3QXWA

Free structure of an anti-methotrexate cdr1-4 graft vhh antibody
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASRRSSRSWAMAWFRQAPGKEREFVAKISGDGRLTTYGDSVKGRFTISRDNAEYLVYLQMDSLKPEDTAVYYCAADDNYVTASWRSGPDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-Methotrexate CDR1-4 Graft VHH
publication title An anti-hapten camelid antibody reveals a cryptic binding site with significant energetic contributions from a nonhypervariable loop.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 29
structure length 124
sequence length 124
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qxwA00
1FORH 4OLZL 3TP4A 1L6ZA 4YHOH 4NNPH 4NC1C 1U91B 1MCLA 4KDTC 2A83B 3S88H 4MCZB 4Y4FA 3VRJA 1CVSC 4PJAF 4L8CB 4EJ1C 4GBXD 1YNLL 1A7BA 1F2QA 4QRSA 1WFOA 3MR9B 4PJAE 4BK5A 4BUGA 1MFEL 4Z76B 2QHRL 3QDAA 4Y4FC 5C6TH 1BBJB 1IGTA 2PXYB 1JHLH 1QBLL 1U36A 4ZSOB 2R1YA 3UYRH 5DJ2A 4PRDA 3INUH 2ARWA 1KFAL 1DFBL 3IFPA 5DQDL 3QUKA 3U4EB 1N5AB 4J3XA 4PS4L 4JY6B 4P2RB 3L5WA 4F7CA 2UWEA 3T3MF 1B4JH 2FJGB 1RUQH 2X4QB 4H5SB 2IPUG 1OAXL 2BNRD 1A0QH 3RRQA 5F3BA 4HK3J 3T3ME 2A6JA 3VGAC 3BDYL 4Y88A 3KPQB 1JUFA 2YMXH 5FFLA 4DGVH 2DKUA 1UVQA 1YJDC 1K8DA 1PEZA 4MYWB 4AK1A 3HZKA 4GMSH 4WV1C 1MJ8H 1AO7A 3MRGB 1CU4H 3HNVL 5HI5C 4I18A 1P9MA 1S8DB 2YOCA 1W72A 5DA4A 2XZCH 2AEPL 4LHJB 2DWEB 5DFTA 3IKKA 3S5LG 15C8H 4N1CA 1PKQE 1T5XA 5J57B 3TPUA 2I25N 1QO3A 1T1WA 5HDQH 2IADB 3Q3GA 4NKMB 2D7TL 4I18C 4O02H 1P9MC 4MNQE 3OX8A 5GJSH 2R0WH 5LG1A 4QXGH 5KG9A 4Z5RB 2HJLB 3DMMA 3QEQE 4IOFC 5T5NF 3VXMA 3T2OA 5LGJB 1BM3L 2G5BA 3VXSA 1WV7T 2CDFA 3OKNA 2NW3B 3E6FB 5ITFA 1ZHLB 1RZ8A 1ZT1A 1E6OL 5DD3L 2H2PD 2OJZH 4RFOL 3DMMC 1E4XI 3L5IA 4YQXH 3BH9A 1KCKA 1T7XA 4B53A 1I4FA 3MXWL 2PW2A 4WEBL 3CC5A 1JHKL 1U8JB 2R4RH 1A6VH 5BRZB 4MA7L 4RWHA 1NGWB 3B9KA 1BZ7B 3WFCH 4FZ8L 3T3PF 1VKXA 3EYSL 4R9HA 5TGBB 4GG6B 4M9OA 2P5WE 1FG9C 3ZKNC 3T3PE 5E2JA 3B9KC 3G9AB 4YR6B 2WUBL 4N0UA 4DN4L 5HXMA 3VWJB 1VGKA 1A6TB 3PG2A 1GGCL 4PY8I 5IMMA 2DLGA 2E5EA 4HBQA 4LCIH 1I1AA 4AT6A 3AGVA 3MOAH 3WFDL 3BKCH 5FYJL 1A02N 3ZTJH 1CLZH 4DW2H 4RGNE 3X12A 1TENA 2PO6A 3QO0A 4DVRH 1I1AC 3I9GL 3JWDC 3RWJA 5DQJB 3HI1B 5JNYB 4KK5C 1FE8H 2ED7A 2VWEE 5HGHB 1F97A 4JFFA 4ZFFB 2C3XA 2PO6C 4YDJB 1M71A 2VXTL 5EU3B 3O4OB 5D2NE 5EZOH 1PLGH 1LDSA 3VD3A 1CLOL 2MCPH 4LVEA 4HC1A 1VADA 3TNMA 3O2VL 3G08A 5EZIH 4KI5D 3UJTL 4MA8L 4Z78A 2GJZB 4HIEA 1YPZF 1DQLL 5SX5H 2APTA 1TQBC 3QDGD 1LO4H 5T33L 4K3JL 4DWHA 1UXWA 1YPZE 3O3AB 2YUZA 1Y0LA 4KUZL 1MCNA 1CD9B 3SGJA 1Q72L 5I1DB 4LSPL 4HLZG 3RU8H 3MOQA 1DUYA 1T4KA 3WUWB 1XCQB 1MAMH 4JRXD 5E6ZA 2R15A 2NY4D 1W0WA 5I19H 5HYFA 1F13A 3V8OA 5IJVA 4XPFH 5FOJA 3SGJC 4M61A 1RIUH 1RULH 2LQRA 4GKSA 2KH2B 4I0PB 4PJBF 5F8RC 1MFCL 3LZFL 5FO8A 2VZOA 1HKLL 4PGDA 1OD7A 1IC4L 1J0ZA 1I9EA 1AGFA 3TV3L 3QIBD 2XWJA 4PJBE 2VH5H 1N3NA 4MD4B 4PJEF 2C7UA 3ZTNL 2PN5A 3GI8H 5TE7L 1EJOL 2DQUL 4I8DA 1D3CA 4PJEE 1MFBL 1A7NL 3P11L 3UXFA 2B1AL 5FCSH 1XGTB 2EDTA 1K4DB 1MHCA 4O58L 3JUZA 2FATL 2WM0A 4OKVA 1OAYH 4F7MB 2Z0BA 4LLAA 3AS3A 1J8KA 1W0VA 4CBPA 3C8KA 1MCJA 2WP3T 4LF3A 1ES0B 4OCWL 1IKNA 5ESQA 3VFTA 5DZLA 4Z6AT 1FPTH 2VDQL 5B21A 5J8OA 3SBWA 4J6RL 4OM1H 3TJHD 4YHLL 4KJQD 4TUKH 3BW9A 4RRPA 1A14H 4ZOEA 3F6IA 2AV7B 1U8PA 1IKNC 1T2XA 1NMCC 2ZG1A 3M1BA 4MJ5A 5HYEA 1R3HA 3FRPG 3MLZL 4XMPH 5EBLA 1TTUA 3SBWC 4X7DC 3ARBB 4HUUB 2D0HA 3EYFB 3PDGA 5KS9A 1ZLVK 3H0TA 2XN9D 1V7ML 4MQXD 2DJSA 2MOVA 2QSVA 4Z7VA 4PY7A 1J0KA 1O5DT 3GUTB 1UXSA 3JUYA 4X7SL 3VFUA 1S5HA 1KLGB 2SEBA 3ARGD 3R1GL 3U7WH 5CIPB 1MLCB 2BRRH 1BQUA 4HWEL 1ONQB 1YEJH 3GIVA 2RHEA 5DD0L 2VYRE 1T7VA 2RB8A 5KTEL 3ULVL 4XCEB 1HIML 4KTYA 4O2EB 3TN0D 4NRXB 4N8VA 3J8F7 5JOEA 5DGQA 2VZ1A 1UCBL 3HPLA 1ACYL 3MA9H 3AUVA 4MB5A 5IB5B 3SOBH 4TNWF 4Y19E 1EIBA 1QLRA 3MCLL 2E9WA 2D0FA 2R29L 3EJZD 5JDSB 3VXUD 1XGYL 1L0YA 3NFNB 3D3VA 4QEGA 2R1XA 2EIBA 4KQ3L 4OGAD 2X4UB 1ZSDA 3PGCA 3H7LA 1CLYL 1C5DB 5E7FA 3ES6B 2AQ2A 4EBQH 3OV6A 2VLKE 3KWWB 1ZT7A 2MPAL 5IVOA 3QH3B 4WFFE 1LEGA 5INDB 2BVPA 3KLSA 3VG9C 3UTZB 1QD0A 1NDMA 2IANE 2WBJB 4PRAB 1U3JA 3FO0H 1IKFH 3RBSA 5C0CA 1FYTD 1YQVL 4XZUB 5GRJL 4ZDHB 3JV6B 4CJ1A 1S78D 4OM0H 1YEKH 4XVTL 4BFEA 1PZ5B 1XF3B 4RZCB 4QCIB 4BQBA 1H15B 4ZQKA 2DLFL 2VAJA 4HKZB 5SWQA 5L7XL 4L8BB 1QQDA 1F4WH 1AGCA 5EFIB 3HNTH 1U8KA 2HFFA 1B2WH 2AJZB 3I2CL 4Q0XH 3MJ9H 2JCCA 1H8SA 3HG1D 2ARJA 5SWSD 3NN8B 4JFDA 4ETYA 1L7IL 1IM9A 2FLRT 4LEOB 4XCFH 1I75A 3C08H 1KB9K 5F1NA 5DRXA 1YJDL 5A40E 5HGDB 4PJGF 2YHGA 3FO9B 3IGAA 3RVWD 3RWDA 1Q0XH 3MNZB 3GO1L 5L2KE 2DM7A 3PDOA 4GAYB 4OI8A 5I8EA 3BD3A 1MNUH 4PJGE 5M7QA 1RK1B 4FTVE 1G7MB 5GGSB 1QUNA 1FL5B 1T83A 1IGCL 4LPWA 4X99A 1T0PB 4N9GB 4M03A 1OTUC 3MXVL 1DLHB 1W72L 4MSWB 4UQ2A 5CUSL 2DQCH 3QXAA 1T6VN 3KPTA 5TFSH 1M6OA 4L4VD 2MSPA 3STLA 3RUGF 5GS2H 4JZOA 5C0GB 4R0LA 5F93C 5IW6A 3RUGE 3VXTA 3F58H 4U1NA 4XHJD 4GS7B 3BRDA 3OZ9H 3U4EA 1JGVH 2AXGB 3JXAA 2W1NA 4M1DL 5GRZA 3G6JA 2PXYC 1TZGH 4WHYG 1ND0B 1ZLSL 4YHIA 4D8PB 1AD0B 4R0LC 4ZFOB 5H8DA 1H8OA 3BWAB 4YHOL 4NNPL 2FJGA 1G7JB 2V17H 5IMLA 2X4QA 4ZUUB 1OAZH 3BVNB 3S88L 1FIGH 5I9QC 2DDQH 1BLNB 2LV4A 3PXJA 2NY0C 4YXHH 1GGYA 2YSSB 4JFEE 5AYQA 1WTGT 1LMKA 1UM4H 5T5FH 4R2GC 1XGPA 1MAKA 1D7FA 1T1YB 4KRPD 4OCYH 5C6TL 3UYRL 1JHLL 2CD0A 2DWEA 3O8XB 3HZVA 4JFPA 4HUXA 4OD1L 4FA8A 4YJZL 1BREA 2FWOB 2FB4H 3WSQL 4UUJA 1RJLA 4KKAC 3NIDF 5FO9B 4P5KA 4WFHE 3BKJH 3NH7H 3EO1A 1MFDL 1QBBA 3FOLA 4PTTB 5CS7A 1RUQL 3NIDE 4HDIA 1WBYA 5JO5A 3HAEA 2YRLA 2ORBH 1RUML 2YMXL 3LQZB 3HE7D 5DHVB 4EQ3A 4DGVL 1HK6A 2Y36H 4KJPC 4S0TD 1NJ9B 4PJFA 4GMSL 4NZDA 5DJXB 3QDJD 3CZFB 3T0EA 1PX3A 5BRZA 1QTYT 2PYED 3EYVA 3FQUB 2XZCL 2YPLE 1M7DB 1PJ9A 1YECL 1QP1A 1K3ZA 1GL4B 1S7QA 2FHFA 3IKCA 2HTKC 3TBSA 4OZHA 5MENB 3T0EC 4O02L 3PP4L 5GJSL 4HF5H 2R0WL 4HC1L 5IHZB 4JRYD 4QXGL 3HI6H 5KVDH 1KG0A 4YR6A 1CTOA 2NY6D 4FRWA 1OP5K 4P46B 3PDDA 3O3BB 3WIHH 3VWJA 3BZEB 4P5TD 1YMMB 5JW4N 2YD3A 1CGYA 3KYMB 1OQOA 3KPLA 3BYTA 2OJZL 4YQXL 4K94C 3DVGA 3NCJH 3K8KA 2FEDD 3MRPA 2W38A 4WEMB 3VWJC 2BOCA 4XPAH 4MX7B 1J7VR 1UB5B 4LPCA 2R4RL 1A6VL 2BCKA 1YUHB 4MD5B 3C5ZD 32C2B 3WFCL 4TUJB 5LKNA 5C0NC 1HINL 2VL5A 4QRUB 1S5IH 5MERA 4KK8D 1I1RA 5EIIB 5D4QA 4JFQB 3VXRE 1D5BB 3BPLB 1JI2A 4QHMA 3QQ3A 3CZJA 2A9NH 1CGTA 4MNGE 1EAPA 3GMLB 4LCIL 5FA3A 2RQ8A 1NC4A 3O4OC 3MOAL 3ARFA 1T21B 2LFGA 3BKCL 5TDNA 1U8IA 1SY6H 1CLZL 4L8DB 3PWPD 4DW2L 5JZ7D 4QHKJ 2P8PB 3OAYH 4C57C 3EGSA 1NMAH 4MNHB 1GGIL 4H25A 4PR5A 1G9MC 43CAA 3BAEH 5I1JH 4KY1H 2MHAA 3ARFC 4UNVA 3DARA 3TBVB 3EOAB 3MCKA 4PP1D 4XP1H 3WBDA 4RMWA 3MROA 2J1KA 3WS3A 5EZOL 1QKZH 1PLGL 2MCPL 4X6DB 3IFOA 5EZIL 4PBVC 3STZB 3WIHA 4LP5A 2EH7H 3QJHB 1JJUA 1U92B 5TF1H 4M9PA 1QA9A 4FQ2H 5KSAB 4I0PC 1J05B 4C58B 1JK8B 2A38A 4ELMF 4Y4HA 2ESVE 5K9QG 3KXFD 2VLJA 3QNYA 1CXLA 5IBUG 2G9HA 1VCAA 35C8H 3RU8L 4OAWB 1G6RB 1N7MH 1GGBL 5F7MC 3NABH 5BW7C 3BXNA 4W6XB 1MHPL 4ELME 1KIQA 2HYMA 1N64H 1HHHA 1NL0H 4XNXH 5I19L 1IT9L 3OR7B 1RIHH 4Y4HC 4LCWB 4XPFL 2B4CH 3DGGB 3IDMA 4U7KA 4HUMB 1RIUL 1RULL 1ES0A 2UYLB 3S36L 1PX4A 4U0RB 3S34H 5HYJD 2A74A 1U8HA 5T1LB 1JWUA 3MODH 2VH5L 1CD1B 5A1AA 3VGFA 4Y2OA 4B41A 5DJDA 4KKLC 5IWLA 3GI8L 3D0LB 3PHSA 1RFDH 4D0DB 3IDJB 3IXAB 4PLKD 3T8XB 1BJ8A 3PGDB 1SY6A 3CFCL 1R5VB 5E4IA 3HTLX 3CGTA 5IWLC 2O61B 4M93B 4JHWH 1Q0YH 2JJWA 4K8RC 3QDMA 2BNQB 5C0AD 5I1KH 5CIPA 4BYHA 5EO1A 1JWSB 2MTPA 1I1CA 1MLCA 1FPTL 4J3SA 4EN3A 1X44A 1EEQA 4OM1L 2E6QA 4NDMA 2JIXD 3JVGA 4G43B 5BZWB 1R3KA 5DVKA 1A14L 4NRXA 2F54A 5DVNA 2BVQB 5ICYB 5C08E 1CIDA 2QLVB 4XMPL 3UTSB 3HLAA 4P23D 3U9UA 5FKAB 3JVGC 1CN4A 1QVOB 3QIUB 4AQ1B 5GGQH 4CN1A 1JNHA 1QSFE 4TOYH 5LXGH 3RDTA 3GGWB 3WDIA 3FOMB 4QGTA 3EDJA 1X4ZA 3ZMRA 1DQMH 3EJYC 5BXFA 2EEDA 1C12A 1NAMH 3CCHA 3U7WL 3QP3A 4UDUB 1XMWA 3QDGB 1DDHA 2BRRL 4PREA 3U7AA 3UPCA 1YEJL 2WWMC 1RZJC 5HHPB 1FO0H 2EDFA 3TWCH 2YC1A 5CJ5A 5C0IB 3SO3B 4JDVB 4PJ5A 3TIDA 3LV3A 3SDAB 4QOKA 3MA9L 2NY4B 3HC4H 3SOBL 5JW4M 3QIWD 5FUOH 4QCIA 1L4IA 2C1PA 2P5EB 4N0RA 2X4PB 4QRRD 1U42A 3MLSH 4PV8A 2PETA 2VB5A 3VD7A 1KCSH 2P24B 1TLKA 1REIA 3U36B 3QFJA 3Q1SL 2FBJH 3V6FB 2E7LC 5IROC 1X5LA 3BKMH 2K7QA 1BOGA 5I75C 4LEOA 4AH2A 4EBQL 3EHBD 1OTSD 1TETH 3H9HB 3X13B 4MJ6B 1Q94B 3B8SA 3FO0L 3QQ4B 3CAFA 4OFDA 1IKFL 4UAOC 5HGAA 2GAZB 4R7NB 2IMNA 2QEJA 4OM0L 1GZPB 2ZCKH 1DLHA 4MSWA 1E27A 1F4WL 4XP4H 3GJEA 1B2WL 3FRUB 1BMGA 1ZVSB 3MJ9L 3MV9A 4H88H 3SCMB 4YBHA 1KEMH 1AKJD 3I6KA 1OWWA 4XCFL 4ZFGH 3C08L 1R5WB 5DHYA 5GISH 3LRGA 4LSRH 3L95B 3GSOB 3VGEA 4BH7B 3S96A 1Q0XL 2DMCA 2VISA 1ND0A 1NAMA 3VFOB 4E41A 5JUEH 4H0GA 3FFCB 5I66B 3D39D 4ZFOA 1MNUL 3PIQA 4ZUUA 1AIFB 4GS7C 5MEQB 4LEXL 4POZD 5F7EL 2GSIA 3VFMA 3T4AA 5HHVL 4NSKB 1E28A 2E6JA 2YPVL 1IAOA 1T1YA 5IW3A 1WK0A 3FKUS 4JO4H 5C0BD 5I0ZA 1RUKH 1GIGH 5ITBH 4YAQB 1IM3B 2VR4A 2EH8L 1A9BA 4P3WA 1HSBB 1U9KA 4K94L 1AR1D 2R56H 3OZ9L 1JGVL 4K2UL 2W9EH 1T20A 4M48H 1TZGL 1JIBA 4P99A 5DUPH 4X6EB 3RKDD 3ZL4H 3GM8A 1XIWB 4R8WH 4QY8B 4R4NC 1S9XB 3CFDB 4EI5D 4LKXA 1FIGL 1RPQA 2DDQL 3FO2B 1QPXA 4PD4J 4YXHL 4M3JA 5DHVA 3EFFB 3VDAA 4APQD 5FXCH 3NOIA 1UM4L 5F6HJ 4JLRB 4AG4L 1IAII 2J6EH 1JHTA 4OCYL 3HZMB 2P8LA 2FYYA 4TVPE 3LKNA 4JANB 5D7JD 3V5KB 3KDMB 2FB4L 2X4NA 4Q7DA 2X9WA 1R5IA 3IU4H 3HMWH 3N9GH 1CE1H 5DJ6A 3L7EA 3ARRA 3BKJL 3NH7L 4OCXH 3M17B 2DI8A 2RFXA 5DJ8B 2A6DB 5BS0B 4HAGA 1YMMA 1EDQA 1M4KA 1GRWA 1I1FA 1RVFH 5DVOA 3FB8B 2ORBL 1CWVA 4C54A 4OLWH 2Y36L 3H9SD 1FG2B 2FHCA 5KSUA 4OLUL 1JGDB 3VRIB 1UB5A 2GT9B 2JKXA 3MREB 4WI5A 4NO5A 5MP6H 5HHQA 4PJHA 5IF0A 1RJCA 2Z91B 4PV9A 1TVHB 1NBVH 3WUWG 2DM4A 1A47A 3ARTA 4HF5L 4LCCB 5A2JH 5KVDL 4Z8FH 1OAKL 4GBXA 1Q9KA 3WIHL 1V7NL 2Y5TB 4HJGA 4LLQB 3OXRB 1A1OB 1OT2A 2NLJB 3TH2T 2VDNL 3UZEA 4P2RE 1BD2B 4OQ1A 4ZPTB 3CSYB 3HRZB 4LLYA 3HE6D 4GBXC 3NCJL 5ID1A 2NX5E 3G5YB 4NRZA 5GGTH 2NZ9D 4GQPH 1EBPA 1WISA 4L8DA 5ENWB 4YDVA 3FQRA 1EHXA 3HUJF 1QFWI 3MJ8A 3EYUH 2Z31D 4Q9QH 3IXTA 4LIQE 1HHJB 4BZ2H 1OSZB 2RGSA 3UC0H 1NGYA 1ZGLA 3WFEH 3HUJE 3GSVB 1FL6B 3TBVA 2BNRA 3QXWA 3ZYIA 1P84J 1RMFH 4N0YH 4U3CA 4ZMAT 1ZHNB 3TIEA 2EE3A 2A9NL 4ZTPH 5I17A 5E1AA 1RK0B 2CDEB 2ZNWA 2AQ3A 3U83A 2EDXA 1BQLH 2CPCA 4QF1B 4H26A 5IM7B 1OF2B 1O0VA 4NC0B 1U92A 4HS3B 1SY6L 4R4BA 5C0FA 1VESA 4ODHL 2H6PA 5CJBA 5ADPH 3PWLA 4HIHA 1NMAL 4I3SH 2HRPH 5F6IB 4JM4H 4X4YB 1FYHB 3BAEL 5E2VH 5I76B 1Z9SA 1CFVH 3BPOB 2BHYA 5CD3B 1DUZA 4L8SA 2VKXA 4HFUH 3TH3T 1ADQA 3D5OF 4U6TA 4HEME 4XP1L 5F7HA 3H3PH 2A6IA 4PRIB 3GMPA 2EYRB 3BISA 1QKZL 5DEGA 1XGRA 2Z4QB 1VACB 5D7LE 2JTDA 1KGCE 3H3KA 5A2FA 3L5JA 4C83B 2EDWA 3HR5B 5L6YH 1P6AB 4Y1AD 3QAZC 2EH7L 4U3HA 5C09E 4HG4K 2H2PC 3B5GA 5TF1L 5SX5K 4TN9A 5CEYA 5JLZA 1KJVB 2H2SD 4XPGH 1MF2H 3IDJA 2CJUH 3LN4A 3QHZH 3PGDA 3E2HB 1FGNL 1Q9LB 3CFIC 4PJ8B 1RZJL 35C8L 5BZDB 1N7ML 5GGTA 3NABL 2FO1A 4Y0GA 4QNPE 1R5VA 1K3IA 4AENB 3RTQD 3JTTA 1N64L 4U1MB 1NL0L 5HBBA 2NXZD 4JDZA 1RIHL 3QYCA 4RFNC 2B4CL 2YN3A 4XGZB 3OPZH 2JJTA 4UT6H 2BNQA 2XV6B 4X9FA 2W0FB 4XNUH 1JWSA 1OAQH 5GRUH 2PKDA 3S34L 5JXAH 1FJ1B 2VDPH 1MSPA 3DOSA 3CFJB 3MODL 3DURA 2JJTC 3X14B 4ZUWB 2Z35A 5D71L 2ZSVB 2IG2H 1V8HA 1XGQB 2QR0A 4MJID 3RL2A 4AMKH 4Q2ZA 1BF2A 1RFDL 5D9SB 2YXMA 4WUUE 5C86A 2OSLA 2X7LA 1ZAGA 1JGUL 4NJ9H 1MCSA 5HYSA 4YLQT 4Y2DD 1S7SA 3GGWA 3WMSA 3BZ4A 4I4WA 4JHWL 5ANME 1Q0YL 1AFVH 5IQ7H 2APWA 1J87A 4XC3H 1RZGB 5I1KL 3FQWB 5IEKA 2ENYA 2XNAA 2E27H 2WBKA 3QDGA 4HXAH 5TDPA 3SKUD 5EZLB 2A9ML 3GBMH 5GRVL 4KI5C 1M7IA 3DSNA 5E8DH 2B2XH 3SKNA 3P4OA 4PTUB 1CE6A 2VZ3A 4JRXA 4L4TD 4F57H 4AZ8A 3CH1A 2YD5A 1Q9OB 3D18B 5ECJE 5EUOF 4LASH 3SO3C 3U4BL 4ONFH 4F3FA 5DSCA 2K7PA 5EUOE 1QBAA 2NY4C 1DQML 3C60D 2VDRL 3QIBA 1NAML 3DXAD 1CYGA 3DRTB 1J8HB 5HHXL 1NEUA 4N0CD 4Z7QF 5GS3A 2O93L 5I1LA 2OI9C 4KJWD 3NCMA 5B39B 3S35H 5ID0B 5EUKA 5JPMB 2X1OA 3WIIH 3TWCL 1ZMYA 2PTTB 3QIBC 4Z7QE 3NCBB 2QKIB 3BH8B 4ORGA 3KPSB 3CK0H 3ZDYF 3N1FC 1CFTA 1XR9B 3HC4L 4XAWH 3NIGF 1NC2D 4HSQA 3ZDYE 3L3IB 3MLSL 3WL9B 1HQ4B 3DX9A 5DWUL 3W9EA 1KCSL 5CEXA 2FBJL 3W2DL 5KAQF 3BKML 3NGBC 5DS8A 3PWUA 3WIFA 3MTRA 1GXEA 4TTDD 3GJFH 3WNKA 4BUHA 3AMLA 4N1EA 4NZTH 4NQDE 1TETL 3GSOA 4MGXA 3MJ7A 5IV2A 3NPZB 3ULUF 4TVSa 2OP4L 3TJHC 4F33B 5E7BA 3PHQB 4KJQC 2YBRB 5ERWB 3SN6N 3VJ6A 5FOBB 2QSTA 1RJZA 5CJOH 5E6ID 3ULUE 4TPRL 3MPCA 3V0VA 1MH5B 3RWHB 3ARDD 2XN9A 5GZOD 4WI3A 1HILB 1GHFH 3VG0L 3L3GB 3GSNB 2V5RA 2OQJA 1IQWH 5EBMB 5E5MA 5JOPD 3ARGA 1T5WB 4X4MA 1FVEB 4PB0H 4J3UA 3PQYE 4XNZB 2HMID 4MQXC 4PJ9B 5E2UH 4GKNA 2IF7A 1ZHKB 1NBQA 4LCYB 5K9KB 2ENSA 3JWNC 1Y18B 4HT1H 3TH4T 1FSKC 3TN0A 4YAQA 4ZFGL 3PABB 3ARGC 4Q9BA 7FABH 5GISL 4LSRL 1OP3H 1MRFL 4YH6A 3V6OA 4U49A 5EPMB 5JUEL 4NO0D 3DX7A 2QADD 5J12C 2OR9H 3TN0C 1GGTA 3DRQA 2AK1H 1LNUA 1XF4A 4Y5YB 3VXUA 4GSDH 2AK4E 3PNWA 4KKCD 4PG9B 4Z7NE 3V6OC 3FB6B 3IFLH 4KGLA 2WQRA 4MQ7B 4QHNB 1MCFA 4KTDH 5JW5A 3IJHB 3FCTB 5HYIA 3EJZC 3HN3A 1VDGA 1U95A 2DIBA 4X6FB 4JO4L 3MGAA 1VFMA 1ZWIA 2EIDA 4MZ2A 1RUKL 1GIGL 3BPNC 5D5MF 3R8QA 1FYTA 4PGCA 2W9EL 2VNCA 4P4KD 5ESAA 4M48L 5D5ME 4S2SB 4OTXH 5E6YA 4Q6IB 3KNBB 3ZL4L 3B9VA 1WZMA 2EZ0D 5DJ8A 4HGWB 1CR9L 1EEUA 2AW2A 4R8WL 1II4E 3KPRB 3OKYA 3RL1A 1YY8A 4X0KB 3K2UH 1TTGA 3DBXB 5HPMA 1DTUA 4YO0A 5J11B 2E9BA 1DBKL 1S78C 3FB8A 4MDJB 2BY1A 3HG1A 5IVZB 5SWSA 5TQ0H 1FG2A 5H2BA 5IOPB 5B38A 1P69B 3OAUL 4IS6A 2ICWJ 1OGAE 3ZSTA 3QRFM 3NA9H 3M07A 4YPJA 2BVUA 4OCRH 3S4SB 2Z92B 2R2BA 5HI4D 4H1LA 4MDIB 4L4JA 1D6EA 1S7VA 3N50A 1IARB 3QXTA 4Z7WB 5DMYA 4NN5B 2FIRT 3RNQA 3IU4L 3BIBX 3HMWL 1CE1L 3N9GL 3RVWC 4G8GE 4PJCA 5D2LB 4OCXL 4IOIB 3LEYH 3EIFA 5FM5M 2FSEA 4Z0XA 1CS6A 3OXRA 2AP2A 2ICCA 3N1GC 4L4VA 1RVFL 1TMCB 4NN7B 1MCQA 2NW2B 1MLBB 4J23A 4LNRB 4GMTH 4OLWL 3G5YA 4Y5XB 3ECBB 5CKGA 5I1IH 2A0LC 4X80H 2L7JA 2XA3A 5FO7B 4DK6A 5MP6L 1YDPA 2YD2A 2Z93B 3D39B 4BFIA 1YN7B 5JHDB 2E7MA 4NUJB 1NBVL 2ICES 5B8CA 2VLRB 1FFOB 2BSTA 4NBYB 5J1AB 1FL6A 2A73A 4DQOH 4HCRA 2XG4A 4Z8FL 1PG7X 1V3KA 5CKAA 5L2JB 1CT8A 2XOTA 3BPCA 3D48R 2GQHA 3FFDA 3FO1A 5B8CC 4ZAKD 4AL8H 3U1SL 1RK0A 2CDEA 3QUZB 1N6VA 3CDYA 3QWOB 3I6GA 1EERB 4RGND 5LAXB 4HS3A 1A6ZA 2G2RA 2X41A 1S7TA 5GGTL 4D94A 5FYJE 1UADC 4NQED 2GI7A 3OR6B 4MVBD 5EZJA 2OYPA 1MFNA 3J7HA 5ISZB 1IZJA 1X6NA 4NHCL 4OF5A 4IDLA 3WLBA 4Q9QL 1G7HB 4EZMA 1QRNE 1A4JA 4GW4A 2FX8L 3MMEA 3WFEL 3U0TB 4LSVL 3CVHH 5CD3A 1X3DA 5SWZD 2DQTH 3MRJA 1J0HA 5IUSA 4L3EB 3GK8H 4XP9L 4L5FL 5KVFH 4N0YL 4TSBH 3EOYG 3HE7A 4DCQB 2APBA 1FFNA 2MKLC 5HVWA 2D3VA 4PJIF 2XQYK 1BJMA 1A5FH 4ZTPL 5ELIA 5CGYC 3QDJA 4G7YH 2NY1B 2NXYD 2ITCB 2PYEA 1WFTA 1WEJL 4I9WE 4PJIE 3HE7C 3REVB 4KWUA 4JB9H 5E4EC 4RGOL 1I7UA 4HKBB 4JZNB 3BGMA 3TFKD 4PRHB 2H9GB 2J4WH 5BVJB 4I2XE 1J0JA 4I3SL 5I16B 4JRYA 3VFNB 5BZDA 4S10A 3T2QA 4LPUA 5E2VL 4FQJH 12E8H 1CFVL 1WCBB 4X4XA 4HFUL 4P5TA 4U1MA 2XFXB 3H3PL 3LN9A 3E2HC 5EB9A 1N8ZB 2NY6C 4G3YL 3E8UH 3SKMA 4C56B 5CBEA 2EDBA 1EBAA 2IQAB 3HC3H 1MHEB 4P5TC 2FX9H 5L6YL 4X6CB 3LKRB 2BC4B 1HOCA 2MWCA 4K9EC 1CDGA 3OTTA 4KTEH 4R7DB 5DF0A 6CGTA 3C5ZA 4EQ2A 1LO5A 1JVKA 2FEDC 5KJRH 1KIPA 1DN0B 1IL1A 1BEYH 1MF2L 1MCHA 1RZIB 2B7DT 4LARL 2CJUL 4D3CH 5AD0B 5IR1B 3DV4B 5D9SA 3VD9A 4HK3N 4RAVB 4HJJH 3C5ZC 1VFOA 1LGVA 5EU4B 2HJKB 4XP5H 1MCWW 2ZP0T 2R0KH 5DRNB 2C1OB 4HW6A 4JFYB 1KLUA 4G8EA 3OPZL 4FNLL 4KK8C 3HC0A 4RAHA 4UT6L 1FO0B 5I73C 2DQGH 3CVHA 4KJYA 3WE6B 1T0MA 1G9EA 4XNUL 1OAQL 1JPTH 4LLWB 4O51A 5GRUL 4U1HB 1WCQA 4XNMB 3W0WD 1LP9B 4GKOA 3PWPA 1IBGH 4YK4B 4HZLB 4KDWA 3LAFA 1S9VA 4XNYH 4CNIB 2VDLL 4DEPB 1XH3B 4EDWH 3MRDB 3BUTA 2IG2L 4WTZA 5F72S 4AMKL 4HPYH 1GYAA 3O3EB 5JZ7C 4YBLB 1Q9OA 1A4KA 5HPOA 1FNHA 3CFBB 2DI7A 1D5XB 1JRHI 3UPRA 4NJ9L 3U9PH 3IJYA 4UB0H 2PTUA 4LLMB 1N59B 3WDHA 4JM2D 1QSVA 2ZSWA 1AFVL 5IQ7L 4E42A 1G0YR 1RUPH 3C9NB 4OGZA 4PP1C 4M62L 4XC3L 4FXKA 1KTLA 1UB6A 3VH8B 3ULVF 2DKSA 5E8EB 4PP2A 4HXAL 5CLWA 4ODWB 3V95A 2FIKA 1YEDA 5E8DL 5GRVK 3KXFA 3MLXL 4XB8A 3ULVE 4Y19D 2B2XL 3DV6B 3CDGB 2QKIA 5IMOA 1CD0A 3U0PB 1N4XH 4XRCB 2J5LC 1ROWA 3HR6A 4ODUB 3RVTC 1KENH 2IBGA 4QWWD 1BVKA 1Q8MA 4ONFL 2Z8SA 5J6HA 1DVFD 5EH1A 2I26N 4MWFA 4J4PD 2V7NB 5D7KD 5FGBA 4F9PA 4Y16B 2OS7A 5HTSA 5HYJA 1T1ZB 1AGDA 3CXHJ 4JQVA 5F9OH 4FFWD 4V1DD 4OGXL 2HJFB 1I8IB 1T04A 3OKDB 4UDTA 1H3WM 5FGBC 2V2WA 5DK2B 4F9PC 4GRMB 2B8OT 3D25B 3WIIL 3ALPA 1YN6B 4JQVC 2YBRA 3DROB 4WFGE 2DQIH 4WU7B 1A9EA 1RI8A 1G6VK 2CDGB 4DZ8A 2ITDA 2AJYH 5GJTH 3S97C 3NPSC 2D4DA 3KPMA 1MH5A 3CK0L 4HIIB 1CGVA 3C5JA 4J3WA 2IPTH 4PLKC 3OBAA 4M8QB 4XAWL 4IRZH 1LD9B 5F3HA 5C0AA 4KRMB 5H94B 2ATPA 1ODAA 4N9OB 1BVLA 3ALXA 5IK3B 2MQ3A 4U4BA 4Q9RH 2BMKB 2EXYD 2I5YH 2JIXA 5K9OA 4LCYA 5K9KA 2FRGP 1U93B 5ALBH 3PABA 1HZHH 4OFVA 5T3ZD 2EYTA 5F1SA 4HUVB 3QO1B 4P23A 3BP4B 3LN5A 2J8UB 3DUSB 1TITA 1YEHH 2XT1B 4LOUC 4P59H 1F11A 2XPGB 5HGBB 5IBTH 1GHFL 1MI5D 1AO7E 1UM5L 3B3IB 4P23C 4MQ7A 2R4SH 1MWAB 4H8WC 1QSEB 4K7PX 3GZKA 1IQWL 3PWVB 2E8ZA 3WHXA 3SGEH 4N68A 4NFBA 1T1XA 1F45A 4JQXA 5E2UL 4H20H 4JPIB 1CXEA 4QRPD 2P5EE 1NCBH 4L1HA 1CDJA 4O2FB 4TUOA 1LQSR 4PIRF 1P4IH 7FABL 1GAFH 4WO4B 4XMLH 3VXME 3O45A 3RHWF 3PUCA 4S2SA 5JQHC 3OB0H 3SDYH 3VXSE 4Q6IA 3MBXH 3QFDA 3A67H 1CDIA 3PP3H 5DVMA 4Z95H 4FQIL 2AK1L 4MJ4A 2ZOLA 4GSDL 3PV6B 1A1MB 4QRRA 5D1XB 4CMHB 1YEEL 4PRPD 4HV8A 2AS5M 4MDJA 4Q6IC 2VXVH 4B7IA 4OV6F 4KTDL 1KUMA 3BJLA 4HMDA 3L3DB 4M7LT 2LVEA 1ZT4B 1LO3H 4NNXB 5J11C 5D96B 4D0BB 1UACL 1R3LA 4OCNC 1YMHB 1KOAA 3PE9A 2LTQB 2VUOA 3A6BH 2DYPD 5T1DH 1CK0H 4FXLA 1OQXA 5KSBA 3WHE1 4N0UE 3EHBC 1OTSC 2C26A 3ILPB 3L3OA 4OTXL 4JFOA 3OKKB 1EFQA 4QXTB 3AXLA 2CKBH 1FVCA 4X8JB 4YBQD 3OJVC 1IFHH 1JPFA 5GS1A 3K2UL 2IQ9H 3UTTD 3VXNB 5D7SH 1I3RB 4FS0A 4FQXD 3RPIB 2OK0H 4MXQD 4LNRA 4PJXB 1CQKA 4U1KA 4X9GA 1AKJA 1ORSB 5TQ0L 3UTOA 5FUCC 1KXVC 1UWEH 2IJ0C 3LDBB 1U8OB 5GS1C 2A1WH 1CIUA 2GHWB 3NA9L 3MNVA 3L3KB 4OCRL 1DSFL 5HHMD 2VXQH 1LK2B 4JFFE 3D39A 1YN7A 4DFIA 3O2DH 4O5LL 4XNQB 4DKDC 1FV1B 3S9DB 1JPST 2ATKB 2Y25A 2DI9A 4XAKD 3BYYA 5KSVA 3U46A 1QNZH 3T65A 2WIMA 3LEYL 3L5XH 3GBLA 4FOMA 5FA4B 2CLRA 5BJTB 4LCUA 2KZ1B 5DURB 3ZE1F 1JF6A 3QUZA 4POZC 4EUPB 4FN0A 3QWOA 5C0BA 1MCBA 4N8CH 5ICXA 3LQAH 1D5MA 4GMTL 1V3LA 4MAYD 3ZE1E 2XTJD 2XG5A 5I1IL 4K71B 2HT2C 4X80L 4R96B 4NOBA 4P9MH 3QUZC 4ODBD 3RWGB 3OXSB 4LLVA 2MFNA 1LE9B 4P3DA 4QHLA 2QADB 4B50A 3HNSL 4K9EL 3QUYB 5E99H 4DOHE 2VSCA 1G84A 4EI5A 5L0QB 1AR1C 3D2UD 5K9QI 1PZUB 4DQOL 4MMZC 4PJAB 1JTTA 3B5TA 3RKDC 5ADOH 4YX2L 2AXJA 1IGJA 1P4BH 4APQA 3D85B 3GRWA 4X7TB 2J88H 4LL9A 4Z18A 4AL8L 5T3XD 1J0YA 4EI5C 2FJFA 5FB8A 4H0IA 2YD7A 5BS0E 2ERJB 4APQC 4AIZA 5D7JA 2VZVA 3MLUH 2Q76B 4HKBA 2IPKA 3EZJB 3MGOB 1VEOA 5IHBA 5BVJA 5I16A 3EZ8A 5F7FA 5FDWA 4N0FA 4ONHB 3V6ZA 1HHKB 3P4LA 4KROB 3CVHL 1C8PA 3B83A 2V6HA 1FHGA 2DTSA 2DQTL 4GUPB 3ORJA 4FP8H 1D5IH 5KVFL 2KZWA 4TSBL 4ODTH 3KPOA 4OV5B 3H9SA 4K7PY 4XVJL 1A5FL 1PKQB 4G7YL 3MFFB 3FB5A 1MAJA 3EDKA 5E9DD 5JORB 2BC4A 3CLEH 1X5GA 4R7DA 5KS9F 4MNQB 2IAMD 1EJ6A 1F6LL 4JPKH 1DEDA 1MCDA 4Z7VF 4JB9L 2D9CA 3FHAA 4FQHB 3L9RA 1MIEH 3QEQB 3CVIH 1BD2E 4G42B 5KS9E 5FF6B 2J4WL 5TDOB 3FHQA 3MACH 4Z7VE 4FQJL 2C3HA 3WFHA 2XKSA 1JGEA 4OF7A 2W59A 5IW1A 4P2OD 2B0SH 2QHLA 2C1OA 1JN6A 4K55A 1G0DA 3K3QA 3E8UL 3HE6A 2P43B 1UZ8A 2BRQA 1WZKA 1IVLA 3KS0J 2FX9L 1VFAA 4M5ZH 5B39G 2DWDA 5CLTA 4TVPH 4CNIA 4WGWB 2Z31A 2P5WB 4WHTA 3HE6C 1I7TB 3P2TA 5KJRL 1K2DB 3OKOB 5E5UB 1BEYL 3O3EA 4UIKH 4JJHA 2WQ8A 4YK4C 3PWNA 3RWIB 4G9FD 2WIIA 3D3VE 3CFBA 3TC9A 2Z31C 4HJJL 3ELAT 4U6XA 5E8OA 3W11D 5GGUB 3VGBA 2OLDA 4XP5L 4LLMA 4IEFB 2R0KL 1CGSH 4UV4H 3LRHA 2DQGL 4RGNB 5KN5B 4LVNB 5GZND 1N5YL 3DVFA 3BGFB 1MVUB 5C0CE 1UQSB 1IBGL 5BVPH 1XFPA 1P6FA 3SPVA 4GLRH 4XNYL 5LGKA 4ZXBD 4EDWL 5A2KH 3H9ZA 4GRWF 1XCTB 4HPYL 2JCCF 1I85A 3U0PA 2FX7H 2Q8AL 2Q6WB 4XRCA 5D2NB 1WBXB 5CGTA 3VDCA 4GRWE 25C8L 2JCCE 2WLZA 2NQCA 5IVXA 4LVHC 1G7QB 1KYOK 3U9PL 4UB0L 4JFDE 1AH1A 3GJFB 1SHMA 1I85C 5E03A 4TSCH 4DJMA 3WJJA 5FK9B 3BP5B 5CMAA 4RFEB 4NCC2 4A6YB 1Z3GH 1RUPL 2NY3B 1YPZB 4Y1AA 4G8FB 2RIKA 1G1CA 5DQ9B 2WNGA 3OKDA 4YHNA 1B0WA 3LEXB 4WUKH 4CVXA 1OGTA 3WJJC 1HQRA 2DM2A 3DROA 4JGJA 5F7DA 3NCYP 2CKNA 4KUCF 2HN7A 3MYZA 3G6AA 4D9RD 3RPKA 2AQ1A 3RTQA 4OIIH 3FT2B 3B2VH 1N4XL 2H2SC 3KJ6L 4GG8B 5IB4A 3GI9H 2P8MA 1RHHB 1CL7H 1KN2H 2NNAB 5A16A 3WO4B 1SBSL 1KENL 4YXLH 3MLVH 3DX8A 5DJCB 3RA7H 3VI3F 4PJBB 3G6JF 4G5ZH 3V7AG 4DTGH 5FYLD 3MA7B 2BMKA 2NXZC 3VFWB 4N1HB 5F9OL 5EU7E 1EFXB 4OZGB 4DUXA 3G6JE 4PJEB 5KZCD 4ZTOL 4MJIA 1HH9A 4HUVA 5AYUL 1HHGA 2DQIL 3SE4A 3KYOB 4NQTA 2RCSH 1N26A 5GJTL 5E00A 5HJ3A 4J7RA 4L9DA 5E08H 4PGBA 2OJEA 4Y2DA 4G6FB 1DJSA 2IPTL 3K4ZA 5HY9B 4IRZL 5GGVH 1EEYB 3SE4C 4OQTH 3PWVA 1JZ2A 2VLLB 1UH2A 1KJ2A 2WW8A 4K3EH 2X4SB 4XH2B 3IRZA 3VD4A 4JPIA 2I5YL 1NUFA 3E0GA 3M8OH 3S4SG 4NIKB 4V2CB 2BSSA 1HZHL 3GJFK 4JREC 1FGVH 1U8LA 3SJVD 2H32B 2XQYG 4L4TA 3OGOE 2VAAA 3QUXD 4MA1C 4PJFF 1FDLH 3IETA 1YEHL 1GVIA 2ADJB 4JCLA 4P59L 2R23B 4P4RA 3VFRB 3U82B 1A2YA 2W9LA 4PJFE 5IBTL 4WWKB 1BIIA 2ZWLT 1I8KB 3IVKB 2R4SL 2WBWB 3T0EE 3C60A 3DSFH 4JY5H 5JHLH 3LKOA 1B90A 2BK8A 4G9DA 3DXAA 1E4KA 2DS4A 4DKFH 2F74B 3GKWH 2R2HB 4ZUTB 4CMHC 5CWSB 2GJ6D 4GRLB 4H20L 4Y89A 3RGVB 3BEVA 3Q0HA 3C60C 2HLAA 3Q2CA 1NCBL 1E4KC 1P4IL 1GAFL 1OT1A 2A2QT 5EC1A 3MV8D 1R3JB 5D96C 1OP3K 5ICZA 5INCB 1NLBL 1N6QH 3MBXL 1NCTA 1IC7H 3R0NA 4NPYB 2LTQC 4NBXB 4OF8A 3EDEA 4JN2B 4WW1B 2AKRB 2GCYA 1VERA 5DK0B 2I9LB 2VLKB 3TJEH 2VXVL 1H5BA 3D9AH 3MLRH 5FEBA 4LMQE 2IANB 1XR8B 1JZ6A 3TT3H 3NBNA 3BO8B 4XWOD 1F2XK 3DIFB 2ZKHH 3PJSA 2Q7YA 3QA3B 3GSXA 3MRNA 4OQTA 2H8PB 4X7CC 5DEFA 3DWTA 4OI7A 3UROR 2LU4A 3A6BL 1P4LB 5T1DL 1CK0L 3I75B 4TTDC 4XNQA 5FV2A 3LDBC 3LSOA 5E6IA 5JPNB 3ARDA 5F9JA 3QT2A 1CFNA 2DBLH 2DOCA 1OB1B 4NUGH 4OLVH 3C2AH 2MKWA 1IFHL 5E6IC 2IQ9L 1JPGA 3QEHA 5D7SL 3V5DB 5DTFB 3ARDC 5GZOC 3U6RA 1Z5LA 2OK0L 1HI6A 4KAQH 3IT8D 1UWEL 4F2MA 3TZVD 4LLUB 3ZHLA 5L2KB 2MQ0A 3P0YH 4GW5A 4PJGB 5GRWA 4FTVB 1T22A 5DMJB 3CJJA 5CAYB 2PXYD 2VXQL 1FRGH 4NO0A 1FN4B 1QBMH 1KT2B 4G80A 5ETUB 5IB1A 2OX5A 4K71C 43C9A 4UZGA 4HX1A 4U6YB 1FNAA 1QNZL 4P2RD 3NCFB 3MZTA 3L5XL 1K4CB 2QADC 1DBML 4X7TA 3MRCB 1T2JA 2ADIA 5L0QC 4KKCC 4DN3H 4PLNC 2DBJA 1FZMA 4NHUB 4P5MB 3W39B 1FVDB 3H2WA 1PVHA 2VLJE 2ZCLH 3LKPB 1FZKB 1TVDA 3MV7E 5IP4A 1OD9A 2XKNA 4P4KA 4P9ML 1W0YT 5DMKA 3FTGA 2X4TA 8FABB 2V9TA 4ISVB 1LILA 1YYMH 2F5AH 1A21A 5E99L 1WIUA 1NGZA 2YD9A 4BZ1H 2R2EB 4JFEB 1IJ9A 4Z7WF 4X5XA 4HS8H 2IEPA 3GIZL 4X98B 5ADOL 1TNNA 3L3HB 1P4BL 4UILL 1CDUA 2J88L 4Z7WE 1NBYB 2AV1A 2W91A 1NANI 3TVMD 1YY9D 3D69A 4UI2A 1JF5A 5D7IA 2Y4SA 4LGRB 4P57B 4LGPB 3I85A 3UBXI 2BXYA 2YPKA 4QT5A 1TZHB 2XRAH 4U1JA 3B6SA 1EV2E 3QEQA 3ETBF 1JFQL 3D1MC 3RZCB 1C5CH 4G42A 5FKPB 4PJDA 3WEXB 4BFBD 3V79C 1YEGH 5BRZD 1UC6A 5ACZA 4N90D 3G5XA 4OFPA 5HI4C 3DVIA 1LDPH 1WFNA 3QDME 4PD4K 2VXSH 3BZFA 2VITA 4HFWB 4OLEA 4EVNB 2GITB 1D5IL 4FQQA 4E9LA 3GMQA 1S7UA 2X70B 4OZFH 1G7PB 2HFEA 3MYJB 4ODTL 1FFQA 1ITCA 2YPLB 1T7WA 2F54E 3VH8G 2X1XR 3MRQA 4HLJA 4LBEB 3VWJD 3FT3B 2QHRH 2EO1A 1DL7H 4FFYH 4JPKL 2V2TB 5DUBB 1FBIH 1C08A 5C0ND 5GRXG 1NFDA 3H8NA 3PWJB 1BZQK 3RWIA 2BFVL 2ZJSH 3MACL 3OGCA 1T03H 4JY4A 5D1QB 1EHNA 1EZVY 1H3XA 1HHIA 1X9QA 1PYWB 5GGUA 2B0SL 4ZAKA 5ISZE 3IJSA 1WAAA 4M1CD 1KB5B 5C07E 1KNOB 3W9DB 5KN5A 3UAJD 5DJYA 4W4NA 3T4YB 5HVGB 1KIRB 1U41A 4NQEA 2CR3A 4M5ZL 4QOKE 1TQCB 3CNKA 3BP6B 4OKDA 4RGNC 2AEPH 3ESUF 3QNXA 3LH2H 2OL3H 3BN9D 3IF1B 3VXRB 1IQDA 4UIKL 3X11A 4MVBC 5LBSL 4D9LH 1CXHA 4MXVF 5SX4I 1BVZA 5SWZA 4LPXA 5AZ2L 4ZFZA 1VFBA 3BWUC 4MNGB 4X5WA 4RA3A 4YHKH 3QFJE 4RQQA 1HEZB 2C3WA 2FEEI 1FAIL 3EDFA 4AEHL 4MXVE 1U3HD 3MRRB 4MD0A 2VIRB 1BM3H 3BP5A 1CGSL 2YXFA 2B5IB 4NT6A 4RFEA 3JTSA 5D2NC 4F9LA 2X4OB 4RMUA 2Q86B 4G8FA 4GKZA 1XF2A 3ARVA 5DQ9A 4RFOH 1G7IB 1B4RA 3KLDA 4I0PD 1CGWA 5F1IA 4WEBH 4F9LC 3HCVA 2NXYC 1JHKH 2J12B 3NTCH 1NCWL 1P84K 3EYSH 2FX7L 4GG8A 3SQBA 4D2NA 1KJ2L 3B9DA 3TFKC 3QPQD 3C6SA 3MUGA 1U6AH 1JWMA 1IAIL 3MV9E 3VXQB 4POUB 1CGXA 4PJBA 4TSAH 3WN5B 5IIEA 2YD6A 4DN4H 5K9JL 2Y6SD 4TSCL 4OFKA 1QR1B 3LPWA 1DQJB 2GKIA 2VTFA 2ESVB 3VWKB 4E41E 2XY2A 3VFPA 1FNGB 3I50H 4WW2A 4WUKL 3WYRA 4JFHE 4ELMB 3QWRD 4HGKC 2W65B 3SGKA 3QBTB 3S5LA 1ETZA 4NN6C 1TCRA 2EO9A 4I5BA 3WNPA 4WW2C 2VQ1B 3B2VL 2YUVA 3GI9L 4L1DA 1KN2L 3ARBD 5HY9A 3AU1A 3KS0H 2OL3A 3C8HA 4K8RD 4PGZA 3SGKC 4YXLL 5IGXH 3MLVL 1OCWH 3RA7L 5IKCA 1YQ2A 5MHSE 4K7FB 2VXTH 4LP4A 4G5ZL 4GXUM 4DTGL 3S37H 3P73A 3O6FB 1AHWB 3W0WA 5DYOB 1PY9A 3F5WB 1CFQB 2VLMD 2W0LA 2IBBA 4JVUA 2PUQT 1DQLH 3MRBA 1GOFA 2FGZA 3P77B 5MEOB 4Y5VA 2AEWA 2RCSL 1Q72H 3TA3B 3OF6D 2CMRH 5DI8B 5E08L 5IFHH 1DE4B 2EE6A 3RAJH 4JM2A 1N2RB 2NR6C 3IVKA 5JW3H 5GGVL 5T3ZH 2XZAL 1F4HA 3LS5L 4OQTL 3MOBH 4K3EL 5C08B 1MCOH 3GMRB 2WWMD 1IGYB 4XCNB 4NCDA 3MRLA 3TV3H 4R97C 4Y19A 5AG8A 2CKBB 1FGVL 3CUPA 5F1KC 1QSFB 4IRJB 5FHAH 5TE7H 3UTQA 3RGVC 2CIIB 1QEWB 2WBJD 1P1ZB 2JLLA 3G5ZA 3P11H 4R3SB 1DQTA 2B1AH 4MMXC 4RMQA 3L6FB 3BIAX 1OOAA 4J4PA 4PJHF 5DK0A 4O58H 2FATH 4EUPG 3WXVH 4ZNEA 1KSRA 2ADGB 2ICEB 3DSFL 4JY5L 5EC2B 5J6GA 4V1DA 4CADA 2Z9TA 5GGRB 2GY5A 4C59B 4PJHE 1A1NA 4QWWC 1XR8A 3GKWL 4OCWH 2WINB 1EO8H 4J4PC 5E2WH 5ESVB 4BSVB 3E3QC 4U0QB 5J0BA 4FFWC 3GMMA 1KTRL 1K85A 1AXIB 3T77A 2NZIA 3TBWB 3B2UC 5DJZA 5TQ2H 5TPWH 4HKXA 3PV7A 1N6QL 3OB0K 1IC7L 1JF1A 1HXMA 2VE6A 3PP3K 4XT1C 5DRZB 1ZHBA 4JAMA 3HZYB 4LFHG 4I0KA 4W81A 5DTFA 4E5XA 3TJEL 1V7MH 3D9AL 1I7RA 1UZ6F 3MLRL 2ZUSA 5DVLA 5EO9A 5L2KA 2NTFB 3TT3L 5AUMA 5C0JB 1I3GH 1UZ6E 5HSFA 2ZKHL 1PQZB 1QSEE 1WC7A 2EXYC 2BNRE 5DC0A 4XP6H 4ZUVB 2EKSB 3GHBH 2D7PA 3ZHDA 3QJFB 5CD5C 4DZBB 4YGVA 4HJ0C 1I7ZB 1ACYH 1MI5A 1GOHA 4KMLB 5GSRB 5C8JB 2DBLL 3MRHB 1DQQA 3MCLH 3C2AL 3ARPA 3MRCA 3RVUD 4NFDA 1B0GA 1D6VH 1W8OA 2R29H 2HLFD 4PYHA 5EO0A 2Q7NA 3RUGA 1XGYH 4WU5B 2X9YA 4QHUA 3W39A 4KQ3H 4QRPA 4KAQL 1LHZA 5BV7B 1FZKA 1K9TA 3P0YL 3MRMB 3P40A 3HI5H 1AGEA 2DMKA 3E6HB 2GFBA 1FRGL 4UIMA 3Q6FB 5FUZH 3FT4B 1QBML 3QUXB 4JFXB 4QXWA 2X4RA 3O8XD 3WLWD 5E5RB 5T5NG 2NCMA 4R4ND 1XZ0A 3FRPA 5GRJH 4PRPA 4ERSH 3LB6D 4X98A 3QULA 1A22B 4Y4KB 5C7XH 5L7XH 2ZCHL 5HHNB 4DN3L 3U0WH 2BHZA 1PKOA 4U1SA 1IEBB 4P57A 3AS0A 2Z8VC 1JMZA 2FJHA 2DYPA 3EUUA 1L7IH 3ROLA 2HVKB 3SEPA 4MB4A 3QR2A 3R0MA 3IRPX 1ZTXH 1KPVA 5T3XH 3LD8B 3R06B 3GSWA 1YYML 2F5AL 4HFWA 5T1MB 4BZ1L 2NY5C 3UTTA 4EI6B 5MEND 1R0AL 2VR5A 2UZYB 2VN7A 3F7YA 4FQXA 1X6LA 3MYJA 1J1OH 5DK3A 2AXFA 3IU3B 4XMKH 4P46D 3MXVH 5CUSH 2UV3A 4CN4A 5F88B 4O00A 4HBCH 3DI2B 2A6KA 1S9WB 4S1QL 2ZUVA 1YNTA 4HGMA 4MXQC 3T0WA 3QHTC 2V2TA 1RJYB 3I02B 1S7WB 2Y7QB 3IAPA 2XRAL 4P0DA 3TBYB 4KI5F 5D6CB 1PW3A 4R90L 4QRQA 4J3VA 1TJGH 4F7PA 4EDXB 3UYOD 4M1DH 4XBGB 4FXGA 3SKJH 5DZNA 2ZG2A 1LDPL 2EDYA 4OSUH 1EO7A 2VXSL 1UKQA 2X1WL 1U8QB 1INDL 1UENA 2XWBB 2P7TA 4MAYA 2Z8WC 2IH3A 4OZIA 3T4YA 4IJ3B 3TZVB 4OLYH 3K2MC 1KCLA 4MAUH 3RWCB 1ZK9A 5LQBH 5FM8A 1DL7L 4FFYL 2UUDH 5CSZB 5DFWH 4MAYC 2XTJC 1NDGB 1FBIL 2XTLA 4OD1H 3MLTB 3LRSB 4XPHH 4HWBA 4K3HA 3WSQH 3SDCB 5J13B 1JNJA 3D2UA 2X1PA 4MCYB 5GGRY 2ZJSL 1T03L 5IB3B 2VZSA 1QFHA 3L3JA 1MFDH 3D0VB 3RWFA 2NX5B 2V5SA 4WV1A 1HXYA 3JWDH 4KMQA 3AAZA 3DGCR 4YIQB 2X4OA 1UJTA 1IE5A 3ULSB 1RUMH 4PJ7F 3MBED 3UX9B 1TVBB 5CSBA 4NKOA 1VGEH 1IEHA 3HUJB 4PJ7E 3EW3B 5C9JB 1J1XH 2CXGA 4YC2C 2AJ3A 3LH2L 2OL3L 3V52L 2RR3A 1YECH 3G04A 4PRBB 5KSAD 3UJJH 4UNUA 4D9LL 5CEZH 1JZ8A 3O3DB 1HH6B 2F19H 2PF6A 3PP4H 4AM0B 2R2CA 4YHKL 4HC1H 4FABH 5B3NA 3VXQA 5EN2A 2X40A 4CAGA 4WTWA 3WN5A 3X3FH 4IDJH 3TVMB 2YA0A 2ZOKB 3IDIA 2GSGB 1DQJA 2VDOL 4XHQA 4HK0A 1ZA3A 3P4MA 1TJHL 5CJ8A 1CDHA 3P30H 4LCWD 5E9DA 4NO3B 3Q5OA 4Z77A 1YYLH 3LKQA 5CHNB 4F7TB 2IAMA 3BI9X 3MO1B 1BP3B 4IMLB 3WN5C 2C9AA 1H9VA 3QUMA 3RI5F 2EIEA 3N85H 4ENEC 1LEKB 4LLDB 2XN9E 5T1LD 2W65A 1A7RH 2JB6A 3GB7B 5A43C 1D5ZA 4Y8DC 2GEEA 3VWKC 2H3NA 3NTCL 1LO2L 2IAMC 4B7LA 1S9KC 5IFJB 3VGDA 2FGWH 1MHHA 4XPTH 4P2OA 1HINH 4YHYB 4X4ME 2V7HB 1G7LB 5D7LB 4JFZH 4WCYH 1U6AL 5TH2B 1P7QB 1S9YB 4RNRA 4XBPA 4TSAL 1B0RA 1MRDL 5C09B 4L9LB 1CFBA 4P2OC 4BFGA 4KVCH 4OD3H 2ILLA 5L88L 5JTWA 2BSRB 1BX2A 2CXKA 3V6OE 4XTRC 3MZGB 2ZUXA 2BNQD 4WFGD 2KBGA 3OB8A 5D72H 3I50L 1OAUL 4M7ZC 4ZYKA 2XZQH 2VC2L 3JV4A 3OJMB 4XI5D 3VXUE 3AB0B 2O5XH 4G9FA 5FYLH 3KLAB 4M43L 1SEBB 2D03H 1GGIH 3CFKB 1GOGA 4U1LB 2XWTA 4X6BA 2DJ4A 3F6LA 4JHZA 2EDRA 5DD5H 2CIKA 3UTSD 3QIUD 5IGXL 1OCWL 3TBTA 4NQSB 3B5HA 3S37L 4ELKA 1AGBB 5C92A 3W11C 2XACC 2AERT 3FN0H 1FYTE 1IGYA 2C3VA 1NGXA 5E1HB 1UM6H 1KJ3H 4WDIA 3NFPA 4ZXBA 3DECA 1NBZA 5CJQH 1JYVA 4WUUB 2P1YA 4XXDB 5GZNC 5AAWA 4MLSA 3HHRB 4LKCB 3REWB 5F44A 1GH7A 1QEWA 1KJMB 1XGUA 4KGJA 5ANMB 1CICB 4ZXBC 3HG1E 2CMRL 1GGBH 2ZUQB 5SWSE 4OUOA 1RZ7L 5IFHL 3SDAD 1U3HB 1MHPH 1O7VA 4QGYA 3RAJL 1NAKH 3KPNA 4HD9A 5EU5B 5DD6B 4IRJC 4NYLA 5IB2A 1S7RB 5JW3L 1IT9H 5T3ZL 4WFEE 5HDLA 2V2XA 2P5ED 1AI1H 1I9IH 3MOBL 4DVBA 4XCYB 3PL6B 2EIZB 4MQSB 3UZQA 3O11B 3T0XA 3OJDA 4PJCF 1XT5A 1MCOL 4N5EC 3S36H 2EYSB 3MRIB 1F6AA 4HIJB 1EXUA 3U30C 1HWGB 4G8IB 5IMKA 3DVNB 4L29B 1SBBA 5MI0C 4OZGF 4PJCE 5HDOA 5I1HH 4BH8A 1C16A 5FHAL 4OZGE 1TDQA 4IOSD 4L4VE 5EUOB 3IDNB 2AEQH 3KJ4B 5DRZA 3EOBB 3CFCH 5T1KB 2V9RA 4LHUB 4CN6A 3RIFF 3LOWA 3RNKB 3WXVL 3WNNA 2X09A 3OHXA 1EO8L 5E2WL 2ED8A 5C0JA 5CINH 1Y6KR 5HDBF 2QBWA 1ED3B 5EBWB 3JZ7A 1VENA 3SCMD 5F9WB 1JP5A 1FL3B 4YPGA 4UU9A 3UPAA 5TQ2L 5TPWL 2CLVB 3FFCD 2UVEA 4GRWH 3O6MH 1AQKL 1Y6MR 4IM8A 3DUUB 5B3JF 4KKBC 5HVHC 3CFEA 1A3LH 3NACH 4WU5A 4YNYB 1DEEA 1CTNA 4NQDB 2NY5L 4QYOA 3CDFA 5B3JE 1CXKA 1F3JB 3MRFA 1BBDL 1JV5B 4OT1L 4PBWD 3TLRA 1SJVA 4O2CA 1IGIH 2JK5A 4BKLB 3QI9B 1I3GL 1BAFH 2IH1B 2HT3C 3QCTL 2AEIT 4MA3B 1K8IB 3SJVA 5IG7B 1ACZA 3QUXA 4XP6L 5C70A 1KPRA 4HPOL 4WY7H 4Q97A 3GHBL 5BV7C 3OKEB 5B4MD 3B4NA 5HYQB 5TE4H 3QDJE 1SYVA 5J06A 2D31B 3NIFF 3PQYB 4J1UA 5LJYH 3QUXC 1JZ7A 1HE7A 5F9AC 2EDLA 2PYEE 4U1IA 1XIWD 3FJTA 1D6VL 1SYSB 2CK0H 4PLJD 3SDDB 2NY7L 3NIFE 4WNQB 4Z7UF 3AMKA 3QXDB 2GJ6A 4HWZA 4NRYB 3O41B 3Q1SH 3Q6GH 3RQ3A 1GZQA 4CVZB 3GKZA 5L9DH 3UBXB 5JR1H 4JRYE 2PNDA 4Z7UE 3OSKA 2HVKA 2YRZA 4JGMA 1ZS8A 5C0RH 1X7QB 3HI5L 5J9PB 2AK4B 3MV8A 5FUZL 4OZFB 1C1EL 4HKJA 2X10A 4K23H 3GSUA 4ERSL 3JSSA 3LHPL 3AC0A 5C7XL 3BGAA 3VFSA 5BS0D 4BQ9A 3VCLA 3U0WL 2W60A 4P9HH 1QLFA 1KF9B 4HWBL 3VXPA 4NQVB 3WUZA 1OL0A 5D5MB 1QOKA 2G75B 2Y7QA 5I1CH 3RY6A 2BSED 1XF1A 4CJ0A 1INQB 1AD9B 4DGYL 4ZUSA 1CDCA 3V5HB 3VE0B 1T66C 2H26B 5DDHB 5CGMA 4XWOC 4EDXA 3P4NA 1ZTXL 5T3XL 3DO7A 4XBGA 2R8SL 1U58A 2D0GA 1QSZA 3TCLB 1KPUB 3RY6C 3HAEH 4ZO9A 5IQ9B 3U2SB 3GMOB 1U91A 2QTEA 4LEXH 2A83A 4MCZA 1X5YA 3I6LD 5F7EH 3T0BA 4JO3H 1OGAB 1P5VA 5F9DC 3PWPE 1J1OL 4OB5H 5GHWH 4L8CA 3BEWB 4M3KB 4QRTB 4XMKL 3SDXF 3TZVA 2QV2A 1CG9B 2IGFH 5J89A 2A0LD 5HHVH 3MR9A 1FNEB 1RIVH 4RGMB 2YPVH 3RWCA 4HBCL 4HS6B 4Z76A 1N0LA 1BD2D 3G5VB 3SDXE 1BBJA 2PXYA 4KPHH 4ZSOA 4G8GB 2OTWB 4IJ3C 3TZVC 1H0DB 3HS0B 2EH8H 3K74B 1H8NA 4K94H 1TJGL 4MCYA 4U2ZA 5DJ0B 4K2UH 1N5AA 3WHE0 4LQ1A 5MEPB 3BQUB 3SKJL 4JY6A 4P2RA 5E0QA 3MNWB 4OSUL 4S0SD 4KHXH 4IHOB 4LMQI 4J8RB 1CQYA 4H5SA 4QTIL 1BPVA 3QUML 1HSAB 4BSJA 5H35B 4D9QD 3KPQA 3KXFE 1ZA6B 4OLYL 5I8OL 4NNYB 1MPAH 5KOMC 4HH9B 4MAUL 3V4PH 3MRGA 1EA9C 4AG4H 5LQBL 3QNZB 3TO2B 2B1HH 1S8DA 2N1KA 4NZUL 4JR9H 4ETQB 1IEAB 1S7XB 4XPHL 3ZT7A 2IADA 3FB7B 4NKMA 3CMOH 2ARJQ 3H7BB 3K7UA 1EX0A 5HYJE 4Z5RA 2HJLA 4BQ8A 3LKSB 1QG3A 1H3VA 1MUJB 5LGJA 4P9HC 3TVMA 1G9MH 5CGYD 3JWDL 4RAUB 5CFHA 2NW3A 3E6FA 1ZLVH 1ZHLA 2HFTA 2PCPB 1NGPH 2DL9A 4PRID 3LEVH 2IALB 2GTWB 5C3TA 3TVMC 3P9LB 1YY9C 2P47B 1VGEL 1QRNB 4OLUH 3C09B 4LDLB 1U8JA 4GJTB 1IZKA 1CGUA 1J1XL 3GB7A 8CGTA 3AREB 1NGWA 5CP3A 1BZ7A 1AXTL 3BHBB 1TTFA 3C6LB 4OD2B 3UJJL 1NEZB 3AS1A 4JZJB 5C0AE 5CEZL 1G9NC 5TGBA 4GG6A 2F19L 5TH2A 1L9NA 4PJ8D 2AAVA 4FABL 5FECB 2FZ3B 3CX5K 3V2AR 1OAKH 4PJIB 3X3FL 4IDJL 1V7NH 1F42A 1A6TA 2YZ8A 3C5SB 3P30L 2BSRA 2VDNH 3V4VL 1YYLL 4I2XB 3V4UH 3NZ8B 1LEIB 2D4FA 1F4AA 3N85L 3O9WB 2F53B 4UT7H 3GMNB 1OLLA 4QTHB 3CH8A 2HFGL 1A7RL 3LVEA 2AGJH 5FGSA 5JDJA 2KL6A 4U1LA 1I8MB 1KXQE 2FGWL 2FLBT 4OIBA 5DQJA 3HI1A 2FO4B 4XPTL 1KCVH 1VEMA 5JNYA 1WBZB 5HGHA 4JFZL 4M4PA 4WCYL 4XC1H 4URTB 4ZFFA 4HIXH 1UJ3B 5BQ7B 2CLZB 4YDJA 2V5YA 5FYKH 4JJ5B 2R39A 5EU3A 1AGBA 2X89D 2VABB 2HG5B 4KVCL 4OD3L 2GJZA 4M1CC 1WZ1H 3TO4B 3A6CL 4HUWB 5J3HD 1FC2D 5D72L 3UAJC 4K8RH 1NUNB 5TF0A 2XZQL 5DT1H 4NWUH 2HTLD 4QRRE 3O3AA 4NQUA 2O5XL 4ODHH 5FYLL 4P2YA 5FYJU 2D03L 5E94B 5I1DA 3BN9C 3QEUB 3EO0B 3WUWA 1RZKH 1U3HA 1XCQA 5DD5L 5FGRA 5CIPH 4BSWB 3K81A 2XYCA 4KXZH 1A8JH 5I1AB 4S1RL 5KSBF 5I2IB 4PUBH 1CICC 2GUOB 2APFA 3KGRA 4CDGC 3MBEB 2ZUQC 3O11A 4NKDB 1AY1L 4I0PA 1U3HC 3FN0L 1TCMA 1UM6L 4G8IA 1KJ3L 4B5EA 5GGSY 5CJQL 4MD4A 4RIRB 1J8HD 5BW7A 1MQKL 5FUCE 2DD8L 2GTZB 4U1GB 3F12B 4F7EB 3KPPB 1T3FB 5DZOA 4R4FH 5C0EB 1ZVHA 3ME0A 5K93A 3SKOB 4NOFA 2X5PA 3RVTD 1FGNH 1RZJH 5I18H 1XGTA 3KPSD 1K4DA 3UZVB 2PW1B 2NY2B 1NAKL 1VPOH 4F7MA 5GS2D 4F58H 5H37H 4X9BA 3QPQC 3GEWB 1AI1L 1I9IL 3KJ4C 4CGTA 4YHPB 4DKEL 2Y6SC 4MS8D 2YEZB 3ARQA 4OBRA 3QWRA 1HWHB 3GSQB 3KG5A 1FL3A 2I60H 5I1HL 4IRSB 2AV7A 4Q6YA 5D71H 4GAJH 5F7KC 5F89B 5C0DB 2FR4B 3ARBA 4HUUA 5F9WC 5C0BE 3EYFA 5GS0D 2AEQL 1A6PA 4XVSH 4O4YH 3DUUA 1EK3A 1JGUH 3DYMA 4XWGH 1H3GA 5HHOE 1WIOA 3EO9H 4PY8J 2J2ZA 3ARBC 3GUTA 3IDYB 3HFMH 2E8YA 3SGDH 2HH0H 4Y4FB 3VRJB 1KLGA 1IRAY 5CINL 1K8IA 2Q20A 1ONQA 4PJ9D 2A9MH 4QRSB 6FABH 4XCEA 4O2EA 1RZKC 4IMKA 1OHQA 1IGTB 3BN3B 3OF6A 2R1YB 5JQ6L 4LOUD 4TNVF 3ARSA 2BNUB 5DJ2B 4PRDB 4GXVH 5IB5A 4LQFL 3IFPB 3O6ML 3QUKB 4JPWH 1OM3H 4LSUH 4HG4J 4J3OC 3U4BH 4IMKC 4WGVB 2AI0H 5JDSA 3VGAB 1A3LL 3NACL 2DMBA 3L5WB 1F02I 3DNKA 3NFNA 4F7CB 2RJMA 2X4UA 1AJ7H 1C5DA 2VDRH 3T0AA 3VGGA 3ES6A 7CGTA 1IGIL 3KWWA 1BAFL 5HHXH 3QH3A 1JUFB 5J9PA 5INDA 4NM4H 1LE5B 3UTZA 1UVQB 2ED9A 1K8DB 2EDHA 2P49B 4WI9A 3HZKB 5C2UB 2WBJA 1AO7B 4PRAA 4WY7L 4I18B 1W72B 4Z0BL 3H9SE 3GSRB 4XZUA 4ZDHA 3WDJA 1T5XB 3JV6A 5TE4L 3TPUB 4NC2B 1QO3B 2E7LA 5IROA 1PZ5A 1XF3A 2WBJC 3Q3GB 4RZCA 2GW5A 1H15A 4M5YL 4HKZA 3KPRD 2CK0L 2PR4L 3OX8B 4L8BA 2VDKL 3BP7B 3CSPA 5KG9B 5EFIA 5DWUH 3DMMB 2AJZA 2BX5A 3VXMB 1WIPA 3Q6GL 1NMBL 3W2DH 5L9DL 2G5BB 3VXSB 3NN8A 5JR1L 2CDFB 3OKNB 5ITFB 1ZT1B 3IS1X 4LHQB 3QRGH 5C0RL 3VE0A 5DDHA 5HGDA 3FO9A 3BH9B 2OP4H 1I4FB 3MNZA 2PW2B 3CC5B 4GAYA 2KQMA 1G0XA 5DHVH 1RK1A 1G7MA 5GGSA 4TPRH 1DQDH 4K23L 3B9KB 1FL5A 4RMVA 5TE6H 5ALCL 1VKXB 4F80A 4N9GA 3VG0H 1BFTA 4GAGH 4UT9H 4RA0C 1BFSA 1SEQL 1HYRC 4P2QE 2V9QA 4P9HL 3QXUA 4N0UB 1BFVH 5C0GA 1VGKB 3R4DA 1WTLA 5I1CL 5IMMB 2VR9A 4JG1L 2YS4A 5DJAB 1I1AB 4AT6B 2AXGA 1MRFH 2EDDA 5A2LH 3FAWA 3VFGH 4D8PA 2WLYA 1AD0A 5DFVC 3DLQR 1CVRA 1WF5A 3BWAA 3JV5A 5JHDD 1OW0A 1G7JA 3X12B 2VLRD 5KANI 2PO6B 4G7VH 3RWEB 3BVNA 1ZLUH 3QO0B 1PGRB 4JO3L 1BLNA 3RWJB 4A2MA 1F4XH 4OB5L 5GHWL 3BQUC 5H35A 3MX0A 2YSSA 4OF6A 1ZA6A 4JFFB 1OW0C 2IGFL 4NNYA 2R9HD 2HT2D 3RVUC 2HLFC 1RIVL 2QSCH 4KVNL 1M71B 3QUZD 1TQBB 4KPHL 4WI4A 3R8BB 3BRGC 1I9RH 4I3GA 3TNMB 3G08B 3O8XA 4UQ3B 1FZOB 4Z78B 2FWOA 4HIEB 2UZXB 2ZUTA 1CXFA 2HA1A 5ISZD 1NFKA 1CDYA 5FO9A 2DQDL 5C07D 4KHXL 1UXWB 2CRMA 4Y1AE 3O8XC 3WLWC 3QQNA 4PTTA 1CR9H 1Y0LB 3RHWK 4PPTA 3WNOA 1OP9A 3LB6C 1DUYB 1T4KB 1DBKH 2VZTA 4L3ED 3LQZA 1W0WB 1QRKA 2GTWA 3IFNH 4AYFA 1NJ9A 3B9EA 1MPAL 3P9LA 4TQEH 5IJVB 5DJXA 3V4PL 3CZFA 4DOHB 3OAUH 2NY1D 2B1HL 1GPOH 3FQUA 5FO8B 1JGLH 1M7DA 2UUDK 4JR9L 4PGDB 4WJ5B 1A6UH 1NEZA 1GCFA 2XWJB 4RCAA 3CMOL 3C09C 1N3NB 3MV11 5MENA 4PRHD 4KMTH 2D9QB 2C7UB 3IDXL 5IHZA 3AREC 4P46A 3O3BA 1G9ML 2Y06L 3IDGB 4JZJC 4ZOCA 3BZEA 2BHUA 4D0CB 4MJIE 4RMRA 2BVEA 3KYMA 1C7TA 1MHCB 1NGPL 3LEVL 4OKVB 4C56D 2UZIH 4R26L 4P46C 1G6RH 3C8KB 4MX7A 3GMNA 4LF3B 5GRYA 3QB7C 4QTHA 5ESQB 1IMHC 1YUHA 4MD5A 1ADQH 3EFDL 32C2A 1VB9A 1I8MA 4M00A 4TUJA 4FFVD 3BW9B 4QRUA 3O9WC 5JMRA 1U8PB 4U6VH 1QHPA 3M1BB 5EIIA 4JFQA 4PRNB 1D5BA 5CJXA 5DR5H 3V0AC 3VI4F 2WV3A 1P5UA 2IC2A 2DICA 3U1SH 4L4TE 5KS9B 3H0TB 3GMLA 3VI4E 2JELL 3V4UL 2HP4A 5CJXC 4Z7VB 3BPLC 4PY7B 1C5BL 1T21A 1UXSB 1YZZA 2EC9U 3FL7A 4UT7L 3VFUB 3B8YA 1S5HB 3GFUA 3KHQA 4AQOA 2SEBB 2P8PA 3TO4C 1F3DJ 3FONB 2AGJL 4NHCH 4MNHA 3T04D 1EO5A 3GIVB 4UMGA 3O81A 2FX8H 1KCVL 3DXAE 4LSVH 4N8VB 4LHUG 5ILTL 4X5LA 4XC1L 3EOAA 4HIXL 3Q48A 2CO6B 5I2IA 3HPLB 5FYKL 4XP9H 3TEUA 4L5FH 3UEZA 1FH5H 3MBEA 3I3BA 1QLRB 4M8VA 4X6DA 4EKXA 1WZ1L 2WK2A 3STZA 3KYAA 3D3VB 1WEJH 2R1XB 3QJHA 4WWID 3VG9B 4K8RL 3MBEC 5DT1L 5KSAA 4NWUL 1J05A 1ZSDB 3PGCB 2LU3A 4RGOH 3F12A 1JK8A 3CU7A 3JBG7 2MQCA 1ZT7B 4BQCA 3TT1H 2FH8A 4OAWA 1G6RA 4RWYH 2BVPB 9CGTA 1RZKL 5CBAB 1NDMB 5KSAC 5IT2H 4KRNA 3AVEA 3OR7A 2R69L 3BDXA 5C0CB 5KAQG 4LCWA 4PUBL 3DGGA 3PF2A 3UYPA 4G3YH 2UYLA 2NY2C 4Y16D 5F21B 4ZQKB 4N8PA 4UTAH 5SWQB 1QQDB 5T1LA 4JN1H 1AGCB 1CD1A 1U8KB 4GRWB 2HFFB 3ULVC 3BDBA 2JCCB 2ARJB 4U0RC 4JFDB 3D0LA 4LARH 1KCRL 2KKQA 4D0DA 4R4FL 1IM9B 3IXAA 3EJJX 4AEIH 3T8XA 5F1NB 5DRXB 5IHLB 4U7SA 3IGAB 3RJDA 3RWDB 5I18L 4K3DH 1Q9WB 3F7VB 1VPOL 2EC9T 2O5ZH 3PDOB 4BM7A 5I8EB 4F58L 2O61A 5FAAA 3HPJB 4DGIH 4FNLH 4UBDD 2WUCH 3UBXG 4X99B 2FECL 5HVFB 3ZZ1A 4UQ2B 5IJKA 4RDQF 4M93C 2YD4A 3QXAB 1N0XH 3IDYC 4G43A 5BZWA 1M6OB 1FCGA 3EYQD 3STLB 1SM3H 2I60L 2VDLH 4OZFG 4EOWH 5LCVL 2BVQA 4JZOB 5ICYA 4GAJL 1JNNH 4R0LB 2BNUA 5IW6B 4XI5C 1NCNA 5IJKC 3VXTB 4L3CB 4U1NB 5AAMA 3UTSA 2BXZA 5FKAA 1QVOA 3QIUA 4XVSL 4QHKI 4O4YL 3C87A 5I9QB 4OCSH 2GK0B 3DETD 3G6JB 1KCUH 2NY0B 4YEFA 1DN2A 4YHIB 4XWGL 1Z0NA 3EO9L 3FOMA 5IMLB 2EEBA 1QSED 3DHMA 4R2GB 3HFML 2HH0L 3QIUC 4M62H 4OLXH 2IBZX 1OSPH 2UVFA 1INEH 4UDUA 3V9FA 2W0KA 3ESVF 1J18A 3CLFH 2X1QA 3NA4A 1LE5A 2E7BA 5HHPA 6FABL 1FAKT 1XGPB 3MLXH 5C0IA 3STBA 3VGHA 4JDVA 1URLA 3QCVH 5D7IF 4WO4D 4BELD 3SDAA 5BCAA 3GSRA 4ONGH 3U79A 3HZVB 4JFPB 2D7QA 4HUXB 4GXVL 2NYYD 5D7IE 4UUJB 4JPWL 1RJLB 1OM3L 4LSUL 2P5EA 4PJDF 2X4PA 2AI0L 1MJ7H 4P5KB 5D1XD 3BP7A 3SDAC 2XXCB 4NBZB 3EO1B 3SY0B 2P24A 2VL4A 3FOLB 3V8CA 3U36A 4HDIB 4PJDE 3V6FA 1AJ7L 4JO2L 1WBYB 5ABDE 4LDOB 4OGXH 3UO1H 1EHLH 5JO5B 4ZFOL 1OWRM 3HAEB 1DBBL 2FEEL 4NM4L 3H9HA 3X13A 4CU6A 4MJ6A 3BUYB 4PJFB 2J8HA 1Q94A 1WVZA 3T0EB 3QQ4A 4NM8H 3WJLA 3EYVB 3E1F1 2GAZA 4R7NA 1CLCA 1E4XH 3CPLB 4TTGA 1S7QB 1GZPA 3IKCB 3TBSB 4OZHB 1NFDF 3WJLC 3WD5H 1J0IA 1KG0B 2OMBA 3FRUA 3NIGE 1ZVSA 1NFDE 3SCMA 1WAAF 5K33A 4AEEA 4MQTB 3QRGL 1R5WA 2JJSA 2P44B 3KPLB 4XBEH 5DJAA 3L95A 2J3SA 1T80A 3QG7H 3DVGB 4BH7A 5ACLA 3MRPB 1WAAE 3HB3C 5D6DA 3VFOA 2BOCB 1FLRH 3FFCA 3SCMC 1PEWA 5I66A 5EA0H 2VOTA 4WIQA 1JE6A 1WUNT 2WZPD 2BCKB 1AIFA 5MEQA 1DQDL 2JJSC 5I8KH 3QCUH 4OJFH 3RWEA 4NZRL 5TE6L 4NQEE 5D6DC 3W5MA 1QYGH 1UM5H 2VL5B 4GAGL 3NAAH 4UT9L 2X9XA 5MERB 5DURD 3VXOB 4H1LH 3OKMB 4NSKA 1W2KT 1RD6A 3BT2H 4DFHA 4WVRA 1BFVL 4QHMB 3QQ3B 5SWZE 3WXWH 3O4LE 4UQ3A 1IM3A 1FZOA 1EAPB 4MJ2A 4M02A 5EWIH 1HSBA 5FA3B 1ERNA 1NEZG 3LMJL 1NC4B 1I9JH 3VFGL 3ARFB 2DIJA 4X6EA 5TDNB 1U8IB 5B22A 3T0VA 3BKYH 4YE4L 3QUYD 4HAFA 1XIWA 4FQIH 3EGSB 4QY8A 1S9XA 3CFDA 4G7VL 3I84A 4H25B 4PR5B 5B4MC 43CAB 1YEEH 5CP7B 3ZKXB 2MHAB 1F4XL 3FO2A 5KVEH 4ALAL 3EFFA 4LPYA 3D85D 4ZPVB 3MCKB 1HDMB 3S3PA 1XIWC 4LFHD 3FN9A 2X44D 2QSCL 4PLJC 4JLRA 1RURH 3MROB 3HZMA 5DUMH 1RHFA 3WS3B 1UACH 4JANA 4XX1G 1I9RL 3IFOB 4HCRH 1C7SA 3KDMA 4WJ5A 3V5KA 5JMOC 3RVXD 2N4IA 5JXED 1QA9B 1FNLA 4WW2F 1L9MA 3M17A 2A6DA 2DQHH 4Y4HB 4KROD 3QQ9D 2VLJB 5BS0A 5IHUH 3IDGA 3QNYB 4OZ4B 2G9HB 4D0CA 3MV7B 3BXNB 1KIQB 2Q3AA 1F8TH 2YKLL 1HHHB 4OCLC 3IFNL 4TQEL 4CDHA 4XPBH 1JGDA 2QQQA 3IDMB 2IBZY 3VRIA 2GT9A 3MREA 1CFSB 1GPOL 1S3KH 1DSFH 1JGLL 3NCCB 4MNQD 2Z91A 1MJJB 3BIKB 2A74B 2N56A 1TVHA 1U8HB 1A6UL 3LIZH 4O5LH 4M6NH 4P3CL 1JWUB 3KR3H 3QEQD 4KMTL 3ZDXF 3W0WE 4LCCA 5DJDB 4ZG1A 4PRNA 3GHEH 2Y5TA 3TPKA 2Z8RA 4LSSH 2JJUA 4I3RH 4LLQA 3ZDXE 1A1OA 4MLIA 2WMPA 5M94B 2YK1H 2Y07H 2NLJA 4YWGH 1BD2A 4LCCC 4ZPTA 3CSYA 3HRZA 2FNBA 2CSPA 1B9ZA 2UZIL 2OBGA 4U33A 4JM2F 2VUYA 4X9HA 1G6RL 3QDMB 2G5RA 5ENWA 3FONA 1E4WH 5EO1B 1ADQL 1RQ5A 3OWEA 1T89A 2P5WD 1HHJA 4EN3B 1BJ1J 1OSZA 1KBGL 4NDMB 3ZKQD 1BQHB 3HNSH 4K9EH 1DZBA 1R3KB 3GSVA 5EG6C 3SHSA 2F54B 3P0VL 3VMPA 4U6VL 1T89C 3N1MC 1DCLA 4YX2H 2AJUL 2X42A 5DR5L 1ZHNA 3HLAB 3U9UB 4PB9L 4JGUA 3MLYH 1JNHB 2IFFH 4QF1A 3RDTB 5IM7A 3BFOA 1OF2A 3RX5A 1QFPA 5BXFB 3CU1A 1C12B 5EU6E 5D7KE 3CCHB 1GSMA 5F6HI 3ILQC 1U2CA 1DDHB 4PREB 4ZNEE 1MEXH 3E3QE 5C07B 4X4YA 5I76A 4V1DE 5E8PB 3BMVA 5CBAA 4LSQL 2YC1B 3Q5YA 4PJ5B 3OAZH 3TIDB 3LV3B 2CK2A 2Y5EA 2O5YH 4NJAH 4QOKB 5F6IC 5GIRB 5BO1L 1FH5L 4PRIA 2XQBH 2EYRA 3VMOA 3BPOC 5FYKU 4XVJH 2Z4QA 1VACA 5I75B 2C1PB 4EXKA 4C83A 5IEHB 2NY3D 3HR5A 2YR3A 4PV8B 4YHMH 2BY0A 1DR9A 3QFJB 1KACB 3BE1L 3PGFL 1KJVA 1BOGB 3N1QC 4AH2B 3I3DA 4UAOB 3OAYK 4PJ8A 1Q9LA 3EDDA 3TT1L 4RWYL 4WFED 1MVFA 2F53E 1Q9WA 5IT2L 2J8OA 4AENA 3F7VA 1D9KB 2C4FU 4XX1E 3HPJA 5HGAB 4XGZA 5T3ZE 4PJ8C 3IYLW 5CILH 2W0FA 4OFYD 4F15B 4KU1A 2NPLX 1FJ1A 4UTAL 1E27B 4JN1L 1EFXD 3CFJA 1MI5E 1T83C 3GJEB 3X14A 3DHJA 3P0GB 4ZUWA 3MV9B 2ZSVA 2E7HA 4JRWA 1XGQA 3WCYA 3I6KB 4OGYH 5HD8C 5C1MB 2V5TA 4UOJA 4L3CA 2F15A 4AEIL 1EEZB 1TIUA 5D8JH 2GIYA 3L1OH 5DHYB 4YEEA 4QRPE 3S96B 2VN4A 2GK0A 2VISB 1NAMB 4K3DL 4E41B 1FORL 2HWZH 5GSVB 2O5ZL 4G6FD 2X89A 5EOCJ 3CXDH 2YWYA 2IFGA 4X9IA 3PIQB 4DGIL 2FHBA 2WUCL 1RZGA 5EU7C 5A2IH 5C6PB 3FQWA 1F3DH 1JTPA 4XCCH 5GS0H 1N5YH 5EZLA 2XA8H 2GSIB 3VFMB 1N0XL 3T4AB 4PRPE 1E28B 4YGAB 1KIUA 1IAOB 1SM3L 5J3HC 4EOWL 3GSNH 1MQ8A 1JNNL 4PTUA 2HTLC 4QKXB 3INUL 2Q8AH 5I8CB 1A9BB 2NR6D 3RBGA 3DTXB 2R0ZH 2DF3A