3QXWA

Free structure of an anti-methotrexate cdr1-4 graft vhh antibody
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
b'QVQLVESGGGLVQAGGSLRLSCAASRRSSRSWAMAWFRQAPGKEREFVAKISGDGRLTTYGDSVKGRFTISRDNAEYLVYLQMDSLKPEDTAVYYCAADDNYVTASWRSGPDYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-Methotrexate CDR1-4 Graft VHH
publication title An anti-hapten camelid antibody reveals a cryptic binding site with significant energetic contributions from a nonhypervariable loop.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 29
structure length 124
sequence length 124
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qxwA00
5D1QC 4AEEA 4YHLL 2BRRL 2BDNH 4HIIA 1IC7H 1MFDL 2FEDD 4L4VB 2FHCA 4PS4L 3IDUA 3KG5A 3HPLA 1ITBB 4NOFA 3ARGB 1G9NC 1ZT1A 2O5XL 4JAMA 4JRXE 3VRJA 1WT5A 1PGRB 5DRXB 2HN7B 4G9FD 1AI1H 1T04B 4BZ1L 1QA9A 3GSOA 3GMQA 4KFZC 3SN6N 5DMGD 1KTDB 4MNGB 4HBQA 4HWBA 4XAWH 3EDJA 4RMRA 4WUUE 2AEWA 3K0WA 1U3JA 2ORBL 1Q9LA 3RWJB 1FPTH 2EEDA 5E1AB 3DARA 4JANA 4UILH 2VAAA 1TZGH 4U0RB 3FCTB 2YD8A 5GGSY 4NHUA 3BEVB 3PGFL 2DQJH 1I9EA 2DQGL 2ADFL 1K8IA 3T4AB 3G5VA 1IGMH 1A0QL 1IM3B 2V5YA 1G6VK 4ZUVB 2VB5A 3DOSA 1P4BL 1J0HA 2VLRB 4WWKA 3DRTA 1AY1L 3I75A 4C58B 4F7EA 4XCNB 4I0PB 4Z8FH 4KQ3L 2HTKC 1KCUH 3WNNA 2P47B 1DQLH 3SO5A 1BJ1J 5IBLC 1BOYA 3SBWA 5CHNA 1T7VA 1DJSA 5FIEA 2VNCA 3MV7E 1FZOA 3IDMA 3U7WH 2HRPL 2MQ0A 2DB8A 3DX9A 4G6FD 4HIHA 4U6XA 5ELIA 5FYKD 5FKAB 4YXHL 1CD1A 4KPHH 1JN6B 4XP4H 3BH8A 1H5BB 1A7QL 3HAEB 4YHPB 1MCRA 1RULL 3EGSB 1ND0A 5E56A 2MPAL 4Z7OF 1PFCA 5DD1L 4Z76B 1BQHA 2VR5A 2E27L 4XP5H 3P0YH 4TSCL 4QHMA 1K5NB 5BZWA 4OM0H 3HI5H 5ETUA 4LP5A 3FQUB 3VI3E 2CKBA 1Q0XH 3CH1B 4XC1H 3CDGA 4GOSA 1R3JA 1U8OB 3FZUC 3JUZA 4PLOB 1VEPA 5DD0L 2Z8SA 3PJSA 3KNBB 3MC0A 5GSVB 4DFIA 1P2CA 3LQZB 4HH9A 5IQ9A 2JJSC 1NPUA 3MJ9H 1GGTA 1EFXD 2VJXA 5LGHL 3BQUA 2XG5A 4RGOL 3GB7B 3VXQA 4LNRA 4DVBA 4RSVA 5I8OL 3O6FB 4QTIL 1GCFA 4O4YH 2OZ4A 3PQYA 3BN9C 1I85A 2YS4A 3PWPB 3RIFF 2P8MA 4G43A 1UENA 4UB0H 4TVPL 5DC0A 1LEGB 4JGUA 1MH5A 3H7BA 4DAGH 1R3KB 3HCVB 1TNMA 1E4XH 2O61A 1Z2KA 3CXDH 5TGBA 4X7SH 4KI5F 4P2YA 4PBXA 1I1RA 4XWOC 3WFDL 5E5RB 5C2UB 2I5YL 3NGBC 4UTBH 2NR6C 3THML 5DJXB 3DMMD 1S7TA 3VFPB 3VDBA 4ETQB 5EORL 1MRFL 3ME0A 2X7LB 3GHEH 3BP7A 1DEEB 1NLDH 2FYYA 4I1NB 3EOAB 2ATKA 2KUTA 4Z7VB 3WKNA 4O58H 2NY5L 3CFDA 3FO2B 3ZDZF 4LQ1A 1KEGH 1NC2B 2Y1VA 3LKQA 1IEAB 1N0LA 1YEGL 3C60C 1LK2B 4NQCB 3G6JA 4GRWF 3VXOA 2IQ9L 4PLJC 4U4BA 5DFVD 1S7QA 1P4IL 2DLFH 1KOAA 1IBGL 2YWZA 3FN0L 1GGCH 2EDNA 4EI5A 3MGOA 3I50L 5ITBL 1IILE 5E2UL 2R4RH 3K8KA 1D5MB 1YNTA 4ELKA 1E4WH 4I3RH 4O2CA 5T3ZH 3BP5A 3P9MB 3C2AL 1AGCA 1Z0NA 2VZVA 3PUCA 2ED9A 5DJCA 9CGTA 4HSQA 4LASH 4XNYL 1FLTX 3FHAA 1HZHL 5JLZA 1C16A 4M48H 4ZUTB 3ZHLA 3FQXB 5INDA 3SCMB 1I1YA 2EDJA 1A6WH 4YFLF 1OB1A 3IDXH 3V2AR 2H9GA 2LAAA 3T0EC 3QG7L 4JQIH 1AXSB 4DTGH 4HJJH 4JPIB 3SGKC 1TJHH 1C5BH 3GMPB 1KJ3L 3W0WA 2BCKB 4JM2C 4K7PL 1MVUA 4XNXH 2VLKE 4Z0BL 5L0QC 1UM5L 3HC3H 1EEYA 4G6ML 1QPXA 5J57B 4V2BA 3O3BA 4Q9BA 1AO7D 5IVXE 2P1YA 2A83A 3EYQC 2AEPH 4M3KB 4QHNB 5I1LA 4W4OC 4J3UA 1MHEA 4ZOEA 2D03L 5D93C 5DJ0A 3D18A 4S2SA 5I75B 7CGTA 3GMLB 5HVFB 4XVJL 4ZPVB 1ZMYA 4NZUL 1MPAH 4JR9L 1MHPL 2EIBA 4NM4H 3VI4F 5C7XH 2ZNWA 2FX9H 3FONB 4LLUA 5JW5B 5DK3A 4ZS6C 3OF6D 2NNAB 1HK6A 4JN1H 1PKQA 3QIBC 4BH8A 3DXAE 3VFOB 3ZKQD 4TNWF 1QSFE 3FO1A 1U8LA 4Z7QE 3BPNC 4MX7A 1H8NA 2X70B 4R4ND 3QUXD 5SV4A 1ZVSB 4YHYB 2ZUUA 2AQ2A 4HWZA 1RUAL 1QRNA 4K3EL 3FAXA 4KK9C 3ULUC 4XTRC 5GGVY 1ZGLB 2V7NA 3FRPA 3PWLB 3JV6A 3ILQD 1TZHA 3HNVL 3RWGB 2UZIH 3OB8A 1B6DA 1QD0A 2QSCL 4GT7A 4PRAB 4XCCL 3VRIB 4MS8D 4RIRB 1QHPA 5IG7B 1KCVL 2QSVA 1C5DA 3S7GA 4J4PD 1A1NA 1BLNB 2R15A 4XZUA 4N8CH 4AEIH 1VGEH 3C5JA 2CUHA 5E9DB 3NH7H 2E9BA 2CJUL 3PHOA 2ZJSH 1OT2A 3VH8G 5GS2D 3INUH 3UTTE 1CE6A 1HKFA 5D7LD 3K8MA 1D5XA 1NKOA 2FSEB 4Z7WF 1NGQH 5IVZB 5I1CL 4GKSB 5GGVL 3RY6C 4L1HA 4OFYD 2ICWI 4LSSL 5IT2L 4X7FC 3EYOA 3X11B 3TA3C 1T7WA 2LU4A 2H45A 3QDGB 1MFAL 5C0ND 1MLBB 4I77L 5JOEA 1YJDC 2Z35A 2IPKB 32C2A 1BVZA 1P6FA 3LZFH 5FB8B 2H32H 1F11A 4CBPA 1EHLH 4QWWD 1ZLSL 4JFEE 1IGCL 1XEDA 4NO3A 1LK3H 2VISB 1LO0L 4WV1A 3SDDA 1VFAA 3GUTA 4IMLB 2J6EH 3HPJA 1L7TL 3Q48A 4Y4FA 2VWEE 5DVNA 5L2KA 3TWCL 4A6YH 15C8H 2AK4D 1GZPB 3O6KL 4YZFF 1BVLB 1PD6A 4MJ4A 3PWNA 4X5WB 2KQNA 4MXQC 3VGAB 1ZLVK 4PV8B 5DHVA 3T0EA 1OTTD 5HGHA 2P24B 1FVDB 2A1WH 3DYPA 3SGKA 4HPOH 5FM4A 4RNRB 4X98B 1B9ZA 4M43H 4PR5A 3QULB 4KRPB 3HNTH 5LAXB 4FQIL 1BREA 1PBYA 1ZS8B 1JGVH 4LVOC 1R3HB 1U8PA 1XH3A 4PB9L 1PEWA 1QBMH 2ZG3A 4XGZB 3C9NA 4BZ2L 3QEQA 2AJUL 1H15B 2R1YA 5C07B 1KEML 2WINB 4ZPTB 3QIBA 1FRGL 1U8NA 1GIGL 1AQKL 1H0DB 4G3YL 1HYRC 4KRMB 2Q8AL 4YE4L 3VH8B 1N5YH 5JDSB 2HJFB 4YBHA 3TO2A 1LO3H 1RIUH 2NY3C 4OF7A 5KN5B 3VCLA 1YYML 3G9AB 1D6VL 4UOW0 5DI8B 3E6HA 3I85A 3MOAL 4YPJA 2AEQL 3BP6B 5B38G 2X4UB 4XWGL 5I1HH 5HI5D 1KG0A 3EZJB 3KYNA 2YR3A 2Q3ZA 2LU3A 1NAKL 2DMBA 1BX2A 3IKCB 2DM3A 5F7UA 2J5LB 5L2JB 4OZFG 5GJTL 2I60H 3C6LB 5EU7E 3TVMD 5C09A 4ZD3H 4NGHH 3VXUB 1XGYH 2GITA 3RY6A 3QJHA 4KHXH 1LD9A 1I9RH 4S1DC 1EHNA 1A7NH 3LH2H 3MLYL 1LHZA 1JZ6A 3WN5A 3BMVA 5EN2B 3GZKA 5E94B 4M8VA 5HGAA 2PW2A 4JQVC 1AJ7L 1R5VB 5CJ5A 5IM7B 3PG2A 3H9SA 4KKAD 5I17A 1F4HA 1KGCD 3BPOB 4HFUH 4HS8L 3O2WH 3U79A 5JNYB 2Q76A 3QIUB 1RIVL 4I5BA 5F9OH 4WENB 4OZ4A 5F9DC 3OHXB 4YDJA 3O11A 5DK0A 1ZHKB 3MBED 3PGCA 2M8XA 1BFOA 3LSOB 2R0ZL 1DANT 2FHFA 4S11A 2P5EE 1HKLH 4YHLH 4KDVA 5ICXB 3T0AA 1IC4L 1MFDH 2Z91B 4PS4H 1Y18A 3EDDA 2HWZH 3EYSH 4M03A 5GSRA 1MCEA 1FFOB 4MCYA 1CXHA 4GRWB 3MCLH 2AKRB 2O5XH 3PV6A 4PRPD 3RNKA 4GW1A 5EO1A 1WCBB 1YMMD 2VOTA 1IGYB 1QFHA 4NZTH 3RVWC 1CD0A 3SCMD 4AIZB 1IQWL 1NBZA 3FB6A 1FAIH 3RWFA 1R6VA 1SHMA 1YNLH 5B38B 1MCKA 2XTJB 2NW2A 1OF2B 1GZQA 5GJSL 2MQ3A 1DDHA 2XICA 3S96A 3PGFH 1I8KB 1KTLA 2ADFH 4NRXA 5IMMA 1TQBC 4LSVL 5F72S 2VMFA 3D39B 4OZFB 1P5VA 3P73A 4MD5B 3JZ7A 1QLEH 4L3CB 4OZHF 4HXBL 4HXAH 2D7PA 3VXMA 4M4RA 4KQ3H 4ZS7H 2VH5H 3CAFA 5BO1H 1MLCB 1EO8H 4WFED 4F7CA 5IEHA 4WI5A 4JO1H 4GRLB 3MSPA 3MO1A 3O41A 4DGVL 5EDXA 2MKLC 4LDEB 1NCUA 2FR4A 3W9EB 4YXHH 3HE7A 1F58L 1FL5B 4N1HB 2OM5A 3WBDA 2OLDA 5H94A 1V3LA 3TJHD 5DLML 4PRIA 1RULH 3WDHA 1UWEL 2MPAH 2NX5E 1CLOL 4TVSa 5TF1L 3W5MA 5DD1H 5JPMA 1HDMB 3NPSC 2W1NA 3BPLB 4JZNB 4JVUA 5JW4R 1NBVH 4CAGA 4JRXA 2FATL 4JKWA 1NJ9B 2AJXL 4R90L 4DK6A 1A9EB 1KJ2A 1U42A 4OKVA 4Y88A 4G8GE 5DD0H 5IUSA 3L7FB 4YHOH 2ICES 5DJAB 1IKNC 3BEWA 3ARED 4WUUA 5DJ2B 3HRZB 4JQVA 3C8HA 1JL8A 3OGCB 1FG9C 2MCG1 1DFBL 3N1MC 3FFDA 4ZOCA 2R1XA 1HCFX 1RZFL 5HD8C 2RBLA 4RGOH 4YPGB 2NY6B 5ALCL 3MLWL 3MFGB 5DF0A 3HS0A 4FXGB 5C3LD 4M93B 4BH7B 2PYEE 2A38A 3SDXF 5IEKB 1JFQH 1QACA 1NCAL 4HUUB 3FFCB 3GIVB 2FJGB 4UDTB 1DUZB 3EYVA 4TVPH 1BEYH 1WEJL 4J6RL 4ZTPH 4LOUC 2LQRA 3MREB 5DJYA 4U1MB 4IIQC 1VFBA 3P77A 4PJAE 2H8PB 1U8IA 3AB0B 5T3XE 1S7WB 3PABB 5E95B 5DEFA 3WFDH 3LKSA 4LLMB 4AMKL 1QQDB 2YOCA 4EZMA 1RJCA 1S7RA 5IHZB 3ES6B 1BF2A 1LVEA 3DUSA 1N0XL 2DQEH 4GMTH 5HYIA 4OZIE 4HV8A 3X13A 5EORH 3GSWA 1XR9A 2IADB 3RZCD 5DGQA 3F58L 3F7YB 3OKOB 1B2WL 3VXSE 2QEJA 2YD6A 1DUYB 2WWKO 3TIDB 4L5FL 5FCUH 3QFJD 2ESVB 3IJHB 4S1QL 5CEYB 3PDDA 3LMJL 1FNFA 3LEXB 4DW2H 1CDHA 3L5XH 2NY5H 4HGWB 2DWDB 1XF1A 1QEWA 3E6FA 4UDUA 3O81A 3T0DA 1QVOB 1JNNL 3MGTB 1PG7L 3P4NA 2XA8H 5MI0C 2JLLA 3LAFA 1T3FA 1NCDL 4DGYL 5ITBH 5E2UH 3O8XC 4QXUL 4M7JL 2J7LA 1PAMA 5E8NA 2YD1A 3A67L 3P0VH 4CU7A 4XNYH 2OJZL 4HWUA 1WTGT 2P43B 5E5UB 1MELA 2XN9B 4L4VE 5FYLL 1JWUA 1K4DA 1QKZL 1BVKB 3IU4L 2NXYB 5KS9F 3QG7H 4G7VL 2JJWA 2PTUA 4JM4H 2YWYA 2IH3B 3O3AB 1KJ3H 4K7PH 1FN4B 1W0WB 3JV5A 4X7TB 2DJUA 2VC2L 3BKJH 1QFWH 4MNGE 4S1SL 1UM5H 4NRYA 3C5ZA 5EOCJ 5KSBF 3BKMH 4JO3H 4CDHA 2P4AB 4L8BA 3VD4A 4LVHB 4WVRA 3S3JA 4DZ8A 3FT3A 3MROB 3ESUF 3P4LA 2AJYL 4KK6D 1XF3A 4MMXC 1IKNA 3PIQA 3CXHK 4PY7B 2D03H 3HE6A 2GK2A 4WGVB 3KWWB 3OJ2C 4P59L 4LIQH 5SX5H 1A7BA 1KIRA 1XF4A 3B9EA 4TPRL 4XVJH 3IT8D 5CINL 1H8OA 4R7DA 1JGDA 1UZ6F 4NZUH 4JR9H 3ZKND 2HFTA 5ICZA 2VLRE 3HC0A 5LXGH 2NY4B 4M6NL 4XNMB 5FA3B 2Q6WA 3IVKA 1BPVA 3DTXB 1G7LA 2F19L 5KVDH 3GMNA 5IB2B 1ZWIB 6FABL 5IHBA 2EXWD 3AXLA 3QNXB 1FP5A 4ZDHB 2AGJL 4EBQL 1UWGL 3RGHA 5A1AA 1JV5A 1A5FL 1SYSB 3MV8D 1ZVHA 4MGXA 2H1PH 5B22A 4WTZA 5T5NF 2EECA 2ITDA 1KB5H 3TCLA 5TE6L 1I7TB 5D6DC 3VMNA 1FIGH 1HYSC 4AH2B 4Z18A 4ELMF 3HNVH 1Z6JT 4GW5B 4RFOL 5M94B 3B3IA 3FOMB 4R7NB 2R23A 5IB5B 5A2JH 3HTLX 3JTTB 2EDKA 3PP3H 1J0JA 2P8PA 5FCSH 2UUDK 3DUUA 4YGVB 5SX4H 1FLRL 1QFPA 3VXRB 2JK5A 1LO4L 1BOGB 2VLKA 2YN3A 4LSDA 1UKQA 3BIBX 3MRRA 1NAML 4O51A 2ZUVA 1EGJH 4M1DH 2AVGA 2D31B 2FECI 4LSSH 4QF1A 5SWSB 1OTUD 3FT2B 1ORSB 3IYLW 3BUTA 4JRYD 4RWHA 2MMXA 2AJ3A 5IVXA 1BZ9A 4JG1L 1R5IA 4PJ9C 5ENWB 3BGMB 4JDVA 3OKKA 4NJ9L 4S0SD 2CRZA 2DQDL 1MCIA 1T89A 3T77A 1FDLL 1CGUA 4Y1AB 5E00A 5TDPB 1ZLSH 5GRZA 4APQB 2HAZA 5A40E 4KZDL 1IGJB 1XCQA 2F53D 5HGDB 3L9RB 3PWPE 4D0CB 5E6IB 4YHML 1JK8A 2ZOKB 1L7TH 3CSYA 4L4TD 4P5TA 3DXAA 3SGEI 3KPOA 4HS3A 1X5HA 1QSFA 1W72H 1RZIA 3GEWB 3QUKA 3TWCH 4YQXL 5EZJA 2CLZB 3MZGB 4U49A 3QEGL 3HZYA 5J1TC 3MLZL 3MRPA 3T2NL 2Z92B 1JZ5A 5GZND 1S3KH 5IW6A 4N0CD 4GRLD 1PZ5B 5MHSD 2BVPB 2OTUA 1AKJA 4XXCC 4S0TD 1RZJC 1QYGL 1HXYB 4UIMB 1H3TA 2SEBA 3FTGB 4FQIH 1ZHLB 4X6BA 2X4PB 4Z7VE 4AM0A 4LBEA 1NEZA 2JELH 4U3CA 2W60B 1Q9KB 1JF5A 4WI4A 4B0MM 5E7FA 4NQCE 2IGFL 3FL7A 5FEBA 4MD0A 1ZLUH 5FO9B 3RY5A 2AJUH 5EU7C 1XIWD 3UTTA 1KEMH 1KPUA 1FYTB 1KJMA 4GAGH 1W2KT 1MY5A 3PWVB 1RJZA 4QHLB 3D0LA 1SEQH 1XGQA 5DC9B 4JZJB 3TJEL 2B4CC 3VGDA 2OJEB 1YYMH 4WW1B 2HTLC 3TIEB 2JCCF 5CGYD 4P23B 1L7IH 1N7MH 4JFEA 2AEQH 3EJYC 4QCIA 3W9DA 3ALPA 4OGYH 4N9OB 3EDEA 1OGAD 1ZT7A 4PP1D 1A6VL 4URTB 4N1CA 2BNRD 3IJSB 3IDGA 3OZ9H 5GJTH 4GKNB 4QNPF 1ONQB 5FHAL 2R56H 4PGZA 3DV4A 1U93A 1UADC 4X6FB 4RZCB 4GW4A 5KANG 1AGDB 4X99B 2A6KB 4DFHA 4GLRH 1WBXB 4MQTB 4JY4B 3O2DA 2ADGB 2AERT 4HMEA 5D2LE 5ESVA 4XBGA 3SDXB 1U8MA 5FM5O 1CXEA 5A43C 4BSVB 2HFEB 4UQ2B 5IP4A 5KZCB 4KK5D 2CDEA 5JOFB 2NY2D 5D1ZC 2H6PB 2Y6SD 4HH8A 2YPKB 3JTSB 5DMIL 1X5KA 1FCCA 3LDBB 4W6XB 1X5XA 3O4LB 3V5DA 4HD9A 1PX4A 3MRMB 4OSUH 4PPTA 5FO7B 2VZTA 1SM3L 1XGPA 1HXMB 1S9WA 3B5GA 1I1AA 1Z5LA 3OKEB 3QUMB 2XXCB 3ARFB 2R0ZH 3NCFB 4QRPB 3IXTA 1A7RL 3STZB 1W0VB 2VDML 5F1KC 1A1OB 3TN0B 4ZXBB 3E8UH 3NCMA 4OD2B 2PNDA 3QPQD 4M9PA 5HDOA 5T5NG 5ABDE 4Y2DC 4LPCA 2UYLA 2X4TA 1CL7I 5E9DE 5HYFA 4JFFD 3GDBA 4GH7B 4HCRL 1I3RA 2ZNXA 2Y23A 4Y5VC 1NGWB 5H35A 3MRNB 3EUUA 5JPNA 5CUSL 4BSWB 4LLWB 5TQ2L 3MOBH 2XT1B 3V52L 3QDGE 4PBWD 2YA1A 4EIGB 1RV6X 5DD6B 3MRCA 5DQ9B 1MAKA 3K7UA 3MRFA 1OTSD 4CJ0A 3LN4A 2V9QA 2X4OB 4N0YL 5KS9B 1V8HA 1WICA 2Q8BH 3KPRE 4HXBH 1FC1A 4M7KH 3I6LD 3CDCA 5ISZD 5FYKL 2GTWB 4UBDD 4NZRL 1Q72L 1QNZL 4QYOA 5F7HA 4MDIA 5T1DL 3GSNL 5KSBB 4N0FA 4RFNB 2AV7B 1S5IL 5DJ6B 1ZE3C 3KJ6L 4UT9L 5B8CB 3DVGB 3DECA 3GSVB 4CVZB 2VLMD 1RU9L 5BW7C 1T83C 5CP7A 1F58H 2BY2A 4ZFOL 5C0CB 5HI3C 1JTOA 3QXUA 4LDLB 5DLMH 4V2CB 4F7MB 5HVGB 4Z9KB 4WHYH 3ZT5A 1QLRB 1U3HC 2WAHA 1XGTB 4JG0L 1J8HB 3HI1A 3QIWB 1EAJA 5JZ7C 3U2SA 1KJ2H 2XOTA 3RWIA 2D2OA 4N9GA 4UQ3B 3LKRB 1D5ZB 5EOQH 2DLEA 2AJXH 4HFWA 4UOJA 4CADB 1JTTA 1RJLB 3QJFA 1J1PL 5C07E 3HC4L 3MQIA 1B4RA 1HCVA 3IDYC 1UEYA 5TDNB 1EFXA 3S4SG 2QADD 3N50A 4MQ7A 4ELMB 1CU4L 2B8OT 1NGYA 1UH2A 4Y4HB 1J05A 3RDTD 4NCDA 3FN3A 4ONHB 1YEDA 5SWSD 5CSZA 5ALCH 3EO1B 1X7QA 3MLWH 4Z7OE 3FJTA 2XWBB 3CFKB 4H5SB 5F71A 3ARDB 5GGUA 5AG9A 3TBWA 3NCJL 2NY5C 2IH1B 1NCAH 1UB6B 4NN5C 1EAPB 3BIKA 3D5OF 1EZVY 3P9LA 4JO2H 4M5YL 4OAWB 4N8PA 1M05B 3DMMA 5INCA 4MA7L 5H2BA 3IRZA 4HUKB 1PKOA 2V2XB 2OQJA 4Y2DA 4AMKH 4P3DA 3RX5A 1YNKH 3BGFB 1INQA 4O2EA 5IR1A 2VIRB 2XWJB 4X8XA 4GSDL 1N0XH 5C08D 4NCC1 3DGGB 3MNWB 1F5WA 4GXVL 1Q9OB 3F58H 3H42L 5EZIL 1A6TA 3KPSB 5GISL 1B2WH 4YBQC 5CWSB 4L5FH 5GGSA 3VE0A 2DBJA 5H8DA 4RISL 4S1QH 1JYNA 5TJWK 3WO4B 2DS4A 5E8DL 2Y5TA 4F8QA 2NMSA 5TDOA 2VZ3A 1KB9J 2Y7QB 4KI5E 3X3FL 2KH2B 2FDBP 5HHVH 3OQ3B 1UG9A 1PG7H 3BO8A 3MBXL 3N06B 3QUML 2PUQT 4E41B 1WJ3A 4PLKD 4U0RC 3ARWA 5F9JA 4XPAH 1NCDH 1B4JL 3D2UA 4DGYH 4YHKL 1HHHA 1WZLA 3QA3B 1INDL 1FYTD 2Z8WC 2BNUB 1MY7A 4AEFA 1E0OB 2CXGA 4I48B 5DQJA 1JHLL 3TBTA 2A6DA 2OJZH 3B9AA 4Q6YA 4I0PC 5K59F 5H37H 2YRPA 3ZDZE 1JGUL 3NCYP 4JJ5B 5CEXB 4XPFL 5IFJB 3DX8B 2NPLX 4O2FB 3S4SB 3VWJB 5FYLH 2EKSB 1V05A 4CN4A 1QKZH 3IU4H 4WIQA 2DKSA 3QUYC 4GRWE 1ZT4B 2YN5A 1RURL 1F90L 2E7MA 1U3HA 4GQPH 1HHGA 1I1FB 4HUNB 1LQSR 4P23D 5IIEB 1YN7B 3QDJD 3O4OB 5CJOL 4PJAA 4TUKL 5F1OB 3LRSA 2X44D 4MQXC 1H5BC 4OB5L 4S1SH 1I7RA 5JXEC 4KAQL 1OP5H 1QSZA 3R1GH 5GIRB 4Z7UF 5ID1B 4OZIA 2XTJE 4ORZC 5E2VL 3LQAL 5T1MA 3QEUA 2AJYH 4PTUB 4HJGB 1KBGL 4OM1H 5J13B 3VXSA 2R8SL 2H2PC 2JCCB 3FQTB 4LU5L 1JNHA 4XMLH 5I1GH 1GAFL 2EDTA 4MNHB 3D39E 4PGEA 5KSAD 3OXSA 3U46B 1FGNL 1OAKL 3PHSA 4Q6IC 5C0AB 6FABH 2ED8A 4FP8L 2YMXL 5KZCD 3GM0A 1BD2B 2AGJH 4EBQH 3VFWB 3RJDA 1CD8A 5B3JF 3I6GA 4LCUB 3EO0B 4X83A 3OKDB 3MMEA 1N3NB 1F6AB 1ZV5A 2V2TA 1OT1A 3C5SB 3QFDB 2DYPA 4KVCL 4Y4KD 3RBGA 1W0YT 3RGVD 2WLZA 4UU9A 4KMLB 5D5MF 1TCRB 5TE6H 3F12A 4LFHG 4LRNL 2H3NA 1KN4L 5C2BH 4PG2C 1YN6B 4RFOH 4RAHA 3CSBA 2HVJB 3VI4E 1N64L 1KLUB 5MEOB 4L4VA 4YGAB 1GGBL 4QKXB 3ARGA 4QRPD 1OCWL 1FNGB 3S37L 1OAQL 4K8RD 5DRXA 2HN7A 3R0MA 1T04A 4OGAC 4K3DL 4MA8H 1CGYA 1RPQA 3F5WB 4U1GC 1KTDA 3D0VB 4MNGA 2FIKB 1NAMH 3TP4A 1IAOB 2RCSL 4GBXC 1SY6H 1K3IA 3B8SA 3RWJA 5E1AA 2OSLB 4JG1H 3FCTA 1RK1B 4NJ9H 5EWIL 2ZCKL 4IOFD 3BEVA 2X9YA 1JRHL 3I3DA 2DQDH 4H25B 5I8EB 5T1KD 4PJFF 1VSCA 4EKXA 1X3DA 3T4AA 1IM3A 1VKXB 2ZUWA 2DQIH 3S9DB 1RQ5A 4ZUVA 1OP9A 1R24B 4KZDH 2VLRA 5HYJB 3V4VL 4FQCL 3FFCE 2VDKH 1NGPL 2ZUSA 2F58L 3S3SA 5ILTH 1U91B 4IHOB 4XCNA 2W0LA 5JIKA 4I0PA 3CIQA 1VDGA 3L5WB 4R97B 4Z7WE 2ENYA 5KTEL 1DQTA 1F3RB 1A7PL 2ICWB 1OARH 3T2NH 5E2WH 4YWGL 2CIKB 4MJ6B 4NM8L 1NUNB 2H2SC 3H6JA 5FKAA 1T0MB 1JN6A 1H5BA 2ZUQB 4XPGH 2JB6B 2AEIT 1QYGH 3HAEA 1I9IH 5JXEA 4YHPA 4QTHB 4HS6B 3C08L 3REVB 3WS6C 4AIXA 2ESVE 1J1OL 3MA9L 5C0DB 3EGSA 1KSRA 3X12B 5C0CD 1JCKA 5JO5B 1IAIH 4Z76A 3EOTL 4KGJA 1K5NA 4NRZB 1OLLA 2JJVA 1A9BB 4YZFE 2IGFH 1ODAA 3FQUA 3QIWD 3CH1A 4FOMA 2GJ6B 3ZE0F 1VEOA 1U8OA 2BSTB 5HHXH 1FIEA 3U6RB 3QQ9C 4Q9RL 3KNBA 5GSVA 3LQZA 4J1UB 5EIVA 5I75C 4NP4H 3TZVD 3LEYL 3EBAA 4NN6B 4IRJD 5CCKL 2DQCL 4O02L 3GB7A 4LEOB 1WWAX 3GJFH 3O6FA 3WXVH 5IB3B 1CIDA 2XN9E 1HOCB 4YO0B 3S36L 3LVEA 4TTDC 4WEUD 2AV1B 4IRZH 3QBTB 3PWPA 4HDIB 4PG2A 3RIAF 1LEGA 3ARDD 1R3KA 3HCVA 2E9JA 3HHRB 4XNQB 4R4FH 4YHYC 1UWXH 2XPGB 3BYTA 4XHJD 3SDYH 5C0BD 5FHAH 5DJXA 3VFPA 2OR7A 4ETQA 1T0NB 1MHCB 5C0IB 5E5MB 3ULVD 3HZMB 2X7LA 3CNKA 3S35X 1DEEA 3EFFB 1ZGLP 3D3VB 1RAMA 1J7VR 4EI6B 5F7WC 1XGUB 3EOAA 4Z7VA 5EA0L 4JFDB 2ZUTA 3FO2A 4P4KD 3NACH 4MAUL 1IZKA 4OCRL 1NC2A 4XMKH 1IEAA 2XKUA 4QRRD 1LK2A 1MI5B 3EDFA 4NQCA 1TNNA 1XR8B 3BD3A 3HUJF 1SMOA 4DKEL 1DBKL 4MVBD 1GGUA 1L6ZA 4ODHL 1SM3H 4G6AC 2Z0BA 1D5MA 4OLVL 3DX6B 2EDYA 4QRUB 3TO4D 3P9MA 5CZVH 1BJMA 3HMXL 1A7RH 3SHSA 1XF2B 5ITFB 1A8JH 2EIZB 3SDAC 4BFGA 4FFWC 4ZUTA 4KROD 3FQXA 4L3EB 3P40A 1XFPA 3SCMA 5LKNA 4GKZB 2R2BB 4V1DB 4JM2F 2EE6A 4ODVL 3VGAC 3WS6A 5DWUL 4HCRH 2YD9A 1AXSA 1OPGL 4JPIA 3GMPA 2BCKA 5CKGA 5AUMB 3JWOL 1CDYA 3VXRE 1JP5A 2NZ9C 4MJIB 4G7YL 2PO6B 2P5WD 2ITCB 2X1PA 2E3VA 4KRPC 1JNLH 4R26L 5TQ2H 5C8JB 4Y16C 3VFSB 4EQ2A 2IAMB 1TVHB 4QHNA 1TTUA 1FSKC 1LNUB 4ODSL 4U05A 1B0WA 4TOYL 4JHAL 3GMLA 4ZPVA 4Y1AE 3MLTB 2YEZB 3QXVA 3FONA 5FYKH 1I1CA 4C4KT 5JW5A 3MJ7B 2NNAA 1Q72H 1YQVH 4LGPB 3VFOA 1TJIH 2DIJA 4JHBA 5T1DH 3AS3A 3GSNH 4WY7L 5TE7L 1PX3A 1S5IH 1TETL 3SJVD 4Z7UB 3KJ6H 1X6NA 4UT9H 4OFKA 5C0AD 4WI2A 3ULUF 5EO9B 3RTQD 2X70A 4MLSA 2BXZA 5FUCE 1ZVSA 4HGMA 3WSQL 2VXUH 1ZGLA 4KJQC 4BFIB 3PWLA 4NQEB 1NC4D 2CK0L 1F4XH 3RWGA 3OR6B 4OZHE 2DM4A 2PTTB 4PRAA 3VRIA 3ELAT 4JG0H 4RIRA 5IG7A 5F9WC 2DJSA 1QG3A 4U7SA 4CMHB 3LB6D 1BLNA 4W68A 2RIKA 4ODWB 3OMZA 2J5LC 4RA0C 5E9DA 3VWKB 2F8XC 4G42B 5FYKU 3C6LC 5CJXC 1U58B 3HC4H 4EN3D 2G5BB 3MRHB 2FSEA 4PJCF 2R9HD 5D1QB 2XKNB 5IVZA 2BVOB 5D5MB 3NCYS 4GKSA 1OSZB 4OV5B 2A0LC 4NUJB 5TH2B 3DI2B 3X11A 1J0YA 4FTVB 1MLBA 4OIBA 1J12A 1AE6L 4B7LA 1BWWA 4NC2B 5LGKA 2IPKA 4ISVB 4KI5C 1FFQA 2VAJA 2YA0A 5FB8A 1YECL 2WP3O 3NCJH 1M7DB 2HLAB 2FD6L 5DC4B 1ORQB 2R0KL 2VISA 3SKMB 2QV2A 4IMLA 3CH8A 1DVFB 1JHKL 1L9NA 1KTRL 4FQHB 3GO1L 3QRGH 1GZPA 1U3ZA 1ADQL 1BVLA 1PSKL 4X5WA 4QGTA 4PV8A 4FS0A 3UPRB 4NKMB 5D1XD 3IAGC 2P24A 1FVDA 4CMMB 2R0LH 2R4SL 4RNRA 1FH5L 3H42H 4X98A 5EZIH 1L4IA 1I3VA 1NANH 3CJJA 5GISH 2YKLH 4CGTA 1UA6H 2FH6A 3HG1E 3OWEA 3SDXE 3QULA 5LAXA 2GSIB 5GRYA 2DICA 1ZS8A 2X41A 4UT7H 1PYWB 4P2QE 4XPHL 5E8DH 1R3HA 2YHGA 5CP3H 3ZT6A 5ANMB 1CE1L 1IRAY 2YPVL 4X6DF 4GS7B 4D9RD 5I8KL 1IC5L 3X3FH 4XGZA 3MRBB 1C1EH 2D9CA 1I3GH 3MBXH 4JY5H 1OQXA 5CD5C 2XTJC 4IDJL 1H15A 3O4LE 5C07A 1TIUA 2WINA 5A2KH 1OGTB 4ZPTA 4LFHD 1SJEB 2Y9RT 4OCXL 1ZXQA 3QCUH 2GJ6D 2V5TA 1H0DA 1ZEAL 4UOW1 5GGRB 1KF9B 4KKBC 3VH8A 4EOWL 5JDSA 1JHLH 2HJFA 5KN5A 2YBRB 3BX7C 2DDQH 4C56D 3RKPA 2W0KA 3VJ6B 4XPFH 4UTAL 3PL6B 5DI8A 1NGXB 2BVEA 5I1IL 3BP6A 3ZTJG 1RURH 2X4UA 2ERJB 5HBBA 4HJ0D 4NDMB 2K3TA 5I15H 5HHOB 4YJZL 1P53A 4P2RB 4LCWD 4KMTL 2AQ1A 1GXEA 4NHCL 4XNUL 5HTSA 3IKCA 2VITB 4FNLL 4OB5H 1QFUL 1A14L 2BOCB 5L2JA 4KAQH 2Z9TA 2GYSA 1CBVL 2I9LB 3G5XB 3NAAL 3C6LA 5CJXA 4ONGL 5I1EL 5E2VH 3LQAH 1I8LC 3PWJB 1SBSH 3VXUA 1S7VB 5GRWA 3F65A 2HT3C 3H9YA 4LU5H 3VXTB 3AM8C 1VA9A 3BAEL 5EN2A 1FGNH 5CD3B 4HKJB 1P7QD 5E94A 4D0DB 1QFWM 1S7XB 1CGSL 1R5VA 4PJ5D 5KSBE 5IM7A 4WCYL 1CFSB 2VR4A 1YA5A 1ZHNB 4PJEF 5JNYA 3ZE1F 3QIUA 1CFVL 2NY6C 2Z8RA 1GJIA 4KHTL 4BYHA 3OHXA 3RVTC 1WFOA 4W4NA 1ZHKA 1B0GB 5SWZB 1SEBB 1JI1A 3C60B 1KN4H 3LSOA 5GS2H 1PQZB 1UZ6E 1AC6A 2EE9A 1YEJL 5ICXA 1N64H 2Z91A 1J8HE 4R2GB 3ZZ1A 3WXWH 5IHUL 4L8CB 4MAYB 1FFOA 2MTPA 1OCWH 1OSPL 1LE9B 2G2RB 2AKRA 2ICEB 1CGVA 1ZSDB 1RUKL 3T0BA 1IGYA 4K3DH 4AIZA 4K94L 3UTSB 4NQVB 4JDZB 1D5BB 3Q5YA 1E4KA 1ZLVH 2P44B 1T7ZA 3DBXB 1IEBB 4K9EH 2RCSH 4XAKE 5C9JB 3L6FB 4F7TB 2DQUL 1KFAL 5B38A 4WWKD 3ZL4L 4ELME 2XNAB 1F4WL 1OF2A 4J3WA 3MRKB 5EWIH 1F4YL 1JRHH 1I8KA 4NQXB 4AYFA 1NSNL 2YRLA 5IMOB 4JM2B 4KJWC 4F9PA 2YZ8A 3QHTC 1ES0B 1FL6B 2IAMD 3D39A 4OZFA 1IT9L 4MD5A 5L0QB 4L3CA 1YUHB 2F58H 1YMHB 3IFLL 2C5DC 1MLCA 3ZSTA 5BRZB 1PLGL 1I9JL 3WHE0 4GRLA 5HI4C 5D93B 5HXMA 3LRGA 3WHXB 1KLGB 3CC5B 4YWGH 4I0KA 1MWAL 5IMLB 3MYJB 1N5AB 4OLYH 4WI7A 5J11B 5GGRY 3W9EA 1J5OL 1A4JB 4XP6L 1FL5A 2Z31B 4KJPC 3KPSE 4U0QB 1NBYB 3H0TB 4PFEA 2NXYC 1CGXA 1WIUA 3C08H 4S1RH 2DM7A 3MA9H 3CVHL 1G0YR 1I8LA 2EXYC 3BPNB 3QAZB 4RGNB 4GG8B 4NQED 1HDMA 4JZNA 3R8QA 3DURB 3EOTH 5TE4L 3REWB 4OCSL 5BMFL 1CCZA 1NJ9A 2B2XL 4PJBE 4P3WA 1A9EA 4LVHC 2EO9A 3PF2A 4YLQT 2R2EB 4DQOH 4Y5YC 4E41E 4MHHI 4MJ2A 3L7FA 4BELD 4WI6A 4U2ZA 5DJAA 1NFIB 4Q9RH 3VWKD 3MODL 5DJ2A 3OX8B 3HRZA 5ESQB 3OGCA 3QHZL 1TTGA 4FFZL 2VXSL 2HYMA 3LEYH 3VFMB 1JGEB 3PHQB 2Q20A 5CCKH 4O02H 4YPGA 2RR3A 1JVKA 4PV9B 4FXGA 3S36H 4BH7A 4AG4H 1EBPA 1KIUA 1DTUA 5IEKA 3CDFA 4ZUSB 4HUUA 3FFCA 2LAGB 3GIVA 2FJGA 4UDTA 1DUZA 3MRGB 1RMFL 4UNVA 4G8EB 4KVNL 4I3GA 3MREA 4AT6B 4U1MA 4ORGB 4PJCB 3TA3B 1EJOL 5JDJA 3M17B 4KU1A 2H8PA 5E8PB 3CX5K 4I9WE 4GRMB 1S7WA 1ZA3B 3PABA 3U7AA 4JHZA 4LLMA 3JVGC 1QQDA 3LKOB 4N8VG 5IHZA 1HEZB 3ES6A 1CT8B 3GKWH 5HDLA 3I9GL 2IADA 3F7YA 3OKOA 4JFHE 3U0WH 2JCCE 2NY0B 1S78D 1DUYA 3TIDA 5D7KD 2Z8VC 2ESVA 4YR6B 3IJHA 3RJQB 5CEYA 4NFBA 1UB5B 1UXWB 5EA0H 1FNAA 5DMGC 5TQ0H 3LEXA 4HGWA 2DWDA 2HTKD 1JWSB 5IBLD 1J8KA 4PJGB 1BQUA 1QVOA 5C86A 4G80B 2FB4L 3MGTA 4DKEH 2OTPA 1BD2E 3CUPB 4HUWB 1DBKH 4QNPE 5EOTB 3UPCA 5EU4B 4LVOB 4OLVH 4MXVF 5KBNC 4HKBB 5DK2B 4OUUB 4DVRH 4APQC 2ZP0T 3VD7A 3MPCA 5E6IC 3F7VB 3W0WD 4R96B 1G6RH 2XN9A 5IQ7H 5F1NB 3MXWL 3W5NA 1BVKA 3LD8C 4P9ML 4C55A 3U9UB 3FZUD 5DWUH 1FO0L 1IZJA 2VDRH 4PG9B 2LVEA 2IH3A 2GUOB 5FUCC 1ETZB 1FN4A 1W0WA 1F42A 3JWOH 3MNVB 4OQTL 4X7TA 3IDJB 3O3UN 2VXQL 1S5HB 4G7YH 3QUZB 4P2RD 3FMGH 5FYJD 4JRWA 5IFAH 3K4AA 3MROA 3LPGA 4OLZL 1S7SB 3QHFL 1V3KA 1QSEE 4ODSH 1P84J 3HNSL 2C3GA 4PY7A 4J3TA 1TVBB 3KWWA 4JHAH 3BN9D 3DX7B 4IJ3B 1DN0B 4RMQA 4N8VB 2FECL 1EVTC 2FEEI 1V7ML 5HYJE 4NZDA 4XNMA 5FA3A 3CLEL 3DTXA 4P9HC 1DQDH 2WWMC 4LLDB 3RVUD 1QRND 1A3QA 3MCG1 5IB2A 4XWOD 1ZWIA 3O6LH 4I18C 4PRBB 3QNXA 5TE7H 2NR6D 1SYVB 1TETH 1OAZL 4QT5B 4ZDHA 2VYRE 4DUVA 1QP1A 1AR1D 4G5ZL 3TFKC 1SYSA 3OAUH 3IDIB 3QNYB 4HEPG 5DO2C 1UC6A 3IDNB 1DBMH 5EIIB 3WSQH 1FZMB 4OCMC 1TITA 1I7TA 4R9HA 2WIMA 4AH2A 1Q0YL 3JVGA 2AJSL 2CK0H 4WU5B 4QY8B 1JUFB 4GW5A 3W39B 5K9QI 1IL1B 5HSFA 1MFCH 3FOMA 4R7NA 5IB5A 3C60D 4ZUUA 3JTTA 4PLJD 5DQDH 1MREH 4LKCB 3SE3C 3LS4H 3WYRA 2HLFC 4TUJB 4LQFL 3EAKA 4D2NA 3QDMB 4PJEB 4YGVA 1VACB 4U31A 2XRAH 1HH6B 3AS1A 2ZCLL 3VXRA 1BOGA 1FGVH 4M6MH 2D31A 1G7QB 5SWSA 2MNUA 3FT2A 5IB4B 1ORSA 1CLCA 3MV7B 4OJFL 2JIXB 5ENWA 5IW1B 3BGMA 3F6IA 2Y06L 1C08B 1FNSL 5C6TL 3GNML 5L2KD 2X1QA 5DFVC 5DT1H 3B6SB 3IKKA 1P5UA 3T4YB 4Y1AA 5TDPA 4APQA 5I66B 3T0ED 4U1NB 5FECB 2R0KH 1IGJA 5I0ZA 2YSSB 3CMOH 4HC1A 5HGDA 3L9RA 4D0CA 5A3IC 5E6IA 2ZOKA 4JM2D 1RY7B 1JHKH 4CDGC 1X44A 4YAQB 5F88B 3GO1H 1RZ7L 3TT3L 3KPNB 2CLZA 1ADQH 2CD0A 3ARFC 4G6JH 1HIMH 2Z92A 2FWOB 1G7HB 1HSBB 3EYQD 4ZNCD 5I16B 3TN0C 1S7UB 1PZ5A 2BVPA 3D3VE 1HXYA 2HJLB 3QEQD 4UIMA 1ACYH 2WK2A 3FTGA 1K9TA 1ZHLA 1CXFA 1BQLL 3TBVB 2X4PA 4ZS6D 5FGBC 2C7UB 3QIBD 4JFDE 4X6CF 2YPVH 2IALB 3UBXI 2W60A 1Q9KA 1IC5H 4KK8D 5D70L 2EO1A 1MI5E 4B7IA 1WZ1L 5FO9A 2PW1B 1TQCC 4BSJA 1FYTA 3B83A 1LO2L 2FO1A 1N26A 4OCXH 4KK9D 3PWVA 2QTEA 3BKYL 4QHLA 1NCTA 3NPSB 4Q74A 3LQAC 4NBYB 4YXKH 4EOWH 3O2VH 4JZJA 3WDJA 3V0VB 2ARJB 4ZO8A 4HIJB 2OJEA 4WW1A 4UTAH 1RZ8B 3L3DB 1EK3A 3TIEA 2X40A 1MAML 2FJFB 2HKHL 4L3EE 4P23A 3QXAB 3ROLB 4RFNC 4V1DE 1M71B 3ARRA 4RMTA 4R4NC 5DZLA 5C09D 4Q2ZB 4XBPB 1MUJB 5B8CC 1TENA 1MCHA 5LWYH 5DA4A 1X6LA 4KMTH 4NHCH 4F15C 4XNUH 1ZVYA 4H8WH 3ILQC 4FNLH 1QFUH 3V6ZB 3VA6A 1CBVH 3IJSA 3QXDB 3SE8L 4MJIE 2VZOA 3I02B 4MS8C 3TA3D 4GKNA 1YYLL 1ONQA 1OD7A 4J4PC 4UNTA 2AABL 2VQ1B 3GI8H 4X6FA 4RZCA 2LABA 4X99A 2A6KA 43C9B 3EFDL 4X9BA 1WBXA 4IIQB 4JY4A 2ADGA 5HHMD 3SDXA 3BP4B 3D48R 3H9SD 5I18H 3FQRB 4BSVA 2HFEA 1P7HL 1SVCP 1A7OH 4UQ2A 2BY1A 3BAEH 5JOFA 4CUCA 2IEPA 2UUDH 3F8UB 3TESA 1NCBL 4XVUC 3LOWA 2H6PA 3U0PB 5JHLL 2OYPA 1IC7L 2YPKA 1PJ9A 4UV4H 4MXQD 3JTSA 5IROC 1QFOA 3O4LA 3V6FB 2HJKB 4Z7UE 3MRMA 3SKOB 5FO7A 4Y4HC 4XT1C 1M7XA 1CFVH 2RHEA 2DI9A 4KHTH 1HXMA 3WV0A 4QWWC 5HYEA 1QLFB 3OKEA 3QUMA 4QOKB 4JVPA 1C5CL 3ARFA 3NFSL 1A02N 1CF8L 3UTPE 4XAWL 1UZ8B 2P46B 4QRPA 2IBBA 3STZA 4BJLA 1YEJH 1QOKA 5HDQL 1W0VA 1FPTL 3TN0A 2E7LC 1A1OA 4ZXBA 4UILL 4JZOB 1TZGL 4OD2A 5KJRH 5IHUH 3RHWK 1OSPH 2WWKT 5JORB 1EUTA 2DQJL 1IM9B 3O8XB 2IANB 1IGML 4BQBA 4QO1A 1NGWA 3U4AA 4NWUL 5JR1H 4OLXH 3MRNA 4Z8FL 3MXVL 5D5ME 4LPUA 4JPWH 1KCUL 4NSKB 3ZL4H 4LCYB 4BSWA 1X4YA 1F4WH 5KOMC 3VXMD 5ACLA 2X9XA 2NY3D 3K4ZA 4LLWA 4FTVE 4M5ZL 5DZNA 4OZFH 5DD6A 5DQ9A 4M7LH 2FL5B 1NSNH 3TNNB 1T1YB 4OD1H 2X4OA 5KS9A 1IT9H 1FJ1B 3LRHA 4XP4L 2ILLA 2BVTA 1AXIB 2WIIB 2L7JA 3MUGB 3IFLH 2GTWA 2IWGA 3HE7D 1OLZA 4WHDA 4FXLA 2QKIB 1O7VA 4WI8A 3ZDYF 1T66C 2X1OA 4PRID 5KSBA 2AV7A 5DJ6A 2I25N 2KL6A 3P0YL 4YHNB 1MCWM 3SE4C 4WU7B 4EVNB 3DVGA 1MWAH 3GSVA 3HI5L 4OM0L 4CVZA 5B8CA 3S88H 1EBAA 3MNZB 5KOVC 3ZHKA 1Q0XL 3T04D 4XC1L 1J5OH 4FQJL 4XP6H 2DI8A 3B9KC 4JRXD 4QEGA 4S1DD 3NIDF 4PJFE 3VWJC 5C0CA 4UT6L 1P4LB 4F7MA 3OG4B 1JPTH 5DJ8B 1QLRA 2W9DL 3CVHH 4PRNB 1XGTA 3MJ9L 4JCLA 1J8HA 3O4OC 3QIWA 4WUUD 2ICWJ 2J8HA 5ANME 3X14B 5TE4H 3X3GL 4UQ3A 4H88H 3LKRA 4O9HL 4AY0A 4FFYH 1D5ZA 5BMFH 2BMKB 2B2XH 1FV1B 3U4EB 4L29B 4CADA 4Y8AA 3F7RA 1RJLA 2A74B 1MHHB 5TDNA 1CDJA 2QHLA 4DAGL 2FJHB 3QDMD 5E08L 2B1HL 1E4XL 4QXTB 5IROA 2VRAA 4JKKA 4Y7MA 2H32B 1EXUB 4N0UE 4X7SL 3QHZH 4ELMA 3CFBB 2DTML 4Y4HA 3G6JF 4ONHA 4PRDB 4UTBL 5BV7H 2DQHL 3EO1A 3MV7D 3GSUB 4JGMA 2XWBA 3CFKA 3EOBB 4H5SA 1OM3H 1NUGA 1IAIM 4A6YB 4MD4B 2G60H 2JIXD 3ARDA 3GHEL 4HHAB 2IH1A 3RVWD 3DRQB 3BJLA 5ADPH 1UB6A 3RP1A 2BSED 3ZE0E 4KVNH 1EAPA 2CLVB 3QCTL 5J06A 3EYFB 5HHOE 4OAWA 3RWCB 1M05A 5ERWB 4O58L 4PJ9B 25C8H 2D7TL 2V2XA 5CEZE 4KTEH 1M7IB 2VIRA 2XWJA 1G7PB 3DGGA 1BAFH 3MNWA 1Q9OA 1RI8A 1GGCL 3GI9H 4MB5A 3KPSA 3D69B 5CWSA 1BFVH 3G6DL 2R4RL 3GJEB 1RJYB 1E4WL 1RUQL 4QXGL 5T3ZL 4M7ZB 5C0JB 4LCCB 2KZ1B 3HB3C 2Y7QA 1WWWX 4R0LB 4E41A 3JWOC 1A6WL 4U6VL 2XA3A 3LHPL 4JQIL 5TFSH 3QA3A 4DTGL 4HJJL 1TJHL 2B1AL 1I4FB 3UO1L 3CFEB 2BNUA 3WFBH 3WIHA 5I1KH 4XNXL 5SWZE 4I48A 3E1F1 4P46B 3HC3L 4BQ9A 3Q6FB 2Q7YB 4JJ5A 4UNUA 5CEXA 5IFJA 5L8KB 1MCBA 3DX8A 2W0FB 4O2FA 4R97C 3S4SA 3VWJA 4D9QE 2EDDA 2EKSA 3MXWH 5IJKC 1J0KA 2AEPL 4P9MH 4RGMB 1ZT4A 3HUJE 1XZ0B 3VA2C 1FO0H 2B5IC 2CSPA 1FVEB 1ZANL 1I1FA 2V17L 5IIEA 4WGWB 1YN7A 3NA4A 3UTSE 3BZEB 1IJ9A 4OQTH 4NM4L 4NO5B 1QO3B 1Y6NR 2VXQH 5C0EB 1T0PB 2VLJE 5I1DB 3CSPA 2VZ1A 5GIRA 3O45B 5ID1A 5HD8D 1DANU 1EFQA 5J6HB 4NQDB 1SJHB 4NNPL 2YC1B 4OLZH 3RWDB 3QHFH 1BGXL 4PTUA 4HJGA 2V5SA 3HNSH 2JCCA 3C8DA 1OAUH 3FQTA 4MNHA 1ZA6B 1INEH 1V7MH 2BNQB 4LOUD 5GRUH 4YH6A 3CLEH 2P5EB 3U46A 3RBSA 5C0AA 2AP2A 3RI5K 4MDJB 3FAWA 5BRZE 5D8JL 1BD2A 4K07A 3VFWA 4N8CL 4AEHL 4G5ZH 4AEIL 1VGEL 3EO0A 4LCUA 3RVVC 2ZSVB 3OKDA 3UP1A 5BS0B 3RA7H 1N3NA 1F6AA 1UEMA 3C5SA 3QFDA 3INUL 1VCAA 4BM7A 4D9LH 1TCRA 4MLIA 3TH3T 5D1ZB 1Q0YH 1NGQL 3OAYK 1YN6A 2HVJA 1JYXA 1KLUA 5MEOA 3IJYB 2VLKD 4RGNE 4C54A 1DR9A 3TBYB 1FNGA 3HMXA 1CXIA 1UACH 4G9DB 4LQFH 2F54B 5IVOA 5IV2B 5DDHB 3ULUE 4HMDA 2OL3H 3VFUB 3SDCC 2ZCLH 3QI9B 1LK3L 1IM9D 2BERA 2BSSB 2N1KA 3D0VA 3F5WA 4U6TA 2J6EL 2FIKA 2R2HB 3EJJX 5JTWA 1IAOA 4ZAKB 2IFGA 4LGRB 4OJFH 2YPLB 4XCEB 3RKDD 15C8L 2OSLA 1RK1A 4X4YB 3DXAD 5JQHC 2JTDA 2Y06H 3GNMH 3MJGX 1QSFD 5I8EA 4HG4J 2RJMA 4Y5VB 4NPYB 2GY7B 1VKXA 1CFTB 1R24A 4KDTC 4OFPA 5HYJA 1EX0A 5IBUG 4IRSB 3IB4A 3VG9B 1U8HB 1U91A 4IHOA 4M43L 1X5LA 2QSTA 1AKJD 2CR6A 2J8UF 3L5WA 4PJCE 3NIGF 5IJKA 2C1OB 2ICWA 3TBSB 2B0SH 2AK1L 5IKCB 2CIKA 4JFPB 4MJ6A 2R69H 2IBZX 3GMMB 4G8GB 1N59B 1T0MA 2QR0B 4P2OC 2JB6A 1HI6B 4QTHA 4HS6A 3UTTD 4PGDB 4F33B 4M6OL 3REVA 4HULB 4KH2A 4BUGA 5C0DA 4HBCH 4QHKI 3X12A 5HHNB 3ARBB 5JO5A 5IBTL 1N5YL 3MACH 2FZ3B 5D2NC 3TT1H 1WCQA 2GI7A 5D70H 4ALAH 4NRZA 4GFTB 1A9BA 3WL9B 4I3SH 5D2LF 2PYEB 2GJ6A 1MIEH 3D9AL 5IMKB 1WQVT 2BSTA 1LO2H 3U6RA 1N4XL 5I1HL 4AQ1B 3ZKNC 4J1UA 1HYSD 4JFED 3S5LG 4LPWA 2HH0L 2DQFB 5GRVK 2I60L 5F7MC 5D6CB 4LEOA 3TM6A 1MCDA 5IB3A 4X6DE 5EC2B 1MAMH 1HOCA 3P4MB 5J6GB 1QHOA 4YO0A 5DHYB 4EXKA 1GPOL 2AV1A 4HDIA 3OPZL 3GIZH 3D87B 3U30C 3LH2L 4XNQA 2MCPL 2XPGA 3W2DH 4HLJA 1MCQA 2E6PA 2V7HB 4HKZB 4LF3B 4PJ9D 2BVQB 4PREB 2NLJB 2AABH 5FDYA 4K23H 2BZDA 1T0NA 1MHCA 1BM3H 3RY4A 3ZYJA 5C0IA 5E5MA 4RA3A 3HZMA 3ARYA 3EFFA 4WFFE 3EFDH 3D3VA 3SGJC 4EI6A 1IAMA 1XGUA 4R8WH 3S35L 2YUWA 3OAZK 1KPVB 4JFDA 2V5MA 4EUPH 3SKUD 2WLYA 1I1AD 1NCBH 2ED7A 4WDIB 4X7DC 1HKLL 5JHLH 5C0FB 4M1CD 1MI5A 1PDKA 4L8SB 1AD0B 1XR8A 2BK8A 2HWZL 3EYSL 1P7KB 4XBEL 5F3HB 4BFEA 4K94C 4E9LA 4KDTA 1FBIL 5FOBB 2WNGA 5FF6B 4ZYKB 3MCLL 1BJ8A 1RZKH 4Q58C 4K7PX 4IBLT 4HWBL 5IJVB 4NZTL 5KANI 3DX6A 4QRUA 1C5CH 1FAIL 1GSMA 3ILPB 4K8RH 3NFSH 2OR8A 2VDOH 5D71H 1CF8H 5HDQH 1XF2A 1YNLL 5ITFA 2EIZA 1DVFC 5C9KA 5C0RH 4P2CG 2EZ0C 1LDSA 4L3EA 4GKZA 2IQAB 2R2BA 4V1DA 3S5LB 3ZDXF 4N0CC 4P0DA 4XVSL 1NFDF 4LLVB 1EH9A 4Y19B 1KCRL 2UZYB 4E0RB 3QDME 4PJEE 1J0ZA 1AGEB 3ZE1E 1QLEL 4NWUH 3AGVA 5AUMA 2AI0H 4HXAL 4MB4A 4LVNC 1IEHA 3MXVH 4HLZG 3NBNA 4ZS7L 4UUJB 2VH5L 2K7PA 1MCLA 4MJIA 5BO1L 2PO6A 2ITCA 4NIKB 1EO8L 1Y6MR 3QUYB 5C8JA 3VFSA 4M5ZH 4JO1L 1RZGB 1LP9F 4MHHG 5AAWA 2HTLD 2IAMA 5T33L 1TVHA 4EQ3A 2HFGH 4GS7C 1LNUA 3P0GB 3EJYD 2IBZY 1EEUA 1RUMH 2YK1L 4Z95L 3MLTA 3JBG7 1ZLWK 1A3LH 1FNHA 1G7MB 1WUNT 1XF5B 2YEZA 4DN3H 4D8PB 3MJ7A 4RFEB 2DWEB 5D7JC 5B4MC 1BFSA 4LP4A 1CYGA 1KB5B 2P5ED 4Z7UA 2QLVB 5CIPH 3KS0J 5EZOH 1NBVL 5J12B 4KGLA 3MV9E 2P8LB 4UMGA 4WO4C 5EO9A 2IBGA 1CFQB 3WDIA 4FQJH 2RAMA 4POZC 3EYUH 1JRHI 3OG6B 4LHUG 4NO0B 3PL6C 4YHOL 4UT6H 4L9LC 4Q6IB 2XXMB 4BFIA 4NQEA 2C4XA 2ERJC 2GY5A 1IAKB 2W9DH 3OR6A 2NTFB 5GRXG 2PTTA 5DRZB 1U36A 1AFVH 1M1SA 1F02I 5D1ZD 5E70A 1VESA 4U1HB 1UKTA 3X3GH 4ODWA 4O9HH 5HY9B 1EPFA 2EE2A 3VWKA 4G42A 5E6ZA 1WF5A 1U58A 1U8JB 3B2VH 1JFQL 4KKLC 5D96C 1G9NL 2G5BA 3MRHA 3ZYIA 5D1QA 1BEYL 2XKNA 2BVOA 5D5MA 3P2TA 4ZTPL 2F54D 5E08H 3UYOD 2Y36H 2B1HH 1OSZA 5K33A 1N6QH 4HUVB 1IQDB 1RIHL 4OV5A 4NUJA 5TH2A 4AQOA 1T1ZB 3OJVC 4FTVA 1E6OH 2DTMH 2NY2C 4XX1G 4PRHB 4TTGA 1GOHA 5C3TA 5I6XB 2DQHH 3P4OB 1MNUL 5ID0B 2DQEL 3NOIA 4GMTL 4ISVA 4EJ1C 2QQKH 1N8ZB 1W72B 4Y2DD 2HRLA 1U9KA 4U1GB 3V4UH 2G5RA 5GGQL 1M7DA 2HLAA 3KYMB 4NBXB 1ORQA 4KTYA 5FDWB 3SKMA 2GK0B 4H1LH 4GBXB 5EC1B 3QCTH 5FCUL 3ULVH 2WBWB 1QR1B 1DVFA 3F7QA 3FO9B 4DEPC 4LHQB 1MQKH 4DW2L 4FQHA 3L5XL 2GSGB 1UJ3B 3V5KB 1S8DB 2D7TH 2NX5D 2XWTB 3UPRA 1DN2A 3D1MC 4NKMA 5EFIB 1T1WB 3JXAA 4CMMA 4NWTL 2XA8L 2YD2A 4R2GC 4EEEA 5IVNA 3IETB 4IS6B 3ZE2F 4MCZB 4MAYC 3ZKMD 2DRUA 4FQLL 3G6DH 4K7PY 3GKZA 1T6VN 4G8GD 1IE5A 3AAZB 1RUQH 2GSIA 4QXGH 1MFEL 4Y5XB 2PCPB 3EW3B 1PYWA 3D2UD 3P0VL 5ANMA 2J8UB 4LHUB 4KUCD 1IC1A 4H20L 2YRZA 3MRBA 4HF5H 4O5LH 5T3ZE 4YBLB 3UROR 3WS3B 3GBLA 1OGTA 4U6VH 1SJEA 1I3UA 3LHPH 4YDVB 1FORL 5HI3D 4JM4L 2PYED 1M6OB 3GK8L 2B1AH 3UO1H 5HPMB 4QOKE 1CVSC 3X17A 3BKJL 5GGRA 1CICB 1U3HD 1QFWL 2A9NL 1HQRB 4UBDC 1D9KC 3BKML 4JO3L 3C6SB 2YBRA 1HHJB 5JZ7D 1PY4A 5T3XD 1ZTXH 3VJ6A 3WO3B 3PL6A 4NKIH 1NGXA 2H26B 5D2LB 3QNZB 1F97A 2JJSA 2W59A 1ZANH 1B90A 4N5EC 1RK0B 4LIQL 2IANE 3SQOL 2V17H 4NDMA 4MA1B 4J3VA 5HHOA 5K9QG 4JKPL 4P2RA 4ENEC 5J11C 3VXSD 5HVHC 1CK0L 5LXGL 2VITA 2Z31C 4U3HA 4MXVE 2BOCA 5KVDL 1TZIB 2I9LA 3G5XA 3BESR 4MXWL 5MENE 3WMSA 4NNPH 3PWJA 3QAZC 1BGXH 4RGNC 1S7VA 2FX7L 1CGTA 2H1PL 2PXYB 5EU6B 4WHYG 1KB5L 3VXTA 1P69B 1FIGL 1AIFB 1Q9WB 1MCWW 2QADC 3NFPB 2X4QB 2DYPD 2XG4A 3B5HA 2P49B 5CD3A 4HKJA 4NNXB 5DURB 1JZ2A 4D0DA 5D8JH 3BDXA 1S7XA 4JY6B 4F37K 3UTQB 1GC1H 1CFSA 4AEHH 3L3HB 4UI2A 1ZHNA 2GT9B 5D7IE 4L4VD 1SVZA 3ALWA 4GW1B 5JXAL 3QH3B 2D3VA 3ARGD 2HT2C 4YBQD 1OOAA 5GS1C 4MZ3A 5C6WH 2VSCA 1WFNA 3Q2CA 4FXKB 4NNYB 2J2ZA 4W6YB 1B0GA 5SWZA 1SEBA 2I27N 3C60A 5GZOD 1PQZA 1EGJL 4M1DL 5E03A 1VENA 1F8TL 3TPUB 1CVRA 2YD5A 1IGTB 4MAYA 4L8CA 5I9QC 1LE9A 2G2RA 2ICEA 4HZAA 4BK4A 1ZSDA 4Q9CA 1A3RH 5BQ7B 2OXHA 1DLHB 2GW5A 3ECBB 3UTSA 3KPRB 4NQVA 4JDZA 1D5BA 1IGFH 4M7LT 3RVXC 3DBXA 3UBXG 1IEBA 5C9JA 1QBLH 3SDAB 1HNGA 3L6FA 2NY0C 4F7TA 3K81A 2VLRD 3KPMB 4GG6F 3WLWC 1W72L 2XNAA 2YD4A 4EDXB 4I0PD 3MRKA 3VFGH 1T2QH 3S8WA 5JA9A 4NQXA 1S3KL 2XZCL 1CGWA 3QUYD 1P9MC 5IMOA 4JM2A 1ES0A 1FL6A 3RFZC 1NFDB 1KXTB 4KJYB 1EDQA 1DQQB 1YUHA 4GQ9H 3MLVL 4NC0B 1YY8B 3NZ8B 3IFNH 4XVTL 4UZGA 2O26U 1WC7B 1YMHA 2B39A 4Y16B 5BRZA 5JXED 3AY4C 1X5YA 1MAJA 2JELL 4W4OA 3B2UD 1FSKB 3FT4B 2AK1H 1KLGA 3WHXA 3CC5A 5GRJH 5IMLA 3MYJA 1N5AA 1LP9B 2C26A 5DMJB 2UY6A 3BIAX 2H2PD 1A4JA 3W11D 1UCBL 2Z31A 4GAGL 3BH9B 3NFNB 1S9XB 2CMRH 1NBYA 3H0TA 4M6OH 1SEQL 5AD0B 5HHQB 2BRQA 1HWHB 5IBTH 3QSKB 4GG8A 1I7UB 3J7HA 3R0NA 3WUZA 3DURA 3REWA 3MUHL 4OF5A 4QHUB 2HMIC 3VMOA 3QUZC 4RWYH 3UTZB 2OP4H 3D9AH 1L7IL 2R2EA 5FUOL 5C92A 1N7ML 1DP0A 1I7ZB 1N4XH 3MLUH 3O6FD 1NFIA 1M4KA 3QO0B 4JEGB 4OGYL 3OJDB 5EUOF 5F9WB 2W07A 1T22B 3OX8A 4IJ3C 5ESQA 3PWPD 4NZJA 3G04B 1JGEA 2HH0H 3PHQA 3VFMA 3VFTB 3OZ9L 3PDOB 2R56L 4PV9A 2F9BT 3UBXB 4X6CE 3MTRA 2FIRT 5JHDE 1GPOH 1A22B 5GGTA 4ZUSA 3OPZH 4MA3B 4PB0H 3MRGA 4KQ4H 4Y4KC 4G8EA 1EVUA 4XC3H 5DD3H 4AT6A 4M6AA 4ORGA 4PJCA 3TA3A 2MCPH 3QPXH 3M17A 1UM4L 5E8PA 4GRMA 4OIAA 4GBXD 1ZA3A 4LAQH 5CMAB 3BW9B 2NYYC 1DBAH 1PG7X 2X5PA 3LKOA 1KCSL 4KC3B 3OKMB 1HEZA 1CT8A 2EDXA 2ZOLB 2I24N 3SEPA 2AJZB 5I0DA 4NQDE 1NC2D 1KB9K 3LS5L 4OSUL 4K3JH 4NQCD 4YDKL 2ZKHL 1C12B 1UVQB 1VGKB 3K8LA 1YZZA 4JGJA 4YR6A 3BHBB 1UB5A 1UXWA 3S35H 4UINH 1TCMA 2XZZA 2BNQE 5L7XH 1JWSA 4LNVA 5KVEH 3T09A 4PJGA 2F74B 1P9MA 2EYSB 2WP3T 3E8UL 2M1KA 3FB7B 4XBEH 4G80A 1FBIH 3CUPA 4HUWA 5E2TL 4P5KB 5FUZH 5EOTA 2H2SD 5EU4A 2OR9L 4HWBH 5BS0E 2FEEL 3AY4A 4HKBA 5DK2A 3N9GH 4OUUA 2E8YA 1MF2L 2P7TB 2E7BA 4BQCA 2V2WB 4D3CH 1KYOJ 3F7VA 4R96A 5MEPB 4A2MA 3MOBL 2E9IA 5F1NA 5HDBF 1U41A 1OL0A 3U9UA 4XVSH 1KCRH 2F54E 4ZNEE 3QQ9D 4PG9A 4G6KH 2GUOA 1ETZA 4M1GL 2Q8BL 3MA7B 5DJDB 5F96L 1XMWA 1CLYH 3MNVA 3IDJA 4M7KL 2BP3A 3UZEA 1S5HA 4TNVK 5SWQB 1WSST 2L0DA 3QUZA 4OZGF 2UY7A 5JIIA 4BKLA 2YPLE 3RRQA 4BQ6A 2WBJB 2LE9A 2IG2H 1S7SA 5T33H 2J3SA 2X09A 4QRTB 5HYSG 2P42B 4TTDD 1TVBA 4L9DA 5HGBB 1AR2A 3DX7A 1VFMA 2YK1H 3GRWA 4Z95H 1DN0A 2J1KA 4YDLC 1KULA 4N8VA 5ACZB 2BFVL 1JJUA 1WAAF 4OKDA 3MRLB 4LLDA 2FNBA 1EERB 4OGZA 4PRBA 2CKBH 1A1MB 1SYVA 4QT5A 1KJ2L 4LRIC 5EOQL 1I8IB 3IDIA 3VXPB 3QNYA 5GS0L 3VMPA 5BJTB 3IDNA 5EIIA 2NZIA 1FZMA 5E9DD 1F6FB 1WTLA 1KENL 2HKFL 3DLQR 4WU5A 4QY8A 1JUFA 8FABB 5HYQB 3W39A 3H3BC 1IL1A 4NYLB 5EBMB 1L6XA 3DYOA 4Z7NE 4PJIF 2OZ4H 1LGVA 1NAMB 2C1PB 2X4NB 3ZDYE 1HSAB 4LKCA 2ADJB 2ZCHL 4TUJA 3EJZC 3QDGD 5F8RC 1H3XA 3QDMA 4PJEA 1VACA 3AMLA 4M3JA 1HH6A 1G9NH 4G6AD 3PQYE 5L8JB 5L88L 1VPOH 4FFVC 4JO2L 1REIA 1KC5L 3NIDE 1J9CT 2LVCA 1G7QA 3BOVA 3KPRD 3MZTA 4MYWB 4PJHF 5IB4A 1RIHH 3VGFA 4Z7WB 3MV7A 4ZMAT 3V95A 3KXFB 2NY1B 3L95B 1BBDL 2JIXA 5EZJB 3SDAD 4TVPE 5IW1A 4FFWD 1YNKL 1C08A 1MNUH 3MJ6A 3R4DA 1F3DH 5DJZB 3B6SA 5F97E 5GGQH 4L3AA 4WFHE 1CQKA 3FB5B 3T4YA 5I66A 1NH6A 4U1NA 3HR5B 5FECA 4JFXB 2YSSA 3ZYOA 3MRIB 3TO4C 5F88A 4YAQA 1MRCH 5HYSB 3WNOA 5BVPL 3RWEB 4XCFL 3KPNA 3WFEH 4KRPD 2VR9A 4GG6B 3E2HB 4Y16D 2FWOA 1G7HA 1HSBA 4KROC 5I16A 5HHVL 4F3FB 3G6JE 4NWTH 1S7UA 5CLWA 1W8NA 4XPAL 4FQLH 2HJLA 5C07D 3VGBA 2VL4A 1DBBL 1A6AB 2Q87A 3TBVA 1MFEH 4MNQB 4X9HA 1A2YB 1JBJA 2C7UA 1K6QL 4FQ1H 2GHWB 2GQHA 1FZKB 1CDGA 2IALA 3VXNB 4MWFB 4H20H 5EBGA 2VE6B 3KLAB 1WZMA 3MJ9A 2CLRB 2PW1A 2JB5H 3D85B 3Q1SH 1FORH 3GJFB 3GK8H 1OAYL 4KJQD 1CDBA 4PJ8C 4CVXB 4JREB 2VABB 2A9NH 3RWHB 3OR7B 4YNYB 2IF7A 3V0VA 2CDGB 2OMNA 1MIMH 1IFHL 2ARJA 2G75B 1A6ZB 3R1GL 4HIJA 2XV6B 2RGSA 3H3KA 4Y5YB 1NCNA 1RZ8A 3L3DA 2FJFA 3HI6L 3QXAA 3QZWG 3ROLA 4QLRA 4OM1L 1M71A 3C6LD 3VD9A 5FYJH 4Q2ZA 4XBPA 5IGXL 1MUJA 2VZUA 3H9ZA 3OL2A 4X9GA 3SQOH 1BWMA 1EUUA 4XMLL 5I1GL 2IPTH 3LCYA 4Y19E 4JKPH 1UM6H 5K9KB 1CK0H 4HIXH 5EUOB 3T0WA 3V6ZA 5F89B 3QXDA 1YEKH 3I02A 4LIQE 2VTFA 3K2UH 4MXWH 3FO0L 1FL3B 5LG1A 4WI9A 2VQ1A 3DWTA 4BUHA 2BOBB 1AQDB 1T5XB 1UCTA 4KI5D 43C9A 2FX7H 1WIOA 4M4PA 5ACMA 4IIQA 4X6EB 3BP4A 1X5IA 4FQXB 1FNEB 3FQRA 3QIUD 2Y72A 4K3GA 2CO7B 3L3IB 3RIFK 2J12B 5C2BL 4Z0XB 3T3MF 3MFFB 4JPKH 3U0PA 3C09C 5EG6C 1J18A 3GSQB 4JLRB 1U3YA 3FQNB 5TF0A 3V4PL 3V6FA 5KSUB 2HJKA 4G9FB 2EEBA 3SKOA 2X1WL 5M95B 2B7DT 2L4OA 2ATPB 3V9FA 5JXAH 4J3OC 4R6UA 1BJ1H 1QLFA 4MA8L 4QOKA 1KELL 3U7YL 3V6OC 1UZ8A 3VRLE 1SY6L 1YQ2A 2OTWB 4FZ8H 4W70A 4JZOA 4KTDH 1RFDL 1JYVA 1G7JB 8CGTA 1F8TH 1KUMA 2BSRB 3I6KB 5JORA 2ZZUT 1U8QB 3O9WC 5D1XC 5CD5D 3KYAA 2XTJD 1IM9A 3JV4B 3O8XA 2X05A 3P11L 2IANA 3FB8B 3S34H 3CCHB 1HILB 2DQIL 2QQNH 1HINL 2VDKL 5ILTL 3J8F7 2CIIB 2QQLL 3QZWB 3D39D 5DHVH 4OCLC 4LCYA 4ZSOB 2CGRL 3TV3L 3UJIH 3LD8B 4G6FB 4PTTB 1H8SA 4PJBF 1OARL 4TSBH 4M7ZC 4PRHE 5I76B 2Q3AA 5FA4B 2YD7A 1YEHL 4KY1L 5E2WL 5ESAB 1DQMH 4LCCC 5CILH 2V9TA 2FL5A 3I2CH 3M45A 5E8OB 2XZCH 3GSNB 3TNNA 1T1YA 5F3BB 2DKUA 3L3KB 2DQTL 4HIEB 5E4EB 1FJ1A 4R0LC 4XPGL 3MLVH 1I9IL 2FBOJ 4XVTH 2WIIA 3VU2A 5J89A 3MUGA 2EYTB 5JA8B 4OZHB 5F7FA 5KG9B 1TMCB 3O0RL 2QKIA 4FMKA 2EC9T 3AU1B 4ZFOB 2A73B 3L3GB 1IAIL 4OZGB 3ZKSD 4YHNA 1VADB 1U2CA 3U2SB 4EVNA 4WU7A 4P46C 3MNZA 3GSRB 3EO9H 3Q6GH 5B39G 2HT3D 1UCBH 5HHXL 1Z9MA 4F58L 1P4LA 4U6YB 4P57B 1CN4A 4RGMC 4I18B 5DJ8A 1XGRB 3B9DA 5DVMA 3DVFA 4PRNA 5ADOH 3IXAB 1E4JA 4NP4L 4YX2H 1E28B 4JN2B 3DSFH 2J8UE 3X14A 2FHBA 5DMKB 2N56A 3NIGE 3Q3GB 4WEBL 3TYFB 4AZ8A 2BMKA 3WXVL 1FV1A 3U4EA 4TNWK 4L29A 3PNWB 5FUOH 5D6DA 2W92A 2A74A 2NY6D 4PGJA 3O6ML 1MHHA 4IRZL 3RVTD 2X9WA 2GJZB 3H2WA 5D4QA 4PGCB 2FJHA 1NDGB 3O3DB 4QXTA 4R4FL 2C3XA 2H32A 1EXUA 3FFCD 2VN4A 3CFBA 5FK9B 4JDTH 3DO3A 5IK3B 3SDYL 1QSVA 4PRDA 4OGXL 1CZ8L 3GSUA 4PJIB 4LARH 3EOBA 4POYA 5C0GB 4DZBB 4A6YA 4MD4A 4HHAA 5FO8B 3HRPA 3ESVF 5LVEA 3RUGF 5BXFB 3DRQA 3UEZA 1EZVX 4XCYB 2XACC 3HG1B 3FQWB 2CLVA 4XX1E 1JZ8A 1YJDH 3WKML 5DD5H 3EYFA 4NUGH 3BZFB 3RWCA 4ERSH 4P2QB 1UM4H 5ERWA 5AAMA 4PJ9A 4L8DB 3QWQB 3U4BL 2AAVA 1EHXA 3NACL 2QJDA 4PJHB 2ESVD 4XMKL 1KCSH 1M7IA 1G7PA 1MJ7H 2CDFB 4M02A 1X5FA 2X4SB 1AGFB 5DUBB 3LS5H 4LL9A 5EZLB 1D5IL 4KJWD 3BRDA 4YDKH 2ZKHH 3D69A 1TPXB 2Y07H 3GJEA 1RJYA 3KR3H 5EU6E 1RHFA 4TSAL 1RUPL 2I07B 4FQ2H 4N90E 5CZVL 5C0JA 3QI9C 5FKPB 5B39B 4LCCA 1G0XA 4YDIH 1R3IH 5HVWA 1AXTH 2YUXA 2UVFA 4ZAKC 1FNLA 5HI4D 3P3YA 4XXCA 3IAPA 4R0LA 5DVOA 3ARUA 3SBWC 5E2TH 5ICYB 2E7CA 5FHBL 2AJVH 4JJHA 3WIIH 2OR9H 2XN9D 4KJPD 3CZJA 4LKXB 1C8PA 1B3JA 1I4FA 1X4XA 2NXYD 3CFEA 5J8OA 3WNKA 1MF2H 5AWNH 1JTPA 3BRGC 3CK0L 4P46A 1AO7B 4GAYB 3Q6FA 4IRSC 4OLEA 3VG9C 1B88A 3UC0H 3QDAA 4IM8A 1TQCB 1JNLL 2Q7YA 1IMHC 3T3PF 1YDPB 2W0FA 3NCEB 4OBSA 4F57L 2GEEA 3EDKA 3SQBA 5IHLB 1XZ0A 1FVEA 3QWOB 5DZOA 4ESKA 4Y2OA 1CG9B 4M1GH 5F96H 5LQBH 3BZEA 5DSCB 2CKNA 2RB8A 4NO5A 1QO3A 4Z77B 2CXKA 5C0EA 4GXUN 1Y0LB 1O5DT 5I1DA 4YXLL 3NPZB 1YQVL 4N0RA 1TJIL 3O45A 1D6EB 2NY4D 5GPRA 5J6HA 4NQDA 1SJHA 4P99A 3MGAA 3QUXB 4X0KB 2YC1A 5EBWB 3ARBC 3RWDA 1CL7H 1CWVA 3L5JA 1ZHBB 3TH2T 1UWXK 2F5BL 5A2LH 1BQSA 3BQUC 2IMNA 4F15B 5IFHH 3WFCH 1BF8A 3ZDXE 1ZA6A 4OUOA 1NFDE 2BFVH 2VXUL 2BNQA 4KKCC 3MV01 1KIPB 2DI7A 2P5EA 3JSSA 1F4XL 4CVWA 4X80L 3V5HB 1I85C 4RDQF 3S37X 4ZTOH 4MDJA 3QRFM 2APTA 3LEVL 4HPYL 5DUMH 1P6AB 4U1KB 2E6JA 5EPMB 1BFTA 2ZSVA 7FABH 5D7LB 5BS0A 4WFGE 4OLWH 1LP9E 1R0AL 4OF3A 5E7BA 1K8DB 5GS0H 1H3GA 2YUZA 1KENH 5D1ZA 3N1QC 2HKFH 2DBLH 4CVUA 2R1WB 2X6MA 1UGNA 4DCQB 3VXRD 3IJYA 2EH8L 3KYOB 4JPVH 3VD5A 2HFFB 1CLZH 3TBYA 3PWUB 2ZCHH 4G9DA 3TNMB 4P5MB 2F54A 4LCIH 4Q0XH 4ZNEA 5IV2A 5DDHA 4AIOA 3VFUA 2O5YL 3QI9A 1S78C 2BSSA 3NZHH 4JFOB 5L88H 1T03L 2R2HA 4ZAKA 2AK4B 1KC5H 35C8H 4EI5C 4FABL 4Y1AD 4APQD 3LKNB 5KSVB 1NGZB 1LEIB 2YPLA 3QRGL 4IOSD 4XCEA 5E6ID 4X8JB 5LCVL 43CAB 1BBDH 4LSUH 4X4YA 4PYHA 4XP1L 3B8YA 2AXJA 4XI5C 4Y5VA 4NPYA 4PBVC 2R0LL 2RFXB 5IOPB 4L8SC 2WQ8A 1CFTA 3CFJB 2YKLL 1UA6L 4IRSA 5DUPL 1U8HA 2NX5A 4UT7L 5BVPH 2VDPL 3KPPB 4XCFH 2C1OA 4JFZH 4ZQKB 1E4XI 4PUBH 2NTSP 3TBSA 3BSZH 3IGAB 1DL7L 1CIUA 5IKCA 2O93L 4PJBB 1C1EL 4JFPA 1JPST 1I3GL 4JY5L 3GMMA 4G8GA 5JW3L 1N59A 3QT2A 2QR0A 1J87A 3S97C 3HZVB 1HI6A 3QCUL 4PGDA 4F33A 1DBBH 2WWMD 3G6AB 5HHNA 3CPLB 3ARBA 1NUDA 1K6QH 2Q86B 2FZ3A 3S36X 4M9OA 2DDQL 5BW7A 1T83A 1LWRA 4IOIB 2EE3A 3B9KB 3WL9A 4P4RB 2PYEA 3TFKD 5IMKA 3DETD 5T3XL 1AGBB 5DMYA 5DO2D 1JMZA 1NMAH 1OAYH 3VG0L 5I15L 3ZE2E 5FYLE 3JWDL 4POUB 3OTTA 5EO0B 1DE4B 3RVUC 4JFYB 3TVMB 1E27B 1IFHH 5KAQF 2DQFA 3GBML 5D6CA 3MLRH 3PGDB 1PG7W 5EC2A 3ZTNL 5J6GA 1SBSL 3P4MA 1EIBA 2HLFD 3D25B 3HI6H 1AR1C 5DHYA 4DKAA 1J11A 5IGXH 5J12C 2QQQA 2A6IB 4ZOAA 2A9MH 2VXTH 2A6JB 3ETBF 2LFGA 2F5AH 3HG1D 4DKFL 2FLBT 3SKJH 4OI9A 4XPBH 1NL0H 2V7HA 4NKDB 4HKZA 1B6UA 4P2QD 5DXWA 1CDIA 2EDWA 4LF3A 2BVQA 4PREA 2NLJA 3FO0H 4XH2B 3VDCA 4I8DA 3AC0A 3QISA 3OAYH 4LSQH 1EEZB 3WD5H 4UIKL 1HNFA 2OK0L 3K3QA 4B5EA 3NN8B 3WUWG 3MBEB 3O4LD 3RUGB 2C3HA 2DIBA 2X4RB 3RNQB 4LLQB 3C87A 5A3ID 2E7HA 4YC2C 1KPVA 3G5YB 3QEHB 2XFXB 3HA0A 2D7MA 4WDIA 5C0FA 3SDDC 4WV1C 2BXYA 2FX8H 3ARFD 2GFBB 4L8SA 1AD0A 4PRPB 1P7KA 3WXWL 5F3HA 3L3JB 3V4PH 4K3HA 5FOBA 1T80A 4Y4FC 5FF6A 1YMMB 1F13A 3V7MA 4ZYKA 3TN0D 3PE9A 4ZXBD 5F7DB 5I6XC 3ABZA 2FH8A 1G6RB 5IJVA 2UWEF 4RDQG 5DTFB 1KELH 1F3JB 4DWHA 3ILPA 2FBJH 3CZFB 3U7YH 3ZT7A 4K9EL 5E99H 1NMBL 2OCFD 2IMMA 4OCWH 1HH9B 2W91A 2PF6A 1EJ6A 1RFDH 1RVFL 4MB3A 1UJ3C 1ACZA 2IQAA 1QSEB 3S5LA 3P11H 4LLVA 4Y19A 3CSGA 4E0RA 1P84K 1AGEA 1HINH 4K71C 1X5JA 2QQLH 4UUJA 4ODTL 5JOPE 3VFRB 2CGRH 3TV3H 4Y5XC 3KXFE 3QUYA 3MRQB 1RZGA 4ZFGL 3CGTA 4KK8C 5CJBA 2B5IB 1YEHH 4KY1H 4WJ5B 2APFA 3BI9X 3V7AG 5AYUL 2ARJQ 4OLYL 2HG5B 3MRDB 4PY8J 3QQ4B 2DQTH 3C8KB 4YBLC 4I2XB 1XF5A 1G7MA 3WEXB 5K93A 4D8PA 4S1RL 3DPBA 5FV1L 5IW3A 5AZ2H 3LN5B 4RFEA 3SY0B 3O0RH 2DWEA 4XP9H 2BC4B 3WUWB 1KB5A 3DVNB 5FGCB 3BXNB 1CICC 4X9FA 4GG6E 1FFRA 3BWAB 3I84A 5EU5B 2P8LA 1J8HD 1CFQA 3Q5OA 4DQOL 1F45A 3AREB 1MCJA 4NO0A 4F58H 4Q6IA 1NEUA 4TYUA 1IAKA 2NTFA 5DRZA 4PD4J 3OB0K 4MA1C 4MNQE 4XVUD 4XAKD 3MJ8B 3UX9B 4U1HA 4DOHB 3V0AC 2RQ8A 5HY9A 3WN5C 1EGJA 2APWA 3BWUC 4WEBH 2WUBH 1D7FA 2FGZA 4Y4HD 3MRJB 4AG4L 1U8JA 4HEME 1NDMB 4AENB 3O6MH 2CQVA 1YY9C 2CRYA 3BZDA 3ULSB 3BVNB 4HUVA 3GHBH 4HWEL 1IQDA 4YHZL 2PXYC 1T1ZA 3T1FB 2VSDA 5KVGL 4PRHA 2K1MA 2PYFB 4YUEL 4OGXH 3RZCB 3U9PL 1CZ8H 3P4OA 3O2DH 1PW3A 3GKWL 5ID0A 3OAZH 1KIQB 1N8ZA 3RQ3A 3SDCB 1W72A 3KPTA 2C9AA 3QFJB 3L1OL 3KYMA 2ARWA 5FDWA 1Z9OA 3U0WL 2GK0A 1NCCH 4GBXA 5L6YH 5KAQG 5EC1A 3WKMH 4OFVA 1QR1A 1MCOH 3CFCH 1SJXA 5E1HB 4WHCA 3FO9A 3KPSD 5TQ0L 1FG2B 5DR5L 2GSGA 1UJ3A 3U4BH 3V5KA 1S8DA 4U1IB 5EUOE 1Z9LA 4X9IA 1DQJB 2XWTA 1GGIH 5EFIA 3BYYA 1T1WA 3KLSA 3DYMA 3EKCA 2X42A 4HAGA 1D5IH 5GHWH 3IETA 1MEXL 4IS6A 2E6QA 4MCZA 3A6CL 5F6IB 4AL8L 5EOCH 4E41D 3AAZA 2HT4C 1HQ4B 4TSAH 4Y5XA 1RUPH 2PCPA 2UV3A 1L9MA 4DVRL 3OV6A 1FE8L 2GCYB 2J8UA 1RZJH 3EHBC 1FZJB 4LHUA 1T66D 4GAJH 1NMCB 4LDOB 4MJ5B 1G6RL 5IQ7L 3QQ3B 4P2OB 5BVJB 4E5XB 3WS3A 4G9FE 4JB9H 5FHBH 3E3QE 3WIFB 2BHYA 4YDVA 3T0VA 3B9KD 3VWJD 3IU3B 4ODBD 2VDRL 1M6OA