3QY6A

Crystal structures of ywqe from bacillus subtilis and cpsb from streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
247
structure length
247
Chain Sequence
MIDIHCHILPAMDDGAGDSADSIEMARAAVRQGIRTIIATPHHNNGVYKNEPAAVREAADQLNKRLIKEDIPLHVLPGQEIRIYGEVEQDLAKRQLLSLNDTKYILIEFPFDHVPRYAEQLFYDLQLKGYIPVIAHPERNREIRENPSLLYHLVEKGAASQITSGSLAGIFGKQLKAFSLRLVEANLIHFVASDAHNVKTRNFHTQEALYVLEKEFGSELPYMLTENAELLLRNQTIFRQPPQPVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase YwqE
publication title Crystal structures of YwqE from Bacillus subtilis and CpsB from Streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 87
structure length 247
sequence length 247
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2011-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3qy6A00
5G4HC 2BB0A 3GIQA 1A5OC 2KAUC 4DI9A 1O5RA 4RDYA 1ITUA 1RJQA 2D2HA 3K4WA 1RJRA 4XAFA 2RAGA 3PNZA 4F0SA 1WXZA 3TN3A 4C6EA 4CNUA 1M7JA 4CNTA 1EZ2A 3FDKA 3IJ6A 2R1NA 1ZZMA 4DO7A 1V7AA 3A4JA 3DC8A 4KESA 2ADAA 3E3HA 2YB4A 4CNSA 2I9UA 2R1MA 1R9YA 2Z27A 1P6CA 2DVUA 3UPMA 4IFRA 3GTXA 4XD6A 1PTAA 2E25A 3E2VA 4LFYA 3ISIX 3EGJA 2A3LA 4KIRA 5LXXA 4MUPA 1EYWA 3MDWA 1EJTC 3NEHA 1M65A 2PUZA 3D6NA 3K2GA 1XGEA 3UF9A 4ERIA 2Z24A 1KRBC 3AUOA 1M68A 1ONXA 4GX8A 2QT3A 4J2MA 4DLMA 5AKQA 4QTGA 4PE8A 1W1IE 1FWCC 4LAKA 1EJUC 4UB9A 3RCMA 4XD4A 4KEUA 3F4CA 3F2DA 4R85A 2D2JA 4R7WA 2F6KA 3URBA 3LY0A 1FKWA 3S2MA 2PGFA 1K70A 2UZ9A 4QRNA 4C6MA 4F0LA 4B92A 4H00A 2Z4GA 4H9UA 2R1LA 3HM7A 4GBDA 4HK6A 3AU2A 4P5UA 4F0RA 4PBFA 4XAGA 4I6VA 4PCPA 4QROA 3ORWA 1RA5A 2DVXA 1UIOA 1O12A 3GU2A 1KRCC 4CQDA 1FWGC 2GWNA 4E3TA 1KRAC 3A3XA 2OOFA 3ICJA 1FWHC 3HTWA 3QY7A 4L9XA 4C6DA 3G77A 1A5NC 3MSRA 4CQBA 2QPXA 1FWFC 4G7EB 1FWDC 1J6PA 1XRTA 4C65A 4XAYA 4B3ZA 1POKA 5E5CA 3E74A 3F2CA 2HQAA 4IFKA 4C6LA 3T8LA 3UR2A 2QVNA 4EP8C 4C6FA 1GKRA 1UMLA 2D2GA 3B0YA 4IQJA 4LAOA 3IGHX 3IPWA 1EJSC 4H9ZA 4AC7C 3A3WA 2GZXA 5CH9A 3E0FA 2QS8A 2BGNE 4DIAA 1RA0A 1PO9A 3SO7A 4IH3A 4IF2A 5FSEC 3PNUA 2WM1A 2FVMA 4HJWA 3URQA 2P53A 4LANA 2EG7A 4DI8A 3T1GA 3URNA 1YNYA 4KEZA 1XRFA 1YMYA 4H9YA 2FVKA 4H9TA 2HNHA 3B0XA 2WJFA 1PB0A 1PSCA 3WMLA 3CS2A 2VC5A 1WXYA 4PCNA 3RHGA 4INFA 4UBPC 4BJHA 1UIPA 3C86A 2CZVA 5A6TC 3DUGA 2FTWA 1FWAC 3IACA 2HPIA 3GU9A 4BY3A 1GKQA 4LEFA 3NURA 2Y1HA 4GYFA 3ITCA 4EPDC 4WGXA 2XIOA 4QS6A 4C60A 3LU2A 4J5NA 3OJGA 3E0LA 4C6BA 2PAJA 3OODA 2OODA 3QY8A 4C5ZA 2WJEA 4KF1A 1K1DA 3QY6A 4C6KA 3SFWA 2GSEA 1FWJC 1POJA 1YBQA 2HBVA 3CAKA 2FTYA 3AU6A 2Z7GA 2IMRA 2Z00A 4NI8A 4GOAA 4H9XA 1RK6A 4GZ7A 3IARA 1R9ZA 1NDZA 4RE0A 4KEVA 1BF6A 3GIPA 4HK5A 4RDZA 1FKXA 2AMXA 3GTHA 2HBXA 4IG2A 2P50A 3GG7A 4H9MA 3MPGA 3GUWA 3LSCA 3LA4A 1EJXC 2VR2A 3QGKC 4GC3A 4EPKA 3JZEA 1A5MC 1V77A 1RJPA 1V51A 4TQTA 4H9VA 2EG6A 2ZC1A 2YB1A 2DVTA 1RAKA 4IFKB 4ZSUA 4NP7A 2Z28A 3TNBA 4EPBC 2G3FA 1NDVA 3CJPA 4LCQA 4CEXC 3O0FA 2Z2BA 1JGMA 3EWCA 4M51A 2PGRA 1YRRA 2VM8A 4WVXA 1IE7C 2PLMA 4G7EA 1NFGA 4EPEC 1GKPA 1J6OA 3GU1A 3LNPA 1ITQA 3NQBA 3OOQA 4GY7A 1A5LC 3TN6A 3F2BA 4RDVA 2GOKA 4GXWA 4Z42C 1NDYA 4IGMA 3UR5A 3MTWA 3BE7A 2Z29A 4C6CA 4GK8A 1P1MA 3IRSA 2VUNA 4I6KA 5HMEA 1I0DA 4ICMA 3PAOA 4B91A 2VC7A 3WYZA 4DYKA 4G2DA 4C6OA 1XWYA 4RDWA 3MVTA 2R1PA 4C6NA 4H01A 3QGAC 3HPAA 3EWDA 1V79A 2Z2AA 1J5SA 1ONWA 4PBEA 4ZSTA 2WJDA 3PBMA 3MKVA 3RYSA 3URAA 4B90A 2Q09A 1QXLA 2Z26A 4LH8A 4DZIA 2YZ5A 4LALA 2ICSA 2EG8A 4GX9A 2AQOA 3N2CA 2OQLA 2ANUA 4L6DA 1J79A 1EJWC 1V4YA 2R1KA 4AQLA 2UBPC 4XAZA 4C6IA 4DZHA 2HPMA 4QS5A 3FEQA 4ERGA 3PANA 1FWEC 1KCXA 4CQCA 3KM8A 3V7PA 1UBPC 1RK5A 4R88A 3ID7A 2OB3A 1EJRC 4NG3A 1FWBC 1VFLA 5HMFA 4D8LA 1YBQB 1E9ZB 3LSBA 3S2JA 3TN4A 3TN5A 1K6WA 3GRIA 4KETA 1KRMA 4HA0A 3T81A 3LGDA 3O7UA 4XD3A 1QW7A 3DCPA 4IFOA 2GWGA 3WZ0E 3S2LA 1I0BA 4V1XA 4RZBA 4C5YA 1NDWA 4J35A 2W9MA 1E9YB 2FFIA 3R0DA 5FSDC 2VHLA 3B40A 1FWIC 4IG2B 5HMDA 4WHBA 2Z25A 1YIXA 4JOMA 4QSFA 3E38A 3IV8A 2I5GA 3F4DA 1A5KC 3S2NA 2AQVA 4LCRA 3MDUA 3GTIA 4OFCA 3RN6A 2Q01A 4IGNA 4BKNA 2O4QA 4DLFA 1DPMA 3LGGA 3FDGA 4KQNA 1R9XA 4XD5A 3OVGA 1P6BA 4HK7A 4DNMA 3LS9A 3OQEA 1S3TC 3S4TA 4C6PA 2YXOA 1HZYA 3GTFA 3MJMA 4KERA 3MVIA 3OU8A 1EJVC 4GY1A 4CEUC 3UBPC 3K5XA 4LAMA 1A4MA 4YIWA 2O4MA 2OGJA 1ADDA 2E1WA 4C6QA 1A4LA 1EF2A 4ERAA 4GY0A 4LCSA 4V1YA 4C6JA
chains in the Genus database with same CATH superfamily
1NWRA 3RU6A 4GACA 3PJTA 3TZFA 4X0NA 2ACRA 4FS9A 4YL2A 1QCWA 4UMAA 4GBUA 2GPTA 3SAZA 1PXGA 1WXZA 1QHZA 2Y5SA 3GD6A 4QJ1A 4YJ5A 1EZ2A 1JUBA 3BLIA 1MUMA 2CBVA 4I5UA 1MMFA 4IL2A 4GCXA 3KDOA 3VM7A 3C56A 2E5BA 5B7YA 3XISA 4HVXA 1SYTA 1OC6A 3P80A 3PBVA 4JGDA 3TW7A 2PDLA 2PI6A 1WAUA 1FCVA 3VDHA 3ZO9A 3K13A 2W61A 5ENLA 4ADTA 3EX4A 3K2GA 4REQA 3U2CA 3U7VA 3NIYA 2CLKA 3AUOA 1W1ZA 1MEHA 4MNKA 3AI0A 1E5NA 2ACSA 5FA5A 1WKYA 4FNPA 3ARQA 4W7WA 3TJXA 4GKLA 4OIFA 2D2JA 4GNKB 4GNVA 1UH3A 3K46A 1DYSA 1J9YA 3B9EA 3E0IA 5FEXA 4Q7NA 1S38A 1UD6A 2PDWA 2PTYA 3GG8A 2PWFA 2Z4GA 3VA8A 3FK4A 4LB3A 4PBFA 2EEXA 4GGHA 1E6ZA 3CZ8A 4O50A 3O6DA 4O13A 4O53A 4MF4A 4ZQPA 3IV3A 5A6AA 1O12A 2ACQA 1ONRA 1DJNA 1LG1A 2QCHA 5FJJA 1E51A 2REQA 5LIUX 1XJBA 1TVPA 4S3EA 4JHMA 4QAIA 3C4UA 1I2PA 5LGZA 3F5JA 1EKOA 3AICA 2E40A 4G7EB 1FP9A 4YXGA 1G67A 1DXFA 3MZNA 4PMNA 4DO5A 5TD4A 3TU9A 1TR9A 3H26A 4RLIA 4R9OA 1QO5A 3W1XA 1QNOA 1B2YA 1VP5A 1QDSA 1J12A 4NZFA 1HP4A 1TPB1 1RP8A 1FH8A 5D03A 4CLMA 4EAYA 1UD4A 3W2UA 4CQAA 3M46A 3JU2A 1Q65A 5CZKA 1TR1A 1DHPA 1MDLA 3URQA 3THAA 2EG7A 4RE4A 1UP0A 1YNYA 3B8WA 1NOFA 3TYDA 3DOPA 4M1BA 4KBXA 3O9NA 4O1AA 4DO6A 3W70A 1VPQA 4DYEA 4AHOA 1XBYA 3ZR5A 3AAMA 3BW3A 2DUZA 3HG3A 4HQVA 1W54A 3UZ5A 3KP0A 4OV4A 3N9RA 4JX5A 1DE6A 3C3NA 4EPDC 3TA9A 1FP8A 1VYRA 1GJUA 2J4GA 3LUTA 1XYLA 3M0KA 2YBVA 1BWKA 1VB9A 1AQMA 4C6KA 4RV3A 2TRSA 1W17A 1CTNA 1NVMA 1YBQA 1YE6A 1QVBA 3WENA 3PJWA 3TYEA 4W84A 1DWGM 2Y88A 4GOAA 4P8WA 4GZ7A 1JCTA 3MMTA 4GUFA 4GRSA 4ATDA 1WOBA 2TPSA 3ZVIA 4DWSB 2QJNA 1IIHA 1TFVA 2VENA 2J47A 3L5MA 5JIWA 1O5XA 1HN1A 2A6LA 1UC4A 3O07A 4IXXA 2D73A 3RGTA 1A5MC 1RJPA 4TQTA 2IQ0A 1SJBA 2WVVA 5AB3A 2G3FA 2Z2BA 3H7VA 4C1NA 5AYZA 1KGWA 2RJHA 4EVZA 3N13A 1E71M 3NQBA 1JD9A 4LUIA 1EJ7L 2PA6A 1JPMA 1JZ2A 1KM2A 1Z9AA 5C0QA 1UD8A 3REQA 3IRSA 2PLKA 4ADUA 4QSHA 4JKLA 3TTOA 3VDGA 2LLEA 1BYAA 3GVRA 1R30A 1BRLA 4JIPA 4B91A 4Q8OA 3R94A 4N9CA 3OP2A 4PR4A 2HXUA 2X1SA 3UNDA 4F2BA 3APTA 2YCLA 3AZRA 3ONBA 4CKQA 4ENLA 3SUUA 2G3NA 1V79A 5L9FA 3PWIA 1XXXA 4DEFA 3UU0A 4BCEA 5K2ZA 2Q09A 1QXLA 3LMYA 4A4AA 3P84A 4LWWA 3A3HA 5D02A 2KZHA 4O4VA 3UWZA 1HXJA 4AQLA 5JH1A 4DZHA 5A5WA 4A3UA 1UKPA 1DJWA 3IVUA 1P0NA 2Y6ZA 3VMNA 4Q3MA 4JTEA 2J7HA 1YXDA 2OB3A 1UD2A 1IR2A 1VFLA 2QJIA 4D8LA 1FBAA 3S1UA 2VUYA 4HP5A 3MSDA 2PDJA 3TN5A 1G94A 3KZSA 4IHCA 1V6TA 3HPZA 1T41A 2XTKA 5CAKA 3N25A 3UCQA 4Z17A 1KCLA 3I6TA 2FFIA 4ROQA 2GGHA 5A8PA 5HNNA 3H70A 4AVOA 1TQJA 2JKPA 2QF8A 4AMAA 1H0GA 1YIXA 2ZUNA 2Q6ZA 1F05A 3CEUA 1JXKA 5E9XA 4Z1CA 2GVLA 2UWFA 1ONEA 2OQHA 3PTKA 1W3TA 2Y89A 4XD5A 4Z0JA 3LS9A 3TA6A 4V2XA 4NYUA 1OIFA 3UCCA 1HZYA 1KCKA 4IIGA 4ZO7A 4E8CA 4GY1A 1RVKA 2ZIDA 3B9AA 3PG8A 1EF2A 1MRQA 5G2IA 3PS7A 4OBTA 1GG1A 1GPWA 4LCSA 2P5NA 2QMJA 3AS0A 1KV5A 2HXTA 5DQPA 1DJYA 5CSSA 4Q8MA 1UH4A 2X7WA 2YA1A 3WDIA 1R6WA 4IWWA 4F79A 4ZA0A 3EA1A 4GZJA 1RCOB 4CNSA 5T8GA 3DYOA 3RJYA 1J96A 1PDZA 4MIMA 4A21A 3KLLA 1UHVA 4HNCA 4XBSA 3N11A 4U5IA 3GB6A 1GOWA 3PZOA 4C90A 1XQLA 4N4PA 1B3WA 3VIHA 4UTMA 4PC8A 4KWSA 3IJLA 3LHYA 4EF9A 1PEZA 5G2HA 1VLIA 5F2GA 5C70A 4F0MA 2E3ZA 3H23A 4AZ5A 3QMTA 4ZB5A 4ZCWA 1XLHA 1K4GA 4R7WA 2WC7A 4B5WA 3KVJA 5DMMA 4HMDA 3V5CA 4BR1A 1R3RA 3WK0A 1NIUA 2ONEA 2UZ9A 4AXKA 1Q6RA 1EUAA 5E93A 1YDNA 3UG8A 2J25A 1IWPA 4O1FA 2H3BA 4PCPA 5AYIA 3DHDA 2BASA 2ZBTA 3ZT5A 2QR6A 2ZX7A 4LOCA 4E3TA 4NKCA 2OOFA 2QUTA 2V3DA 1MQQA 3QM3A 3L0GA 2XH2A 3DERA 3EEGA 1VRDA 4C6DA 1M3UA 2ZZ1A 5HANA 1FWFC 4OU1A 5EYWA 1VFMA 1XYCA 4B3ZA 4JTRA 4LF1A 4C6LA 4IX2A 4UTUA 7ODCA 1B90A 5AN7A 3TE9A 4L1WA 4N4QA 3RUBL 5EKYA 4TUFA 3SCWA 4MFEA 4HN8A 2CIPA 3MKKA 3GXFA 4EXAA 1S39A 2BGNE 2X2YA 3FCPA 3BO9A 1WDQA 3NSXA 2DSUA 5FSEC 1W1TA 1LBMA 3URNA 1TUXA 2BZNA 4JQ1A 3NL5A 1VD6A 1SZFA 1GZ1A 3CUZA 4XVDA 3AIBA 4JS3A 4YCPA 1D3CA 1FOBA 4UTTC 1GYLA 5D04C 3SCNA 3WMLA 1KXQA 3MBFA 1VBRA 4NUWA 4PCNA 1J0IA 3VMPA 5A6TC 3DUGA 4PMVA 3NDOA 4S3CA 3U7BA 3VD7A 1UWSA 2YYUA 4PTDA 3UA3A 3KVLA 4XZLX 3OW1A 4DUWA 4JFUA 1EC8A 2J77A 4JHOA 4HKPA 1FDZA 4PMOA 3BGJA 5FJTA 3M4HA 4GLEA 3OPSA 2PBGA 3VNZA 4ILSA 4QE5A 1LTDA 2OJPA 2FB2A 4DWSC 3S9YA 5C54A 4ONVA 3CK5A 5CEWA 1X7IA 5TAOA 1OT2A 1FKXA 3PUDA 3NQ2A 4EWND 2ALRA 3M16A 3BAWA 3WY1A 3QR0A 1NSJA 1JI2A 3ITTA 1JEZA 2C1HA 3G6MA 2D0GA 5GVJA 1AODA 1JRBA 1TV4A 4ZSUA 3W1LA 4YYFA 3PHAA 1UPMB 1W37A 2VDIA 4AIOA 3G1XA 2OZTA 1EX5A 2WLYA 1JG9A 3CB3A 4GY7A 4RDVA 3ATYA 4B5UA 3T4WA 3D47A 3CWHA 3BE7A 1F3TA 2GJXB 1LOSA 1Q45A 3SSZA 3GDRA 3I10A 3OIHA 2QEZA 3E6EA 1L9WA 5GNXA 5M5DA 1AD4A 4ICMA 2ASHA 3BJTA 3DDMA 3I7SA 1VC4A 5CSYA 2IW0A 2D3NA 4CU7A 3CUFA 2A7RA 1OX5A 4YTTA 5AZ0A 3CAWA 2H9AA 4N7QA 2Z1XA 4TO8A 3ITOA 1VFSA 5CLWA 3IIOA 3PBUA 3EWDA 1A0CA 3HQNA 5J5RA 5KMYA 2HS8A 3UT0A 1ICSA 4PEKA 1KFEA 2O55A 2WVUA 1F6YA 5G1MA 1X1ZA 2OQLA 4LBUA 1M53A 3LNMA 2WM0A 5I0DA 1F8MA 3PANA 3LZ5A 1FWEC 2VEPA 1E3XA 2W3ZA 4TX9A 3WLJA 4O8AA 3T2PA 5KZ6A 3QYSA 1O5KA 3V18A 3THUA 4I9AA 1CYGA 4K7VA 3DYPA 5BWFA 4GQGA 5DRCA 3HPXA 2Z25A 1HJSA 1HJUA 3IIVA 1ALDA 1W5PA 1XIFA 3UG5A 5IRPA 4JTJA 2ZC8A 2AAAA 3OQ8A 4KRUA 3NQ7A 5CGQA 3FDGA 4IQDA 2YX0A 1DIOA 4AISA 1S3TC 4NJKA 2EAWA 5FOOA 3AS3A 4P8VA 5T26A 1NWTA 2J78A 2Q3OA 2VKZG 4BF5A 3QZ6A 1WV2A 3K5XA 4TX8A 1J01A 3UA4A 1AW2A 3F5LA 5K4XA 3CGTA 1I60A 2BB0A 3GIQA 4TMCA 4U33A 3LPGA 1LL6A 3N3MA 3TQ0A 3S1GA 5CSRA 4U10A 3TK7A 1VJSA 1F76A 3CQJA 4PUKA 2DIEA 1B9BA 4IUGA 3N12A 3DFYA 4W86A 4Q8NA 3W7GA 1Z44A 1W56A 1KB3A 2C15A 2CETA 2E25A 2XIIA 1U83A 4H6EA 3E2VA 4U2ZA 1C3FA 1S2CA 4G1KA 1WBJA 2YSWA 1XRVA 2F7FA 4A3HA 2I1OA 2CBUA 4GZEA 1XLJA 1GUVA 3EKGA 3VIPA 1C8QA 3H7RA 2YOCA 4J2MA 2Y61A 4IP7A 1R47A 5EGRA 5DBUA 2J8GA 1DWFM 2OQYA 4FX7A 1NP0A 5HUPA 5LNRA 2A0NA 3N2OA 3AZTA 1R5YA 4FNQA 2P88A 1P0EA 2ZE3A 4O16A 3EXSA 1TG7A 1K70A 3D46A 1MI3A 4NRRA 4H9UA 2FLIA 1LRQA 4KCVA 2QPSA 4P5UA 2XHYA 4LF2A 3EWXA 4FB7A 3WBXA 1V6YA 1EWDA 2RKXA 2FJKA 3MY9A 1SM9A 3LXBA 3GU2A 4ZGYA 2PDHA 4O0KA 5G2WA 2NVDA 1DTNA 3QY7A 4QNEA 4OE7A 4N2YA 3CPGA 3ZXWA 1CDGA 1XLKA 4F2UA 5FAJA 4L1GA 1ISVA 3UWEA 1JFHA 2J9XA 1P7TA 1JYWA 1YPFA 3VNJA 4UR8A 1G7UA 3NFUA 4RK8A 5J04A 3L4WA 4IFKA 4ZQMA 3UR2A 1E4IA 2QCMA 1BSIA 3N17A 4WY0A 3SCQA 1KM4A 3S0CA 1ZP3A 3SECA 2FHFA 3BOLA 2HVMA 1OWQA 1EJSC 1PKYA 2CLPA 3QQ1A 2B0MA 3QHOA 2OLAA 5CBBA 3S1XA 2P10A 1YHTA 1ZUAX 1W3LA 3G1VA 1X1NA 1SW0A 4K36A 3EMQA 4B16A 3GVQA 4FR1A 3PTQA 1AJZA 1ML1A 3W7EA 4MJ2A 4H9TA 1EDGA 5FF4A 3WDPP 1PL9A 1XBZA 2V8ZA 4K37A 1KXHA 1XYBA 4YHEA 2V5CA 1ECQA 3WSUA 1Q6LA 2ZZ5A 1BEUA 3OA5A 5H8PA 1XH1A 1UBSA 4Y7EA 5H8MA 1RD6A 4BY3A 3MP3A 4CN4A 3WJZA 4DO4A 2W27A 2OVLA 5FACA 3GIYA 3KOWA 1F2JA 2X40A 3CM4A 2DJLA 4CQ9A 4QR6A 2BOGX 3W7NA 2OT1A 3W74A 3QY8A 4MDOA 5MKGA 3TTYA 2EF9A 1W0MA 2POZA 4I9JA 3QOKA 4F40A 4IPNB 4CCEA 2BTMA 3TYBA 4OWGA 3P14A 4NX5A 1O94A 1ISYA 3DECA 4JEQA 1OFEA 3IANA 1CXLA 3BK0A 4FIQA 4NAEA 3JZEA 4D1JA 1V77A 2WW5A 3PPCA 1KQZA 1H41A 4EPBC 4LC6A 3EX6A 1E6SM 4CNPA 1GQIA 1O1ZA 3O0FA 1LL4A 1PKNA 3HQOA 4Z2GA 1QRQA 4FLQA 3POCA 2BOFX 4UR7A 1GVRA 4JY9A 3V4BA 3U2EA 1E1CB 3W7IA 4XZMX 1IXPA 1GKPA 1UKSA 2GOKA 3OLDA 3LK6A 3PB2A 4NAFA 2WNNA 2GGIA 3AWNA 5FJUA 2WZIA 3PB0A 1ZSXA 4XG1A 3ITVA 4HU0A 1BYDA 2VTFA 4AWTA 1DIDA 4DXKA 3QV7A 4E38A 4FA3A 5K3VA 3U0HA 2VZSA 1PZ1A 1R8LA 5BOOA 1TZZA 4KRZA 3WJXA 1R86A 2W6RA 4LYQA 1PVNA 1JCMP 4FR6A 3VIGA 1PTDA 3T2OA 3LERA 1OM0A 2O9RA 3WQDA 5EMYA 2Z1WA 1GTHA 3PC0A 3WFLA 2ZRUA 3WQVA 2VFGA 2EPKX 3RYSA 4ZO8A 4ZO6A 3ZLHA 1XYZA 2ICSA 5CGTA 5DCDA 4IMCA 1FCUA 2UBPC 2HMCA 4UTFA 3PUEA 4QS5A 2HPMA 4UFLA 1KCXA 4PB3A 3WLKX 1VH7A 1XP3A 3KM8A 4UMCA 3C0LA 3TC6A 4YU1A 4L7ZA 2C18A 5HMFA 1UR2A 1BSLA 4UQEA 2F61A 1H62A 1BPLB 2XH4A 3WLMA 3WEOA 3LGDA 3L23A 5E70A 4H7ZA 4RZBA 4RNFA 4R7OA 3GZ3A 1WKEA 4S3DA 4OBRA 4DJEC 1QI4A 4PUWA 1M41A 2V9DA 1A5KC 3B9NA 1TPUA 4LCRA 4GYKA 3GTIA 4OFCA 3GVGA 3RN6A 3M7WA 3AMLA 2A21A 3NL3A 2BLEA 2FQIA 3CXOA 4Z1AA 1ESWA 4AEEA 5IOBA 2FDMA 3RM8A 4DNHA 4I7UA 1HX0A 1THFD 4P61A 2IKGA 2O4MA 3PZMA 4NHVA 3ME3A 1GEQA 1FCBA 2WNZA 5FCZA 1EA9C 3CBWA 4LAZA 1SR9A 3V3WA 1RJQA 4LXFA 3V35A 2D2HA 3K4WA 4AVFA 5ECVA 1HUVA 2OO0A 3W38A 3VCNA 3FDKA 1E6PA 1QNPA 4YVPA 2O56A 3R5EA 5L6UA 4UQCA 4J3ZA 2ADAA 2VVSA 4DBDA 1PIGA 5HNRA 2PFHA 2VJXA 1P6CA 1CGXA 2QZRA 4DJED 4IFRA 4BA0A 5C2XA 3UG4A 2ZVIA 2QGYA 1QMLA 5HQLA 4HHLA 3VABA 3TR9A 4IIEA 4PSRA 1VLWA 2V2DA 1SU5A 1LT7A 4YTSA 4UTTA 4AZ6A 8XIAA 3UXKA 2FPTA 4S3GA 1XYFA 3ITXA 4U31A 3OIXA 3T09A 3CYVA 2WYSA 1MVYA 1BXNA 4XD4A 3WLPA 1RD5A 2DU2A 1SQ7A 1SW7A 3TTSA 1ME7A 3K8LA 2OYKA 4D2JA 5IFTA 3LQGA 1A5UA 1OINA 3H4GA 2HV5A 3V16A 3W4RA 4F0LA 2DZXA 1E6QM 2QCLA 1Y5XA 3GLCA 3ELFA 4YS1A 4LUTB 3QEZA 2YJQA 3TWAA 3CHDA 4JZ5A 2XWDA 5CLTA 4DWSA 3ICJA 1D8CA 2WQDA 3A21A 4QITA 4LS0A 2ZDSA 1IF2A 3KOFA 4XX6A 4XSMA 3U2ZA 3CYJA 1XF0A 3W00A 4P8UA 5LA0A 3CH9A 1FWDC 4BF7A 1OG6A 5AHNA 4O4WA 1UOKA 3ARWA 4MY1A 3NPXA 4O1CA 3IJQA 1UJQA 3PSWA 1S2AA 2QVNA 5EB8A 1F3WA 3GW0A 2RGLA 1GEHA 1FFQA 3U8GA 1Z41A 3QPZA 3EKLA 3HJZA 2GDVA 1ZJHA 2GSHA 1R7OA 3EPNA 3WL1A 1U33A 5H91A 5CJMA 4LUSB 1WE5A 2CKRA 1L0PA 1N8WA 5A8GA 2JIEA 2PWVA 2JIWA 4EACA 1G69A 1TX0A 2E6FA 3B0XA 3E1F1 1WA3A 2WJFA 3W0KA 3R13A 1JXJA 4IL0A 1H60A 2V63A 3GAKA 2ZXAA 1L2UA 1K8CA 1G1YA 2V5DA 1OCJA 3E5BA 2YW4A 1BG4A 2ZUTA 6TIMA 1GVIA 1Q6CA 1V6XA 1SJCA 4IIBA 3NURA 1TRIA 4S39A 3HQ1A 3FSTA 4Q33A 2XIBA 1KTCA 3HG4A 4ML9A 1OHLA 3SURA 3LRKA 1XLDA 3R79A 4C5ZA 1FQ0A 1KLYA 3H55A 4QLJA 4NL1A 1UWUA 3FYOA 3Q67A 4JFVA 3UJFA 3FGCB 2ACUA 3WBAA 3ITLA 2XINA 1UJPA 1D3HA 1ZB5A 2XGIA 1B54A 2AKZA 3W6YA 1KTBA 4TIMA 1NFBA 4FNTA 1WZMA 2NXGA 2JEPA 3NQCA 3GUWA 4NZ3A 1XIGA 2EG6A 5EFDA 4IXHA 4GFIA 2PTDA 2FZ9A 2HNEA 4NXKA 3CC1A 4YLWA 2HEJA 1ZBCA 1JIBA 4X63A 1JRCA 1UD5A 5HMSA 4Q7IA 3MC5A 1EB3A 3TJIA 1IE7C 2V5BA 3GU1A 3EEZA 3F2BA 2QCDB 2F38A 1EHAA 2V67A 3BCJA 1N55A 4QISA 4K39A 4UQAA 4F8XA 3Q45A 4AH7A 3QLDA 5IBXA 4FALA 2DORA 4RNHA 2FH6A 2VC7A 4G2DA 1EFZA 4HTYA 2YKKA 3PBGA 3MI3A 3HGOA 3BJFA 5I3GA 4GQQA 2VEMA 2ZCGA 1PIIA 3UQNA 2BGQA 3QGAC 3UZXA 3W1NA 1VCGA 1J5SA 3WEZA 5I02A 3EOUA 3PBMA 2WQPA 3K8MA 4HCLA 4UFJA 2BV9A 1E70M 3P82A 4ASTA 2EG8A 4AD1A 1TV3A 2XN0A 1TYGA 3GDBA 1MYRA 3SIZA 4ERGA 1CZ1A 1ZY9A 1RLDA 1PUDA 4K8EA 4NZ1A 3NO1A 2YFNA 3EMZA 1TJ2A 1VCVA 3LXAA 4XKYB 1ME8A 2CNCA 3S2JA 3QZEA 2GVJA 4LC8A 4CD8A 3WJYA 2Q02A 2JKEA 2NT1A 3L5LA 4IFOA 2GWGA 3CT2A 8CGTA 4HMNA 3ZVHA 4MJZA 2ISDA 4FXRA 2QAFA 1JQVA 3WQ8A 1U5JA 3GZAA 1QPQA 4KRTA 2ZTJA 6XIMA 4H8HA 1QNQA 3NQ8A 3RM4A 4IGNA 2C19A 3B0UX 4DNMA 1OQFA 3WUGA 1IZKA 1RALA 4GQ0A 3CTLA 4NYYA 1IXQA 4ZO9A 2ZWZA 3NPWA 1KM5A 3CMFA 3CZJA 2OGJA 3WD0A 1H3GA 1UA7A 2W79A 1YTEA 1BQGA 1GVSA 2DW7A 2HTMA 2UV8G 2P0OA 5F4SA 5CGMA 3QR1A 3ARTA 1Y5WA 5FL0A 1W1PA 1KM1A 1NWUA 3QHNA 4GJIA 3N2MA 4M80A 5JH2A 1IEIA 2XPKA 3UPMA 2G3MA 2X41A 3N6JA 1VS1A 2O0TA 1ZALA 2CC0A 1PTAA 3FEMA 5G5IA 1QOQA 4C7DA 5A8QA 4FAMA 2NQHA 4IIHA 1H50A 1EYWA 5ABGA 3VK5A 4A8NA 3MO4A 1MW1A 3AXIA 2GJPA 3DAQA 3G0SA 1DJQA 2QDHA 3PBWA 4UXDA 1MXGA 4PE8A 1I45A 5AOUA 1EBHA 1DE5A 4PTNA 3WL0A 2GJLA 4JTCA 5A6LA 2E0PA 3LI1A 5GJNA 4PRRA 4YWSA 1ITCA 4AB4A 4WF7A 2RDXA 2NX3A 3GDTA 4MTVA 2DUXA 3LCWA 1WXJA 2Z1BA 1MNSA 2CWNA 3NQAA 5A6SA 1MNZA 4IGSA 1HQTA 2ZZ6A 1TV5A 4L4MA 1TJRA 3WQGA 4JTFA 1AQFA 1QHPA 4Z2IA 1B0IA 4O0QA 2YBTA 1AMKA 5FEZA 2D3LA 3N9SA 3UG3A 1D3GA 3P0WA 1JJKA 3AJXA 4HPNA 5LHEA 4XAYA 4PUEA 4DBEA 3UZZA 1YE4A 3F2CA 4XBKA 4D6GA 3FFSA 4C6FA 1EF3A 3LHWA 3UGRA 1LQ2A 3W3OA 3BWWA 3O0KA 5T9CE 2YCJA 1BHGA 3IK2A 4MWAB 3DZ1A 4GO9A 1VKFA 1N8IA 4K38A 5D9NA 2GJXA 3WN6A 3V0UA 5LNVA 1F8IA 3PNUA 2J7FA 3QSRA 4QE1A 4HYWA 5ABEA 5F4XA 2GLKA 1HL8A 4JCLA 4B2DD 1V3LA 1GVOA 1IT0A 3I6EA 2C1IA 1G7VA 5DO8A 3RCYA 5BMWA 3PP7A 1TIWA 5C5YA 3O3RA 1OCBA 4GI9A 1DEDA 2X42A 4HOWA 2XIQA 1ICQA 2E6DA 4HT3A 1PTGA 3C86A 2PDNA 4PL1A 1OFRA 3SN0A 3B8DA 4C91A 4KFOA 1QNRA 3WUEA 3EPOA 2E28A 4GINA 2PCEA 3KTXA 1VGAA 2C6QA 2A7PA 4LPCA 2G3JA 3E0LA 3WNMA 4AF0A 3RPDA 1PDYA 4GC4A 4KF1A 1ZBVA 4CD4A 1K1DA 3KUMA 4Q32A 4GI8A 3SFWA 4KKXA 1WYIA 4O1DA 1QUMA 2ZXBA 3T78A 5H1WA 4E2BA 3SJNA 1E55A 4AMCA 2C3ZA 3U5YA 2C0AA 5DT5A 3OVPA 1NDZA 2ZUSA 3CV7A 1QI0A 2H8XA 1E1FA 1D9EA 2IKJA 4DJEA 1S46A 2OX4A 5CQ1A 4H9MA 2BXYA 3BL3A 2PWDA 3NO5A 5H8UA 1L2QA 1KC7A 2WMIA 4AIUA 3N2TA 2WBGA 3FOKA 3DI1A 1TMHA 4XK2A 1V03A 3DIPA 3CNYA 3QHMA 3DI0A 1SGJA 3EWCA 4W7UA 2POTA 4I8DA 4F66A 1YRRA 3K1DA 4M5PA 2BVTA 5KETA 5ABFA 3QYQA 4PMZA 3NG3A 3SQSA 1OF6A 1TPC1 3CL7A 2YBUA 4FLRA 1QBAA 1EP1A 2Z29A 3TVAA 3LQLA 1SO6A 4GK8A 1UKTA 3UZWA 3VNMA 4AXNA 4UOZA 3PY2A 1CPUA 2VQUA 4PRWA 1YKWA 3WF2A 3AYTA 4AWSA 2VVNA 3R4IA 1DQUA 4YTUA 1XWYA 1EOMA 4HPXA 2XM1A 4B15A 4UQBA 2HZGA 3OLEA 4WK9A 4YWIA 2IXUA 3PSVA 2A5HA 4PBEA 3AS2A 1RY8A 4QEHA 3TQKA 4MB1A 1A5BA 2Y7GA 5K7JA 4FZIA 3GFZA 2Q8ZA 1XISA 2NX1A 4K2SA 1J79A 1V4YA 2PDXA 6ALDA 1UR9A 2Y7FA 2OOGA 1O5QA 1K7FA 1ZPTA 3V7PA 3USZA 3ID7A 2YCKX 4YTRA 2DQWA 2PP0A 1DWIM 3SN1A 2JFEX 1CB7B 1QW7A 3AXXA 3WZ0E 1QW9A 4HMCA 3N73A 1TMQA 1XPYA 3OGRA 2NQ5A 5IM51 3PZNA 2C1GA 4GWEA 5EL1A 4D1IA 1C92A 3ZJKA 5HAOA 3S2NA 1ENUA 3QXBA 1W5MA 1P6BA 3B05A 2PCQA 1ZTVA 2BVDA 4XO7A 4GG9A 1S5NA 1YPXA 4KERA 4OV9A 2GQ8A 1SZRA 5K9XA 1EL3A 2ZE0A 5AZ1A 1JYNA 3LTPA 3ZZ1A 3QMRA 3W1MA 3RRXA 4XV0A 5I3DA 1EP2A 1H49A 2W5FA 1JPHA 1ADDA 5DELA 1A4LA 3W84A 4MOZA 2EGZA 2ZRYA 3W7MA 4C6JA 3N2BA 3DHUA 1B3XA 3ARUA 5C55A 3T6CA 4Q8PA 4TX6A 3EAUA 3S8HA 4W5ZA 3MV11 4E2VA 5HJYA 2WWCA 4D8ZA 3OEXA 1W9XA 4CNTA 1XICA 2PC8A 3VVGA 4KPLA 2R1NA 3I3BA 1IXOA 1V7AA 3R12A 3NXLA 4M1RA 3NXFA 2YB4A 3EDDA 4Z1DA 1TUFA 3CUIA 1W9PA 3WK3A 4UWMA 3BOXA 3HPSA 2ZRZA 4YNGA 4H41A 4MUPA 3H6OA 1RBLA 2D2OA 4Q8QA 2PUZA 2YZRA 1QFEA 5F7UA 1TCDA 3LMZA 2H6RA 2AQWA 4JL2A 3WD2A 1LOLA 1C91A 2NXIA 5CZ0A 5C9RA 3OYZA 3GFXA 4CN1A 4I7WA 4GQBA 4QTGA 3TMLA 4W9TA 3GQYA 1XRSA 3C2YA 3ECQA 4EANA 1TKKA 5DFAA 5A69A 1EWEA 2OXNA 3CUXA 4LB4A 2C71A 4GI4A 1B4EA 3ERPA 1A80A 3AU2A 3MI2A 2FJUB 4Y96A 3K4AA 3GC2A 3I4EA 2WKLA 4LX4A 4ZOCA 3W7LA 1W9UA 3W7OA 4X9YA 4ZQCA 1FFRA 2A3AA 3WDQA 5D8ZA 3I7RA 3FSUA 1JZ6A 4JTDA 3NWRA 3SRHA 4Z2LA 4H3DA 1QWGA 3U9IA 2GUBA 3VE7A 2PE4A 3KFTA 3FLUA 1VPYA 3CMJA 1XD1A 4H8NA 1XIJA 1FRBA 3QC3A 3B3DA 3CHVA 2RDWA 2JKAA 4GABA 4MWAC 5I5RA 4WKFA 3NGJA 2DJXA 3VO0A 4R27A 1PO9A 4N9EA 1FHVA 3CUHA 3LV6A 3KX6A 3MS8A 4URIA 1QNSA 4EAMA 5AC6A 5CC3A 2PRLA 3NUKA 1E0UA 3KRSA 4GKTA 1IHIA 2GL5A 2EJAA 4HNNA 3BLKA 1TV7A 1VIZA 3L12A 3HMCA 3CZLA 3W7QA 3N4EA 1B57A 2C79A 3GC5A 1DJGA 1KM6A 4JFTA 4LAUA 3RR4A 3V0TA 1Y5VA 3AYSA 2EO7A 1EDTA 1TA3A 2CWXA 2MNRA 3IAPA 3GE7A 1TCMA 3FA5A 1XYMA 6PTDA 3BOFA 4JICA 5F4WA 5D2TA 3L67A 1XDMA 1XHGA 4UOJA 4MVAA 2FB3A 2I57A 4JCMA 4DM1A 4GIEA 4QAWA 3WUBA 1DBTA 4WDUA 2NWRA 3T42A 4US5D 1BQCA 1YPIA 1GVYA 4H9XA 4XZ9A 1KWKA 1SW3A 4ZR8A 2O92A 3PJXA 1G9HA 2E9LA 2EPLX 3QLLA 4OTKA 3AMCA 5I77A 2QNEA 3TX9A 4DX3A 4JKMA 3AHTA 3N6QA 1HJWA 1XDJA 2JE8A 3APYA 3AROA 2FZ8A 2DH3A 2OGYA 3M0ZA 4UUIA 1M5WA 2E6YA 1UW9A 3JS3A 3WF3A 1VBJA 3ZSSA 2I16A 1MO0A 3KBMA 4PBGA 3Q37A 3A23A 3QKEA 2PTZA 2PGRA 2XFFA 4XZNX 1NFGA 1ZFJA 3LNPA 3TN6A 4IGMA 3GS6A 1HT6A 3CAVA 3WD3A 3CWNA 4OQVA 5CPTA 4F4RA 3AMKA 5XIMA 2GFTA 4C1LA 3LV5A 3FA4A 4RDWA 3RLGA 3MT1A 1X8CA 5AHIA 3NL2A 4DVOA 1HJQA 2R1PA 3MVTA 4S3FA 4UZUA 4J27A 5E1QA 4DAIA 1IQ8A 3LBOA 1X1OA 1X8FA 1V3HA 3BAXA 3M5XA 1JAEA 3KTCA 2Z2AA 3T05A 4JIEA 4GUIA 1EQCA 5G4WA 4B90A 4MSSA 1IZJA 2YZ5A 4LALA 1V3IA 2AQOA 3G6LA 3SCVA 4W8LA 2R1KA 3HFTA 1NELA 3THDA 5HULA 3W23A 2PC4A 4QG8A 4QG9A 4R88A 4XBJA 1VF8A 3HJEA 3QGVA 2XVGA 1F5ZA 3S5YA 3TCEA 3TN4A 3PUOA 3DFTA 4NJJA 3EKZA 2XDFA 1PIFA 4JTKA 4J3SA 4G8TA 4Z0SA 4UIOA 2VGGA 4M19A 1H2JA 2WK2A 2ZZ4A 1UOZA 2CPUA 1LM1A 4LUTA 4B2DA 1S5WA 3M64A 4A3YA 3MDUA 3AYVA 4JIIX 2NSXA 3CWOX 1DJIA 2VDGA 4UTKA 1LROA 4BQ5A 1LT8A 3R0UA 2D22A 1FH7A 1RXOB 3AIRA 4EXQA 1K9TA 3MHUA 1DJZA 2G3IA 1KBLA 2BNJA 4ZQRA 1I75A 5HPCA 3EOOA 3WD4A 4WJXA 1JI1A 1O5RA 1MW0A 3L0KA 4AZCA 2VI0A 3TUUA 1KQYA 2PDKA 3PNZA 1XW8A 2Q3RA 3PZ9A 5BU6A 3IJ6A 4JN7A 4Y8EA 1TZ9A 1ZBKA 3WLOA 3QV8A 4KESA 3MUAA 1O4UA 3EWUA 2CLLA 4LUSA 2VX6A 2R1MA 3VOCA 3WQCA 2Z27A 4H4IA 2VFHA 3C0JA 1H7WA 1KFBA 1JZ7A 3FY1A 2ODOA 3VUSA 4Z1YA 5I24A 2VWTA 4MY9A 4A2RA 4L4LA 4R5EA 3MDWA 4UR9A 4DRSA 2WBKA 1ONXA 3WLNA 3R2GA 3QQ0A 4DLMA 4UNIA 4MYAA 4B5SA 4FF5A 1JDCA 3EPMA 3GHRA 3EYPA 2QUMA 4M6UA 3F2DA 2NV2A 3O8AA 3QPYA 1HL9A 1MEIA 4JTHA 4HJFA 3WKZA 1V6WA 1ZNNA 3URBA 1MZRA 1MWOA 4NZCA 3TEVA 2BMBA 3LHVA 1W3IA 3O2LA 4B92A 1MEWA 3HM7A 2PU1A 3NQMA 2WB5A 1JNDA 3V36A 4RJEA 2E5DA 2FZDA 3FGCA 4ZQOA 1XH0A 1Z32X 5A8OA 4JKKA 4IJRA 1S2UA 1ZQ5A 1Q7ZA 1W9BM 4L6HA 1KR0A 4D8AA 2V5LA 4L9XA 1RQBA 1CW2A 3FXYA 2QPXA 3MB9A 2QDGA 1K7XA 2JGYA 1I8JA 1UQYA 4HCDA 2CZ5A 3UPWA 3EOEA 3H7UA 2F9RA 3T0DA 3UZYA 4S1FA 5EMUA 1SO5A 2J66A 1TV2A 3MU7A 5HDRA 1XUZA 3G1FA 3II1A 3IGHX 4NF7A 5FF7A 1QOPA 1JR1A 2QCDA 2DGAA 4GQRA 4DBSA 4F0HA 3SR7A 3B04A 1KO0A 2INEA 2ISSA 1IEWA 5AC5A 1E6XM 1V02A 2BGSA 3TXZA 2PDGA 1V02E 5LZLA 3M0IA 2G97A 4QJ3B 3U3HA 5I6SA 1XC6A 1OB0A 2H90A 3T0BA 1HKVA 1VFHA 3MP4A 1KWGA 4UBPC 3BUVA 1FWAC 3LLDA 4AYGA 2EKGA 4OECA 1V0MA 1A0EA 5BCAA 1C7SA 4LVGA 5IHRA 5KEZA 4IJCA 5JMUA 3OJGA 4AY8A 2PDIA 2PWEA 4JIHA 3WF1A 1QBBA 2VP8A 2VRJA 1PWLA 1IIGA 4XZIA 5A2BA 2BS9A 3W25A 3S1WA 4XKYA 3ABZA 2XGZA 1F9CA 2C14A 5I3HA 4GVIA 3WJSA 3KZPA 4NI8A 5C71A 2ZUVA 2EHHA 4GUHA 4XZBA 4DJDC 3VGHA 5M2FX 1TRDA 4ICNA 1R0MA 4Z2HA 4RUBA 3P67A 2CZFA 4M82A 1KTNA 1E3ZA 2J13A 1IXNA 3P2VA 1Z89A 4ORMA 3TP4A 1K9EA 1XIMA 3O05A 2V68A 5I09A 3KOZA 4GC3A 2HE8A 1C9WA 3BGAA 2CFFA 3BSHA 1PAMA 5CKSA 3BG9A 3WEMA 1RBOB 3LM3A 1P6WA 4WGHA 1ZP4A 1JGMA 1IEXA 3C61A 2V3FA 1J0HA 4AW7A 2EPOA 4GXWA 3H2NA 1NDYA 5I79A 4IMDA 1TWWA 3VFCA 3HV9A 3F03K 4HNTA 3LZ3A 2Z2UA 5EMKA 2VUNA 1E73M 3BH4A 1I0DA 4GNJA 3VKAA 4ATWA 1LORA 3PAOA 3WYZA 1US3A 1JD7A 2HE5A 4AX7A 3ALGA 4PMYA 3KOXA 5I3IA 3RNDA 4JL1A 3TCSA 2VURA 3W01A 2FTPA 3NNTA 4JR5A 3RLUA 2GK1B 4DZIA 5FKYA 1UASA 3N9KA 3N18A 2DIKA 3VDAA 1EP3A 2R91A 1Y0EA 4B5NA 5BROA 1HF6A 5JBDA 2J75A 3KWSA 4BFAA 1AK5A 4F0KA 4EE9A 3NQ6A 1EJRC 1UUOA 4D6FA 5IDZA 1E9ZB 3DFOA 1XSIA 3BGGA 1X6NA 3DKJA 4PMRA 4KETA 4UTHA 1GHSA 1BGAA 1BVWA 5D05A 4K1GA 7REQB 2WCGA 3WH5A 2W9MA 1DVJA 1T8XA 3O06A 4MADA 3F1QA 4GIAA 4WHBA 4X9SA 3AMGA 2RHGA 1VHNA 4K8GA 3WDRA 1UWRA 2XM2A 5HNUA 2OCZA 1IV8A 1FY6A 2O9OA 4LNCA 1GZJA 1MUWA 4BKNA 5GNZA 1J2BA 2CHOA 2WSRA 3W53A 3G8EA 1QPKA 5DY2A 3SUVA 1UG6A 3MJMA 3KRUA 1YX1A 4FX8A 3UBPC 2A7NA 4RR4A 1OJXA 1JYXA 4ERAA 5D2YA 6ENLA 1U5HA 4V1YA 1FHLA 1LCOA 2H8ZA 3INPA 3VILA 3WLIA 4NZ4A 4MGGA 1EGVA 2QHAA 3P93A 4RDYA 4NNCA 2G4FA 1NH6A 2FPVA 3BICA 3SUWA 3DG3A 4QNWA 4WZHA 4N0RA 4MWAA 3M43A 2Y62A 4MWAE 4US5A 5D2WA 3LEPA 1FWNA 3NVTA 4US6A 3W7JA 1M04A 2A3EA 4A22A 2E5CA 2NVCA 4CU6A 3C5QA 4H6KA 1G5AA 1TTIA 4H6RA 1TREA 3A13A 1GONA 2ZX9A 1L8PA 3A24A 3N4AA 1LL7A 4UFIA 1OFDA 1NEYA 1O95A 3TFCA 5LIYX 1W32A 5U7SA 4F2TA 4O1BA 2PLJA 2R24A 1I1XA 1FWRA 4GIYA 2BXZA 1X38A 5HR6A 3B0PA 4TXEA 4E0CA 1REQB 3CHFA 3HZ3A 1P4CA 3A12A 2DSKA 2NUWA 3BMWA 3P81A 2B81A 3S6TA 2XSBA 2ZKMX 2CXGA 3NCOA 4FOKA 4A8IA 1DTUA 4BK9A 4QRNA 2I7GA 4XO6A 1E72M 1W3HA 4UFKA 4BQ2A 4E6MA 1M03A 4XAGA 3RFAA 3NA8A 4I8YA 4QROA 3Q65A 1EOKA 2OT0A 3WNOA 3IAQA 3K4DA 5BXRA 1U22A 1HGWA 3FXGA 1KRAC 1C93A 1GOKA 1AZ1A 3IJ7A 5HBFA 3IGUA 4C1NB 2BDQA 4JIRA 3VD5A 3G77A 1A5NC 4GCAA 1T96A 3UR8A 2ZX8A 4AWUA 1XRTA 3VE9A 2PTXA 1ODZA 3LCXA 1G4EA 4LRSA 4AIBA 2CLFA 3REQB 5CG0A 3TZNA 5EU9A 4ZXOA 3CU2A 1XIHA 1XUUA 3KCJA 1Z6KA 1FDJA 3B0YA 2A79A 4IQJA 1EXBA 1RQEA 1L6GA 3KBSA 2YW3A 1O60A 3MMDA 5D8WA 4LS1A 4DZ5A 2C7FA 5IXEA 3GG0A 4HCHA 5LIWX 4DELA 1KKRA 1S2TA 1CBGA 4AEOA 1YXCA 1B9ZA 4HJWA 3QMSA 3T1GA 3CZEA 3GBDA 3W1AA 5JQ9A 3DU0A 3GDMA 4AZIA 1XH2A 2J79A 1B3YA 2Z1SA 4DUXA 2UY3A 4FEZA 4O10A 3HPFA 3LXCA 2E8YA 3C2OA 1L6FA 1GOXA 1E0TA 3RHGA 3APGA 1XLAA 3L65A 4UQDA 4Q4QA 1U2YA 1V3MA 2FTWA 4ADSA 4FXJA 3CUGA 1FXQA 3NGFA 4PTVA 2PDFA 5I3KA 3ITCA 5TQLA 5DCBA 4W88A 4J5NA 3NZQA 4DJFC 2JBMA 5DLCA 2R14A 5FJPA 3CO4A 4RZ4A 1UWTA 1VFFA 2UY4A 3JW7A 2O9TA 1BD0A 1OX4B 2OSYA 3VFLA 1HNYA 3AU6A 3T55A 5DRIA 5FIPA 5LHFA 4XISA 5D9OA 3SADA 2GVGA 3LYEA 4FOJA 2CERA 3MW7A 3MV01 3ARVA 1CIUA 2AMXA 3WQ6A 4V15A 1KFLA 3ZJ8A 4QLKA 1QHOA 3GG7A 4QHRA 5F2IA 3PZVA 4O1EA 3D3FA 1SPQA 2RDTA 5E0KA 3RU8X 3N29A 5AYXA 4UZSA 4AX6A 2Z28A 2F84A 1M01A 3SRKA 3CJPA 1BVZA 4LCQA 2DDXA 1H1NA 1HKIA 3JZUA 1A53A 2E67A 2J88A 3GHUA 2X09A 3PBYA 1H5YA 2PLMA 5HJXA 3GWQA 4EPEC 2DZTA 2C16A 1ITQA 4R9XA 2WMGA 1CWYA 1AL8A 1A49A 1JYVA 1JCNA 4JTQA 4HBKA 8XIMA 2WPBA 4Y9PA 2VCBA 2VD8A 1Z7AA 5AC7A 1LLZA 1OFAA 4PTMA 3FS2A 1QI5A 3N6HA 4Q7BA 5HWNA 1H4PA 1AMYA 4ZENA 1K8YA 3EOSA 2ZWYA 3MA8A 4GIRA 3A22A 4L4OA 3PPFA 2PD9A 4H83A 5EBUA 1HTIA 3NQGA 3GNDA 2OLHA 3ONCA 4XIAA 1BAGA 1BKHA 3OZMA 1TPVA 4KEMA 4N6EA 3VTRA 4TTGA 3KBVA 4HZMA 1C29A 4KW2A 1IWBA 1V5XA 3VOFA 1PZ0A 3TV8A 1YDYA 4L6DA 1ADSA 1EJWC 3RIKA 3RLHA 3ANYA 4PUNA 4XAZA 2B7PA 5BRBA 5G1YA 4FXFA 4MG4A 3SJ3A 3ARRA 2ZUWA 1BFNA 1ME9A 5KZMA 1K8XA 3JUGA 3P61A 4B5TA 1OEPA 2VCCA 1CT5A 1F6KA 4L64A 1TELA 1WDPA 2CLIA 3HV8A 4W8BA 1GOOA 1JDEA 3BXWA 3QF0A 1OGBA 1UWQA 3QC0A 1SZNA 1SO3A 3DCPA 4MJMA 4C5YA 1ZHAA 2VYOA 4OT7A 1CXIA 1E9YB 4FNUA 1WBHA 1YLVA 4JOMA 4QCFA 2X05A 3NDYA 6XIAA 1W1VA 2Q01A 5DMNA 1X39A 1R9XA 1IR1A 4E2OA 1TPWA 3MUY1 1W5OA 1XC4A 2VOTA 3AMDA 4BWLC 1I2QA 4XIMA 1GOMA 1EJVC 4CEUC 3NDZA 4QGCA 4PMJA 1C9DA 4OVXA 4D6IA 4WCJA 1PWMA 4K68A 4ACZB 4WDTA 2DV0A 1OD8A 1A5OC 5XIAA 4DI9A 3ZWTA 3WH9A 1U1JA 5AHFA 4L1XA 5AVNA 3OBAA 4TU1A 3STGA 4F0SA 4FLSA 1OZMA 2CITA 5I78A 4K8HA 1BGGA 4Q8WA 7CGTA 3WFZA 1RY0A 3A4JA 3IJDA 1TVLA 2VR4A 4B5VA 2CLEA 2MANA 1RSCA 5LNSA 2VOMA 1RVGA 4JTLA 3ISIX 3VNDA 5LXXA 3VGGA 4WX2A 2HK0A 1ZAJA 2DZSA 1GW1A 3ZT7A 4TMBA 3W2KA 2E6AA 1XDLA 3H53A 1E0VA 2YYTA 3CEPA 2VFDA 1E56A 3QN3A 3MZ2A 1DKWA 3H21A 3BPWA 3VNIA 4QP0A 2F6KA 3AQUA 2YDAA 3G0UA 4AEFA 5CZJA 4JTIA 4E4PA 5CJNA 2X0SA 3EA2A 1S1PA 3W24A 5B7ZA 3WK1A 1VAHA 2DQXA 3NQFA 4LQ1A 5FD0A 1Q2RA 4G5DA 4PEEA 1JCLA 4ZODA 2BOEX 3GXDA 3P60A 4Y9AA 1R85A 2DUAA 2NZLA 3FV9A 1HG3A 2OEKA 1W91A 2OO6A 3KAOA 3EWYA 1TPEA 1FHUA 4XZWA 3MSRA 3ZWSA 1VENA 4AY7A 2C8NA 1UWAA 3T9PA 1UH2A 4O0ZA 3N3TA 1JUEA 3PFMA 3T8LA 2QV4A 5BYWA 3G1DA 4P7LA 3CV2A 2W0UA 4P8XA 3B06A 3IPWA 3TQPA 1XKJA 4ICCX 3W6MA 3AFBA 3AHYA 1FX6A 2ZZ3A 3G1SA 2QMKA 3O6YX 2TMDA 1PBGA 3AHZA 4RW5A 1W3JA 1EIXA 1AH0A 4GI6A 4TV6A 3HGSA 2HNHA 5U4NA 3M44A 5JUVA 2XN2A 3UWQA 1RH9A 4HNOA 4CNNA 5TF0A 1RQHA 4DWSD 1UUQA 4NILA 1S3HA 2VC5A 1QAPA 3CB8A 3LD5A 4YVVA 4BJHA 4X2PA 3M0XA 2Y1HA 1EC7A 1EO7A 2XIOA 2YXGA 3NM1A 2QCCA 3L0NA 3CZKA 1U1HA 3ANVA 3ABRA 4R33A 3A5FA 3WQ5A 4A35A 2WJEA 5DX7A 2ZXDA 3IVTA 3VZXA 3IJ8A 4Q4MA 1XIEA 1WDSA 1DV7A 1W1B1 3E02A 5DXYA 2PB1A 3A5VA 5D2XA 3B9DA 1YQ2A 1ELSA 1RR2A 1JPDX 3SZ8A 4RE0A 1S5TA 2WCSA 4RDZA 4H7VA 1YW1A 3UJSA 4ZTXA 1WO2A 1JVNA 1I2RA 5C9XA 3GR4A 2PGEA 1T6MA 3LA4A 4ZZ9A 2QF7A 2VT0A 1B5TA 3M0JA 3UJ2A 4HZ6A 3UETA 1XGZA 4DM2A 3HURA 1E4NA 3H4XA 1DJHA 2IXVA 2FIQA 1KBBA 4S2CA 1HO4A 4DY1A 1FDYA 1ODUA 1LRNA 5A2AA 3STEA 2O7QA 3DGBA 4OUIA 2ZUMA 1E1EA 3AS1A 4C6CA 4O19A 3GFYA 5JBEA 2GVEA 5B80A 3Q2DA 3VIMA 4I6KA 4KGJA 2QXWA 2PLCA 5HMEA 3LI0A 3RM9A 2DEPA 4N02A 4IQLA 4P7OA 3W1RA 3W6LA 4QE4A 3AALA 3L66A 3TOPA 1FWSA 2FGLA 3UWYA 1CEOA 1E15A 5D30A 4QQ3A 1CCWB 4GHRA 5EMJA 4JNMA 3HPAA 1H11A 3RJXA 4ALDA 3O6AA 3QTPA 3FNDA 3PVFA 3MKVA 3A6OA 1B3ZA 3GYEA 2PP3A 5JIPA 2Z1VA 4MYXA 3SRDA 3DC0A 9XIAA 1BWVA 2ANUA 5LA1A 1PX4A 4UMBA 1EQPA 2Y5JA 4O28A 3UY7A 2V38A 4A6GA 2IUZA 1RK5A 3EX1A 5GPRA 3GXNA 2VFIA 1PJ9A 1W2VA 2YL6A 1F6PA 1XV8A 2ZUUA 4F48A 4DXVA 3O7UA 4AG0A 3P7YA 2DZUA 1L6WA 1KV8A 7TIMA 3P8JA 4GGBA 4L80A 4TR9A 1N82A 1EH9A 3B40A 3FVMA 4CUCA 1FWIC 1KFCA 2G5WA 1SVDA 3I3EA 3QRHA 1JPKA 3F4DA 4PN2A 5CPSA 4Q8VA 4GYJA 3W7DA 3HFYA 4JYFA 1KBKA 1DPMA 2WMKA 3U5UA 2I5IA 2WHJA 3S47A 3Q4DA 1OK6A 2ZA1A 3DEQA 1CNVA 4LUJA 1M1BA 2HDJA 4PTXA 4NY2A 3EXRA 3QH2A 4IP5A 3VYLA 1QT1A 3ENLA 5CZSA 4DBUA 3QR3A 3MSGA 3N14A 1UR0A 1HVXA 5BU9A 1F7BA 5HPOA 2J7CA 5EMMA 3SY1A 1BG9A 4WLCA 3WDJA 4HPGA 3QJAA 2D0FA 3IRDA 2WV8A 3HMJG 3M1ZA 4WQ6A 4JNYA 4XVEA 1SSGA 2KX9A 3IUIA 1H7OA 1J18A 4GXPA 2X1IA 3PWGA 4CNUA 2W67A 3W26A 3WQEA 3I4KA 3M0MA 2E9BA 3TTEA 3LRMA 1JGIA 3IIZA 3OLIA 4I3GA 5GNYA 5KITA 3OO2A 4NX0A 4NU7A 3W22A 1MZHA 4UQ9A 4IMEA 3UWVA 4ZMGA 4MPQA 2C0HA 1OK4A 2VC9A 3RG6A 3FX4A 1QPNA 4DPQA 3HB9A 3VIJA 4BI6A 2XSXA 4KIRA 3CIWA 3NAVA 3NEHA 3L68A 4ERIA 1KGXA 4JPGA 5CPQA 4ATLA 1KRBC 1E9LA 3MWCA 4KCUA 1VCFA 3FW6A 2QT3A 4NXSA 3UXIA 1SMDA 3N4FA 4NZJA 3B8IA 1FWCC 1EJUC 3E5PA 4EX4A 1N8FA 2VX4A 3F4CA 4QFUA 3TSMA 3R8HA 4MM1A 1TWDA 1QWKA 3SDOA 5A8MA 3G3DA 4JIQA 3SCSA 5AECA 1H63A 4DJFA 2DT1A 4HHPA 2E7FA 2QCNA 2Y8KA 1MW2A 5XINA 1UB3A 1RV8A 3QKZA 1F4HA 3V5OA 1L8NA 5CG7A 4F0RA 2QVHA 1S1RA 4MB5A 4UOQA 3U4FA 2DVXA 2Z7KA 4L61A 1UIOA 1SO4A 2Y5EA 4QBXA 1E0WA 3DHFA 1EUNA 2AGTA 3DFSA 4Z2KA 4CQBA 4JDYA 5TNVA 3MYOA 2ZXQA 4RE3A 5J5DA 1J6PA 1VFTA 4HHMA 3T0CA 1LUCA 3IGXA 1POKA 4HZ7A 3HN3A 3EOLA 2GDUA 3A9BA 2HQAA 5HATA 4MKNA 2BHYA 4EP8C 4ZVJA 1IZCA 3RX2A 4IJBA 3G1HA 3LG3A 3MI6A 2EPHA 5HQEA 3M6YA 3SCOA 3W27A 3NPVA 5CH9A 3VZYA 3KL5A 1UZHA 1RZMA 2P0IA 5HUOA 5LSMA 3TKFA 3MSYA 2VGFA 2WM1A 4IUOA 1OFOA 4NASA 1SR0A 1GGOA 3VU2A 3IVSA 2DZBA 3UYIA 1VJIA 1J2WA 2E9MA 2WKGA 1XX1A 3BAJA 2CLOA 3VAVA 3BG5A 2EBNA 1I6NA 1H7RA 2R94A 1SJAA 5DMLA 3VGEA 2CZVA 2OR2A 1E4LA 1R2RA 2GK1A 1O68A 2ZZ7A 5AC8A 5AVHA 3LU2A 3LTSA 2CCRA 4AZBA 1TQXA 5CPNA 2PDQA 1DXEA 4PMQA 5DANA 1KM0A 3VNYA 5D38A 3OODA 1AD1A 3ARXA 4NQ1A 3KS6A 2WOQA 1QW8A 1TJ0A 1R3WA 3GNNA 3M7SA 2PWUA 1T99A 1FWJC 3VM5A 1P48A 3V1PA 3UP8A 3KRBA 3KLKA 4Q8UA 2CHNA 5BMXA 4XKMA 4D9PA 4QLLA 4N9DA 4F3HA 5K4ZA 3UW6A 4KEVA 7REQA 2AGKA 3P3BA 1H51A 3DFHA 1XFBA 4RX0A 3EXTA 1BVNP 3W2MA 5HWMA 3ATZA 2PRHA 5F2LA 4EPKA 2XVNA 4DB7A 4BEUA 3COTA 4PRTA 3WUFA 5ABHA 4MMWA 3TNBA 1H61A 2OELA 4LTSA 1ADOA 4Y8FA 2VWSA 3FN9A 3RO8A 4BWLA 1KD0A 1JCYA 4G7EA 1N7KA 5KZEA 1TWZA 5SWUA 3A9IA 3UR5A 2XVLA 3GNOA 4IPPA 4IMAA 3ZMRA 3LCIA 2FYMA 3A47A 5FESA 3E0VA 2GQ3A 3V75A 4UFMA 2YLAA 1KGUA 3W37A 3LBCA 4KS0A 4MUZA 4AZHA 5D32A 1NAL1 3TSBA 1AQHA 4NT0A 4I90A 4HNUA 4C6NA 5M3WA 4H01A 3TDFA 4PMDA 5CPOA 1XPGA 2P8CA 2QLYA 2X1RA 1ONWA 3M9YA 4ZSTA 2WJDA 4IPLA 2CESA 3E2SA 3SI9A 4IMFA 1A50A 1O1HA 2B31A 1NF0A 2WHKA 5EFFA 1WDWA 1OYCA 4ES4A 1AW5A 3W1UA 1Q13A 4J4KA 2Y70A 3P8IA 2ZRWA 1EC9A 4EKJA 1GJPA 3VD4A 4N42A 2RDUA 1P5BA 3W7RA 3PK7A 4MKVA 1OY0A 1REQA 4W85A 4K3ZA 1PHWA 3GRIA 3EA3A 3VIIA 2DT0A 2D20A 3P6LA 1H09A 3T40A 3SQLA 2X0HA 2GGGA 3C2FA 1LQAA 4KWUA 2IQTA 1Y7VA 2WVSA 1BF2A 1FUYA 3VC5A 2WNWA 2YA0A 3E38A 3AOFA 3BV7A 5F1UA 2WZHA 2V5KA 1T7LA 4RZ5A 2WC4A 1XG3A 3PFRA 4TVUA 4GISA 3T4CA 4AZGA 3GTFA 3DX5A 2IPGA 2ZYFA 4LUYA 1JAKA 2PBOA 3H4WA 3GY1A 2VX5A 3L4VA 3W73A 1GNXA 7PTDA 3AYRA 2J7GA 2DZPA 3GSMA 3LN3A 2FKPA 1PV8A 4MFDA 2E09A 3FHAA 2Y85A 3EMCA 2KAUC 3WELA 3BLEA 2ISVA 5E9AA 4BQ3A 3R10A 3CV1A 2RAGA 1NOWA 4LS2A 3TN3A 1V3JA 3M0HA 1UUMA 3KVKA 4K7YA 3NZ1A 2Y2WA 3GG1A 1Z8AA 1ZZMA 4ZE5A 5I07A 4MPKA 3S6DA 4WSJA 2I9UA 1S5VA 4CCDA 2DVUA 4LY8A 3H24A 3USBA 2INZA 4S3KA 4WSHA 1VPXA 3OHMB 3N1AA 4QM1A 1RP9A 3IS4A 5BOEA 3R0KA 3OZYA 4LFYA 4ZOBA 1PZ2A 1FWTA 2PDCA 3UY8A 3CMGA 4M56A 3QSTA 4RPQA 4H2HA 3S5NA 2YFOA 4Q4OA 2FGZA 5BXPA 1UP2A 1I4NA 3LCHA 1KBJA 4KEUA 1ZENA 2AMGA 4R85A 3GH4A 4MB3A 4V27A 3MWAA 2C13A 3UCDA 3ZT6A 2VC6A 4H8UA 3W2LA 5CC6A 5HK4A 1VYSX 2YL8A 3F4WA 4UCGA 3W02A 2YDSA 1OX4A 4PMXA 3T8QA 5IFPA 5HINA 3TAKA 2BY1A 1OBAA 4HU8A 4ZE4A 4I6VA 3BANA 3ORWA 2J7BA 4MDPA 5FAGA 3THQA 3T44A 4FOUA 3BJSA 1J0ZA 4B4HA 4JQ4A 2GUYA 2YR1A 1IWAA 4E8GA 1Q8AA 3BQ5A 4IPIA 3HTWA 3GO2A 3A4XA 4IQEA 1I9CB 3AHVA 4D6CA 4AD4A 3WCZA 3UJRA 1WB0A 3JVAA 2FMOA 4UCFA 1VRXA 1TIMA 2YGYA 1XINA 2F6XA 3KL0A 4RE2A 2GVYA 3E74A 4PUMA 1Q7MA 3HGRA 3BCFA 3O63A 4G1NA 4B9ZA 3BDKA 4QXIA 4DXXA 2BP1A 1ISZA 1Z3NA 1TZ7A 3CHCA 4H9ZA 3L21A 4Q22A 1KLZA 5A6BD 1OCQA 4H8VA 3BAKA 4BZYA 2JF7A 1G4SA 1E43A 3QV6A 1V8EA 4S3AA 4JY8A 3VOGA 1J10A 1L6SA 2E1DA 1GYNA 5EA9A 1PB0A 3W82A 3NZPA 1R3TA 3HBLA 2V5JA 4XTDA 1XLFA 4W5UA 5KTLA 1F4AA 2PTWA 3VX1A 3BLPX 3AUJA 1P1XA 3EWZA 3MUZ1 3IUHA 1IGSA 4I5RA 2FDSA 3GVVA 4OZOA 1C90A 2EJ1A 4GYFA 2YL5A 3GAYA 2V30A 3GYCA 4WJ8A 1TTJA 2HS6A 1UZ4A 2Y7DA 3C2VA 3VXGA 4J3VA 3W2JA 4C6BA 3ZVHB 3V1HA 4H7CA 1YEYA 2JK2A 3NPUA 1FCQA 1OC5A 1VEMA 3G8RA 2GSEA 3VKJA 1AUSL 1A47A 2NQLA 4C7GA 1ZJAA 3N19B 2Z00A 1VBHA 3O6CA 3C0SA 1R9ZA 3MCMA 4X2RA 4I5XA 5C6MA 3BSMA 4Q4PA 5RUBA 4JQAA 2V2CA 2YIHA 4O8RA 2Y4SA 3DFPA 3E9AA 3FJ4A 5HJLA 8A3HA 4M24A 4LVDA 1KW1A 3WH6A 2WSQA 4R53A 1HFBA 1OFBA 3WK2A 2NV1A 4AD3A 2VRKA 4XWUA 1TB3A 4QQUA 3KXQA 3R11A 5G4EA 1EPXA 5A6MA 4JFWA 2VM8A 4WVXA 3H2EA 1ECEA 2DSVA 3PZQA 3UXLA 4GFSA 1FA2A 1W2PA 4ACZA 1BTMA 3H2CA 1PZ3A 3KP1A 2GQAA 3EX2A 1W3KA 4J7RA 2A1YA 4J3WA 1GZGA 2CLMA 4DYKA 2NQZA 5M03A 1AZ2A 3BAYA 1Q3NA 3G0XA 3F4NA 1SMAA 1QI3A 2ZA2A 5I03A 4NIRA 7A3HA 1EHNA 1F74A 4MAVA 4IZGA 3AIUA 1Q5MA 3QZAA 3SCUA 1J11A 3LOTA 4AYSA 4B3KA 1CLVA 4LH8A 3CV6A 4JTAA 3DFQA 4BI7A 3N2CA 2D23A 1CB2A 4R7JA 3LCLA 3E2RA 1UA3A 4C6IA 2AAMA 2D24A 3VX0A 4J2PA 3YPIA 3DG7A 4BHYA 4CQCA 4Z2JA 3M07A 1UBPC 3B4UA 4MNJA 1DJXA 4HOXA 1FWBC 4WOQA 3WLTA 3MP5A 3OZPA 5KINA 1Z42A 4X3ZA 4W93A 3FVDA 3W2NA 2OZ3A 1ISWA 1T40A 1KRMA 4LW7A 4D6JA 4GH1A 1WUEA 5CPMA 1NP2A 4P7QA 2CXEA 3GK0A 3VIOA 5LA2A 3R58A 4PB5A 2HRWA 2J6XA 3IIPA 4DPPA 1VZWA 4IG2B 5HMDA 4U3CA 2ZADA 6A3HA 5C7VA 3VD3A 5C2GA 1K03A 4O54A 3P62A 1V93A 3ZR4A 1A3HA 1DOSA 3SBFA 1WUFA 2PODA 3L7RA 1UWIA 2ATSA 4ML4A 1PCWA 3MJYA 2L5HA 2QIWA 3S5ZA 3S4TA 2XN1A 3W1QA 1OD0A 4O57A 3G1RA 1HGYA 2ATMA 4ZL1A 3UNTA 4HMEA 1UD3A 5T91A 4M7TA 2V6AA 3XIMA 2OKTA 7XIMA 3BCDA 1YXYA 3QFEA 3EZ4A 3BZGA 1EGZA 1XM3A 1TPFA 4ZTYA 3L2MA 1LP6A 3BLOA 4J28A 2CU0A 4MLRA 1XLEA 4NI3A 5D4YA 1FVPA 4L9YA 5F1VA 1WZKA 3IK4A 4DO7A 2X2GA 4IPJA 3TLLA 1WOAA 1OT1A 1Q85A 3SW6A 2J27A 3BC9A 4IP4A 1EIBA 3UWUA 2D69A 2QUNA 2CYGA 3FJLA 2PU0A 3LDVA 5I00A 4DF2A 3EGJA 3G2GA 3W29A 3PPHA 3KS5A 4XTIA 2QJJA 3WQOA 2IQDA 5DCEA 3QOMA 2IKHA 1M68A 4P2VA 3FIGA 2TAAA 4AF0B 1FXPA 4M6VA 1XG4A 3DKLA 2Z1KA 3OLGA 3WF0A 5FL1A 4QJ5B 3QVQA 3RX3A 3UD6A 4HB7A 3PPGA 3ZLFA 1KBIA 2OKOA 2OYLA 5JBFA 1X98A 2CBJA 3UFYA 3KBNA 2A2IA 2QUVA 5FJRA 1PX8A 1Q6EA 2PZNA 1GG0A 2DT3A 4TV5A 3MANA 1KXVA 2QKFA 5DMYA 2V82A 3I3DA 1NWSA 3PUGA 2SFPA 1MQRA 2QPUA 4LV9A 3AC0A 1PPIA 2BG5A 4K6AA 1BTCA 1TVNA 4MNMA 1Q6OA 1ZCCA 2WMIB 1I1WA 1W31A 1VQTA 4B9YA 3A3XA 1JULA 2DFAA 1Q4WA 1Q8JA 1R87A 2G37A 3AJ7A 2DY3A 4G9PA 5ABFB 4JYEA 1RLCL 4G6CA 3UJEA 5IBXC 3CIXA 3EDKA 1DWHM 1K02A 5AHLA 5F2MA 3UERA 2OTDA 4X0VA 5A6KA 2VCAA 3UWWA 1R3YA 1GQLA 3P0XA 3AIVA 4EF8A 3GH7A 4AC7C 3A3WA 3A64A 2VMFA 3KRZA 1GQJA 2JALA 1RA0A 3WBEA 2OYMA 4FO4A 2V2HA 4A05A 4JX6A 3SFKA 1KFJA 3BTNA 5JXQA 3PN8A 4IF2A 2PDUA 3TW9A 3DYMA 2FVMA 4LANA 1DQWA 2R9RA 4X61A 1IEQA 2VO5A 3F5KA 1K6AA 5D33A 2ESCA 3EDFA 2J7EA 1IGWA 3U6WA 2FMNA 4ZFMA 1JZ3A 1BXCA 1XKYA 3G22A 3IGSA 4HZ8A 6REQB 4C1KA 1E9IA 3H54A 4OOUA 2W66A 2P3ZA 4J3XA 1LBFA 3ZYZA 5IDIA 1VEPA 4OUEA 3AZSA 2BHUA 3BURA 3GU9A 3U57A 4LEFA 1WZAA 3L4XA 4WGXA 4LBSA 2Z6IA 2RGMA 1EXPA 3LHUA 3WDHA 1JL8A 1S2WA 3J7HA 5H6HA 2PAJA 2BFGA 4NJGA 2W62A 3GKAA 4QJ4B 2HBVA 1QOXA 2FTYA 2Y8UA 3CAKA 5HA7A 2Z7GA 4E2DA 4O17A 3RITA 4E3VA 1W3NA 3ABSA 4HNVA 2OG9A 1NJJA 2BSLA 2GSJA 2HJPA 1BF6A 2ZDRA 3B97A 3GIPA 4H2CA 5E6ZA 3P5YA 1QR7A 3GTHA 2FFCA 3QBUA 4IMGA 3ES7A 3MPGA 3MUXA 1WKDA 3G24A 1V51A 1EPVA 4U2YA 2ZC1A 1RAKA 2BXVA 2VZTA 4NP7A 2XWEA 2Q71A 1Z48A 2IPWA 1UC5A 2DSZA 3ALFA 4U4MA 1EA0A 5GJPA 3AHXA 2ZRVA 5E0CA 4Q8TA 2AL2B 4RNJA 1XLGA 3OTRA 3ZS4A 4AU0A 1OF8A 3NSNA 3DG6A 2QW5A 3GNRA 5I23A 3E0WA 2G50A 2OLSA 4S2BA 4NNAA 3SRFA 5AYBA 3LCGA 2DP3A 2VELA 3WIJA 2CZDA 1TO3A 4O18A 3W1PA 1HVQA 3BARA 3TYUA 1LQ0A 4O15A 3TJLA 4C6OA 2ZICA 1B1YA 4HPJA 5AYYA 3NYZA 3S46A 4AFYA 4WEVX 1IT7A 3G1AA 4OKDA 4CD7A 4LJ3A 5LNUA 3BVJA 3URAA 3CH0A 1X6LA 5TIMA 2EKCA 4PULA 4W4QA 4KWOA 4LNYA 3TTQA 1EYEA 4L5ZA 2OWWA 3SQMA 3QFWA 3W9ZA 3FEQA 1TX2A 1UQZA 3DBPA 1F61A 1HJVA 4EIVA 1JZ8A 2HISA 4AVNA 3GNXA 3WLQA 4NG3A 4LVAA 4FSAA 3NOEA 4S38A 3UXDA 3L9CA 3O1NA 1K6WA 4Z1BA 1OCNA 4UTIA 2X1TA 5GJMA 3NSMA 4PA8A 3NL6A 1Q4NX 3BV4A 3LPFA 3WD1A 2VEFA 9XIMA 3UVIA 2PWHA 3FJNA 1KA9F 2J74A 5A6BA 3E12A 2YXXA 1XR2A 1ITXA 3NOYA 3H2OA 2VHLA 3NZRA 1UMYA 3M41A 4J3TA 1U5VA 1LRTA 4D6HA 5KSWA 1XIDA 1HW6A 3FYPA 1N2VA 3IV8A 3G3MA 1E40A 1JZ4A 2DPEA 4Y9OA 1GVQA 4S3BA 4DLFA 2RH9A 3TSDA 4GMEA 3R8GA 3VOJA 4CD6A 4M6PA 3WJWA 4BS0A 2ZZ2A 3K8KA 2FPYA 4YIWA 4U5KA 2E1WA 5D2VA 1Q6QA 3T2QA 1MUCA 3ZSTA 3OVQA 4CVWA 5LYRA 3M0LA 3VKCA 5AFDA 3I68A 3G18A 5G4HC 4GVFA 1A0DA 2V81A 2NUYA 3AXMA 4NJHA 1K77A 4JD4A 2VX7A 2E77A 1RBAA 2PRMA 1XFCA 3RXZA 2BWGA 1WDDA 1E1CA 1GOIA 1A5SA 1AG1O 3CQKA 3M5ZA 3CPRA 3CZGA 4RKAA 1OG0A 2XIJA 1X6UA 3KDNA 1M7XA 1OSEA 3NTYA 4D6DA 3STCA 4CN6A 3RF9A 3PZGA 5HNTA 1XSKA 3AIEA 1E6NA 4G7FA 9CGTA 3UZJA 5CBJA 3GXTA 1EDQA 3IJ9A 1TA3B 1KNWA 3GTNA 3MHGA 4HD5A 3RILA 4AC1X 1OGSA 1W6TA 5CC7A 1GHRA 3XINA 3STFA 1EJTC 3ZFHA 4GXMA 4NSBA 1Z69A 1XGEA 4LVFA 2NW0A 2OWCA 4S23A 2BBFA 1L6YA 2ABBA 3WMBA 1K7EA 1MXDA 4GX8A 4ZBCA 3KBWA 3VDBA 3IJIA 3EDJA 4UFHA 3G1YA 1QPOA 5C9UA 3S5OA 4LAKA 4UB9A 4A2SA 4EOUA 5I3FA 4ZFCA 5BRQA 3NQEA 4ROPA 3UXAA 1Q6DA 4DUOA 1CI1A 2JEQA 3FJ6A 1J0KA 4AUBA 3WLSA 1Q7QA 3LY0A 4JBRA 2D1ZA 2ZA3A 3S2MA 3CAQA 4D71A 4GUGA 4CCZA 3CQ0A 4ZXLA 2PWGA 4GBDA 1B4KA 4X60A 4MWAD 5BZAA 5FEPA 3W75A 4A8RA 2RJGA 3E49A 2TSYA 4O12A 4B3LA 1ZGDA 1KRCC 3CTTA 3T07A 4CQDA 4FPSA 4UTJA 2XFYA 5FEWA 2PMQA 3ZQ9A 4AHQA 2VL4A 3TXVA 2JGQA 2XJ7A 5BW6A 4HA1A 4JEJA 2ON3A 1NTHA 1W5NA 2CBIA 1PKMA 3WQWA 4ZEPA 5EBAA 3VCRA 2WWDA 3VGFA 3M0YA 4MAZA 2D0HA 3ARSA 2C91A 2VXNA 2WO5A 5E5CA 4V33A 1C7TA 3AIQA 2A85A 2EQDA 3VPLA 3LB0A 3R7MA 3ZIZA 4HYRA 1LG2A 3B03A 1W9VA 2D2GA 3NO3A 1TTPA 2IPFA 4LAOA 2DW6A 1PX3A 1US0A 3WH7A 2DH2A 1LBLA 3VMOA 4QG6A 3L4UA 2Q8LA 5C2CA 4CGTA 4O14A 3VI2A 5FF0A 3TLQA 4EK7A 2P53A 4DI8A 5A6JA 2BVYA 1YMYA 1YTKA 4H9YA 2FVKA 5CCZA 2PF8A 4CQ8A 1VR6A 3PM6A 5DEZA 3O16A 3W07A 3CS2A 4GVGA 4INFA 1VYPX 1VEOA 1XL9A 1I2NA 1UIPA 1GQNA 3AISA 3PTMA 2X8RA 3S9ZA 3RPTA 4KGLA 4NNBA 2VNCA 4JTSA 2TODA 3WQFA 1OFPA 1V0NA 3POHA 4YYCA 5I2UA 4BF9A 1OYAA 3EB3A 3QY6A 3H22A 3STPA 2NT0A 1GPFA 4FNRA 3WNPA 2G0WA 3MMWA 1U30A 1QU4A 1I2OA 4YVXA 1QJWA 3R25A 1BLIA 3PULA 4MB4A 1TE1A 4HK5A 1SJDA 1SZEA 5I06A 3TMQA 2P50A 1PYMA 4O52A 2WMHA 1WPCA 3DGRA 3NR0A 3NZGA 3LSCA 5BWAA 2PDYA 3RO6A 3CHEA 2XISA 1DWAM 4E4UA 1TSIA 2YB1A 4UTLA 3TC3A 3GR8A 1T8QA 2PDMA 2XH0A 4AZCB 4WOZA 5C8BB 1MXSA 2B7NA 5LGXA 3GDLA 1AFSA 1GVFA 2PD5A 3WMCA 3NQDA 5TBOA 1Q6FA 4QDPA 4AAJA 2XGBA 2PURA 5BNKA 1SZGA 3I65A 4Q6XA 1G6CA 1J0JA 4E4FA 4Q4RA 1PCKA 3FHQA 3KHDA 4FHAA 1UZDA 3OVRA 4DHGA 1CGYA 4RV8A 3K1GA 3IEBA 2OSWA 3HIJA 4WSKA 5J8LA 3CASA 2Y63A 2E8ZA 3VNLA 2PP1A 3BLLA 1VBUA 1V6UA 4YTQA 4GD0A 1E6RA 4DUVA 4FF7A 1ISXA 1Q66A 9RUBA 3KTSA 1JQXA 1JCJA 2YL9A 4Y9MA 3S3GA 4A3QA 4B4FA 1EEXA 2VGIA 2H3DA 3UVAA 2O9PA 3DENA 4KIEA 3C6CA 3DBNA 1BKSA 1U1UA 3OA3A 4W89A 3B8SA 3NQVA 3ZLGA 3WNLA 1NU5A 3NJ3A 3B4YA 1CXFA 3RMEA 4ZB0A 3OHIA 4M6QA 4W87A 3BAIA 3LSBA 4JFSA 2CKSA 4M8UA 4P7NA 5HXMA 3SGZA 1SFSA 1R7AA 1I0BA 1GQKA 1DORA 5DY3A 1NOUA 3R0DA 5HR7A 1E4MM 5D9PA 4OHQA 1ZRQA 2A6NA 4RXGA 1CLXA 2ZFAA 4LRTA 1LDCA 3DN5A 3UGVA 3M5VA 2YCEA 3PF3A 2AQVA 1G0CA 2EPMX 2GDQA 2ZVRA 4FXSA 2OMAA 1PKLA 3S2CA 2A3BA 3OVGA 3OQEA 2PDPA 2X0YA 2A4AA 4N6FA 2F2KA 1HKKA 1KM3A 3MVIA 3LLXA 3W1TA 2GUUA 1D7KA 1EBGA 2PF0A 1A4MA 1UR1A 4YPJA 3U4AA 3VNKA 2G96A 3SGUA 1OYBA 2GGJA 2P76A 4XAPA 4PFMA 4Q6JA 1XYAA 3UPBA 1JUKA 4L56A 1QATA 4GUJA 1VJZA 4C6EA 3L4YA 2X16A 5CBIA 3GC4A 5CPLA 2G41A 2WZMA 3SUSA 2QYGA 3HOJA 2QCGA 5AC4A 3GX9A 3VDCA 3MUIA 1R9YA 1LLWA 1KR1A 1DIEA 3R8RA 2PEVA 2VR5A 1GT8A 3U48A 2P1FA 2F2HA 3GDKA 4DZAA 2XVKA 4LT9A 1VFUA 3LX9A 3UF9A 2Z24A 2F8QA 3GXMA 4DAFA 4PH6A 3H2FA 1JNEA 4PUDA 4M29A 1EZWA 3W81A 1W1IE 5LNWA 2J24A 1XLLA 2EXOA 3R43A 1RPXA 2XZ7A 1V08A 3TOYA 1JDDA 1QNVA 1K4HA 2I9EA 2O7SA 3QW4B 3GW3A 4L4PA 2GYIA 1IT8A 4HGXA 1GK8A 2W63A 3T7VA 4H00A 1LF1A 1H7XA 3JRKA 1KCZA 1TWSA 4HK6A 1TE6A 1TV8A 4KWWA 5A94A 4AWEA 2WSYA 2E68A 5E0FA 3MUCA 1RA5A 3IWPA 4OGZA 4RCXA 5M17A 4XUYA 5REQB 1AH4A 1FWGC 2GWNA 3CLMA 1W8SA 4LU0A 4PCFA 4I7VA 1AL7A 1R38A 4LYRA 4M81A 4IM4A 4C65A 3SM0A 4W7VA 2QQ6A 1J4EA 1PHQA 2AKMA 2CZEA 3L4ZA 5FJOA 2B7QA 4KMQA 3ARPA 5D9MA 1UROA 5FI8A 5DBTA 3EBVA 2NQJA 3L4TA 1TTQA 2GZXA 3W83A 4DF0A 3B0VC 4G56A 3E0FA 2GJNA 3SO7A 1DXIA 1NARA 3V5FA 5A8NA 2IKIA 1DHKA 2YDQA 3A4AA 3U2OA 2XVPA 3TYCA 2G4JA 1ZJIA 4JYDA 2XYLA 1TMLA 1M7OA 1MDRA 4DJDD 4REQB 3BQ6A 4X22A 2Y24A 1XLCA 1XLMA 1LYXA 3HO8A 4W8AA 3SN4A 3GUGA 1RCXB 4XQ6A 1NQ6A 2NQ9A 3RK8A 1J8VA 4KCTA 3WLHA 3S42A 4M0XA 2I17A 2B4GA 2G8ZA 2OODA 1AJ2A 1CXHA 3BLDA 4UNLA 3ZR6A 4IX0A 3RDKA 1POJA 3GVWA 3BMVA 5E09A 3WNNA 3R6IA 2IMRA 1P43A 4DN1A 4DWDA 2QCFA 2R82A 1CECA 1XLBA 4AZ7A 4CU8A 2WSPA 2QJMA 5LIXX 4B5XA 5AHMA 4Z08A 4LYPA 3IUDA 1LJYA 3SCPA 1A3XA 3AXKA 3GHTA 2WLZA 2VEGA 1EO5A 1XSJA 2REQB 2OPJA 1ZS2A 1NY1A 4IG2A 1F07A 3MCNA 1WDRA 1LLOA 1JF5A 1WZLA 1XLIA 3VOHA 3QGKC 1UP3A 2NVAA 2QAPA 4Y6GA 4GO8A 4L65A 3L2LA 5I7GA 4HPHA 1X96A 2VDHA 1NDVA 8RUCA 1XD0A 3TAOA 4AD5A 1VBGA 4FNSA 2WKJA 3A4WA 3QPEA 4IIFA 1QTWA 1OVDA 4M51A 3H12A