-Methotrexate CDR1-4 Graft VHH
publication title An anti-hapten camelid antibody reveals a cryptic binding site with significant energetic contributions from a nonhypervariable loop.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 29
structure length 123
sequence length 123
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qxvA00
1KB5H 1E28B 3VGBA 2A74A 1OAUL 5EG6C 3CLFH 3ARFD 3CX2A 1GPOL 2VXUH 1NMBL 3ULUD 4G8FB 2IH1A 3EOBA 2MQCA 3HAEA 3MRCA 2Y07L 3O4OB 4FMFA 1WWCA 1IEBA 3C5SB 1DLFH 3T2OA 1MIEH 5BMFL 1H15B 3RU8H 4JKWA 4XGZA 5GGSB 2DD8L 5DMGC 3EYFA 3NACH 2VZ3A 3NFPA 5D2LB 5EIIA 4U31A 5GS0H 1NFKA 3W0WA 4LLUB 1KC5H 4GUPA 3F5WA 1KF9B 3B9KA 3O11B 3VXTB 2YUVA 2ATPB 1JNNH 1HSBA 4Q9RH 3MV9D 5HHXL 5GGRA 1ZWIA 2ARJQ 4PR5B 1ZA6A 4R2GB 3CMGA 3CGTA 6CGTA 2HFGH 4MNQB 5E7FA 4OIBA 3QDJE 2J5LC 1URLA 1FZMB 4LSSL 4Y16C 3JUZA 4JGJA 3SDAD 4LSPL 2VWEE 4P5KA 3T0EC 3UC0L 4MSWA 3C08L 5AD0A 5JIKA 4OFIA 5D7JC 2J88H 3H9SA 2DQIH 2BSRB 3EZJB 2XOTA 3IXAB 3MRPA 4UV4H 1R3HA 3MRJA 1XGPB 3QDMA 3FN3A 4Z9KB 4HWEH 4YHML 1CXEA 5BVPH 3V6ZA 5FIEA 1BQSA 4E5XA 3GSRA 4LLDB 3WIFB 3S37L 5I1GL 4P46D 2X4RA 3U2SA 3GJFH 2BSSB 1QRNA 4YFEA 3H2WA 3S5LA 5FF6A 5F3BA 5IQ7H 4L8CA 4TVPH 5IB1A 1NMAL 1KIQB 4UMGA 1AY1L 4PJEB 1V7MH 1F2XK 3KPMA 3VE0B 1CS6A 1G7LA 3MV7A 4DZBB 3VFUB 4WTXA 1IAOA 4QGTA 5I1KL 2DL9A 4RMTA 1YNTA 4JG1H 3I6LD 1FJ1B 1BGXH 4YBHA 2HTLD 3B8YA 3IF1B 3RVTD 4KMTH 1CZ8L 4L8BB 4RGND 3ULVL 1LK3H 3P9WB 4XNZC 3QUYC 2GT9B 2VXSH 1I3GL 3I85A 4M6OH 2ZPKH 3EO0B 4ETQA 5EO0B 3WHXB 3NGBB 1FV1A 4JB9L 4JO3L 4WNQB 1B4RA 4TPRH 4Z7WB 3WFBH 1IAIL 3MRGA 1NDMA 1PX3A 4U2ZA 3MNWB 3KPPB 4XCNB 1LNUB 3G5XA 4XPTL 4N8VA 5DR5L 3RWGB 1CFVL 5F7LB 3FB5B 3VWKA 2E3VA 2DJSA 4ZUUB 3R1GL 5T1DL 1E4XH 4O2EA 4GAJL 5DFVD 4UT6L 1KACB 3S36L 4FQJH 4JQVC 2XACC 3U0TB 3VXUA 3WNNA 4JO1L 1IGYB 1LE5B 1JRHL 4DW2H 5IJVA 3V5KB 4KKLD 3VXME 1SM3L 4TTDC 3WNPA 1N5YL 4UTBH 1QLEH 2DL2A 4G7YH 4XCFL 3IDIB 4MJ2A 2C7UB 2XWJB 5E8OB 2I27N 2P46B 3MA9H 5IM7A 2AJZA 4I3SH 4MB5A 3QULA 4MQ7A 4HT1H 3CC5A 4ODHL 3HI6H 2FD6L 3RDTD 4XB7A 3DGCR 5T33H 4QKXB 3U0PA 4RFOH 3BPLC 1ZLSH 1L6XA 3MLVL 5DRXA 4AENA 3QFJB 4M3JA 4S1QL 4OLVL 3DRQA 4YEFA 2PXYC 3FMGH 1HQ4A 1U3HD 2YUWA 5HYJA 4XPHH 3HI1B 3S88H 4NPYB 1T7VA 2YUXA 5C9KA 2VABB 2XTLA 1P4LB 3RZCC 4R0LB 1KXVC 4QO1A 5CD5C 4KV5F 5AYQA 4BM7A 2QKIB 1LD9A 2N7AA 5DSCA 1NJ9A 4ENED 5BRZD 4ODBD 5B8CB 4WU7A 2NY0B 5TDOA 4LPVA 1T7WA 5GGQH 4G3YH 1ZANH 1PYWB 2Z9TA 2PTTB 3TO4C 1TZGH 1DBKH 2IH3A 1CTNA 2VIRB 3F12A 3BN9C 2IGFL 32C2A 4GAGL 1WWWX 3HI5L 2AV1B 3FT3A 2OL3H 2VLMD 4HKXB 1ES0B 3Q1SL 4QOKE 4WW2B 4M9PA 1IE5A 4KUZL 1RIUL 5BJTB 4X5LA 3I6GB 5CGYD 3FB7B 4K8RD 3U9PH 3WKNA 3AUVA 3BP4B 3ECBA 1S7RA 4XNQA 4R2GD 3D85B 2RIKA 3C5ZD 3DVGA 1CBVL 3DXAE 4MXWL 2JCCB 3GK8L 1NKRA 1S7VB 3OXSB 5DVOA 1AQDA 1AI1H 1HXMA 1C08B 1TPXB 3BIKB 1QA9A 1ZGLP 1GYAA 5EU3A 3C60B 2DS4A 2JB6A 2BNQB 2LVEA 4PG9B 1IQDB 1P7KB 1FZKA 1T89C 3MYJB 4PY8I 3MJ7A 4YPGA 3EYSL 4HCRL 5AUMB 3SCMB 4K3EL 3CZFA 3QCVL 3FO1A 3MQIA 1UWEL 4L3AA 2QSVA 1TJHH 4JZNB 2CR3A 3OAYH 5DUBB 2QSQA 5ICYB 4WFFE 2B1HL 5SWZD 1CFNA 1OAKH 3QIBB 3UTPE 4AEEA 3S8WA 4PG2C 1CU4L 1RUKH 1JK8A 3GB7B 3RVXD 3U36B 1Q9KB 5DMKB 5JW5B 1MCEA 3VFOA 2ITDB 1MELA 4L4JA 1VEMA 4Y4FC 1G9NH 1KEGH 4NQSB 4WV1A 4LIQL 5TJWK 1OGAE 5BZWA 3LN4B 3LN5B 4ZS7H 3HUJA 4JFFE 2BX5A 1MLBB 3BWAB 3MRKB 1W72H 4L3CA 4BQ8A 2MQ0A 5IHZA 3ZDZE 3U7YH 4BA8A 5FGCB 4OV5A 3DJ9A 3N50A 4MA3A 4P4KC 3EO1B 3F62A 5JHDE 5C0JA 4LFHG 1VSCA 3GIZH 4AT6B 4TOYH 5DJCB 3TZVC 4OT1H 3ARTA 1X4ZA 2L4OA 3LS4L 1IAKB 2AEQL 5GIRB 5AAWA 5C07E 1RIVL 5DD5H 1BEYH 2VLJA 1PW3A 2GTZA 1JPFB 1G1YA 4E9LA 2D03H 4GRMB 4CW1A 3F7PC 1DSFH 3VFMA 4Z95H 4QHMA 2F53B 3BUYB 1N6QL 2HVKA 1F4XH 1I1FB 3UJJL 4K3DH 4XP9H 4EJ1C 4KTEL 1DANU 1N7MH 1ZVSB 2DLGA 4KAQH 3CFDB 4Y5XA 1CXKA 3BGFB 3QPQC 3VI4F 1RK0B 5D1ZB 2A77H 4MJ4A 2H8PA 4RMVA 2G2RA 1KPUA 4HJGA 4OUUB 4RNRA 1VKXB 4MS8D 1R3JB 4XXDA 1CFBA 3QXAA 4HV8A 3B9DA 4C83A 5FA4A 3QFJD 4YPJA 5GS1C 4KXZI 1D9KA 1OAUH 3L9RA 1GPOH 1NMBH 1GCFA 1LO3L 2R1WA 2Y07H 4UIMA 5D7IB 3M1BA 5DJDB 1FDLL 2RFXB 4JKLA 1RV6X 4MNGE 5ISZB 5BMFH 1FFPB 2X09A 5FAAA 2BNRB 1I4FA 5C2BL 1WZLA 3IS0X 2DD8H 4L9LA 3MJ8B 4MDJB 4P2RE 1XZ0A 4X0KA 4UU9A 5DXWA 1MCRA 2KBGA 1FPTL 2W0PA 3NIDF 1VERA 5IMMA 1VFBB 1C7TA 1IFHL 2X2YA 5HHME 1EJ6A 5LGJB 3PV6A 4H1LG 3U30B 4LSVL 2OJZL 4XCCL 4G6ML 4KDWA 1FYTA 2XNAA 4C59B 5FOBA 1N3NB 2CLZB 3O3UN 3MV11 3D3VA 3D85D 3SGDI 4LSSH 1BLNA 1U8JB 4FXKA 1IC7L 1A4KB 4LLMA 4LSPH 1PG7X 1MCLA 3MCKB 3UC0H 4GH7B 5HPOA 1NAMB 3C08H 5TDNA 5DEFA 1O7SA 2XV6B 4AYFA 4KJPD 4PGCB 2BOBB 1MCBA 3MBED 4UUJB 2E6JA 2MTPA 4PJIB 3DROB 5D96C 3B3IA 4LPWA 4OFPA 1KOAA 1BOGB 5ETUB 3G6DL 3PWPD 3MRLA 4YHMH 3ULUF 3KPLB 1MFAL 4G8GA 5I1GH 4GRLB 3S37H 4OLXL 4PJDB 1MVUA 2V9TA 4BYHA 1JYXA 5JNYB 2MJWA 1ZHLB 3SDXB 1WBYA 3H42L 3TF7C 1NCTA 3UDWA 4AM0B 1NMAH 2LTQC 4R4FL 4KK8D 5HHOB 3PL6D 1WBZB 1WEJL 4WI9A 4LPYA 3M07A 5LBSL 5I1LA 5DQDL 5I1KH 4N1CA 5TGBA 2X4NA 2LABA 1W0WA 5J8OA 4ZS6C 2LE9A 3DUSA 4HUNB 4JRYE 2PO6C 4HF5L 4DVBB 2CUIA 4KI5C 1CZ8H 1TNMA 1TVBB 4QEGA 2H32A 5A2FA 3ULVH 5KSUA 4N9GA 1I3GH 2FLRT 4MWFA 1FAKT 3HMXA 3O41A 4XB8A 5E1AB 1C16B 3QFDB 4JB9H 4JRWA 4OGAC 1LK2B 5TDPB 1WTLA 1KJ2H 4ZFFA 1IAIH 3CFBB 4JZJA 2X70A 5GS2D 4XPTH 3VG0L 4CMMB 5DR5H 5HHNA 5IGXL 1CFVH 2ESVB 5SWQB 3VD5A 4Z7UB 3MREA 2R29L 2PTUA 3R1GH 5T1DH 4KY1L 1MAJA 4GAJH 4JFXB 3S36H 1IZJA 4DZ8A 2AK4D 4WFHD 1J0ZA 2QADB 4JRXA 5F3HA 3PWLA 3QDGE 3R06A 4XPFL 4OZFG 2XKNA 3ARFA 2D2OA 3DTXB 4PRNA 1JRHH 3PXHA 4HUWA 5I2IA 1SM3H 4QXGL 4D0DB 3RWHB 1R3IL 1N5YH 2XG4A 5E2WL 4NO5B 4FQQB 4XCFH 2F53D 4TNVK 2V9QA 5F7KC 4JHZA 5AZ2L 3LOWA 4ODHH 4OF6A 4XVJL 5FA3B 1QR1B 2FD6H 2SEBB 3T3MF 1D5BA 4S1DD 3MBXL 1HH9A 1HHKB 3MLUL 3MLVH 1G7MB 4S1QH 4OLVH 3RKDD 3MV9A 1T21B 4XT1C 5E24E 5IVXF 5C0CE 4OCNC 2YD5A 2JJSA 2YA2A 1FNGB 1JP5A 2APVA 4ODSL 3AC0A 4ORGA 4ZO8A 5DVMA 1C1EL 2OXGA 1JZ8A 2JTDA 4UBDC 4DKFL 4L3ED 3SDAA 3FONB 2CLRA 3B6SA 1P9MC 3E8UL 5ISZD 5ID0A 3JVGA 3H9YA 2IGFH 4N9OB 1U8HA 3PJSA 3QUML 5D4QA 4M7KL 4GAGH 1UM4L 1G7HB 1B6DA 4YXHL 2FYYA 4HBQA 3HI5H 3X14A 4N90D 1A22B 4RGOL 3BZ4B 3KXFD 1X4XA 2I25N 3Q1SH 5C0RL 3KPNA 2F54E 5EO9A 5I1DB 4NFBA 4KUZH 4PJCB 1RIUH 4G42A 2W92A 4P46A 5J13B 4TYUA 5E4EB 2ZCKL 3SO5A 5FO9A 3H3PL 5TE7L 1SQ2N 1CBVH 1S78C 4X8JB 1AD0A 3S97C 3V4UL 1G7QB 1T0MB 4MXWH 4XNUL 5D8JL 3GK8H 4H26B 5FCUL 5D7LD 3PF2A 2AXJA 5I30H 3VD3A 3QZWG 1HNGA 4NFCA 2UY7A 3ZHKA 4LK4A 4HK0A 3RNKA 4C56B 4PRHE 5IB3B 4HEME 3GRWL 5HY9A 2VISA 4UAOC 1EXUB 1CK0L 4POUB 4LLQB 5FUOL 1U8OB 5KW9L 1U8MA 1EO5A 4FXGB 3EYSH 1EVUA 2QEJA 4K3EH 3FAWA 3ZYOA 1F13A 3HZKB 5EPMA 3QCVH 2HH0L 5D5ME 5IVXA 1UWEH 4HIJB 1MHHA 4V1DB 5D9SA 3IETA 4ZUTB 4W81A 2H6PB 5GGVL 3NCYP 3PIQB 1CU4H 2XFXA 3UTTE 3OKOA 5HHPB 3W9DB 2NNAA 3MMEB 1NL0L 2CDEB 5DJ6A 1RU9L 5HHQB 1HDMA 4NNYA 1JF1B 4LIQH 5F9AC 2BZDA 2CO6B 3L6FB 3ZKSD 4LRNL 3WN5A 4TNVF 4JG0L 2E27L 3KJ4B 5HI4C 5IOPA 1QZ1A 3AB0C 4MNHA 1FL3A 4CNIA 4QHKI 4CN1A 5IJKA 1V05A 5IB5A 4D8PA 2CKBB 4QRQA 5B38A 1AO7B 1FNAA 2EKSA 4XWOD 2HYMA 3OR7A 1DUZB 4U7KA 3RDTA 4IRSB 2EDHA 2ESVD 1MRFL 1DN0A 1U91B 3DMMB 4DGIL 1T20B 3LS4H 5HPMA 2AEQH 2MNUA 5KOMC 1BZQK 3BYYA 3CFEA 3QUKB 1RIVH 3WCYA 2F5BL 4KTYA 4OM0L 1U3HA 2QQQA 5EUKA 5D1QB 1P5VA 5J6HB 1JGDB 4MVBC 5HD8C 1N6QH 5FYKU 5E8EA 4PGDB 1YMMD 3I75A 3UJJH 4Z6AT 5BRZA 4KTEH 4P57B 1OTTD 5DA4A 4N1HB 4N68A 4IHOB 3GSWB 2RQ8A 3TN0B 5KSAB 5JR1L 5CZXC 2GSGA 2VXQL 4LCIL 5GGSA 5CBAB 3BZEA 5C9JB 3FN0L 5F9WC 4LAJH 2LAAA 4FQ1L 4HLJA 2XZQL 4LLUA 1A9EB 2DQDL 3ARRA 3MRIB 4OLUL 3VFVB 5IB2B 1AD9A 4NRZA 4Q2ZB 1RI8A 2JB5L 4OGXL 3O11A 1NC2B 2ATPA 2V2WB 5GRVL 4C54A 5E8DL 4HKBB 1UA6L 4J7RA 3AS1A 4PR5A 1LO3H 5IBUG 4LNRB 3C5ZA 1FDLH 2GFBA 4GLRI 2YPVL 3TNMB 4PBWD 3BDYL 5C2BH 3GMNB 1NH6A 1EA9C 5CGMA 3QG6B 2IPKB 5FGRA 2OTUB 4ZUVA 4XVSL 3QUZD 1LVEA 1FPTH 5IESL 5L8LB 4NOFA 1IFHH 2XICA 5BV7C 4G8EA 3P3YA 1HOCA 3WS3B 1I7ZA 1F8TL 2LVCA 2ZUYA 5H2BB 3KR3H 3EYUL 1JGEB 1U8NB 3WIFA 3ZDYF 4LSVH 4NWTL 1X5KA 1U3JA 2OJZH 4XCCH 3UPAA 4G6MH 3V0VB 5DO2C 5F96L 1FSKB 2BSSA 4W4OC 5F7DA 3OX8A 1P2CB 1H9VA 1CFTA 1IC7H 3HB3D 5SWZA 4YHLL 3VWKC 4PJEA 3ARGC 5EOCL 3ETBF 1N64L 2G5BA 4JFZL 2NW3A 4DZBA 1QG3A 1A47A 1OB1B 4A6YB 4Y4KB 3G6DH 4C56D 1FJ1A 1MFAH 3WIHA 1CDHA 4AEHL 3IF1A 4CDGC 4OLXH 3I3DA 3JTTB 3BKYL 3T3PE 4Z78B 4L8BA 1CI5A 2P24A 1DEEB 5DDHB 3H42H 3WLBB 3DIFA 4RMRA 2GT9A 2X4PB 5DHYB 3HPLA 3JTSB 5IHUL 2AJ3A 5ESAB 4DGYL 4YQXL 2IC2A 3EO0A 5EBWA 5EO0A 4R4FH 2V5SA 3WHXA 3GEWB 4WNQA 1WEJH 4Z7WA 1U58B 4V1DD 5LBSH 4X7TB 4XX1E 3MNWA 1UB6B 3MOAL 3Q5YA 4XCNA 5DQDH 1LNUA 1UJTA 1A6ZB 2P48B 4ZUUA 2ED7A 4ZPTB 1CGVA 3ZLQC 4JY4A 1JN6A 4HF5H 4LOUD 1UB5A 3PHQA 5ACZB 4OD2A 1FNSL 4S2SA 5DD3L 5I1AB 4KUCD 3SKMA 2YA1A 5JW4R 1IGYA 4FQCL 3V5KA 4ZQKB 5TFSL 4NM4L 2CXGA 5EC1A 3ZKXB 1BFTA 3IDIA 3UBXG 4OCXH 1WK0A 2C7UA 1OP3K 2HTKC 3VG0H 2XWJA 3UZQA 5IGXH 1RFDL 2R29H 5IQ9B 5CP7B 1CGXA 4KY1H 4NCC1 1A8JH 3ORJA 4F7MB 5EUOF 3OQ3B 4X9FA 1KLGB 1UKSA 3UBXB 4JKMA 3FT4B 3QFJA 5LAXB 2DMBA 3VGHA 2IF7A 4XPFH 3KPRE 2DDQL 4RZCB 4P99A 4NPYA 2D9QB 1OP5H 4QXGH 3STZA 1R3IH 4G6AD 4R0LA 5HDBF 4BZ1L 5E2WH 3LEXA 4LLYB 3LPGA 1U8KB 2QKIA 2Y7QB 1OARL 5B8CA 1QLFA 3Q5OA 2AXFB 2J4WL 4Y5YC 5AZ2H 1PYWA 2AEWA 1DN2A 4XVJH 3GJFB 4LCYB 4X4MA 3FQXA 5H94B 5BQ7B 3BHBB 3O4LD 5ESQB 2VIRA 4I18B 3S3SA 3IDYB 3MBXH 2VQ1B 3MLUH 2J6EL 2OI9B 3CPLA 1QSFD 1X6LA 2AXHA 5CBEB 1C8PA 1ES0A 4LHUG 2XWTB 4ODWA 5E8PA 1J1OL 1RJLA 3P4LA 4G5ZH 5C3TA 4ZOCA 1K8DB 4ODSH 4GG6E 1C1EH 2JK5A 2PYEB 3D85A 4LEOA 4DKFH 2JCCA 3E8UH 1OT1A 4G43B 2X44D 1KIRB 3I6KB 1EUUA 3MBEA 3QUMH 4LBEA 4M7KH 1UM4H 4YXHH 1IM9B 3PDDA 4FQXD 5ELIA 3BIKA 2NY6C 4UOW0 4UQ3A 4RGOH 2YEZB 3S34L 3PWPA 4WV1C 2Q3AA 2P42B 5C0RH 4NBYB 4WHDA 4PG9A 3EFDL 1P7KA 1J0JA 5F88B 3MYJA 1M4KA 1PKQB 2ZCKH 2UY6A 5EUOA 1UGNA 2FCBA 5AUMA 3SCMA 3T0VA 3H3PH 5TE7H 4YHYC 3CSYA 1J1XL 3V4UH 3VFRB 4XNUH 5D8JH 2HA1A 2H2PC 4JVUA 5EOCJ 2ZZUT 1BX2B 5FCUH 3N1FC 3H7BB 1HKFA 3PL6A 3FKUS 5ICYA 3PQYB 5IR1B 2WBJB 2VXTL 4R90L 2Q8AL 3MA7B 3GRWH 3ROLA 3FFDB 5FYLL 1Q9KA 1HK6A 4XHJD 4R3SB 2BRRL 1CK0H 2M8XA 2APTA 2ITDA 5KW9H 5FUOH 3HZMB 2XYCA 4UILL 5AAMA 3N0PB 1MCDA 3C6LC 5E6ZA 1ZOXA 3FQNA 3PWUB 2E8YA 2HH0H 5F7HA 1RZKC 3EDEA 2P8LB 4HWZB 1OW0A 3BWAA 5FB8B 4MHHG 4I0PB 3V0WL 3DUUA 5EC2B 1ZV5A 5L7XL 5GGVH 3MR9B 2Q6WB 5C6PB 3OAZH 1NGYA 4GW5A 4PRBB 3ZE2F 2KQMA 1UZ8A 4I5BA 1F4AA 3CMOL 3KS0H 3TBWB 1NL0H 5F6IB 3PWNA 2AK4A 4JFPB 1RU9H 3BDXA 4HUVA 1D9KC 3BO8B 4YDVA 1BQUA 2I60L 4QXWA 4LRNH 1D5XA 3BH8B 2I26N 4JG0H 2E27H 4WHYH 3VDAA 3VMPA 3W0WE 3FTGB 3SE4C 1KTLB 2F53A 3BUYA 2FEEI 3CSPA 4L9LC 3LPFA 1NEUA 2Z93B 1LWRA 4ACPA 4U1JB 3JSSA 2Z31B 3B5TA 1JZ2A 1RZGA 1MRFH 5C0IA 4PJAE 3IJHA 4G6JL 2Z8VC 2DKMA 4OUUA 1WV7T 2YD2A 2F5BH 1R3JA 4OM0H 1BZ9B 1DBJH 4K2UL 2GCYB 2X7LB 1C5DB 3H9SE 4M7JL 3P9MA 4YXKL 1Q94B 5CHNA 5IF0B 5J11C 3C2AL 4X9IA 3QDME 1U8PB 3CXDL 4L3EA 3OBAA 1I8LA 1Q9WA 5ISZA 4KFZC 1FFPA 5JR1H 1AH1A 1P69B 1XF2A 4ZAKB 2VXQH 4LCIH 1DL7L 3MFFB 4MDJA 3FN0H 5F7MC 1FFOB 3HR5A 3RNQB 2ZKHL 1QRNE 4FQ1H 4I8DA 2XZQH 1AGCA 3EDKA 2DQDH 4OLUH 2UV3A 3QWOA 1RZIB 4NN6B 2JB5H 4NQXA 1VFBA 4OGXH 4TVPD 4FQIL 4PJBB 1RMFL 5E8DH 1R24B 1UA6H 3G6JB 2GK2A 5LGJA 1JNLL 5DRZB 4IDLA 1YDPB 3MV7E 3KPSD 3UDWC 3C6SB 1LEGB 5LQBL 3QDHA 2APWA 1N3NA 3BDYH 2CLZA 4GW1B 3WD5L 3D39D 4UTAH 1N2RB 2C3HA 5D7LA 4PTUB 4HUUB 3C8DA 4DUVA 4J3UA 1UJ3B 1MLCB 1HYSD 3MCKA 4LHUD 2DTML 1NAMA 1S7QB 1NANH 3MRQB 4PGCA 1RZFL 4BZ2L 4ETYA 1YA5A 1F5WA 2OTPA 3GM8A 4PBVC 4U1LB 2XTJB 4UUJA 4XVSH 2C3VB 1W72B 5IESH 4LP4A 3ARBB 3LRSB 1WBXA 3QNXA 5ETUA 3GNML 3KPLA 1F8TH 1AR1D 1JCKA 3F7QA 3EYUH 4FFZL 3CFKB 5C0ND 4DEPB 3ILPA 4NWTH 2V2XB 3MLSL 5F96H 4NQDD 1CXLA 4FOMA 4LCWD 4JZJC 3SDXA 7FABL 2VZVA 4R4BA 4JJ5A 4YHLH 3OHXB 4U05A 2EH8L 5EOCH 4DCQB 2W0FB 5HHOA 5I71B 2HVJB 3UZVB 1N64H 1WBZA 4JFZH 3PQYD 4Y4HD 4M5YL 3WXWL 3MV8D 3QUXD 2ICWA 4OSUH 4P3CL 4NDMA 4BSWA 4F58L 3WO4C 3S4SG 5DLML 3DOSA 2I24N 4AEHH 1LE9A 2KDGA 3ULUC 5BW7A 3RVUD 3BKYH 5GGTA 1ZSDA 4TVSa 2BY2A 1T2QH 5E5MB 1H3VA 1LP9B 2COQA 2NY7H 4HFWA 1G6VK 4ONGL 5IHUH 3F7VB 4DGYH 4YQXH 3H9HB 4X99A 1IBGL 2FSEB 1RHFA 4KROC 3O6FD 1P84J 4I0PD 3QRFM 3MOAH 5MHSD 2ESVA 3REWB 3WS6A 4PJ9B 4W6XB 3V6FA 5JXEC 4NN7C 2EDTA 5EU4A 1Q9OA 1K2DB 3HG1D 4JFXA 3NFSL 3WJJA 1FNSH 4DQOL 2JJSC 2AI0L 4FQCH 5FKAA 4JPWL 3DTXA 3ZSSA 3WSQH 4PJGF 5TFSH 1ONQB 1YMMA 3RWHA 2ZUWA 4CU8A 2YN5A 2WBWB 4P59L 5EO1A 5TH2B 4NO5A 3WL9B 4FQQA 4QWWD 1ERNA 3JVGC 4LDOB 4WI8A 3JV4B 1A6WL 1RFDH 3TA3C 3P4OB 4LARL 3DNKA 3EBAA 4ONHB 5FA3A 3RPIB 4PRPD 1QR1A 2SEBA 1SJEA 5DC9B 1G7MA 2F58L 4ZFOA 1T83A 2EDYA 2DDQH 2EXWC 4WU5A 2WAHA 4MXQC 1W0YT 3UTZA 1SVZA 4ZO7A 1J8HE 4RAVA 3BKCL 4JZOA 4HKJA 4BZ1H 1FNGA 1R3KB 2FIKA 4R7DA 4EN3C 1A14L 4PREB 4LHQB 4Y8AA 5HI3C 4KVCL 1OARH 1WCBA 3FONA 1ZHNB 2XA3A 3BPOB 1JPGB 3V7AE 3CX5J 1H3WM 2J12B 2VOTA 1DE4B 4ZAKD 2ZUXA 3D1MC 4RBPK 1UWXH 4OFVA 3QUZA 3Q0HA 3O45A 3RVTC 4KUCF 4F57L 3OG4B 2J6EH 4RGNC 1YEHL 4QRPD 2VXVL 5E94A 3QPXL 3MOBL 9CGTA 1FBIL 3UPRB 2VKXA 2OK0L 2V5MA 1EEQA 4X9GA 2HWZL 4KV5E 4ZOAA 1J1OH 2ZSWB 3VJ6B 3ZE1F 1Q9LB 4X5XB 5DEGB 1BF8A 1OF2A 1PFCA 4X8JA 4S0SD 1G7QA 1T0MA 3D48R 4WI3A 2RGSA 3ZT6A 5MENB 5IFAL 5CJ8A 4H26A 1H5BB 2H2SD 2BMKB 5IG7A 1FNLA 4NHUB 4KZDL 5TF1L 3BP5B 3MSPA 1YUHA 2MFNA 3S34H 4C56A 1ACZA 2XTJD 5IB3A 3EUUA 5GSVB 3EFDH 2NZ9C 3WN5C 1ZVHA 1YJDC 1U8OA 2X1QA 3QHZH 1DEDA 4K94C 3QZWA 3QI9B 5IJKC 3V8CA 2FHCA 1J1XH 1GGYA 3VXOA 3LIZL 4G9FE 4QCIB 4OCSH 4UI2A 5JPMB 5J0BA 3W11D 2EDJA 4H25A 4V1DA 3RDTC 3BH9B 4OZ4B 4ZUTA 1YPZF 2VLJE 3G9AB 4QYOB 2H6PA 3TPUB 2VXTH 4R90H 2Q8AH 3PIQA 4PJ8B 4GFTB 3W9DA 5FYLH 2BRRH 4P3DB 2CDEA 3NCJH 3H8NA 1QSEB 4UILH 3QQ4B 4RFEA 5ALBL 5HHQA 3W5NA 3BZFA 4JLRB 5I0ZA 1RD6A 3VDBA 4K3HA 5HYIA 3L6FA 1G9MC 3O4OC 3PNWA 4ENEC 4MX7B 2AJUH 2AEPL 2G9HB 4HX1B 4HZLB 3V0WH 5L7XH 1K4CA 3KPQB 5EU6B 5EIVA 3MLPA 1CFQA 4O58L 1AFVL 3JZ7A 1DUZA 4U1GB 4CJ1A 4Q9BA 5CEXB 1NKOA 4Z8FL 4PJ9D 1T20A 5DRWB 2ICWI 5JO5A 5CGYC 5T5FL 35C8L 3QUKA 2I60H 4R2GC 4AH2A 1I1AB 4D0BA 5KOVC 3E6FA 2NY5C 5IMOA 4APQD 5I0DA 1NCCL 1JGDA 5JXAL 4IOIB 3VRLF 2ENYA 3RGVD 4D3CL 4PGDA 1HHGB 4LCCB 4YHOL 3EYVB 2PW1B 4FFWC 4P57A 1YJDL 2CRYA 4IHOA 3GSWA 2YSSB 1U8IA 3O4LA 5JW4Q 5CBAA 1SEBA 1YY9C 5JOFA 3CH8A 1YPZA 1QSFA 1IMHC 1XCQB 2N1KA 3MRIA 5IB2A 3T1WA 4K2UH 2KH2B 1UM6L 2ORBL 1OY3B 1NC2A 1T0NB 2V2WA 4ZOEA 3RWDB 3RI5K 5K9KA 4ZXBB 2HKFL 3OV6A 1W8NA 4HKBA 1HHIA 4M7JH 3RL1B 4YXKH 4BK4A 1ZGLB 3U7WL 4LNRA 3C2AH 4DKDC 1FVEB 1CF8L 2P49B 3CXDH 4DWHA 2CSPA 5D6CB 1JL8A 4RFNB 4JKKA 3O3BB 3TNMA 1OT2A 5FYKD 3B2UD 1UH4A 4I2XB 1KB9J 4I4WA 1DL7H 5CAYB 1QUNA 3QG6A 1G9ML 3M17A 4FQXA 2ZKHH 4IIQA 4QY8B 4YNYB 2IPKA 4R7NB 3WLWC 2OTUA 2NTSP 4PLKC 3BKML 1N5AB 1RMFH 5JA8B 2ZUUA 4Y7MA 4U4BA 1JNLH 1JGEA 1VGEL 1B0RB 4J1UB 3P4MB 4D9QE 5LQBH 3NABL 3NGBC 2ADJA 4NZRL 5KTEL 2QQKL 3WD5H 3C2SA 4WW1B 2ILLA 2DTMH 1A3QA 4JPIA 5MEND 2VN7A 3QEQD 5DMGD 4BKLA 3T2NL 4FQPA 3SGEI 1RZFH 4BZ2H 3OB0H 3ULVD 3VGDA 1OGTB 3BEVB 1W0VB 5INCB 1OB1A 3VXNA 1Y6NR 2CK0L 4YHPA 3U83A 3GNMH 4F7CB 2R0KL 1AGEA 4FFZH 4WHTB 3V2AR 3JTTA 3MLSH 1DEEA 4FQHA 4OUOA 2GAZB 3UP1A 7FABH 3U4BL 3V6OA 1CGYA 4RGMB 4NRXA 3HKFA 3JTSA 4Y16D 5ESAA 1EV2E 1FNFA 4JRXE 4UT9L 3T0ED 2EH8H 5DJ0B 2X5PA 1U58A 1KB5A 2Z35B 3HC0A 4HS6A 4MS8C 4M5YH 4X7TA 5DJXB 1T22B 3ULUE 3HE6D 4N0UB 4P3CH 2ERJB 5DZNA 4F58H 1SEQL 2EE2A 5J9PB 2WM0A 1A6ZA 5DLMH 5M95B 4NQCD 4NKQB 2JE8A 1NCDL 3O9WB 4ZSOA 5ACZA 3ZKNC 3SHSA 4R0LC 1DQML 4CADB 5I1AA 1BIIA 3PHOB 1FL5B 3EOAB 1JF5A 4L4VB 5AYUL 4HIEA 4ONGH 1E6OL 3HE7B 5B8CC 5DS8A 4LVNB 2NY0C 2PUQT 1IBGH 3RUGB 2VC2L 3MV9E 1AJ7L 1LEKA 5C0GB 1JYNA 2WANA 5EU6D 1MY7A 5FGBA 3IAQA 2OR8A 2UYLB 1JWSB 3HTLX 4OJFL 4WW2C 3RI5F 1CL7I 1KIUA 4MJID 3NFSH 4DQOH 3OAYK 1HNFA 4RWHA 1KLGA 5A2JH 3UBXA 3JWOL 4JFYB 1JIBA 1U92A 4JPWH 2FL5B 3CVHB 4KK9D 2NXZB 3X3GL 2R4SL 4P59H 5AWNL 5I9QB 4P5TB 4Y5VA 2Y7QA 3GJEB 3OKDA 4F8QA 1MCCA 1A6WH 1KPVA 1TPXC 1VFAA 5C0BB 4LARH 3BYTA 5BQ7A 5C0AD 3C60C 5H94A 3BHBA 2UUDH 3CDGB 5ICXA 4QRSB 4XH2A 1CLZL 3FL7A 4S1RL 3SCMC 5CBEA 3S96A 2DLFL 4NFDA 5DI8A 1PQZA 4XMKL 1QFWM 1FGVL 2VLRD 3MACL 3KPSA 1MVFA 3BKCH 4UDUB 1CLYL 4TTDD 2G75A 1A14H 1K8DA 4KK8C 3ZKQD 3PL6C 1S9XA 4KVCH 1RUQL 5C0FA 3GUTB 4KKBD 1A9BA 3VFNA 5CKAA 4JR9L 3QIBC 3RIFK 5HJ3A 3ARUA 3T3ME 4LHUA 5F7UA 1B4JL 5BS0D 4G43A 1NPUA 3VFPA 4RRPG 3I6KA 4F57H 5IVXE 1FFNB 4KQ4L 1WFNA 1YEHH 2VXVH 3QPXH 1BZ7A 4HS8L 3MOBH 5GISL 1FBIH 2OK0H 4Z7NF 4G6FD 4L9DA 2HWZH 4WHCA 5F88A 5L2KB 1CIUA 3QYCA 1FCGA 1JV5B 2R0WL 3QEUB 3WFZA 1ZS8A 4JPVL 1PKQA 4Y2DB 3X11B 4NQDA 1OW0C 2ADFL 2CIKB 5CD5D 2YWZA 4LCWA 5I8EA 3LH2L 5JLZB 4O51A 4I3GA 5B4MC 5IFAH 1BX2A 1EAPB 3H7BA 4MD4A 2HJFA 3PQYA 5E2TL 4Y4HA 3BN9D 3MV8A 3SDCB 2H3NA 4KZDH 5TF1H 3QUXA 2R0ZL 1WJ3A 1I8IA 3T65B 4ZUSB 3MA7A 1XF1A 3FFDA 3HZMA 2MKWA 2X4TB 4OV6F 4M93B 2GJ6B 3SKUD 4EBQL 4ODUA 2JJVA 4KJYB 3CCHB 5E9DD 1BBJA 2X9WA 2Q8BL 3CFJB 3O6FA 2B0SL 2JLLA 3BGFC 3QSKB 2CDFB 4I0PA 1K4DB 1B90A 2MCG1 3PGDB 5J1SC 5EC2A 1D6EB 4JM2B 2AW2A 1F4YL 1CG9B 2R1XB 3SDYL 3EO9L 3ARDB 5FGSA 3RKDC 4F8TA 1FZOB 3REVA 4IMKC 3HR6A 3QH3A 4WEMB 1BVKB 4PJBF 4BFBD 2PTVA 3HG1A 5I6XB 5BRZE 2IANB 2V17L 5ALBH 3BO8A 1GHFL 1A7RL 4CL7A 3AU1B 2XZZA 4M7ZB 1R5IA 4MXVE 1XEDA 2D7TH 1XGUA 1EFQA 1SYSA 1I8KB 1R3LB 2AEPH 1WLHA 4WFED 4ZFZB 1I8LC 4YHIB 3QWQB 3FO2B 3FTGA 2VLME 2OL3A 3RX8A 5CZKA 3NCCB 5D2NB 1QVOA 5GSRA 2V5RA 2Z93A 2ZOLA 4O58H 2VKWA 1AFVH 1I9JH 1Z2KA 4NNXA 4U1JA 4B53A 4PRPA 2Z31A 3SO3B 2PW2B 3V5HA 2VITA 3DV4B 4U6YA 4Z8FH 1CDJA 2VZUA 4ELMB 5CD3A 4TULL 5T5FH 4PLJC 4Y4FD 35C8H 1F4WL 3D0VB 1QO3B 1OL0A 4Z7VB 3O3AA 1C12B 1QEWA 1IILE 4WTZG 2X7LA 5DD6A 1FO0B 1NCCH 3RIFF 4QTHA 2WINB 5JXAH 4MAYB 4PRIE 3QXVA 2NXZD 2NR6C 1MCWM 5FYJE 4D3CH 4YHOH 5BXFB 4WGWB 5IF0A 5BOZG 1YJDH 3R4DA 1PDKA 5GHWL 3AS3A 3FFCB 5DRNA 4FP8L 4K94H 3V8OA 4UIKL 4WWKB 1QBML 4ZAKA 5FDWA 1HH6A 3V0AC 5C0BD 4TSAL 3TZVD 3RNQA 4CBPA 4QRPA 4GRLC 1F3JB 1D7FA 1UM6H 1DLHA 2ORBH 5SWZE 1I1RA 1LP9F 1FIGL 4PJBA 5IV2B 4QLRA 2HKFH 1R24A 1I1YB 3G6JA 3UBXI 4NUGL 4IMLB 4HIIA 4HWBL 3U7WH 2UVEA 3KLSA 2EO9A 5IKCB 1LEGA 4PJ5B 1CF8H 2ED8A 4HD9A 4GW1A 4MMZC 1MI5B 4JFDB 1BP3B 4PTUA 4HUUA 3QPQD 1QFUL 1G9MH 3QXDA 1MLCA 1S7XB 3QAZB 4U49A 5HVGB 1S7QA 1FC1A 4ZPVA 5IB4B 3VG9B 4J23A 5BW7C 1W72A 3BKMH 3ARBA 3LRSA 3AROA 5D93C 1CXHA 3NZ8A 5EFIB 4NKOA 1S9WB 1VGEH 3C8HA 2XRAL 5C08D 1ZTXL 4Y2DD 3NABH 4NZRH 5KTEH 2QQKH 1J88A 5IROA 3L3GA 4PY7A 2IQAB 4XWOC 3GSVB 4F37F 1VENA 4OKDA 5KSBB 1B9ZA 1A7OL 2ADGB 4MCZB 3LKNB 3T2NH 4DCQA 2W0FA 2PKDA 3RWCB 4N0CD 4H8WC 3VRIB 2A83B 4AQ1B 4RAUB 2CK0H 4OZHF 3DRTB 3SDCD 4GKSA 4LMQI 2QADC 3ZDYE 1JZ3A 1WCQA 2R0KH 1NGWA 4HIHB 4Q0XL 3VD4A 1N59B 2H26A 2ICEA 3NA4A 4JFED 3BJ91 2N56A 5JDSA 2DJUA 4KC3B 5E5MA 3KDMB 5E1HB 1P6AB 1LP9A 2GITB 3NVQA 3U4BH 2R1YA 3UTSB 1J0HA 2NX5B 3F7VA 4R26L 2DWDB 3S4SA 2MCPL 4UT9H 2DTSA 3PE9A 1UEYA 5FO8A 1E4XI 3SN6N 4NQVB 1A6TA 1I7TB 1CGSL 4HHAB 1GZPB 1SEQH 1S8DB 4PJ9A 1X5YA 3OGOE 2APFA 4NKIL 3SJVB 5F1KC 2EDQA 5F70A 1NCDH 3WUWG 1FZJB 1MJUL 1K2DA 3GSXA 3C87A 1DQMH 5T3ZH 1JPST 3HRZB 1NGQL 3LV3B 2H9GA 3I2CL 4X4ME 4APQA 5AYUH 3GMRB 1E6OH 5SV3A 1DCLA 1RK1B 5HYEA 5C8JB 5TH2A 2VC2H 1MWAB 4RDQG 3WL9A 5KVEL 1U3ZA 1AJ7H 3TWCL 1YQ2A 5DJAB 1OD7A 2XPGA 2DQHL 3EKCA 3JV4A 3G5ZB 1QHPA 3P4OA 2XQYG 3KPOB 3RPIA 4WFGD 3S6CA 1DBAL 3N85L 1DZBA 4KI5D 5J13C 2W0KA 5E4EC 2OSLB 4OZHA 3BDBA 3JWOH 2Y6SD 2P7TB 4LRIA 3PWJB 4WO4B 3RRQA 3VA2C 3X3GH 1K6QL 2R4SH 4EKXA 5AWNH 3KNBA 4MAYD 3PWPE 1PAMA 1R5WB 1TJGL 1BECA 4CKVX 2EC8A 5E2JA 1ZHNA 3SE9L 1AKJB 4KK5D 5EUOE 1JPGA 1AC0A 1INDL 4HXBL 4PJ7F 2GSIA 4MLSA 2FX7L 4BUGA 4GQ9L 2F5AL 1F58L 3L3OB 3TBYA 1QQDA 3KYOA 1ADQL 1CLZH 5DQ9B 4S1RH 1VPOL 1GVIA 2DLFH 4RMUA 4XMKH 3UPRA 5EBLB 1FGVH 3TIDA 3MACH 1O7VA 5DTFB 2ZSWA 1B3JA 1CLYH 3W39A 1B2WH 4CMHC 4BQCA 1Q9LA 4X5XA 4BSJA 1RUQH 5DEGA 2NY1B 4NM8L 1P1ZB 3TCLA 1Z0MA 2X4SB 3NCEB 1B4JH 4EDWL 5MENA 4LEXL 3QEQA 5FKPB 4P4RA 2P5WE 3MC0A 5KS9F 3DBXB 3CLEL 2I5YL 2BMKA 2ZG3A 1A21A 5JW4M 4NHUA 4KQ4H 3QDJB 3BP5A 1Q1JL 3G5VB 4HS8H 5GISH 3QRGL 4LSUL 2H41A 4PJFF 2YMXL 1KJ2A 2R0WH 4D0CB 4JPVH 3ME0A 1QFWL 3KJ4C 2BHUA 2X4UA 3RAJL 4GKNB 2ADFH 5IEKB 2NY2B 3LH2H 3HNVL 3SGJC 1MH5B 2XXCB 4Y16A 4QCIA 2LU3A 3QJFA 4NQED 2YA0A 2AK4E 3QT2A 4WFHE 1S9YA 5JPMA 3T0EA 4OI9A 5DK2A 4EQ3A 3QJHB 2ZCLL 2UZIL 5KVMC 2OR9L 3I02B 5E2TH 2A6DB 3G04B 4IRSC 1LDPL 1VADB 1HI6A 3HE6A 3O3DB 1JUFB 43C9B 5HGBB 3BGMB 2R0ZH 3TPUA 1HWHB 1UQSA 3JV6B 4EDXB 1C5BL 4NQCA 4Z77A 1CE6A 4YZFF 5JORB 5D1QC 4P3DA 1B0WA 4PB9L 3QQ4A 4EBQH 5F7WC 1YN7B 4JLRA 5DVLA 3D87B 5B39G 5EBGA 1S78D 3RWIA 3ESVF 4MX7A 1RQ5A 1ND0B 3W9EA 3L7FB 2Q8BH 1G7IB 2B0SH 4FTVD 4K9EC 3TN0C 5KSAC 3BWUC 2YXFA 1ZHKB 3HS0A 1F4YH 3KPQA 3L3KB 5EU6A 3GM0A 3LKPA 5F6HI 3SDYH 1EGJL 3JBG7 4U1SA 4YHKH 5FV1L 4U1HB 4EI5B 4QRTB 4BQ6A 3FRPG 1LO0L 5KS9A 4MJIA 3VXPA 2DLEA 5JA9A 5A1AA 1KCSL 4L3EE 3BP6B 2V17H 1GHFH 1A7RH 1JNJA 2VH5L 2XKUA 3R8BB 4JHWL 4Z0XB 1A4JB 4PJFA 1AGFB 1OAXL 4AK1A 1WZ1L 4H5SB 2BCKB 2NXYB 4J3WA 4IOIA 3PGFL 3KXFE 5GJSL 5K9QI 4PGEA 5F1OB 4F7TB 1OPGL 3ZE2E 3EYVA 2B5IB 2PW1A 3A6BL 3JWDL 4FQXC 4U1MB 2RCSL 3BXNA 3SBWA 4ZMAT 6FABL 5C0AA 2YSSA 3VXMB 1KPRB 3U4EB 2CKBL 2V7HA 4S11A 3V5DA 1H0DB 1HCVA 4TULH 4JQVA 5DJYB 5F1NB 1NBZA 1F4WH 1XCQA 5JPNA 1TVHB 5D7LE 4FA8A 4XAKE 2VLRA 2PN5A 1FSKC 2F74B 5HI4D 4OCMC 2VR4A 8FABA 3CZJA 3RL1A 4TUKL 4WO4D 2Q76B 1ZGLA 1II4E 5MEPA 5GRWA 3UROR 2EDNA 4UQ2A 4WI6A 5GHWH 1NEZG 3OKLA 5D6CA 3O3BA 5BS0A 3TV3H 4FP8H 3FOLA 1A7BA 4UIKH 4MDIA 3U46A 2DYPB 1QBMH 5KSVB 2F8XC 3TLRA 4XHJC 3MRBB 2EDEA 4TSAH 2FZ3B 3HAEH 4QY8A 1MCKA 2VDRL 1F45A 3A6CL 2VLLB 4URTB 2P47B 3MLXL 1FIGH 3HZYA 1BJ8A 4WRLA 1Y0LB 1ZLVK 3V6OC 3ARPA 1R5VA 4NUGH 4MVBD 4HWBH 3KYMB 3RUGF 4J1UA 1Y6KR 3L5WA 1CDUA 3P4MA 3IDNB 3K46A 4QOKB 4NZTL 3K0WA 1BQHG 5E2UL 2IAMD 3MJ9H 1QFUH 4OLZH 4WW1A 1GGUA 2XN9D 5CWSA 1MCPL 1UACL 1QLRB 1QD0A 1T1YB 2NMSA 1OP5K 1P6FA 3DXAB 3BEVA 3DX9A 3LD8B 5T1MB 2BOCA 3G08B 2DI9A 2MSPA 1MSPA 2WW8A 4MJ6B 4YEEA 5INCA 2E6QA 1BJ1J 1NUGA 3VXQA 4LLWA 4H88H 2BSTB 4IOFD 5GS0C 3WFCH 4MCYB 2XRAH 1ZTXH 5EU7C 5KANI 3O2VH 1RJZB 1YEEL 3ZKXC 2NY2D 5E9DA 2GAZA 2P45B 1FVCB 3L3HB 4U6HB 4LPCA 5EZJB 4WVRA 3EFFB 1A7OH 1SYVA 1HHJB 5FGBC 2BVOB 4O2FB 3MRRA 3P77B 4F7PB 1F3DJ 2ARJB 3TYGH 5DJXA 1T22A 1RAMA 3MZGB 2VE6A 1U0QA 1LEIB 1N6VA 3TT1L 1YMME 2X89D 5J9PA 1GRWA 1HXYB 1UEMA 2FATL 2MOVA 4NOBA 4QF1B 3QNZB 2NTFA 4Q0XH 5K9OA 3O9WA 2X9YA 4K7FB 1EBAA 3P0YL 4KRPB 1IAII 3CNKA 1KJMB 3L1OL 5DO2D 4R6UA 3TVMB 4GRWF 5C2UB 2WQ8A 2FJHB 4R26H 1HKLL 1TITA 4HWNA 2MCPH 4J2XA 5EWIL 1NGXB 2A6IA 3OL2A 4CJ0A 3DV6B 5FUCC 3RUGA 1EK3A 3ARGD 5IUSA 1CGSH 1OGAB 2A38A 1IZKA 3I9GL 3Q5TA 4I18C 3IDYC 5GGUA 1QPPA 1L9NA 3L3JA 4JFFB 5KG9A 2OI9C 3HMXL 4HGWB 5IK3B 1JRHI 4OCRL 2UYLA 4X4ZA 1JWSA 5T1LD 1CD8A 4Y4FA 1MJUH 5HGGS 3GKWL 3NCYS 5JHDB 3D69A 1FG9C 1Y18A 4OTXL 3D2UD 5D1XB 1NGQH 1ZA3A 2ITCB 3I2CH 5EOTA 3NN8B 4EUPB 3D0LB 2FL5A 2BY3A 2IPTL 1NGZB 4LF3A 1HYSC 2QHLA 3IU3B 5C07B 4HUXB 5KVEH 3TWCH 2A9ML 1KCVL 2I07B 1KNOA 2DQHH 1J5OH 5HGAB 4NSKB 5C0BA 3NFNB 3F7YB 4LKCA 4JREC 3HRPA 5CSGA 3VXMD 5J3HD 4XBGA 1IM3B 5HYJD 5HVHB 5C0NC 1DBAH 3CDGA 2R2HA 3T0DA 3FAXA 1ZMYA 3CU7A 2IADB 3F7RA 1TCMA 2EZ0C 4X6BB 4PJGE 1P53A 3WFHB 1EHLL 2ARWA 3D18B 3BD5A 3OAZK 1K6QH 1H3TA 4UDUA 4PJXF 3AXLA 2CKNA 3LEVL 4N0FA 4IDJL 1T03L 2B2XL 4DN3L 3GUTA 4OZIF 1TJGH 1NFDF 4TUJB 2HTKD 2WBJC 3SE9H 2AJYL 1INDH 1LO5B 4HXBH 2UZYB 2FX7H 3LDBB 3SE3C 2P8PB 4GQ9H 2F5AH 4W6YB 2FECL 1F58H 4FQLL 1X3DA 4MNGB 1FFNA 1ADQH 1EFXB 1UG9A 1TETL 1VPOH 4CVZB 3UXFA 4JPKL 1AGDB 3K80A 4I0CC 4P2RB 3K1DA 5L2KA 2CO7B 1JV5A 3QEUA 4KI1A 5E0QA 1L4IA 4OQTL 4Y2DA 2EICA 3G5YA 4I0PC 1E4KC 1OQOA 4NM8H 1C5CL 5FYLD 3KAAA 1MFNA 5HHMB 1CWVA 3Q3GA 4JKPL 2DQTL 4EDWH 5A2LH 4LEXH 1EAPA 2YZ1A 1MCWW 2LQRA 5JIPA 2PYFB 4PP2A 2MPAL 1FP5A 3CLEH 2I5YH 3GSNB 4KI5F 1X7QB 1T7YA 3P73A 1I9EA 4JCLA 4OLWL 5D7JB 3SDCA 5BZDA 3FZUD 1EEUA 1Q1JH 3LKSA 1FYHB 2NY4B 1XF4A 3GMOB 3QRGH 4LSUH 3DXAD 3TPKA 2YMXH 1HHHB 3SDDB 2X40A 3NH7L 1WUNT 1QFWH 4NYLB 1WGOA 1MEXL 3RAJH 3RL2B 1BJ1H 4LQFL 2X4TA 4JFEA 4Z5RB 2L7JA 5ICZA 4U6XA 1GC1L 3FQWB 4QWWC 3HNVH 1UXSB 3BQUB 1FG2A 2KUTA 1BMGA 3ZTJH 4JN2A 3MUGB 2CDGA 2D7PA 4M1GL 1IEAB 3CFJA 5FECB 2ZCLH 1N8ZB 2UZIH 1MFDH 4PJXA 4XC3L 2OR9H 2XQBL 3SKNA 2Z31C 4OBSA 3NIFF 5GRVK 1DBML 1LDPH 3BOVA 4OZIA 3P2TA 1CG9A 1NFIA 1F3DH 2DN7A 2D9CA 4K3GA 1C5BH 1JGVL 4YH6A 3DURA 2PR4L 4PB9H 4ZTOH 1LQSR 1DFBL 2BNUA 5IW3A 1IGTB 1X5GA 3UTPD 1B0GB 3QXWA 3O4LE 1INQB 2E9BA 3F8UB 1F6LL 1R3LA 4M43H 5E8NB 3BIAX 3MRDB 2XQYK 5FHBL 4XNZB 4JRYB 4QXTA 1EO7A 4P23B 4YHIA 1YPZE 4ZFZA 1QSFE 3FO2A 1ITBB 3P11L 5FK9B 5IVZB 4ZAKC 1CXFA 2EYTB 4FFYL 1EGJH 1TNNA 4B7IA 1XH3B 2MWCA 2XA8L 1LO0H 2VLKE 2PW2A 3P30L 4NN6C 3DV4A 1KCSH 1UKTA 3FRUB 2HFFB 2F9BT 2VH5H 3QCTH 4JHWH 2GY7B 3D0VA 3SPVB 2Y5TB 1QO3A 3C6LD 1MHEB 3FCTA 3MNZA 1AP2B 4OF8A 4QHLA 1OTSD 4PLOB 5D1XD 5ID1B 1C12A 3QUMA 5IMKA 1OAXH 2BVUA 4DJMA 1WZ1H 2C26A 2WINA 5GJSH 4XPAL 1I75A 3PGFH 4IS6B 1G9NC 4MAYA 4X4XB 4POYA 1YY8B 3FQTB 1OPGH 2BHZA 1UJ3C 2H2SC 3QDGB 4GG8B 3A6BH 3JWDH 2RCSH 5C07D 4YDIL 3PDOB 3GIVA 2XZCL 5D7SL 6FABH 2XTJC 2XI9A 4PJ5E 2QR0B 4H0IA 4WWKA 5DK3A 4WTZA 1A3RL 2FJFB 2CKBH 4AMKL 3ARBC 4UNVA 3KLAA 3VDCA 1EEZB 1S7SB 3QIUB 5HTSA 2YS4A 3T0AA 4DEPC 4X7EC 5FM4A 4PGBA 5FXCH 3VRLE 5IV2A 5C0EB 5J6GB 2FO4A 1EPFA 4TUKH 2KQNA 4IMLA 3GRWA 4LVHB 5DC0A 5IKCA 2X4QB 4OZGE 4NP4L 1XIWB 1XCTB 3WYRA 4JFQB 5I71C 2GTWA 3LQZB 5IT2H 5C0CB 3DX7B 1NC4D 2UWEF 5CEZD 4X6EA 4PPTA 5IHLB 1S7XA 2A6KA 2VDRH 4WJ5B 5DVNA 3A6CH 5IB4A 1T04A 2DJ4A 2HJKB 4E0RB 1TDQA 4G7VL 1GIGL 4LVEA 2YZ8A 3PP4L 4MA1C 3MLXH 1EFXD 2KPNA 3TM6A 1KXTB 3B83A 1G9EA 4YR6A 4P2RD 2D0FA 3D3VD 3L7EA 2VSDA 1WISA 4NQEA 5FYJL 1V5JA 4NZTH 2ZUTA 2F54B 1S7TB 2EDLA 5E03A 3WNLA 5E2UH 5DMYA 4ZSOE 1V7NH 5HHMD 3EOYG 2V2TB 3P4NA 5FEBA 1LMKA 5KAQF 1MCPH 1UACH 3R0NA 4PGZA 4PJ9C 2ADGA 1D5ZB 4MCZA 3LKNA 3PUCA 2FWOB 4BUHA 4RDQF 3RWCA 4PS4L 5TE4L 3QG7L 5C09E 4HKZA 4KRLB 5I74B 1BVLB 1IL1B 5EU7E 2A73B 1GGBL 2C1OB 1HN1A 4Z7OE 4HIHA 3H9ZA 5E00B 5C0DB 3U9UA 2OS7A 2Z0BA 3WNMA 4NUJA 3SDDD 3B5GA 1N59A 5I73B 4AQOA 4PRHB 4Y19D 1YEEH 4NN5B 4KJQD 3GSUB 3KDMA 4S1SL 2RBLA 3LKRB 4FTVA 4LKXA 4JFOB 2BVQB 1T1XA 3V7MA 4X6FA 3EGSB 1I7TA 3BE1L 1G1CA 2YD3A 5D5MB 1NBYB 1JZ6A 5B38G 3ARED 1NDGB 3TT1H 1GZPA 1HQRA 3LRGA 3PABB 2FATH 1PEZA 1YNLH 4HJJL 5M94B 4HSQA 3UTOA 1TQCB 5ABDE 3KWWB 5T5NG 3P0YH 1RZ8A 3L1OH 3HRZA 3UTTB 3LV3A 2Z8RA 4OIIL 1HKLH 3N1MC 4LDEB 2H45A 5DT1L 1RK1A 3RWEA 1RUAL 4G9DB 3BPOC 4A2MA 5HI5C 3VXRD 1KGCD 4X80L 4LLVA 3UZEA 2XY1A 3I9GH 1KULA 5DJAA 4F33A 1S7WB 1J1PL 3LAFA 1KIPB 3KPSE 2Y1VA 3G5ZA 4BZYA 4OCRH 1EUTA 2QL1A 3KPOA 3H0TB 3DHJA 3D39E 1JZ5A 3GKWH 3QNYB 5EDXA 4LGRB 4OTXH 2GEEA 4RWYL 2ZUSA 3DPBA 4MA8L 2DQCL 3LKQB 4KH2A 1JWMB 1BAFL 1X5JA 1PG7L 3RWJB 2P7TA 4WO4A 1NLDH 3BI9X 5INDA 4P9HL 1BD2D 3LQAL 5HYFA 3TH2T 4UZGA 1CR9L 4KROD 4ODVL 2GK0B 2A9MH 5L9DL 1KCVH 1H5BC 3ULVC 3BPCB 1R5WA 3TC9A 3QDGD 4M5ZL 4X6CF 5CJ5A 5HGHA 4NQDE 1V3MA 4RISL 1V3JA 5J57B 5H35A 4LCWE 2VYRE 5JXED 3RVWC 5DHVB 3QIUD 2CRIA 4HC1L 5DQ9A 3GFUA 4M02A 3ZYZA 3QI9C 1EHLH 5EBLA 1E27B 2P5EE 5ANMA 3MV8E 4WGVB 3FB6B 2BXYA 3LEVH 4NT6B 2OJEB 3LSOB 4IDJH 1T03H 2B2XH 4DN3H 2HFEB 3OKEA 3T1FA 4HLZH 2IAMA 3WE6A 4U3HA 1XIWD 2X4SA 3HE6C 2LU7A 2BXZA 2XN9A 3S35X 43CAB 2AJYH 3O6LL 3DECA 3TA3D 1CTOA 4PJ8C 5FKPA 1WF5A 3DLQR 1EO8L 2NY3B 3IXTA 5K59F 4FQLH 1PD6A 1M05B 1A1MA 2VAJA 4NZUL 3G5VA 3UTQA 1NMCB 4HMCA 1FFQA 2NZIA 3IDJB 4M6ML 25C8L 2EXWD 4MXQD 1HILA 2BY1A 4D0CA 4ERSL 5MHSE 4OQTH 8CGTA 4GKNA 4P2QE 4EN3D 1LO4L 4FFVD 5HI3D 3BP7B 1C5CH 4QRUB 4ZD3L 4DAGL 3HG1E 4JKPH 2DQTH 2F54D 2GQHA 2YC1A 5B21A 4E41E 1R6VA 3QJHA 2MPAH 4FQ2L 2DRUA 3TBTA 4CAGA 4JDVB 4U1GC 3I02A 2A6DA 2C3GA 2WZPD 4Z7NE 4OLWH 4JHBA 3O3DA 1XGYL 5HGBA 3AVEA 4N5ED 2X89A 4X6CA 2DQGH 3JV6A 3MLRL 4EDXA 4Q6IB 3NH7H 1I1AC 5JORA 2VL4A 3FO9A 4KK9C 1MEXH 4LQFH 4NZJA 3RFZC 1GC1H 3D25B 5CLWA 5C6TL 1QSVA 4W4OA 2O93L 2VDLL 4PRPE 1FN4B 2XXMB 4LCCC 3VFWA 4JQXA 1GOGA 4PRHD 1K5NB 3RJQB 3SBWC 2D3VA 4M1GH 4FRWA 3OJDB 4XC3H 2XQBH 3ARGA 3BRDA 1DBMH 1IKFH 4GBXB 3DYPA 1A2YB 2FNBA 5GRXG 3WEXA 5J56B 4U1HA 1Z5LB 1K8IB 2AJXL 5B39A 2JKXA 5T1LA 1JGVH 4D2NA 1K3IA 1C7SA 3O6KH 2NZ9D 1YEDB 2PR4H 3UCRA 1KJVA 3EJYC 3BP6A 3D2UA 4ZXBC 5I8KL 3DWTA 2NLJA 2PO6B 1DFBH 4H0HB 4EI6B 3HNTL 3VI3E 1VACB 4KKBC 1A4JA 1I85A 4IRJB 5TPWH 3CDYA 1S3KH 3FB8A 1A1OB 1SHMA 4KJWD 5FHBH 3FRPA 4RFNC 4U7SA 3O8XB 4MJ5A 2J6EA 4H5SA 4QRPE 5HYSB 2BCKA 3P11H 4YAQB 4ZTPL 4F7TA 1GZQB 2R2BB 1KN4L 4PB0L 3OZ9L 4FFYH 4U1MA 3RKPA 1J9CT 3DGGB 2LAGB 1XF5A 1IRAY 4DVRL 3VXMA 3P30H 1DDHB 1KPRA 2OM5A 5AG8A 3VCLB 5I75B 2Y36L 4UNUA 1AQKL 4K7PX 1IARB 1TVHA 1BQLL 1PEWA 3QDAA 2JIXB 4HMEA 1OWRM 2FB4L 1BM3H 2F74A 5CSZB 3WFDL 4UB0H 4XPAH 3SE8L 4X4YB 4OI8A 1PG7W 1FORL 1WSST 5I1CH 4YDIH 5IW6B 3KPRB 2IBBA 2XZCH 5J06A 5D7SH 1SJVA 2W1NA 2YKLL 1KLUB 1XGTA 2Q7NA 4Y0GA 2E8ZA 1A3RH 2HN7B 4AMKH 1DVFB 4X6DE 2V7NB 1OHQA 3HUJF 4UOJA 3IJSB 4WEBL 3T4AA 4JANA 5I8CB 2VLLA 3RTQB 1NEZA 2E9WA 3MRMA 3KYKL 1IT9L 3NPSB 4FHBD 3P9LB 2AXGB 4MNQD 3OR6B 2DLIA 1AR2A 4ZG1A 4XP1L 4RGMC 3FOMA 1F6AB 1X5AA 2FH8A 1NANI 1FQ9C 1A6AB 4AZ8A 2Q3ZA 4GOSA 4NP4H 5IMLA 1UKQA 2JJUA 3MO1B 2DIAA 1T1ZB 2F19L 4FFWD 4Y5YA 1DQQB 3G6AB 4DKEL 2QQNL 3HZVA 1GJIA 2CR6A 2P8MB 2ERJC 5I16A 3UX9B 4GG6B 1QLRA 1JVKA 3IFPA 1YY9D 2Z91A 4WENB 1T1YA 3O9WC 4NO0B 3MUJA 3DXAA 4ORZC 5T1MA 4G7VH 4F7EA 1GIGH 4MJ6A 3PP4H 3O3EB 4ISVB 1BQHA 1L0YA 2BSTA 3QEGH 4ZFGL 1P4BL 3R0MA 3CU1A 1CD0A 3HE7C 3IJYB 3MLYL 4MCYA 1RJCA 3H6JA 5TQ2L 5FYJH 4OB5L 1ZLWH 1RJZA 4DUWA 2UUDK 1U2CA 4OCWL 4B7LA 5EZJA 1Z9OA 1JI1A 1HHJA 2BVOA 4YDJA 3GMLB 4O2FA 4CN6A 5T3ZD 3WLWD 4PS4H 5TE4H 4YE4L 3QG7H 5L88L 1I3RB 5DZOA 4PLKD 1LEIA 1RUML 5CZVL 1GGBH 2ZOKB 1CICB 3TO2B 2FJGA 1NAKH 5C1MB 4OF5A 5T1KB 4K7FA 5F72S 5GPRA 2NXZC 4XTRC 3MJ6A 2OLDA 3ZYJA 2R56L 5A16A 5I9QC 4S1SH 3TVMA 4JY6A 1FVDB 4WDIB 4XAWL 3VRJA 1UXWB 3I50L 2X1XR 1NGXA 4OZHE 5EA0L 3BE1H 1T5WB 3T8XA 3KPTA 4LSDA 3A0OA 1HYRC 2Q7YB 4HJJH 5J1AB 4HGWA 5IK3A 3VH8B 3DETD 2OBGA 3ZMRA 5FYKE 3C6LA 4GS7B 4XNYL 2A74B 4TTGA 5D1XA 4X83A 1U36A 3OKNA 3NN8A 2J7LA 2KZ1B 3HAEB 4OIIH 1IEBB 4HS3A 5DT1H 1SY6L 2DM2A 1EDQA 1RUAH 2W60A 3IU3A 3O8XD 5C07A 4GAFB 2J8UF 4X80H 4XGZB 2ZUQB 3IT8D 5SWSE 1J1PH 2PCPB 3EYOB 3ARVA 3FQUB 3I84A 3W0WB 4GUPB 3F5WB 2OYPA 4NSKA 3NFNA 3J8F7 2V6HA 4M8QB 3B9KB 1IM3A 3ALXA 1MCOL 3VMOA 1KV3A 5GGRB 3ZKND 3ZHDA 4Y2DC 4RWYH 2IADA 1ZWIB 4MA8H 2DQCH 3QEQE 1BAFH 1PG7H 4PJAB 2JIXD 2X6MA 1BREA 3SE4A 3QQNA 2NY0D 1MJJB 4P9HH 1MFCL 1KYOJ 3LQAH 5ACMA 1CR9H 5DEZA 4ODVH 4I13B 5L9DH 1EBPA 5I1JL 1JHLL 4N0CC 3CVHL 4M5ZH 1NC4A 2C4FU 4MSWB 5AD0B 3SDCC 3M8OL 3H9SB 4ODTL 4BH8A 5MEQA 1R3HB 1TZHB 3MRJB 1OSZA 4RISH 3QO1A 5A3IC 5HHXH 1JWUA 4QTIL 1HIML 3QDMB 5F9WB 4MNGA 3IFOB 1EFXA 4E5XB 4HC1H 4M93C 3T0EE 3GSRB 4PJHE 1AGDA 3RTQD 4HUKB 2X4RB 4P2RA 3U2SB 1QRNB 4KKCC 3ZL4L 1RHHA 3S5LB 2FRGP 1YZZA 1PJ9A 1KCUL 4EIZC 3OKYA 4NQCE 3RVVD 1ZT1A 5GZOD 3SQBA 4PJ7E 4V2CB 4JM2C 3O6LH 3Q48A 2R9HC 3KPMB 3SGKA 2AEIT 3MV7B 4F2MA 1IAOB 1EO8H 3C60D 3VFTA 2BNQD 3H3KA 1TIUA 2J8UA 2YBRA 1CD9B 5I6XC 2ZP0T 3K2UL 4NZUH 4QRRE 3U1SL 3SCMD 4M6MH 25C8H 4DOHE 4FABL 4HIXL 3SDDA 3BSZL 4ERSH 4NYLA 4G80A 5T3XD 3KHOA 3RL2A 4Y19A 4Z5RA 3B5HA 4K3JL 4CVWA 1AY1H 4LHJB 1LO4H 4ETQB 2YK1L 4ZD3H 4DAGH 5KS9E 1PZUB 4MJIE 3N1GC 3TBSA 1RULL 1M71B 5D2NC 1H3UA 3QIBD 1ETZA 1WTGT 2M1KA 3B9EA 4GAYA 4KK6D 1RURL 3G5XB 1N8ZA 1CDIA 4FQ2H 3STLA 2BDNL 4N8VB 3AGVA 3SO3C 3VWKB 1J0IA 3AREA 4PJFE 4O2EB 3MLRH 3K7UA 3GBNL 2Y6SC 4LVOC 5DJ2B 5FCSH 3E3QC 3TYFB 5F9DC 2R2EA 2ICWJ 4YFLF 5C6TH 4XBEL 4JO3H 15C8L 4MAYC 5C0AE 5IJVB 2VDLH 2O26U 1BFVL 5HGDA 4F80A 2CJUL 4RCAA 1F02I 1QNZL 2DF3A 5B4MD 1U8LA 4KK5C 1WIPA 3VXRA 5IM7B 4WWKC 2AJZB 5EORL 5IVZA 1MFBL 1WT5C 4MQ7B 2VLRE 3VW3L 3QIWB 4UT6H 5JMOC 3EJJX 4DUXA 2R23A 4N8PA 4YZFE 1XH3A 2AJXH 4PRDA 2VL5B 5C6WH 4JO1H 1UCBL 2XIDA 4P2YA 4J8RA 4AENB 3S3PA 3DRQB 1WIUA 2CGRL 3CSBA 1HQ4B 5I8KH 5BS0E 5CIPH 3U82B 3HNTH 1S5HA 4EXKA 3SPVA 1BIHA 3BISA 1AP2A 5ID1A 2EIZA 3O2DA 3GHEL 5A43C 1LD9B 1BD2A 5DSCB 3NCBB 5TDOB 4ZTPH 1YY8A 3FQTA 5D1ZD 1KN4H 3QDGA 3OZ9H 4PB0H 5J12B 4M8VA 3QA3A 3QAZC 1T3FA 1TXKA 3TT3L 1ED3A 2IH3B 3VG9C 4DVRH 5FYJU 32C2B 1MIML 4WCYL 2I9TA 2FO1A 4HGKC 2FJFA 5JXEA 1CE1L 2Y36H 1EEZA 3ZTNL 1S7SA 2CMRL 3QIUA 1AQKH 1M1SA 4KVNL 1ULVA 1BQLH 2DLHA 4GO6B 5ILTL 4LIQE 4XCYA 2FB4H 4L4TE 3ECBB 1WC7A 4XNQB 2BVTA 5GGRY 3WFDH 5C0EA 1VFUA 3DVGB 1VGKB 2DIBA 2BNRD 1FORH 2IEPA 3DVNA 3ZTJG 5H37G 2X4OA 2X4QA 1T7ZA 1XIWA 5AEAA 4J12A 4KHTL 1AQDB 1FO0L 2IALB 3TA3A 1L6ZA 2R2CA 1J8HB 1T4KA 2HKHL 2YKLH 2YPLE 1HXMB 4PP1D 4KRMB 5KJRL 4QNPF 5EU3B 2JB6B 2NYYC 1A7PL 4WEBH 5E9DE 1FH5L 1FZKB 4PLJD 1EZVX 2FR4B 2ATKB 2RB8A 1A7QL 3IDMA 1KBGL 3KYKH 1L9MA 3MJ7B 4YPGB 3ES6A 4XP1H 2CLVB 2WWMD 4EN3A 5DD0L 2NR6D 5T5NF 4YHNA 4FNLL 1SBSL 1IGCL 2F19H 4JE4B 1SJHB 2FX8L 4DKEH 2QQNH 2F54A 4EIGB 5EOQL 1CFNB 4NC1C 1AXSA 2YPKB 3VXSE 3S9DB 4PRAA 1D5ZA 1JK8B 4JAMB 3VD9A 4WFEE 4HCRH 3VFOB 4GRLD 5HHVL 3TFKD 1BVLA 1U8QA 2NY6B 2A73A 4HULB 4ZFGH 1TJIL 1P4BH 4H1LH 5HVFB 3MLYH 2B1HH 2Z4QB 5TQ2H 3GHBL 5D2LF 4PRHA 5IHZB 4HAGA 5HHOD 3GSUA 4OCWH 4OV5B 5D7KD 4CVXA 4MA3B 1DUYB 1CT8B 1S7UB 3TJHC 4Q7DA 3EGSA 4NRYA 4YE4H 4G9FB 3JV0A 3BUTA 5D5MA 5D71L 3WHE1 5L88H 5LKNA 1UC6A 4PBXA 4K71B 3UAJC 1RUMH 5CZVH 3FO0L 3A67L 2VLJB 4MD0A 3MGTA 4WO4C 5MEOB 4CW1B 1MY5A 2ENSA 2EIBA 5CMAB 5C71A 3ZKMD 4UINL 4XAWH 4OF7A 5E99L 3I50H 4Y5XB 4L29A 4U3CA 4G9DA 5EA0H 4WUUE 3RU8L 2H8PB 2G2RB 4HJGB 2HRLA 3BVNB 5ALCL 3ROOB 2O61A 4RNRB 1UYWL 1KC5L 1OCWL 2QADD 3E0GA 4XXDB 3VA6A 1WWBX 4L8SB 4OAWB 1AC6A 1E28A 4HV8B 3WNKA 3QNYA 4NHCL 3B4NA 4GRWE 5FA4B 1OLLA 3NA9L 4XNYH 1D9KB 4G8FA 4PJEF 4NO2B 5D6DC 1N6UA 4LQ1A 4S10A 1I8MB 3C5SA 4Y2OA 2R1WB 1JWMA 3FN9A 4UIMB 2NY1C 5IEHB 1TZIB 3B9VA 3T4YB 2IAMC 1H15A 4OGYL 1SY6H 2HP4A 1SJXA 5F1SA 5CEYB 1SBBA 4KMQA 5D2LA 2GK0A 4RA3A 1OM3L 1XZ0B 4X9BA 3N1QC 2VB5A 5C08E 4UU9B 1JTOA 1MWAL 3VXTA 1ZXQA 2VWEC 4IOFC 2VDML 3AAZB 1QKZL 1MCOH 4Z7WF 1EJOL 4MNQA 2NY2C 4OZFH 1FRGL 3X13B 1BF2A 1FZMA 1FCCA 1Z0NA 1MFCH 4NT6A 3LSOA 1BLNB 4FXKB 5I1JH 1JHLH 2DICA 3CVHH 2HFEA 1RZJC 2BSRA 3IXAA 5TDNB 5DEFB 3CK0L 3M8OH 4HUMB 4ODTH 4AIOA 4I9WD 1XGPA 4OD3L 4JFEE 4X8XA 2AQ2A 1MCHA 3PXJA 1J8HD 2HT2D 4QTIH 3B3IB 1E4WL 2WWKT 4LLDA 4X98B 1FE8L 3DYOA 4PJXE 1F90L 3IDJA 2ZG2A 4JQXC 4YC2B 1KSRA 3LKOB 4OZIE 3ZL4H 4RAHA 3SKJL 1NFDE 3FQRB 1KIQA 4HH9B 1KCUH 1T2JA 3VMNA 2C4XA 4NJ9L 3LEYL 4YFLI 3VE0A 5LGKA 3VFUA 4EI5C 3MPCA 4HJ0D 3ZE0F 2ZG1A 4MQXC 5TGBB 2O5XL 1CGWA 4TN9A 2X4NB 1HINL 1W0WB 1CQYA 4LCUB 3OJ2C 3K2UH 1YECL 3U1SH 4YBLB 4YO0B 4XMPL 4FABH 4XP4L 2FBOJ 4HIXH 1I85C 4Q6IA 3BSZH 5I66B 5HYQB 3TH3T 4K3JH 4KZEL 4MWFB 2ZNXA 5EZIL 4U2YA 2NXYC 1J86A 1H3PL 5JUEL 2YK1H 1FN4A 3SY0B 1YMHB 4WFGE 1RULH 2B5IC 3KPPA 4ZFFB 5C92A 4KI5E 4ODXB 3RWGA 3FB5A 1RURH 3OJDA 4WW2F 1GGIL 2BDNH 5HHNB 5J3HC 3E3QE 4HT1L 3RGHA 3LY6A 3U0TA 3CXHK 2C1PB 4G9FD 1K8IA 3GBNH 3EJZD 4JVWA 4JRXB 4W4NA 5F3HB 1RZJL 4C58B 3PWLB 1LE5A 2JCCF 2XG5A 3KVQA 2CPCA 2XKNB 2EE6A 3ARFB 4XBEH 1UH3A 4PRNB 4XI5D 4EZMA 15C8H 5I2IB 1BFVH 2XWBB 1MHPL 4L1DA 2HMID 3RX7A 4M61B 1A1OA 1CDCA 1K3ZA 2CJUH 3NIFE 2VZSA 1QNZH 2VZTA 2WK2A 5E8OA 3O8XA 4EEEA 5HYSA 1AO7D 4GW4B 4Y1AE 5EORH 1FFRA 1MFBH 3VW3H 3V79C 3K74B 4IRSD 1WVZA 1I7UB 3DMMD 1JFQL 5MP6L 1GGTA 1D5BB 1UCBH 1J7VR 1HH9B 4FXLA 4L8DB 1DDHA 4RMSA 3HI1A 2CGRH 5MERB 3MV9B 5D1QD 3VCLA 5B3NA 2VABA 1ZAGA 4TQEL 1WZMA 1P4LA 1FAIL 1EERB 2GW5A 2JIXA 3BT2L 5L8JB 5F89B 5EH1A 2FGZA 1OAYL 1BBDL 3GHEH 5F9OL 4ZDHB 3GGWB 4X4YA 3KHQA 3SDAB 3MLTB 2PTTA 4O5LL 2CLRB 5KSAD 3B6SB 5ESVB 3TN0D 3C8KB 1WAAF 5ID0B 1J05B 3TT3H 3FZUC 4L5FL 3HNSL 4U0RB 3PJSB 1MIMH 4RX4D 2AV1A 4WCYH 3LD8C 4HKXA 2HN7A 3X14B 4WW2A 1KCRL 1CE1H 3BIBX 3ZTNH 4NQEE 2E6PA 2CMRH 1NC2D 3OXRB 3KPNB 3IJSA 4FZEL 1CVRA 3RZWA 2P43B 5BJTA 3I6GA 4KVNH 3FB7A 4P46B 3BP4A 3RTQA 5ILTH 5HDQL 5ITBL 5FO9B 2AXGA 3OR6A 1S7VA 3OXSA 1M7DB 5DWUL 1CYGA 3PP3H 2Y4SA 4KHTH 1FO0H 5IP4A 2KZWA 1C08A 1KCLA 3G6AA 2HKHH 5DC4B 3C60A 2A0LD 1DR9A 2BNQA 2E7HA 4HK0B 5KJRH 4XBPB 5I17B 3MRHB 3RNKB 5I1HL 1IQDA 4GG6A 5HY9B 1A7PH 4IEFB 2VISB 1FH5H 3ZDXE 4GKZB 5F7FA 2CH8A 2UZXB 1A7QH 1REIA 4NO0A 1KBGH 4FTVE 4P49A 1JGUL 4KRPC 1ZE3C 1MFEL 3O3EA 4ISVA 3V95A 3TVMC 2YRZA 3X3FL 1KTDB 3Q6GL 4JZNA 3SQOL 5DUBA 5DD0H 5IVXB 4ZS7L 2FEDC 4FNLH 1SBSH 5EBMB 1MHHB 1IGCH 2UWEE 1F4HA 5JQHC 2FX8H 3QIBA 5EOQH 5HDLA 1JMZA 2VDQL 2X1WL 3GB7A 3KLHC 4TSCL 3U36A 5DMKA 5JW5A 2R39A 3GMLA 4Y4KD 5CINL 1WAAA 2EO1A 2NNAB 5IWLC 5E5UB 1B6UA 3BPNB 1GH7A 3W82A 4NQSA 5D7IF 5HHVH 2J2ZA 1OTSC 1G0XA 1GL4B 5D1XC 5KN5B 4PJAF 3LN4A 1CICA 1TJIH 3LN5A 5I19L 5LGHL 2R0LL 3WN5B 5AZEL 1IGFL 1MLBA 3K8MA 2O5ZL 3MRKA 5IOPB 3GHBH 5EZLB 5C3LD 1FL3B 4H0GA 3U79A 3WIIL 1HSAB 3EO1A 4YHZL 2V5TA 5DK0B 4JDTL 1G0YR 5IB5B 4QRQB 4D8PB 1FVDA 1T5XB 4K3DL 4WDIA 4AT6A 1PY4A 1FGNL 3OR7B 3ARXA 5DJCA 2VTFA 1IAKA 2V5YA 1DN0B 5D71H 5GIRA 5HVHC 1N26A 5HPMB 2D0HA 2Q7YA 5J1AA 5JQ6L 1U3HB 3VH8A 3MTRA 1JPFA 3FO0H 4GRMA 5EUKB 3A67H 5GS0D 2AJSL 1I1FA 3C9NB 1ZVSA 4Y8DC 5E8EB 4PJIF 3I75B 3CFDA 4UINH 5BRZB 3EDDA 5E99H 1RK0A 5D1ZA 4DGIH 2M26A 3E6HB 2AV7B 2GSGB 1M6OB 1AHWB 3BZEB 4KDTC 4PJDF 3LDBC 1VKXA 2WSKA 2PCPA 3EYOA 3PG2A 5ALCH 5ANME 4IMKA 1FLTX 3FQUA 4HWBA 1JHKL 1UYWH 1OCWH 1A02N 3SDXF 1VA9A 4M9OA 1AD9B 1PY9A 4NRZB 4M8QA 4J4PC 4NHCH 1J87A 3NA9H 3QP3A 3HFML 3MJ9A 2XN9E 5D7IA 5DJDA 3FT2B 2RFXA 3VGGA 3C5ZB 4PJAA 2GFBB 4OGYH 2BNRA 4LPXA 2WUBL 2D4FA 1MJJA 3SGKC 3MJ8A 1U41A 5ADOL 4YGAB 4M4PA 1OM3H 4F9LA 2W0LA 3B2VL 4W68A 2WP3T 4ZUVB 1MWAH 2DAVA 1TZHA 4PRIB 2NY4C 2NPLX 4Q58C 4EQ2A 4LDLB 2VDMH 1QKZH 4G8EB 3UEZA 3SDDC 5DJZB 1HOCB 2C5DC 1I7ZB 5FYKL 1GXEA 2OQJB 3IFOA 3P40A 1EJOH 2YPVH 4KJQC 3W5MA 1L7TL 1FRGH 1IC1A 2PYED 3BQUC 1O5DT 1XR9B 5F7DB 3OX8B 2N4IA 4Z7UF 1L0QA 1U8JA 1A4KA 2N7BA 1CFTB 4X6CE 5SWZB 2BOBA 3E2HC 3CK0H 3AREC 4PJIA 1VB9A 1IM9D 3DROA 4OD3H 2G5BB 2NW3B 5ENWB 1I1CA 1BOGA 4YGVB 4D9RE 1E4WH 2MMXA 1NLBL 4GRLA 2G60L 1MJ7L 4PJDA 3QQ9C 1FE8H 1JNHB 2EZ0D 1F90H 5JNYA 1ZHLA 2VQUA 2P24B 3DVFA 5SX4H 1PGRB 4CN4A 2VO5A 4AM0A 3SKJH 3DIFB 4P23C 5KBNC 3HPLB 3VXUE 2AJ3B 1CDYA 1U93B 5MI0B 5EBWB 1OTUC 4NJ9H 3LEYH 1XFPA 1M71A 2BK8A 1KJ2L 5K59E 2WBJD 5K9QG 1IC4L 2WIIB 4U33A 4K7PY 2OMNA 2O5XH 2YN3A 1HINH 1NBQA 3JWNC 2H1PL 1QSZA 2K7PA 4DVBA 3DX8B 1YECH 2YXMA 5F6HJ 4JY4B 1JN6B 4XP6L 1TVBA 1UB5B 1F97A 3PHQB 4XMPH 5DJ2A 4XP4H 4OD2B 2ZCHL 4S2SB 3GSNL 2PF6A 4HZAA 4U1KB 3SKMB 3TYFA 3VFSB 1SMAA 5FDYA 5E1AA 4KZEH 5EZIH 1C16A 3QFDA 5TDPA 5CJXA 1H3PH 1LK2A 5JUEH 3RPKA 3V6BR 3CFBA 1QR4A 5HYJE 5EC1B 2Y25A 3D5OF 4CMMA 5SWQA 4JM4L 3NCFB 4Z7UA 1GGIH 1IGML 4PJCF 3QIWA 2VDOL 3ILQC 2OX5A 3QIUC 5DD3H 3AY4A 2VL5A 3F65A 1A64A 1RZJH 3IGAB 1FL6B 1DJSA 4D0DA 3T77B 4NM4H 3ABZA 3ZHLA 3STZB 4LVHC 1MHPH 4JJHA 3LEXB 1XIWC 5JW3L 1ADQA 1QLFB 1A1NB 1ORSB 2Z31D 2ED9A 3FQXB 1JFQH 4P3WA 5MP6H 4UV7L 1HHKA 5DA0B 1T21A 3CPLB 5GGSY 5FYLE 5A40E 4TQEH 1IQWL 1FAIH 4ODWB 5E8PB 1RJLB 1YC7A 4DK3A 3BT2H 4FFVC 4HWUA 1OAYH 1BBDH 2J4WH 5F7EL 5F9OH 2JK5B 3QHTC 4LEOB 5KANG 4O5LH 1VGKA 2BP3A 3RA7L 2X9XA 2AKRB 4L5FH 3HNSH 1G7HA 3MBEB 4N5EC 2IALA 3EHBC 4LBEB 5I30L 1J8HA 4FS0A 3BZ4A 4P0DA 4R9HA 5I74C 1QBBA 1KCRH 3AFLA 4UQ3B 1H3XA 5FM5M 5I1DA 4PGJA 3PWPB 4PRID 4PJCA 4FZEH 5FYJD 4HG4K 4HH8A 3RJDA 2EIDA 2FR4A 2ATKA 3GDBA 5I73C 5HDQH 2FX9L 5I76B 5ITBH 5EUOB 5JTWA 2W91A 2BSED 4NN5C 3MGAA 3CSYB 5IW1B 2CLVA 5DWUH 2V9RA 3L3DB 3PL6B 1SJHA 1IGJB 2VR9A 3HUJE 2YPKA 1FC2D 5HXMA 5I1HH 3GMPB 3ARBD 1EXUA 4JAMA 2BHYA 4Z76B 3ROLB 4LLQA 3BD4A 4FXGA 1TQCC 2FHBA 3HN3A 1JGUH 5K9JL 1MFEH 3HZKA 2P5WB 4KJWC 1BOYA 2OMBA 1MJ8L 1EGJA 4HIJA 3FQNB 3X3FH 3Q6GH 3V4PL 3K2MC 3SQOH 2LV4A 4N8CL 2Z4QA 1K85A 2HJLB 3DUUB 2VDQH 5CIPB 3OF6D 1DUYA 1CT8A 5HHPA 1S7UA 4TSCH 1NGYB 3MMEA 4GW5B 5CINH 1UZ8B 4I5BB 4XC1L 3DSFL 1EMTL 3BAEL 4G9FA 3PWNB 3GKZA 2AK4B 1XR8B 4HUVB 4MB4A 1JF1A 3MGOB 4YDVB 2HG5B 4U3XA 1BFSA 5I19H 3TEUA 5LGHH 1DTUA 2O5YL 2R0LH 4BFGA 5AZEH 1D5XB 2MHAB 1IGFH 2CK2A 2O5ZH 5MEOA 3TH4T 3SGJA 3ARSA 2CKBA 3WIIH 5CMAA 5D72L 5EN2B 4YHZH 4JDTH 1AO7A 1YEGL 3GJFK 5DMJB 3CMOH 4WTWA 4IRSA 2RHEA 5C70A 5J1TC 1FGNH 4OKVB 1U91A 3DMMA 2EYSB 4M62L 1RZGB 5C0IB 3IJHB 3DUHA 3CFIC 1U95B 3BVNA 3ROOA 2A1WL 2VR5A 5JQ6H 5D1QA 2ICCA 4L8SA 3NTCL 4OAWA 4BELD 4F15B 3OG6B 1JYWA 2AJSH 5J6HA 4J3VA 5CEZE 2YR3A 4NO2A 2W9DL 4P48A 3P9MB 1G6RL 1I8MA 1MQKL 2IQ9L 5F1IB 5CHNB 1VCAA 1S9KC 5IEHA 1TZIA 1TCRB 3T4YA 1AXTL 4L3EB 5CLTA 3TN0A 3X17A 5KSAA 1Q9WB 2QQLL 4JCMA 2DI7A 5C9JA 4G6JH 1XF2B 1FYTE 1ORQB 5CEYA 2NY3C 5J7CC 4RX4A 3D3VE 1VEOA 1A9EA 3HR5B 3VFVA 1JHKH 5KVDL 1AGCB 4Q2ZA 3KXFB 3QWOB 1NMCC 1TVDA 4PD4K 4NQXB 3AAZA 3HFMH 4EOWL 2EDKA 3T0XA 3KR3L 3VI4E 1QBLL 2HT4D 1ZHBB 3X13A 4G8GE 2J8UE 5KZCB 3GMNA 2WUBH 5JOPE 5D7LB 5JZ7C 5ADOH 4EUPH 5HI5D 1OQXA 3O6ML 4MZ3A 3B2VH 4H1LB 4NGHL 2DKSA 4Y19E 4FQIH 3WS3A 3BJLA 1WBXB 4Q6IC 3QNXB 5H2BA 5FYK