3QY7A

Crystal structures of ywqe from bacillus subtilis and cpsb from streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
247
structure length
247
Chain Sequence
b'MIDIHCHILPAMDDGAGDSADSIEMARAAVRQGIRTIIATPHHNNGVYKNEPAAVREAADQLNKRLIKEDIPLHVLPGQEIRIYGEVEQDLAKRQLLSLNDTKYILIEFPFDHVPRYAEQLFYDLQLKGYIPVIAHPERNREIRENPSLLYHLVEKGAASQITSGSLAGIFGKQLKAFSLRLVEANLIHFVASDAHNVKTRNFHTQEALYVLEKEFGSELPYMLTENAELLLRNQTIFRQPPQPVKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase YwqE
publication title Crystal structures of YwqE from Bacillus subtilis and CpsB from Streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 83
structure length 247
sequence length 247
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2011-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3qy7A00
3E0FA 2D2HA 1GKRA 1V51A 2VC7A 1RJQA 3LSCA 4EPEC 2WJDA 4C6KA 2VM8A 3ITCA 3ISIX 1UIOA 3MPGA 1EJRC 3B0YA 1EJSC 1FWHC 3GTFA 4PBFA 4PCNA 1O12A 4CQBA 1V7AA 4GOAA 2GZXA 5HMEA 2Q09A 1PO9A 4H9UA 4XAYA 3ID7A 4M51A 4IF2A 1E9YB 4GXWA 4H9YA 4F0SA 2AMXA 2Z00A 1YRRA 4NI8A 4KESA 3GTXA 3HTWA 3KM8A 3B40A 3HPAA 4V1XA 1I0BA 1P6BA 1NDZA 4KEUA 4QS5A 1KRMA 3UPMA 3GU1A 3FEQA 4H9XA 3FDKA 3MTWA 3AU6A 3K2GA 2E1WA 4C6OA 4XD3A 4IH3A 2QT3A 4RDVA 2E25A 1RK5A 3AU2A 2CZVA 4LAKA 1GKPA 3WYZA 3GTIA 3MSRA 4ICMA 3A3WA 2VHLA 2O4MA 4XAGA 4J5NA 2R1NA 3IRSA 1XRFA 2ADAA 3S2NA 3NURA 4KIRA 3LSBA 3ORWA 2WJFA 2OQLA 4XAZA 2R1PA 4XD4A 3GUWA 1P1MA 1YBQB 3O7UA 4IFKB 4LEFA 3LU2A 4GBDA 1FWEC 2QVNA 1A5LC 3F2BA 2WJEA 2FTYA 3CAKA 2HPIA 2AQVA 4C65A 4KETA 4GZ7A 3MVTA 4HK5A 3T81A 3F4DA 1A5NC 4RDYA 3SO7A 2D2GA 3PNZA 5HMDA 4C60A 1NDWA 4LCSA 2Z4GA 3QY8A 4J2MA 4KEVA 5CH9A 4H01A 4PCPA 4R88A 4YIWA 1ONXA 3WZ0E 1V79A 1HZYA 4DO7A 1FWIC 1FWDC 4IFRA 3GG7A 3DC8A 4XD5A 4NG3A 1XGEA 3D6NA 3MJMA 2OODA 4GK8A 1YMYA 3MDUA 2KAUC 4IFKA 2OGJA 4C6CA 1EJUC 2Z27A 1RAKA 5FSEC 3ICJA 3T1GA 3UF9A 4C6BA 1K70A 3SFWA 1M65A 1WXYA 1P6CA 4INFA 1R9ZA 3O0FA 1ADDA 3S4TA 1EJXC 4DZHA 1YNYA 2FVMA 4C5YA 3QGKC 3C86A 3QY7A 4F0RA 4ZSUA 4IGMA 2OB3A 1DPMA 4G2DA 4C5ZA 2Q01A 4ERIA 3K4WA 4AC7C 4QTGA 3GRIA 3RCMA 4WGXA 1IE7C 3UR5A 1R9YA 4H00A 4H9MA 2I5GA 2D2JA 3G77A 3T8LA 3IJ6A 4UB9A 3NEHA 1EYWA 2YB4A 4LALA 1M7JA 3EGJA 4GYFA 4QS6A 3IGHX 4DLFA 1NFGA 4B91A 1EF2A 4WHBA 1VFLA 4E3TA 4LCRA 2ZC1A 1S3TC 4HK7A 4UBPC 1KCXA 3WMLA 1FWCC 1WXZA 1RA0A 1UIPA 2QS8A 1NDYA 3FDGA 2W9MA 3QY6A 3V7PA 3MKVA 4C6MA 2DVUA 4TQTA 2R1KA 2Z2BA 3PBMA 1A5MC 3RN6A 4IG2B 3TN6A 1ONWA 4GY7A 3F2DA 3OQEA 2GWGA 4CNSA 3N2CA 2EG8A 3S2MA 2GWNA 1A4LA 1NDVA 1POKA 3LNPA 3LA4A 2EG6A 3TN4A 2P53A 3LGGA 3E3HA 3OVGA 3S2LA 3GIQA 1R9XA 2DVXA 4CEXC 2PLMA 2I9UA 4GY0A 4B3ZA 1FWAC 3OODA 1V4YA 4C6JA 2Z24A 4BJHA 2G3FA 2YB1A 4J35A 1J6PA 2Z26A 2F6KA 1RA5A 1QW7A 2BB0A 2GOKA 1FWJC 2P50A 2VUNA 2XIOA 2Z29A 1KRAC 1PB0A 4H9TA 4GX9A 3URBA 4IG2A 4PBEA 4IFOA 4IQJA 4LAOA 4LFYA 4C6QA 4DZIA 3A4JA 4H9ZA 3IACA 3F2CA 2UBPC 1V77A 1YBQA 2R1LA 1A5OC 3K5XA 3E38A 4I6VA 3EWDA 4GC3A 4LH8A 3TN3A 4CNTA 5FSDC 4CNUA 4F0LA 1J6OA 2Z2AA 3E2VA 3TN5A 2FTWA 3LGDA 2EG7A 2HPMA 4G7EB 5G4HC 1KRCC 2O4QA 2WM1A 2Z25A 4P5UA 4DLMA 4RE0A 2ANUA 3MDWA 3URAA 4D8LA 4ZSTA 1FKWA 1A4MA 4LCQA 4KF1A 5HMFA 3B0XA 3DCPA 3CS2A 3GU2A 4GX8A 3AUOA 4LANA 1EJWC 4ERGA 3OU8A 3HM7A 2A3LA 4RDZA 4C6FA 2DVTA 4L6DA 3DUGA 1YIXA 4Z42C 1I0DA 4L9XA 4BKNA 4B92A 4CEUC 2OOFA 4KEZA 3R0DA 4G7EA 1FWGC 4C6IA 4EPKA 3PNUA 1M68A 4HA0A 1EJVC 2RAGA 1K6WA 4EP8C 1XWYA 1ITUA 2BGNE 4RDWA 4RZBA 1JGMA 1A5KC 1FWFC 2HNHA 3UR2A 3QGAC 2HBXA 2PGRA 1KRBC 3GTHA 3PANA 4LAMA 5E5CA 1XRTA 2Z28A 3RYSA 4V1YA 4CQCA 4QSFA 4KERA 1ITQA 1GKQA 2PAJA 3UBPC 1PSCA 1ZZMA 2YXOA 4H9VA 4WVXA 1E9ZB 4C6DA 3IARA 2PUZA 1EZ2A 1O5RA 4AQLA 2IMRA 1POJA 2YZ5A 2Z7GA 4DYKA 4HJWA 3TNBA 4C6PA 4EPBC 4XD6A 4C6EA 1UMLA 4R85A 1RK6A 1UBPC 1BF6A 3F4CA 4HK6A 4MUPA 3URQA 3EWCA 4NP7A 2GSEA 3S2JA 2HQAA 4ERAA 3PAOA 5AKQA 5A6TC 4DI9A 1K1DA 4KQNA 1J5SA 4R7WA 1RJRA 1J79A 2UZ9A 4DNMA 1FWBC 3IV8A 3LY0A 4C6NA 3E74A 3URNA 4EPDC 4QROA 4BY3A 1PTAA 2PGFA 2ICSA 4B90A 2HBVA 2R1MA 1RJPA 4IGNA 4C6LA 3NQBA 4XAFA 2FFIA 4DI8A 2QPXA 1W1IE 4QRNA 5LXXA 4DIAA 3BE7A 3LS9A 3IPWA 4CQDA 3MVIA 1FKXA 2VR2A 3RHGA 3GIPA 1QXLA 2Y1HA 4JOMA 2VC5A 3A3XA 4OFCA 2AQOA 3OJGA 3E0LA 3CJPA 1EJTC 4GY1A 2FVKA 3JZEA 4I6KA 3OOQA 4PE8A 3GU9A
chains in the Genus database with same CATH superfamily
3BAJA 3EDDA 1OX5A 3RM9A 3KS6A 4NJJA 1R30A 2VYOA 1V93A 2PDJA 3MUY1 1XLIA 2A7PA 3QW4B 1Q7QA 5IDZA 4FR6A 4GOAA 3QLLA 4YPJA 1NM9A 2Q09A 2REQA 3KBJA 1L6SA 1XGZA 1E4MM 1Z32X 3ALGA 3N2TA 1LBMA 3UERA 1E9YB 1JCMP 4CGTA 1FCVA 1A5CA 1KM6A 1Q8AA 1UKQA 3IK4A 1VFMA 2JBMA 4CQ8A 4IHCA 5I3DA 4FXJA 4H8NA 1JDAA 3R0UA 2BTMA 3ITTA 4GJ1A 4XD3A 5BRBA 1J0YA 5HWNA 3M0IA 1E4NA 2V2CA 3H2CA 3WYZA 2G0WA 1C9DA 3MP5A 4PTMA 3NSXA 1MQQA 1B4EA 4GACA 4GVFA 2O4MA 1C93A 1QWGA 1IXOA 3UG3A 3O9NA 4ZE5A 2RJGA 3GZ3A 2Y85A 3IS4A 4G7FA 1GJPA 5AB3A 1JZ4A 1RALA 3QV8A 4US5A 2PI6A 2YX0A 1S1PA 1A5LC 1TE6A 5KZ6A 3GNOA 3A22A 4B4FA 4AYGA 3W29A 2WMIA 3T81A 1NH6A 2HK1A 2VJXA 4H8VA 4M7TA 3S1UA 2YL6A 1GYNA 4HU4A 3U5YA 1ZY9A 1DJWA 2YPIA 2WB5A 3SEPA 4R88A 3B8VA 4AZGA 2C8NA 1CEOA 3FOKA 3DFSA 4ATDA 3RLHA 4PR4A 2H6RA 4RCXA 3SIZA 1Q4NX 4LYKA 2AKMA 3W6MA 3FHQA 3W71A 4TTUA 3PFMA 5I7GA 5EKYA 2XH4A 1H5YA 2ZX9A 3B0PA 1EZWA 4LV9A 2F38A 2NWSA 2C1GA 3ICJA 1KFCA 3HGJA 2ODOA 4XTDA 1K70A 5K3VA 4Q8MA 4CU7A 2A79A 4UQEA 2OZ0A 1WXYA 1TJ0A 1U83A 2ISFA 3QR3A 3UWUA 1KGUA 4MDOA 3I4EA 5D2YA 3TMLA 1ADSA 4K7VA 4QTGA 3PBVA 3VD9A 2V5JA 1FCQA 2ZZ4A 1EO7A 1W0MA 2PODA 4GCXA 3VIHA 1SU5A 1YX1A 3UCDA 3G77A 4A4AA 1SFJA 1M53A 4Q8OA 3O8AA 2AL2B 4LVFA 2H8ZA 1G5AA 4X3ZA 3WQVA 1SO5A 4GYFA 3AHXA 3WNMA 4JN8A 5M3WA 3R94A 1GVQA 2ONEA 1RVGA 2RJHA 3VK5A 2ZVIA 2ZE0A 1UIPA 1ITCA 3WLPA 4D71A 3S1WA 4M6VA 1ICPA 4Q8PA 3T6CA 4B2DD 3T0DA 4MAVA 2X0YA 3M43A 2Y5SA 4HMNA 5BOEA 1QCWA 3KLLA 5E0FA 2EG6A 2NQJA 2CIPA 2E9MA 4QE5A 2PLMA 1G7UA 1JAEA 1LL4A 4LOCA 3W86A 1B0IA 1V3KA 1ZBKA 1TUXA 3IUIA 4MSSA 5BU9A 4QE4A 2BB0A 1A50A 2GOKA 3CL8A 2KZHA 3CV2A 5EMLA 4QG6A 1QO5A 5F2LA 1ZQ5A 4L4MA 3FGCB 1WXJA 1NQ6A 1XI3A 4F2BA 1MZRA 1IYXA 3WH6A 4ROQA 5G2IA 5AN7A 1FUYA 2A3EA 3GDRA 3U4AA 4G5DA 4Y6GA 3VDCA 3FX4A 4N9DA 4PCTA 2F8QA 4WEVX 1BSLA 2FTWA 3LI1A 4DWSC 1BYDA 2PP1A 2INZA 3PPFA 2R6OA 3U57A 1EHAA 2OX4A 3WNKA 5XINA 4DLMA 2A7RA 1JZ2A 3UXLA 2SFPA 3QXBA 1E6ZA 4Y9OA 3ARSA 3NJ3A 5FJJA 1PPIA 5ABGA 1RLDA 4K8HA 3J7HA 2W79A 2P5NA 5D30A 1DKWA 2C14A 3H2OA 3WLTA 1JF5A 3ABQA 1UR3M 4PH6A 3CO4A 1YIXA 5CCZA 4BKNA 4XO7A 3WLOA 1EP3A 1KLZA 2HRWA 1ALDA 3SQMA 4JKMA 2I1OA 1HVQA 1B2YA 1GYLA 5DCDA 2P0IA 1VEPA 4AHQA 4ZEPA 2RAGA 3CZGA 3MCNA 3GC5A 1XLEA 3VIGA 1A5KC 3VGEA 7REQB 1B54A 3PUDA 4AD5A 1ICSA 1VHCA 2QR6A 3DH7A 4PUKA 4V1YA 3ECQA 3T07A 4PC8A 3WUBA 3N4EA 1S2WA 4DF0A 3OHIA 3C3UA 5F2GA 4JEQA 4NU7A 4A8RA 3W7KA 3WFAA 3A64A 3T8QA 4KCUA 4XSMA 5FEZA 4C6PA 1AD4A 3LQGA 4XD6A 1QATA 1M3UA 1ZBCA 3GDKA 2G3IA 3TSDA 4EXAA 5I3KA 1EQCA 1J5SA 1J79A 2UZ9A 4UR7A 2DDXA 1KCKA 1XH1A 3IV8A 1GZGA 4NJKA 2DPEA 4MB5A 4Q3MA 1YEYA 3VVGA 1VR6A 3H4GA 2HZGA 1LBLA 2WVTA 1TELA 3N2MA 2VR5A 3HFYA 2YA1A 4J7RA 4X0VA 1FQ0A 3N6HA 2YYTA 2ESCA 4RJEA 3OJGA 3MP3A 4ZQRA 3W4RA 4FIRA 2VO5A 5IFTA 1J0HA 4Z17A 1R3TA 4H6EA 4HBKA 3G0XA 2OYKA 3LSCA 4AZHA 1GHSA 1S5VA 1KXVA 3MPGA 2CFFA 1TTQA 1FWHC 2XN0A 2W91A 4JTFA 3N3TA 4P8WA 3DXIA 4PEEA 4L61A 4YTQA 3EOSA 3TFCA 3N11A 1DJZA 1F07A 2A3AA 1L2QA 3PZTA 4ICCX 4WY0A 1NWRA 3A4WA 3NQEA 1GVIA 2Y2WA 2ZRXA 4LUSA 2NQ9A 4KEUA 1TX0A 4HNUA 2WPBA 2FDMA 1W2VA 4H9XA 3GLCA 1MFVA 4OBTA 2B7QA 4AWEA 3MV01 1P0KA 4LAKA 5E70A 3P82A 2PDIA 3R10A 4GKLA 3G6MA 3P61A 4TO8A 1NJJA 3BLIA 1WZKA 1CX9A 1ZTVA 3UD6A 3IK2A 3SY1A 4XZBA 2JGQA 4PODA 2XG9A 5TAOA 5IRPA 1O1HA 3WLQA 4R7OA 4P7QA 3P74A 3NURA 3LSBA 1XIBA 1PHWA 4LY4A 4MLRA 1J12A 4MWAA 3NGFA 3QN3A 1TUFA 3MVTA 1EPVA 1YDYA 3IVUA 3SY5A 4O0ZA 2ZWZA 1DP0A 1ME9A 3RU8X 2PF8A 3VZYA 4IX0A 1UD3A 4E4UA 5J5DA 3FYYA 1EO5A 1S38A 4O1EA 1QK0A 3G2GA 3WMSA 2VNCA 3S1XA 3W1QA 1XGEA 2A3BA 1GZ1A 2GGEA 1QNQA 2G5WA 3WF4A 3IUHA 1Z6KA 3OLEA 3W1AA 1HKMA 1XCWA 2VGBA 5ECVA 3WLIA 2VENA 1J0KA 4ROPA 4G56A 3GHUA 3C0QA 3FJLA 3HFTA 3N13A 3TWBA 3EWUA 4YTUA 3U2CA 3G1RA 1BVNP 5HWJA 2PDWA 3BAWA 3T40A 3SUVA 4IPIA 3FK4A 1UBSA 3G1FA 5A8NA 4NXSA 3U7BA 4QCEA 2OB3A 3L68A 2CBVA 1NWUA 4CUCA 4Z2KA 1W3TA 1DTUA 4WGXA 2JFEX 1EH9A 2I16A 3TEVA 4BQ2A 3W84A 1ZALA 5LYRA 3SQSA 3GWQA 2J8TA 4O15A 4AB4A 1CPUA 4PL2A 1Q6CA 3MSGA 3UG4A 3TLQA 1SZFA 1DWFM 4H6RA 1EC8A 3TYBA 4IIDA 1DWJM 4GVGA 3SJNA 1XIGA 3WFLA 1RA0A 2P0OA 1BG4A 3ZS4A 3SZ8A 1I4NA 3RN6A 5K4ZA 3M0VA 2GWGA 2OOGA 3QW3A 1IEWA 1G4PA 1SJBA 2W66A 3CM4A 1UZ1A 1P0DA 5A8MA 3E3HA 2NUYA 3PHAA 3E0IA 3OTRA 2Z1SA 3G8EA 4TU1A 4ZO6A 1LLZA 2W61A 3TLLA 8CGTA 1DJGA 1U1JA 1FWJC 4JCLA 3SCQA 4OECA 4P2VA 3KCJA 1KQYA 3WDQA 2XFWA 1UWSA 2OZ3A 4O4WA 2YCEA 3M5YA 3R2GA 2XGIA 3VNYA 4O0QA 3JR2A 1YPFA 4H9ZA 2TRSA 4XISA 3K46A 1OIMA 1J93A 1FP9A 2NVDA 3UXIA 2PTDA 3UEQA 5DF0A 3GIYA 1UWRA 2C6QA 4G7EB 5A6MA 1W3JA 4PFMA 3TTYA 1VLWA 5FESA 2Z25A 2J77A 2WBKA 4UFKA 5CZSA 4UNIA 1DJYA 4K3ZA 3GKFA 3RILA 4E2DA 3LI0A 2XSXA 2E28A 2J78A 1EJWC 3MBFA 3RU6A 1H5VA 2ZVRA 4B9ZA 4PUJA 3E2QA 3G1VA 5FF0A 1EBHA 1T99A 3AXHA 5E09A 3P5YA 3E1F1 1JZ6A 4UTKA 1MW1A 3S9YA 2XN2A 3L67A 3G1XA 5DBTA 1TV7A 1V03A 4QSHA 4WZHA 1YDNA 3KXQA 2NX3A 2Z7KA 1EJVC 3OGVA 1XWYA 5LGZA 3CHDA 2BVYA 4W9TA 2OPJA 4WF7A 7ENLA 1P7TB 4QBXA 2CXGA 1HUVA 5HDRA 2J8FA 3ARPA 4MMWA 2EPHA 3ARWA 2D2OA 1XH0A 2E5DA 4WVXA 3IARA 3OBEA 4ZOEA 2WVUA 3UPWA 3NM3A 5FEWA 4C6EA 5HWMA 4D6JA 3F5JA 5LXEA 1ME8A 1X98A 1OG6A 2YL8A 4DI9A 3II1A 4UTTA 3UCCA 3E74A 3W23A 2PWHA 1P0BA 2ICSA 4B90A 5LIWX 2HBVA 2R1MA 4GNKB 4LRTA 3SR7A 3NQBA 1TPVA 3OLGA 2YCLB 3PPGA 4CQDA 4OIFA 2DEPA 1WYIA 1E0UA 1PEZA 5RUBA 4R9OA 3E2SA 4OFCA 4JGDA 5FKYA 4YVPA 2ZQ0A 3R0KA 3MKCA 1BSIA 1EGZA 2YDSA 1UP0A 3FKKA 4IICA 4M6PA 1UIOA 5A2CA 1W17A 1ZP3A 2G3MA 1IT8A 4RZ5A 4MKSA 2ZDRA 2E1DA 1KGXA 1UUOA 4M51A 2ZCGA 3CAQA 1NQKA 2BGQA 3TROA 2FTPA 4D72A 3BLFA 1I1XA 1V3JA 4LWWA 4BI5A 3W1MA 4MJMA 4XZMX 3W6LA 2FZMA 4E0CA 3W70A 1E40A 4MOZA 1WZMA 4BCEA 1Y8BA 2I17A 2AGKA 4KWOA 2DT1A 2GYIA 3W6YA 5H8UA 3OO2A 1HJSA 1C8QA 3L2MA 3SY8A 1CXEA 1XHGA 1RK5A 4JS3A 5M17A 4S23A 3NO3A 4IUGA 2VHLA 2QUUA 3KRZA 4DBEA 3TC6A 2VWSA 3ABXA 3AZTA 4KFNA 3I7RA 4I5XA 1XRFA 4FLSA 2QYGA 1DBTA 1UWTA 3AWNA 3F7JA 3APYA 3SIMA 3VNZA 1K9FA 2C79A 1JDFA 2VDIA 2VGIA 2WJEA 3T55A 3EDEA 2ACUA 1NWTA 1XLBA 2OCZA 3KOFA 1W1YA 2D2GA 1OABA 3EAUA 3DX5A 5CH9A 1QNPA 3AJ7A 1D3HA 4PCPA 4JHOA 5G4WA 4XV0A 5G1MA 9XIMA 2D3LA 1UR8A 1GGOA 3MC5A 4Z1BA 1F6YA 1DJNA 3KDNA 3CIWA 1CECA 2Z27A 1A5UA 1NF7A 3WDHA 4L7ZA 1SFLA 3AQUA 1CDGA 3QTPA 2V82A 1S2AA 3DBPA 2BX7A 4HMDA 2NZLA 4Z2GA 2J7EA 1ADDA 4LW7A 5BOFA 4KT2A 1FXPA 3G24A 1LG1A 3EWWA 1NARA 3W81A 1QDSA 2VL4A 3WD3A 3HJZA 4UQBA 1UKPA 4UIOA 3WNNA 2RDTA 1HKVA 3S46A 1KBIA 4IT1A 3NUKA 4HCLA 5KZDA 4JTAA 5EFFA 2XVKA 2VWTA 2JEPA 2QCNA 4D8AA 4LSBA 2JKAA 3EX6A 2WC7A 1VFSA 1NY1A 1FH9A 1VFLA 3CWHA 1S3TC 2ZADA 3WMLA 3SFKA 3TZFA 1DEDA 2W9MA 3QY6A 4S3EA 2FHFA 1DL3A 3P8JA 2Z2BA 4YNGA 2B31A 5H8MA 1Q6EA 5GPRA 4XUGA 1SW3A 3TYAA 3WJSA 2GWNA 3GZAA 2Z1XA 4QX4A 1EP2A 6TIMA 3AROA 1TV3A 1W1B1 1PYMA 3LERA 1JCXA 2W92A 4PUEA 4DEFA 4AEEA 2FZBA 2AAMA 1D7FA 1CIUA 3AIUA 4KWUA 3WLMA 4ADTA 4RNIA 1ELSA 1IGSA 4UTWA 4DX3A 1W31A 4OZOA 2CITA 1XPYA 2JIEA 3M1ZA 2OZ8A 1MNSA 4TXEA 2YJQA 1OFEA 4ES4A 1SYTA 2PP3A 3W9ZA 3HOJA 1KBBA 1GEQA 2R1LA 2CCRA 2I7GA 4DELA 3E38A 1JZ7A 1R47A 2FFCA 3FA5A 4MY9A 2Z2AA 1ZJHA 1F76A 3V18A 4AW7A 3BG5A 2GJRA 2W0UA 3LGDA 3WY1A 2EG7A 1XLDA 3P3BA 2BGSA 2H9AB 3E49A 3PTQA 3VA8A 5C2CA 4PTWA 4EAMA 1UZDA 2IQ0A 2TMDA 3VNDA 3W38A 4DZ5A 1WP6A 4LCQA 3AS2A 2BY1A 3B0XA 3BV7A 3P14A 2ZXQA 2X40A 7ODCA 4DWSB 3QV6A 4PTNA 5E1QA 4JKLA 1LOSA 1WBJA 3RR4A 3M0KA 1Z89A 3OU8A 3KX6A 1UCWA 4XAPA 4RW3A 4MWAC 5CG0A 1Q45A 2ZX8A 3CYVA 3MB9A 4POCA 1RPXA 1N8WA 4DJEC 5FCZA 1ZCOA 1K4HA 3PZMA 1BQGA 5BROA 1QPQA 1S2TA 3VIOA 3G5EA 1MEWA 2TODA 5DMNA 4E8DA 2HV5A 4YLWA 3PULA 2GL5A 1ZAHA 2E8YA 3RGTA 2PGRA 5HANA 1XRTA 4GO8A 4J9JA 5E93A 3HF3A 4FIQA 1S2VA 1F5ZA 1GKQA 4ORIA 5U7SA 2WQPA 1Q6LA 1FFQA 1B3XA 4URIA 4C6DA 1KTNA 4TX9A 1K02A 3K8LA 2FKPA 4MADA 3A9BA 1FX6A 3GY1A 2YZ5A 2WMFA 1AFSA 1XSJA 3S5NA 3AS3A 1E6NA 4GD0A 3WLSA 3WH7A 4ZL1A 2ZXDA 1ZS2A 4HIBA 1NTHA 4GQ0A 4N9BA 5IHSA 1XFBA 4B5SA 1TPEA 2VRJA 1HJUA 1FWBC 3W27A 5L6UA 2VFFA 2HS6A 4EPDC 3MZ2A 2RUSA 1YKWA 1RJPA 3NSNA 1EX1A 2X05A 4K7YA 3TH6A 1A0EA 3TJXA 3BE7A 2BVTA 3IPWA 3PG9A 4GNVA 1CW2A 5I5RA 1XQKA 1Z41A 4UCGA 4JYEA 3W73A 3DKJA 1QTWA 3NQCA 2XINA 2BMBA 4XUYA 2HEJA 3CYJA 2Q6ZA 1ADOA 3DHDA 3ZVIA 5JMUA 2WJDA 3LLDA 3LXAA 4RL3A 3AHYA 2OZTA 1TG7A 2WVVB 1HL8A 1W9VA 1L6FA 4PBFA 5AVHA 2DH3A 1QNOA 4LQ1A 5B7ZA 2YR1A 1OGBA 2GFTA 6CGTA 3BAIA 3GTXA 1UC5A 4YS1A 3K1GA 2A1YA 4DUVA 2WBGA 4DBWA 1V02E 3CUGA 2NXGA 1B5TA 1ISYA 3ARZA 4IMEA 3PN8A 4FLQA 1NP0A 1I6NA 4O52A 2GJNA 1PTDA 3MSRA 1X8CA 3WNOA 3V75A 4AC1X 4XAGA 2Y0FA 3NZRA 4NNCA 1W1ZA 4BF7A 3KZSA 5T91A 3EEGA 2WSYA 4YTTA 4PA8A 1LUCB 3AYVA 5HATA 4F3HA 1TCDA 1W5PA 4NZ5A 3R89A 1K8YA 1T5AA 1HKJA 4PMZA 3C3NA 4KETA 3A12A 3BOFA 1AW2A 5A2BA 1HVXA 4BQ5A 3LPGA 4G1NA 3F4DA 5D02A 3MZNA 3PNZA 1T8XA 3B8WA 3BSHA 3ZJ6A 1WKFA 4YIWA 1PDYA 2C3ZA 5A95A 2PFHA 1FWIC 3PJWA 3P5ZA 1D8WA 3GR8A 5FL0A 3LENA 1I2PA 3BZJA 3B4YA 5CPTA 4OVXA 1LJYA 5A69A 2D69A 4B2DA 2BY3A 3BW3A 3TKFA 5FSEC 1XG3A 3G3MA 2AQWA 1HP5A 1XF0A 3SCNA 3UA4A 3QMRA 4LVGA 2EF9A 3E96A 3BOXA 2GDQA 1UG6A 4JTUA 3IGXA 4DQWA 4XBSA 1PX8A 4HTBA 4OUEA 5REQA 1JYNA 2DV0A 4MY1A 5CGMA 1P0EA 4ERIA 3I65A 1O5QA 1K9DA 4AY7A 1IE7C 1VBJA 5EMJA 1ME7A 3DESA 4JNMA 1FBAA 1BWLA 1EYWA 3QMSA 4FP1A 1TZ9A 1FCUA 3EGJA 3VDAA 4OUIA 4UTTC 1QUMA 4R34A 1OX6A 2ISVA 2CBUA 2ACSA 1B4KA 3OZPA 1EXPA 2QS8A 1L2UA 1FRBA 2JF7A 4GFSA 4ZBCA 1CGVA 2FH6A 4OWGA 3IJ7A 3LCFA 1EA9C 1V0LA 4YXGA 1DYSA 3RPMA 3W7CA 3O16A 4QISA 1POKA 3LNPA 2PDUA 5C7HA 1IT0A 2PDQA 3GDLA 2C18A 4A05A 2AL2A 3GXPA 2WKLA 3S2LA 3WQCA 2QULA 3W7PA 1TWZA 2OEKA 3ZZ1A 4C6JA 4CD8A 3CPGA 2Z26A 2C15A 3QTGA 1E51A 4GUHA 3BLEA 5JVLA 1E1EA 3FSTA 4ATWA 4LNCA 3C2YA 5CZKA 3R13A 3HQPA 2C91A 3HIJA 4K39A 4FPSA 3WSUA 1QOPA 3TQKA 1BXBA 3HV9A 2NW0A 3BUVA 4FK9A 4DZIA 1Q6OA 1KD0A 1V77A 3FCPA 1ZSXA 3SUWA 3CBWA 1RUSA 2VEIA 2FMNA 1DXIA 3VNIA 2Y6ZA 2PSNA 4GO9A 3PZQA 4PUDA 5ABEA 3LDVA 2XWEA 1CLKA 3TN5A 3NA8A 4JTTA 5D9OA 3UFYA 3CO8A 4KIEA 2HVMA 2PDHA 4JIQA 1XLGA 4D8LA 4NY2A 4KF1A 3W25A 2WHKA 1HGWA 3N19B 4WR3A 3TIMA 4AEOA 3CS2A 2WQDA 3FGCA 5M1TA 3GXDA 4NUWA 4OHQA 3TMQA 3ZIZA 5LA1A 1O4UA 3L66A 1JIBA 4WDXA 3DKLA 2TYSA 1BRLB 3VKKA 2J7GA 2J25A 4HPGA 2QUMA 4CEUC 2OOFA 4G8TA 2ZXBA 3SCUA 3MHUA 4ECLA 4X9YA 2FPYA 3WLNA 1TPWA 1CLXA 1PZ0A 4OGZA 1PIGA 4FNQA 2YDAA 3DHUA 3N14A 1HJXA 3S9IA 1Q3NA 4RDWA 3NQ2A 5HULA 5E6ZA 2BLEA 2A6LA 5LNWA 2Z28A 4B5TA 2HSAA 3S1GA 5C6MA 3ZVHB 3W07A 1WE5A 5ECUA 4FX7A 1IIHA 3AXIA 3DIPA 4WSHA 4Q4RA 3WJYA 3EDFA 4GA8A 3QR0A 1DVJA 3DFYA 3TTSA 2D1ZA 1JL8A 4HU8A 4FOKA 4QFUA 6XIMA 2VX7A 3LRLA 4JTRA 4LGXA 3K4AA 4FX6M 3VYLA 4MFDA 7REQA 1RJRA 3NO1A 1GOQA 2YOCA 2E6DA 4HOZA 1KGWA 3TR9A 4JYDA 4PULA 3UWQA 1PTAA 4CNNA 3E0WA 3IJ8A 3ZYZA 4ZQCA 4YVVA 3LYEA 5AC4A 4C6LA 4AIOA 2FFIA 2YXGA 3IJDA 1D7KA 1XD0A 4PUNA 2CNCA 3EOLA 3PF3A 5I07A 1AD1A 1R3WA 2QPUA 2MNRA 3PBWA 4MKVA 4ZA0A 1DIKA 4PMXA 1ML1A 3FS2A 4QIUA 2Y24A 1J9YA 3LPOA 2FVKA 4N9CA 1EDTA 2J66A 3VD3A 4LYRA 1QNRA 2C71A 2BXZA 1V8EA 3RRXA 3KRUA 4UWMA 2J7HA 1IXNA 3EYPA 4HJFA 3NQVA 1H7OA 4O54A 4HYRA 1EJRC 4F4RA 3AIQA 1SFTA 4HQVA 1HJVA 3GTFA 4DPPA 4ENLA 4W88A 1O12A 4MG4A 4CQBA 2QCCA 2RGMA 4RV3A 3KBSA 4JTGA 3T0BA 2J8GA 4P7NA 3ANVA 3AOFA 4LAUA 4Z1DA 4UTWC 4X22A 1GOMA 2Q3RA 1JULA 3T78A 3N2OA 3CAVA 3VKCA 2UY4A 1KFBA 1W8SA 2X1SA 2QIWA 3E5PA 4JTEA 1Q2RA 1F8IA 3VC6A 3ARUA 2E1WA 3NM1A 3QQWA 1X1ZA 1ZJBA 1WX0A 1US0A 4Q6XA 1OWQA 3AXXA 3TA9A 2DJLA 4V15A 3QSRA 4Y7EA 1DIEA 1LRNA 3GH7A 4WD0A 3RLVA 3A3HA 1KB3A 2ADAA 3O05A 3TU9A 4N2YA 3W82A 2BZNA 1CCWB 4FS9A 4JIPA 3QR1A 2OQYA 3G1SA 4GIYA 2FLIA 4GZIA 3O7UA 2WWDA 5F4WA 1OF8A 2W27A 4UXDA 2QUTA 1HNYA 3TK7A 3FIGA 2FTYA 4X61A 4C65A 3WLHA 2INEA 2ISSA 4U3CA 2Y7EA 4J2MA 3STGA 3RDKA 3MI2A 1UOKA 3EA3A 1QW9A 1V3IA 1ONXA 1HZYA 4IMFA 2O56A 4DO7A 1V5XA 1LOQA 1MSSA 5KTLA 2G4JA 2NLYA 2Y70A 3W1PA 4K1WA 2QCHA 4HNCA 3OB8A 4F79A 4XZHA 5BZAA 2ZZ2A 4R53A 1KBLA 1HJQA 1XIHA 4UFIA 5HNTA 1RAKA 1E0XA 4AZ6A 3T1GA 3LCXA 2ZZ1A 3WL1A 3KDOA 4C90A 1E0VA 4D1JA 4FO4A 2JK2A 3SGZA 1T96A 1ISZA 4D2JA 1TJPA 1N82A 1R46A 3O0FA 5D09A 1A53A 2I9EA 2QF7A 4QLJA 4Q4OA 5M5DA 4WDWA 1JZ5A 1NFPA 1W1VA 4ZOBA 3KCOA 3PJXA 5E0CA 4H00A 1QBBA 4IQDA 1PX3A 3W53A 3T8LA 1H41A 1Z8AA 4HZ8A 4NF7A 2QCDB 3SCSA 2O0TA 2CLIA 5G5IA 3T7VA 4LALA 3PZNA 8XIMA 4JY8A 4ZE4A 4GNJA 2O9OA 3W88A 2EQDA 2DT3A 5DFAA 1HO1A 1TV2A 1XYFA 4PTXA 3UR7A 1JRBA 4LS0A 4BQ4A 3BC9A 1UA3A 1MEIA 4S3BA 2WHLA 4E4FA 3BICA 2XIMA 4JTIA 3WMCA 2A5HA 3BG9A 1RSCA 3M0ZA 3LPFA 3NZPA 1MMFA 2PB1A 4HPNA 1IZJA 4IL0A 1JPKA 4PRTA 3L12A 3SRFA 5HNRA 1GONA 1JG9A 3ZR4A 5FF3A 4KCVA 4WLCA 1AMKA 2IPGA 1WOAA 1ZFJA 1E73M 3EOEA 4JL1A 3WEZA 2DIKA 4CD6A 3H12A 2HMCA 2UBPC 3O6YX 5KINA 1DJQA 3ZJ8A 2X09A 4PMOA 1MDRA 4PMRA 5FSDC 4H41A 3BSGA 4J3ZA 1MW0A 1NWSA 3OVRA 3CAWA 4R5EA 4JDYA 4MB3A 1UH3A 2G50A 1SMAA 2GGHA 5D4YA 5DQPA 3SB0A 3UJ2A 1WOBA 1W37A 4P5UA 2CETA 3INPA 1XLMA 2NX9A 2J6VA 1QPNA 3V0SA 1JQVA 3GU2A 4GXPA 4DHGA 1GOWA 1KNWA 4ERGA 3O06A 2P1FA 3DUGA 1EF3A 1TFVA 3OQ8A 4CNPA 2R91A 2X2GA 4Z42C 3ALFA 5I0DA 3F1QA 3VOGA 4QQ3A 2BVWA 2WHJA 3QFWA 4BA0A 3GAKA 1L8NA 2ZYFA 3S0CA 4AHOA 5A1AA 4UR8A 3JUGA 3LLFA 4G7EA 4GI4A 3KP0A 3CH0A 1W91A 1B57A 3TW7A 3NAVA 4ZFMA 1K8XA 3WDIA 4DAFA 3U2ZA 2PDYA 1QOQA 2XPKA 1KM1A 1W54A 2IPJA 3DYPA 4DB7A 3DFQA 4MWAB 1JGMA 4JBRA 4K38A 3OYZA 3BG3A 2GUUA 1KRBC 5FF2A 3MWAA 2XH7A 1O60A 4U31A 1O6IA 5DANA 4H6QA 4QSFA 2W62A 3L0GA 3AIVA 3P0WA 1UD2A 3HZ3A 3QEZA 2FMOA 2VD9A 4P8VA 4F9DA 1Y5WA 4WCJA 4DYKA 1T0OA 3MANA 4RPPA 1TV4A 4R85A 4M19A 5EL1A 1W3HA 4MUPA 3M64A 2HNEA 2V5CA 1BXNA 3U8GA 1XH2A 4YWSA 4C6NA 1XLKA 2ZA3A 5EMMA 2YDRA 3FJNA 1TWIA 1C8YA 2ZXAA 5B80A 4PTDA 2E9LA 1WUFA 2VX6A 2X0HA 2CW6A 1QHPA 3LS9A 4L5ZA 2OLAA 4A21A 2W63A 3WK0A 4F8XA 3MV11 1KO0A 1ONRA 2G3NA 3WQGA 3BLKA 3A21A 1FHDA 1XSIA 1Q8JA 4O4VA 4U28A 1LTDA 4JCMA 1F9CA 1M1BA 4DUWA 4ZO7A 1ODUA 1FFRA 4WJEA 3I6RA 3OOQA 1W6TA 5LIXX 3HPXA 1GVFA 4AWTA 4B5UA 1UROA 3B04A 1P0NA 3S6DA 3L4ZA 1X6UA 4LUTB 2F84A 3PB0A 4IP5A 2OSXA 2MANA 2YCLA 1V0MA 1S3HA 1RCXB 1PO9A 4TUFA 3UGVA 1WAUA 4O1AA 4HZ6A 4F0SA 2AMXA 1VYPX 2YBUA 1N55A 2OYMA 3W85A 2JKEA 2Y7FA 4M0XA 4EXQA 3B40A 3TC7A 2VFEA 4TV6A 3GU1A 4XSLA 1G4TA 2QCLA 4NRSA 4GJJA 3EXSA 4WK9A 3C2FA 4YWIA 1EDQA 4PMJA 5DRIA 2OXNA 3W1XA 4I9AA 5AY7A 1NAL1 1JZ8A 4H6KA 3HQNA 1T7LA 1ZP4A 4HTYA 4MHBA 5LNSA 5DRCA 2R1NA 2QCFA 1UASA 5A8OA 4W4QA 1AL8A 1LF1A 5D04C 2EAWA 1R3SA 3CQHA 4NZ3A 4E4PA 3R8HA 2VZVA 5IDIA 3KVKA 1GOIA 3O2LA 8TIMA 2ZUWA 3SUUA 4BS0A 3CQ0A 3UY7A 3W1TA 4DM2A 4FXSA 3KVJA 1J10A 3VOHA 4IJCA 2BXYA 3RX3A 2QEZA 1A5AA 2OSYA 1LOLA 4MVAA 5CAKA 3C4UA 1FWDC 3NOEA 3GW0A 4XKMA 4IIHA 3CLMA 3MJMA 5BCAA 3MCOA 4PB4A 1RVKA 2J7CA 3MDUA 4PYSA 4GH1A 2WHMA 4ZB0A 4AVFA 4ZQPA 1MWOA 4Z2IA 1XIIA 3S47A 1KXQA 4D6HA 2DZAA 5CPMA 1GZJA 4Z2JA 3GNPA 2NX1A 5DT5A 2OO0A 2XWDA 1LRTA 2O92A 4O17A 3ANYA 2E7FA 4R3UA 4AC7C 2J6XA 3W7JA 2O9RA 3UWWA 3BPWA 3NGJA 2YW3A 1R9YA 2QJHA 2WKJA 1K6AA 4PFHA 1VBRA 2V8ZA 5D05A 4ZTXA 4I9JA 2QVHA 3DHPA 3SQLA 4ADSA 4B91A 1S5TA 2E9BA 2V3FA 2PCQA 1EF2A 3HQOA 1O94A 4U5KA 4FNPA 4HK7A 4IQEA 1WDPA 3SBFA 3V35A 1KBJA 2EKGA 1OK6A 1RBOB 3UNDA 2XN1A 1EOMA 2ZBTA 2XDFA 3TN6A 1ONWA 3W87A 2GK1B 2HCVA 1A5BA 4QXIA 1QW8A 2EG8A 3LG3A 5D2TA 1EWEA 2V63A 1W5QA 1W9PA 1J0IA 2PWEA 5T9BG 1X7FA 5IM51 3Q2DA 3QOKA 4JICA 1W1PA 2PS2A 4AD1A 5CBIA 2WSKA 1H7WA 3VI2A 4GIAA 3KOWA 3W7HA 3LXBA 5C9UA 4U3AA 2ZKMX 4Q22A 2YLLA 3BK0A 3LPPA 3Q4DA 5CPLA 2XIOA 5GNXA 4H9TA 1R0MA 1UD4A 3B05A 4NKCA 4C6QA 4X9SA 4GFIA 5HBFA 2QJJA 2EBNA 1KR0A 3CZJA 3M0JA 3QHNA 2D24A 4GQBA 4S3FA 2BVDA 3C8NA 1A0CA 4I6VA 4GYPC 4ZCWA 5EMYA 2BBFA 3VCCA 2VVNA 3AISA 2OO6A 3SSZA 3NCOA 2DT0A 2CLHA 3LBOA 2H3DA 4UR9A 5DLCA 3ZJKA 2J62A 3ES8A 3UU0A 3EKGA 3VGHA 4NZCA 5A94A 3G1YA 5HMFA 1TZ7A 3GR4A 4E5TA 5HINA 3BARA 5HR7A 3FXGA 3W1LA 2OTDA 4UQAA 4S3DA 1O68A 2OR2A 3SJ3A 2O9TA 2F6XA 5I3FA 4KKXA 4L6HA 2PLCA 3O63A 2H9AA 1H61A 4O13A 3WN6A 4C6IA 1DHKA 3OZYA 1E3XA 4B15A 4RR4A 5HQEA 2CHRA 3HPSA 1RZMA 4HHLA 3AHZA 1TWDA 1EIXA 3THAA 1PL9A 1ZHAA 3WG6A 1KFKA 4DWSA 1H2JA 3RMEA 1BGGA 3ITXA 4LUYA 4A3HA 2GQ9A 1PSCA 3PJTA 1AJ0A 1FP8A 2YXOA 3FYOA 1GYMA 1SZNA 2ZIDA 1A80A 1M6JA 5FL1A 3GE7A 2OLSA 4MNLA 1BYCA 1EKOA 3W02A 1L0PA 4HK6A 5ENLA 3EB3A 3EWCA 2YA2A 2VX5A 1JR1A 3S2JA 4Y8FA 2E40A 3AHVA 1SZEA 3HG2A 4QR6A 3IAQA 2ZUMA 3MMTA 4GI9A 3D47A 5H6HA 4LF1A 4HSNA 3KLKA 4PZVA 4PUMA 4DI8A 1CENA 3GHSA 3XIMA 4QRNA 5AYZA 1LORA 4S2CA 2ALDA 3V0TA 3OIXA 1QNVA 3WNLA 3VKJA 3KOYA 2VFIA 5G1TA 2PF0A 5A3HA 3UQNA 3GG0A 3AIWA 4F2TA 2CZFA 1NIUA 3NL5A 3IVTA 2WANA 3UZ5A 3GFXA 1IEQA 1G1YA 1RV8A 1XDMA 1YDOA 3PK7A 5MF5A 1KFJA 3F5LA 1QI0A 2OWCA 3VC5A 4O0KA 4JFTA 4W93A 1DE6A 2NXHA 6ENLA 4C1LA 1W56A 3H7RA 3ZT5A 2JIWA 2W67A 1JAKA 2VFDA 2XVPA 3TP4A 2JALA 3NL2A 2ZWYA 5EBUA 3IRDA 1YE6A 3WDJA 3S6TA 2OLHA 3R11A 1HKIA 1G6CA 1US3A 1I2QA 1RD5A 4GG9A 3OVPA 3VNJA 3MTWA 3K2GA 4L56A 3BVJA 1QPOA 3CMFA 4NQ1A 1E0WA 3PUOA 5BW6A 2WVVA 3AU2A 1X38A 3RRAA 3TUUA 2CLLA 3C52A 3VZZA 1XRVA 5JUVA 1EHNA 3WDRA 4AHPA 1GQKA 4CNOA 2WLYA 2ZZ6A 3WQEA 2WMGA 4ZODA 4LS2A 3N2XA 1VJSA 4YCOA 1W9UA 4UQCA 4L4OA 2R1PA 1HGYA 1E70M 3E5BA 4DF1A 3VGGA 2D20A 3G3DA 2RDWA 3TNOA 3LTPA 3PP7A 4DO5A 1FWNA 1V79A 3UJSA 3H26A 2CLPA 5D8WA 3HQ1A 2NV9A 4PRRA 2ABAA 1BG9A 1H3GA 4ZB5A 4GK8A 3NDYA 2RGLA 1UB3A 3UETA 1OK4A 4DO4A 1Q7MA 4D9PA 3KOXA 3H2MA 3MHFA 4MF4A 4PB5A 5TNVA 1LT8A 5I78A 2GQ8A 4XKYB 3RLUA 3VKAA 1LQAA 2G3JA 1YHTA 2PPGA 2JE8A 4QG8A 4TVCA 1OFPA 3GBDA 1TREA 1EJXC 4MY8A 1LDCA 3WH8A 3DGRA 5BYWA 5MKGA 4BFAA 4B5NA 1H1ZA 1VP5A 1WA3A 1TA3A 1VLIA 4WSKA 4JNZA 4RE4A 3GRIA 4QE1A 4CCZA 5C9ZA 4Q32A 2QGYA 4ACZB 2KX9A 3K1DA 1GQNA 1PXGA 4H8UA 1WCGA 2DZWA 4L6OA 1VHNA 3OZOA 1AJ2A 1OG0A 3MYOA 2EJAA 3RUBL 1TJRA 4QDWA 3UYCA 1C92A 1MEHA 3LX9A 3WD0A 2OGYA 2IXUA 3OA3A 2AKZA 5IBXC 3ZO9A 4AD4A 1F4HA 1HW6A 5DBUA 1CXKA 9CGTA 1EUAA 4WY0F 1BWKA 4FXRA 1NDVA 4J3WA 4ACYA 2PTYA 4PGLA 4EXBA 3LMZA 3N15A 1OC6A 5EU9A 4GY0A 2VFHA 4A35A 1W5MA 3ZR5A 5GNYA 4GRSA 1Z3NA 3MUIA 3VDHA 1MVYA 3B4UA 1XG4A 4ILSA 5DMYA 4M6QA 4NT0A 5K7JA 3LZ5A 3OZMA 3CZKA 3TYEA 3P81A 2P76A 2CKRA 3N3MA 1ODZA 1E71M 4ORMA 2DZTA 3DFOA 1ZUAX 3AHTA 1KW1A 4PUWA 1Z69A 4AEFA 2P8BA 1MRAA 3QZEA 2J79A 1VS1A 2XIIA 4J3TA 1IWPA 1J6OA 3FA4A 3QFEA 4CKQA 1ZBVA 2WCSA 1J2BA 3QYSA 4A6GA 3QKZA 1WDRA 1VBHA 2OWWA 2QCEA 2UY3A 5IHRA 3NWRA 4US5D 3WQWA 3WX7A 4W7VA 3VKBA 1ISVA 3CASA 4F0KA 3NQ7A 1MYRA 3ONCA 1XLFA 4GX8A 1L9WA 1W32A 3UWEA 1TR1A 3FY1A 3NR0A 5I23A 4RDZA 4N42A 1J2WA 3W01A 5I3GA 2IKIA 2POTA 3W2MA 5LIKX 5EYWA 5DCBA 3ZM8A 3AMLA 3W7IA 2XIJA 3A47A 3UJFA 5GQBA 2GDVA 4HP5A 1H50A 2JGYA 5DY2A 1MNZA 2QV4A 4DYEA 3G1HA 4MAZA 1JCTA 2VCCA 1J11A 2BNJA 2V67A 3QOMA 4XG1A 4AZCB 3QKEA 3GKAA 4RZBA 2HNHA 2QAPA 2PDPA 2HISA 1X1NA 2QDHA 3C2VA 3JVAA 1EGMA 1H60A 4DF2A 3UBPC 3GXMA 1BRLA 3WCZA 1ZB5A 1GVYA 3CTLA 3CHVA 3GUGA 2E8ZA 3WH5A 3QPEA 3RITA 2PRMA 1DOSA 5EGRA 1UBPC 4BF9A 3APGA 2D3NA 1WUEA 3PZVA 3H22A 5AYXA 2NUWA 1EC9A 4Z2HA 1W3LA 1AH3A 3GXNA 5CJNA 1Q13A 3B9EA 3URNA 2CWNA 2ATMA 4BY3A 4GABA 1J96A 2XISA 4QNWA 3ZVHA 1EC7A 3P80A 4FF7A 4I9TA 5EBAA 1LWHA 3UZXA 5REQB 4F66A 1VFHA 1NSJA 1Z48A 3KWXA 2Y1HA 4QEHA 4Z1AA 1PDZA 1V6UA 3C0SA 3BL3A 5HJXA 2PBOA 2F61A 4JX6A 4I7VA 3WD1A 3RIKA 1I2RA 3STEA 4O16A 4UTLA 3L5LA 3LLXA 2PCEA 1GKRA 1V51A 5C9XA 4GINA 1KM0A 1XBYA 1OZQA 3CHFA 4EPEC 1TTPA 3GYEA 1XLAA 4JTCA 1FWWA 2VKZG 4K37A 2I57A 3CHEA 3LUTA 3WD4A 2QCGA 2XFYA 3BANA 2G37A 5MHBA 5C5YA 4G9PA 2BOEX 1A49A 1CI1A 4U33A 1OT1A 3FA3A 3H4WA 3KM8A 3B0UX 1YQ2A 4US6A 3IV3A 3NYDA 3GAYA 2NVAA 5HK4A 1RD6A 3D3AA 2OT1A 3AU6A 3UPBA 4C6OA 3M6DA 3S2CA 2R8WA 1SVDA 4JIRA 1ZJAA 1HL9A 2NQLA 1SR9A 1HQTA 3NQMA 1HO4A 1ECQA 3GTIA 2EO7A 1A5SA 2VOTA 3U5UA 2Q71A 1UHVA 3SGUA 1C91A 4S39A 2HROA 2BSLA 4Y9PA 3WUFA 4RLIA 2FGLA 3I7SA 4BR1A 2Z6IA 1QJWA 5JIWA 2CKSA 3CT2A 1TRDA 3HN3A 4E38A 3MO7A 1LLOA 4N02A 2Z1VA 1F6KA 1W8GA 4ZO8A 1W5NA 4RZ4A 3EZ4A 5AC6A 4HK5A 3TQVA 4RDYA 3REQA 2XFFA 4JTJA 2VGGA 4GQGA 1VB9A 4PSPA 5I77A 2O7QA 2QXWA 4RPQA 1SJDA 3NIYA 1UR4A 3PUGA 1HTIA 1E55A 1E0TA 1E1FA 4NG3A 3KRBA 5F1UA 2WK2A 4HZMA 4W84A 1I2NA 1R2SA 2BDQA 3WQDA 4AD3A 3DYMA 1CZ1A 3S3GA 2VDGA 4XZWA 4NVTA 3N4AA 2OGJA 3UY8A 1M9HA 1OF6A 2QMJA 1MFUA 1FDJA 2VEMA 3PWIA 1XC4A 1LT7A 3LD5A 4HPHA 1AG1O 3GXFA 2EXOA 1H7PA 4JHZA 4CCEA 6A3HA 1VGAA 1G9HA 3W7OA 4GUGA 5I3IA 3CNYA 2L5HA 1Q7ZA 3EWZA 4WRHA 3W7LA 4ZVJA 4O8AA 4JX5A 4UFMA 2XM2A 3GNXA 3OGRA 4WGHA 4HT3A 4JYFA 3ZT7A 3UZYA 4GUFA 1N8FA 2ATSA 4DLFA 1NOFA 4JQ4A 3ATZA 2EPMX 4O11A 3K13A 5I24A 1MXGA 3SCVA 1WKYA 2ZC1A 2PRLA 4ZFCA 1LLWA 1SM9A 4F0MA 3G0SA 3PS7A 3PSVA 3VU2A 3VXGA 2R24A 3KHJA 1B90A 4YL2A 1WV2A 4MZ8A 1WAWA 4UOZA 2OEJA 1EPXA 1EEXA 1KXHA 2D73A 3EEZA 3WQ5A 5EPDA 1A4LA 3H2NA 4B3KA 5AC8A 3KL0A 4JZ5A 1TVNA 4S1FA 2YCJA 3BSMA 2QCDA 7TIMA 1VRDA 3GIQA 2DVXA 3EWXA 4ICNA 2I56A 3N6QA 1QRQA 1ZLPA 3BV4A 1J6PA 4IXHA 1QW7A 4UZUA 3KTXA 1U5HA 3W1RA 1VENA 2DZXA 2Z29A 3AIEA 1M7PA 1P48A 1PB0A 3H70A 3LHVA 4S3CA 1YE4A 4O1BA 1TSIA 1QHZA 4EACA 3VMOA 3FKRA 4I5RA 3F2CA 4H7CA 3UA3A 4RNJA 1A5OC 3GB6A 4KCWA 5FACA 4AZ7A 1C3FA 1TQXA 2GJLA 4ZMGA 1A47A 3WLKX 3NDOA 3RM4A 2WM1A 1ZAJA 4H1ZA 3S5YA 4Q8VA 1CWYA 3URAA 4AZ5A 2CXEA 3ZWTA 3OG2A 6REQB 2GOUA 4M1RA 3VFLA 3AUOA 2DIEA 2YIHA 3CWNA 4OTKA 5KMYA 3D0CA 3H53A 3KL5A 5LKYA 4UTIA 1E72M 1NOWA 2XVLA 3GDBA 5LIUX 1OSEA 4AISA 3NYZA 4JTHA 1LL7A 4M8UA 4EPKA 4J4KA 1JPIA 4Q7BA 1M68A 3TR2A 4A8LA 3ZWSA 4C7DA 2OKTA 2QCMA 2CLEA 2HVOA 3C6CA 1AUSL 3KE0A 5CC6A 1AQHA 2XSBA 2ZA1A 2D0FA 1E6XM 3E12A 5DXYA 3LNMA 4LJ3A 2CLMA 1S39A 3DHFA 4MUZA 2G4FA 4MYAA 4PSRA 1AH0A 3NTYA 1I2OA 2J9ZA 1TV5A 1XYAA 2V5LA 3N1AA 3VILA 3UZWA 4XBKA 3GG8A 4IP7A 2BY0A 3RK8A 1SO3A 4GHRA 2JKPA 3CIXA 3R25A 3G0UA 1RP8A 2R82A 3HA1A 2NQ5A 4A8NA 3T05A 4I7WA 4PN2A 5M2FX 3HGRA 2HVNA 4M82A 2HQAA 4ERAA 5DT7A 3QM3A 3CV6A 1C29A 1R3QA 4DJEA 4HZ7A 1TPFA 4QROA 2PGFA 3M9YA 3HG3A 3QRHA 2I5IA 5AC7A 4LC8A 3DYOA 3KBNA 2VEGA 1LBFA 4UMAA 5XIAA 6TAAA 2RH9A 4JDBA 2JEQA 1JD7A 3WQFA 3GNNA 3LXCA 4YJ5A 4FA3A 4JOMA 1ONEA 2CC0A 3C2RA 3GO2A 4DPQA 4GY1A 2PLKA 3U0HA 4PMDA 1RR2A 2B7NA 3E0FA 1RXOB 2VZSA 1GW1A 1RCQA 1XR2A 3BURA 1Z7AA 1AK5A 3FW6A 2W4XA 1HP4A 1XC6A 4PMUA 4K8EA 1IXPA 4QJ4B 1V6VA 4E8CA 3ONBA 3ARXA 3MWCA 2XHYA 1TPUA 1E9IA 2GZXA 5H2ZA 3NQDA 3VX1A 2HXUA 2WMHA 3HTWA 4AXNA 4LB4A 1V6WA 1H4PA 3SSJA 1NDZA 5HQMA 4XWUA 3GG1A 1KRMA 2XGZA 3FEQA 4XVDA 2X1UA 5C2GA 4LUJA 3TV8A 2PD5A 1Z42A 4LUTA 3GBEA 2BXVA 4JFUA 5CZJA 1XLCA 5FAJA 3SUTA 3W75A 3DN5A 4I5UA 3WQOA 4H83A 2CZVA 4GJIA 1L6YA 4JPGA 1P5BA 3CUHA 3VGBA 5LA2A 5F7UA 4HNOA 3EB4A 4IWWA 4HN8A 3H7UA 1H7RA 4QHRA 1IEVA 4CVWA 2QJNA 3L2IA 3KVLA 5BMWA 1K4GA 4IIBA 5EMKA 3S5ZA 1MXSA 1PTGA 2V81A 4XD4A 1K9TA 3UJEA 1P1MA 3UWZA 5D2VA 4NJGA 1E6QM 4HMCA 4C1NB 4WXYA 2DUAA 4UUIA 3IJQA 3SW6A 2AQVA 2PC4A 4Q8QA 2FGBA 5LNUA 3U6WA 1M04A 2Z4GA 4IM4A 3DG7A 1YTEA 3DZ1A 4HHHA 1J0ZA 3CMGA 4AD2A 3B8IA 3UXAA 4GGBA 4NHVA 3OBAA 2QJIA 4OJYA 4BZYA 2RDUA 3GG7A 1MUMA 2IKJA 2ZZ5A 3PBYA 1VFTA 3VD7A 1UKSA 3ARYA 4EOUA 1YADA 4IPPA 1E56A 1V6TA 4ASTA 3B8UA 3N29A 4AYSA 3EX4A 5C55A 3F03K 1GWJA 3C2EA 4YCPA 2CZEA 2XGBA 1US2A 3UF9A 3AALA 1O66A 1YXDA 3VAVA 4KGLA 1QNSA 3POHA 4WJXA 3VUSA 2FIQA 3S4TA 5D37A 4M6UA 4O53A 1U1UA 5A6AA 1HL2A 5D38A 3WF3A 4V2XA 3LHUA 4F0RA 4AY8A 1U5JA 2Q01A 2X7WA 3Q94A 3K4WA 2DSVA 2OEMA 3DU0A 4D6CA 3P2VA 1SGJA 3RX2A 4KH2A 3OGSA 4HNTA 1J4EA 4HA1A 1TJ1A 5I3JA 1KKRA 4QEEA 3GYCA 1NFGA 1TPH1 4Z0SA 3OLIA 3IWPA 1JNEA 5U4NA 1JGIA 1WXZA 3ABRA 3GVWA 2X2YA 4C6MA 1SSDA 2DVUA 2LLEA 4WQ6A 1FCBA 1RHCA 5F4XA 1S2CA 5AHNA 2VCAA 4OE7A 4EANA 5HPCA 3QJAA 1QR7A 5CSUA 3VKDA 3WDPP 3THUA 3VOIA 4NZ4A 3CMJA 2P53A 5FJUA 1QU4A 4KWVA 1R9XA 2I9UA 1OINA 4J28A 1YXCA 1P4CA 3N9KA 4BJHA 2J88A 1JVNA 4K8GA 1BVWA 1RA5A 3PPCA 2C19A 2WW5A 2WLZA 3EPNA 3OBKA 4K2SA 2VR4A 4DWDA 3TTOA 5J8LA 2B0MA 2GK1A 1VH7A 2D0HA 4IQJA 2VEKA 1FWRA 3BMXA 2PDMA 2ZRWA 1SJAA 1V08A 3TWAA 3GS6A 3UNTA 5GNZA 5G2HA 1RPKA 3T09A 2CHOA 1GVEA 1L6GA 1XS2A 1J0JA 4KFOA 5GJPA 4LX4A 4LB3A 4MJ4A 4HYVA 2YA0A 2CERA 4GISA 1YTKA 2X7VA 5HNUA 4GVIA 4LBSA 4GE8A 3HB9A 3TSBA 1RQHA 1KWKA 3CQIA 1XP3A 5FEXA 3OYXA 4UZSA 3CEUA 2J27A 1VBUA 2PWUA 1ZBWA 3H8AA 1BGAA 2WCAA 3L9CA 3IIXA 3SN1A 3RG6A 3RO8A 4CCCA 4CD7A 1S5WA 3U3HA 5CLWA 4L9XA 1BVZA 4X0NA 3R0DA 3SRDA 1OM0A 1LG2A 4OU1A 4S3GA 4GQQA 5FAGA 5HOSA 1WDSA 2VMFA 1KFLA 4MYXA 2P88A 5DN1A 1HG3A 2GDUA 2F2HA 3AMKA 3UGRA 3AICA 3IEBA 4MB1A 4XO6A 3BJFA 1HX0A 1F7BA 2YYUA 2H90A 4Z0JA 3W1NA 5FJIA 3A4XA 3RYSA 3L2LA 1FA2A 1CB2A 1KKOA 5HMSA 3KAOA 2P10A 3KS5A 1GTHA 4PMQA 1F3TA 1EZ2A 4I7UA 4DO6A 3TNBA 3VZXA 4HHMA 1UMLA 1PBGA 5HPOA 1RK6A 1OFOA 1WB0A 3PSWA 3SAZA 4UTUA 3PAOA 3QQ0A 1XYZA 4R7WA 1KC7A 1X6NA 2ZZ7A 2GVJA 2QGHA 3CQJA 4L1GA 2EEXA 4IGNA 3LB0A 5BXRA 3K8KA 2F7FA 3L4UA 4L4PA 2QPSA 1PYFA 4JY9A 2VR2A 1EBGA 3DFPA 4PBGA 1V3LA 1QXLA 1OFRA 3SCOA 1GJUA 4CLMA 3E0LA 4PMVA 3L5AA 3ANUA 1EUNA 4J27A 4E2BA 3QLDA 1EA0A 4PE8A 1O5KA 1VPYA 2DZPA 1X39A 3SCWA 1F05A 2YL9A 1JNDA 1PCKA 1BPLB 4IQLA 3ITCA 3ISIX 4TV5A 1IHIA 1R85A 1XYLA 3FSUA 2QDEA 1GTEA 3CPRA 2GLKA 2POZA 3KFTA 4FNTA 3RFAA 4DUOA 4UCFA 4GXWA 1VYSX 4FXFA 4LF2A 4IXXA 4W7WA 4MNJA 4ZR8A 1AODA 1GQLA 1PE1A 1OY0A 1I0BA 3GFZA 2FPTA 3MW7A 3UPMA 3O6AA 1JPDX 3UT0A 3NQGA 1W3KA 5FF4A 5A6LA 2PDCA 2NT0A 3ELFA 4PB3A 1EQPA 4UC5A 2DORA 3CL7A 5BU6A 3B9OA 4KRUA 2E25A 5A8QA 3EDKA 5GJNA 2PU0A 3W3OA 2WZMA 2WWCA 4HNNA 1DXEA 1GVSA 1UZHA 3W76A 4ZO9A 1E6RA 5M03A 3NPXA 2Y7GA 1AQMA 1UJPA 3PWAA 1OIFA 1OVDA 2ZRYA 2OT0A 3F2BA 2DQXA 7TAAA 5HMDA 1BAGA 3QY8A 1L6WA 1ECEA 4H7VA 3EMQA 4QJ1A 2Y88A 4GIRA 3A6OA 3NPWA 3MYPA 3GDMA 4JQAA 5CKSA 4CN1A 3N73A 2YZRA 3AO0A 4DJDD 3ATYA 3DEQA 4HA4A 1QHOA 4BWLA 3EA2A 3PC0A 4JTLA 2OODA 2FQIA 3DG3A 3W7MA 2NV2A 3U2EA 1BYAA 1WDQA 3GW3A 3IJLA 4I8YA 2OU4A 3B9AA 1ZAIA 5D8ZA 4FLRA 3G22A 3TE9A 4WDUA 3WQPA 3PBGA 1AJZA 2P3EA 1CXLA 3EPMA 4H4IA 3LCIA 2Z1BA 2C1IA 1UKOA 2DSUA 2VCBA 1XUUA 3C86A 1Q6DA 4HSOA 3EOUA 1TPDA 4RXGA 2E3ZA 4G2DA 3ENLA 3NQAA 1L8PA 4DAIA 2EHHA 3LGEA 4ZQNA 1OGSA 1REQA 3TJLA 3UR5A 1IQ8A 4R33A 4LV4A 5CSYA 3V16A 3AJXA 3QV9A 4WUIA 3BWWA 3CEPA 4OV9A 2PDNA 3C56A 2YB4A 1IEXA 1OYBA 2W3ZA 3HO8A 4XKYA 1I60A 1UZ4A 3WQ4A 3TONA 1KM5A 3KOZA 4Z1CA 4AIBA 4D8ZA 3A5VA 3OEXA 2QDDA 1KCXA 4HNVA 3O6CA 3TC3A 1RBAA 2Y8KA 6ALDA 1D3GA 3GQYA 3TFXA 4GCAA 2DIJA 4HB7A 3OQEA 4ACZA 2FGZA 3QQ1A 1RCOB 2WNWA 5AOUA 2UY2A 1Q5MA 3VINA 3W2UA 3OVGA 1VPQA 3N2BA 2WMJA 1VD6A 4MWAE 3VMNA 4WXZA 2A7NA 1B30A 4MJZA 3L4WA 3B8DA 1KQZA 3BMWA 3WL0A 2DZSA 1W1A1 4NX0A 2IPWA 1PAMA 1UOZA 4FF5A 1GK8A 3G6LA 2UY5A 1KM4A 3URBA 1JPMA 1JZ3A 3PTMA 3WF0A 4NAEB 1YYAA 4TMBA 3VABA 1YBQA 4P8XA 4M5PA 2H8XA 5GVJA 2BHUA 3NFUA 3K5XA 2A4AA 3NVDA 4GXMA 4LH8A 2FB3A 2VP8A 1YTDA 3SI9A 2X0SA 3LHYA 2PWFA 2D23A 3KRSA 1P6WA 2A6NA 3WF1A 2IW0A 1OJXA 4RE0A 4UTFA 3IJIA 1TZZA 3DCPA 5LHFA 1BD0A 3V5OA 2ASHA 1F3XA 5K9DA 3MP4A 4IIEA 5I6SA 3VE9A 4JTSA 1EWDA 4LXFA 3AAMA 2B7OA 4B5WA 3TCSA 1X96A 1MI3A 3FVDA 3I7QA 4KBXA 4QG9A 5KZMA 3E02A 4IPJA 3GK0A 4X2PA 4JD4A 1FWGC 4ATLA 3E0VA 1TR9A 1PVNA 1GNXA 1GPWA 4QM1A 5CXPA 1IZKA 1OZMA 4PMYA 4AG0A 1XLJA 4L64A 1B31A 1S5MA 1CGXA 4XIAA 4LAMA 4M56A 5E5CA 5LNVA 2WJZA 2PDXA 5FEPA 1B3VA 4MTVA 1G4EA 2PAJA 4G1KA 3L0NA 2XH0A 4FOJA 4RE3A 4H9VA 1E9ZB 4A29A 1PIIA 4RNHA 2DUXA 1DXFA 5HUPA 2Z7GA 3JW7A 4HJWA 9XIAA 3AWOA 2ZRZA 1GUVA 3MO4A 3LZ3A 5I02A 3BLLA 4AZCA 4HCHA 3DFHA 1OGGA 4A2SA 4I90A 2FHCA 1AH4A 1UD8A 4JIIX 3FFSA 5DMMA 1KTCA 2ZX5A 2PMQA 5LXXA 5MKGB 1SJCA 4DBSA 1TA3B 3RHGA 4X60A 3AMDA 1QOXA 3STCA 3H21A 2J9YA 3NOYA 3I6EA 4Z2LA 1MUWA 4KWWA 1VJZA 1KFWA 1GOKA 1JYVA 1XLHA 1LRQA 1JUEA 2WNQA 3BW4A 3CUZA 1FOBA 1QI5A 2WO5A 3PZIA 2XYLA 1BLIA 2VM8A 3W2NA 2PDKA 5C9RA 4PRWA 1EJSC 1VIZA 4IZGA 3GNDA 3MMDA 3ES7A 2XM1A 5CLTA 1BFNA 2ZUNA 4CCDA 4R27A 3H54A 1KFEA 4H9YA 3CUIA 4R7JA 2PTXA 4B4HA 5A6SA 4V1XA 1P1XA 1E43A 4WOQA 3WBEA 1SR0A 3FJ4A 1XJBA 2CLKA 3KUMA 3FDKA 3LK6A 3GX9A 4WSJA 4IH3A 2QT3A 4RDVA 5AYBA 4M3PA 2BP1A 4O19A 3EKLA 4JAWA 1DWHM 1W5OA 3AXKA 2BG5A 4J5NA 3V4BA 2C7FA 3IRSA 3S2NA 5E0KA 4Q4QA 3MS8A 2PTWA 2YFOA 4JN7A 5BXSA 2WJFA 1TV8A 3YPIA 4RW5A 1EIBA 4IFKB 2RFGA 4LEFA 1JUKA 3LU2A 4GBDA 3QSTA 4UQDA 1ESWA 1VEMA 1GG1A 1EXBA 4GZ7A 4RZ6A 2PDLA 2OYLA 3W37A 1UQZA 3HG4A 3VGFA 3LCGA 3PZUA 4LPCA 4RXFA 4KEVA 5TQLA 1PKMA 3BLOA 3WZ0E 4MPQA 4EF9A 1XISA 3SADA 5CPSA 1WZLA 4W7UA 3DC8A 2QLYA 2WXDM 4Q7IA 2Y63A 3TJ4A 1GOXA 4GPNA 1A3HA 1UWQA 2IUZA 4O18A 5T9CE 3G8RA 1EJUC 1JDEA 1RP9A 3W72A 3G18A 4GGHA 2CEQA 2ZTJA 3M7SA 3N17A 2OELA 1Q4WA 5AVNA 4GQRA 4DBDA 1GT8A 3B0VC 3BQ6A 2YKKA 1JEZA 4OQVA 3BJSA 2ISDA 3RJYA 4E8GA 2E09A 4ZSUA 1ENUA 3GVQA 2VI0A 5JIPA 2D2JA 2AMGA 5J5RA 1CXIA 3FEMA 2BV9A 4ZENA 4CQAA 3BTNA 3FV9A 2PTZA 3TXVA 1SUXA 3SGGA 3DOPA 1DWIM 3M0XA 2WC3A 4KEMA 1Y7VA 3PWGA 1B3ZA 4O10A 3ZR6A 4L1XA 3MUZ1 5K9XA 3MKVA 4L4LA 1A5MC 1XBXA 3O3RA 4GY7A 4FB7A 3IJ9A 1SFSA 3T08A 1JDCA 3ARVA 8XIAA 3LA4A 1J18A 3ARQA 5ABTA 1KXTA 3RR1A 3ITGA 4CN6A 3MJYA 1WKEA 4B3ZA 3OODA 1FHUA 2GJXA 5HR6A 4JQ2A 2ZE3A 1O1ZA 2D22A 5EB8A 3M41A 5CBJA 5HJYA 1ZU8A 1H11A 3CB8A 3H7VA 2VUNA 2IPFA 4CD5A 4J3SA 5G2WA 3V5FA 2WNNA 1V3MA 1TWSA 3W2KA 3WO8A 2DW6A 3QC0A 4LAOA 3WENA 2E4TA 1D9EA 2DSWA 1R86A 3MUXA 1TX2A 1QWKA 3U4FA 3TYDA 1GVOA 1RY8A 3BMVA 2EPOA 4CNTA 2AOSA 6XIAA 1AZ2A 2DJXA 3E2VA 3C8FA 1N2VA 3GNRA 2EPKX 4IPNB 4HOWA 4KW2A 4QJ3B 1PWMA 4XVEA 3C61A 5C8BB 3TX9A 1R87A 1ISXA 2C16A 4WKAA 4OBSA 3L65A 3CXOA 1A4MA 2WPGA 2EPLX 3AMCA 7XIMA 3N4FA 5CJ5A 3EOOA 4N4QA 4W5ZA 2A3HA 1JXKA 1XKYA 3O07A 2XJ7A 2GPTA 2FZNA 2FYMA 3LRKA 3ITLA 3MUAA 4RV8A 1TRIA 4DNHA 3RO6A 5F2MA 2Q3OA 4H2HA 4S3JA 1VZWA 4O12A 3A13A 1QASA 3AUJA 1B3OA 3VMPA 5A6KA 2CZDA 3SCPA 1IWAA 1QFEA 1V02A 4HA0A 3ABOA 4GYPA 4BEQA 4MIMA 3UR2A 3L0KA 6REQA 3ZQ9A 2HE8A 4BWLC 3MCMA 1U30A 4N6EA 3WLRA 3REQB 3G1AA 3CV1A 4EX4A 3XISA 4Y8EA 4CQCA 2RKXA 2YBVA 3L4XA 3EKZA 3P7YA 5AYYA 3MT1A 1CBGA 3TOPA 1I8JA 3TXZA 1F74A 4ADUA 1NP2A 5ABFA 4OBRA 3DBNA 1TMQA 1OFDA 4MDPA 1FY6A 2V0TA 3VE7A 4XK2A 2GSEA 3TW9A 5H91A 1K1DA 3EA1A 3R79A 3V0UA 4DNMA 3QMTA 4WIWA 1PX4A 4PCFA 1R8LA 4DJFD 5T26A 3KBWA 3VPLA 2R9RA 3I10A 3VIIA 5FD0A 1SPQA 5D9MA 4ONVA 4DIAA 1HN1A 3SECA 1E1CB 1QMLA 2HTMA 3GIPA 1TVLA 1HKKA 3AI0A 4AIEA 2ZRUA 2VC5A 3GR7A 1IF2A 1TPC1 2Q8XA 2YGYA 2W6RA 1U33A 3LOTA 4MKNA 1R6WA 1FWSA 1VKFA 1UP2A 5TBOA 4L9ZA 4U4MA 4S3KA 4Q4SA 1X8FA 4K1GA 3NXFA 4HHPA 1V7AA 2PZ0A 5HMEA 5D33A 1BHGA 4HKPA 1W3IA 4O50A 3ID7A 2PZNA 4H7ZA 3P6LA 2HJPA 7CGTA 5BRPA 2WZEA 4NRRA 3F5KA 3CUFA 2ZTKA 1U22A 1TMHA 4ZQMA 3NG3A 1Q2SA 3AIRA 2WSPA 1OHLA 4HMEA 2OMAA 3QPYA 3I3BA 4QCFA 1I45A 3KVMA 2ZC8A 1C8VA 3NQ8A 2BWGA 1W3NA 3B8SA 1VQTA 5AHFA 4CVUA 4IMGA 3WQ6A 3N9RA 2TAAA 1VC4A 2J47A 2MUCA 4ALDA 5DY3A 1R7OA 1M7OA 2PDGA 4FHAA 4EIVA 1YNQA 3NL3A 3SO7A 4E2VA 2GGJA 5LHEA 1NDWA 3WBXA 1NELA 3EMCA 3K8MA 5AHMA 3VGDA 1BTCA 1UW9A 2VRQA 1FH7A 3P84A 1JYXA 1FVPA 4KRZA 4XD5A 5KZEA 3D6NA 1U2YA 3NPVA 3CQKA 1MZHA 5JU6A 2J7FA 1W9BM 3KTSA 1NVMA 3PM6A 3GSMA 1R7AA 2DT2A 1HKWA 2VZTA 4W8BA 4C1NA 5CEWA 1DORA 5F1VA 3W22A 3OIHA 4MFEA 3BCDA 2Y61A 4INFA 1O5XA 4IMAA 5T8GA 1R9ZA 1WNOA 1RH9A 2QV5A 1EB3A 3KWSA 3UZJA 2QUVA 1Q6GA 1JFXA 4IGMA 3ZOAA 3BGJA 4BQ3A 1DJXA 4AWSA 1U1HA 5CSRA 3NO5A 5TIMA 4M80A 1ZNNA 2FZ9A 3B03A 2XUCA 4H9MA 1UWAA 1UC4A 4Q8NA 4AZBA 1R2RA 2E5CA 1W2PA 1SZGA 3NEHA 2QMKA 1TCMA 1VJIA 2BOGX 1M7JA 2QJMA 4DZAA 3IGHX 4LVAA 3KBMA 1XD1A 3GD6A 4W87A 5FJTA 4FEZA 1XPGA 1XRSA 2YCIX 8RUCA 1I75A 2ZX7A 2J75A 3IUDA 4A3RA 3V7PA 5D2WA 5F4SA 1XYCA 1DE5A 4NX5A 1Z9AA 2VELA 2J13A 1V0KA 5A6BD 1E3ZA 4N6FA 3GH4A 3N2CA 3R43A 5L9FA 3H2AA 4N7QA 3QBUA 3VX0A 5EMUA 2OG9A 4D6DA 3LGGA 4EWJA 3VDBA 3TQPA 4MZYA 1IZCA 1FXQA 4IMCA 5HAOA 1G4SA 3W2JA 3VCNA 2Q8ZA 4HPXA 1AVAA 3SN0A 2WZHA 2Z24A 1J5TA 3THDA 3M4HA 3ITOA 2V5DA 1XIMA 2WC4A 1GW9A 1OX4B 2XH2A 3S1VA 3WBAA 5I3HA 5DELA 1ZCCA 3VNLA 2WSQA 1XIEA 4PBEA 1OBAA 2WSRA 4IFOA 3SRHA 4FSAA 1SO6A 1VFOA 3VFCA 3MA8A 3A4JA 4NSBA 1YNPA 4LU0A 4F0HA 2EKCA 1MUCA 2B81A 3QZAA 3VTRA 3M07A 2V6AA 3T44A 1OD8A 1ZGDA 3BCFA 4WOZA 5IBXA 4GC3A 3TN3A 3S9ZA 3CU2A 3KTCA 3LHZA 4Y9NA 1F3WA 3GC4A 1XUZA 1DIOA 4W89A 1NF0A 2ZUTA 2DQWA 3EX1A 4HVXA 3GM8A 4Y2WA 5HNNA 4DXXA 1DWGM 1GVRA 1MW2A 1VFUA 1C9WA 1NOUA 4M29A 3MDWA 4REQA 3TZNA 3UXKA 2E67A 4JHMA 1QK2A 3PTKA 2YXXA 1ITXA 3PTDA 1TB3A 2H3BA 2QNEA 4LANA 4W8AA 3HM7A 2VFGA 4L6DA 1WZAA 3JS3A 1UD5A 4RE2A 1I0DA 2R94A 2VQTA 5AFDA 3ITYA 5I79A 3SRKA 1B3WA 1QI2A 1CTNA 4AUBA 3O0KA 3U48A 2PURA 3ARTA 1M41A 3CIVA 4IX2A 4M81A 3PZOA 1FWFC 2PLJA 4YMZA 1SZRA 2A21A 2ABBA 4JX4A 1O95A 1XL9A 3GTHA 7A3HA 3NZQA 4ZB2A 4P8UA 2PWDA 2FHBA 2QQ6A 5EA9A 1J01A 3M44A 2BFGA 2NSXA 4Y96A 1ZZMA 4GUIA 4NL1A 4O1DA 1JXJA 1UKTA 4XZIA 1O5RA 4AQLA 1POJA 3TOYA 3USBA 2PWVA 3WELA 1BF6A 3F4CA 2GUBA 1F4AA 1UR2A 3VIJA 1OCNA 2FZDA 1PKYA 4JFVA 4N9EA 2IQTA 3WK2A 4LYPA 2A85A 5TD4A 3M5VA 4FLOA 3QHOA 2QPXA 3L7RA 3WMBA 3PZGA 4NNAA 1F73A 2C0AA 3TYCA 1K8CA 1H0GA 2AQOA 3TCEA 1FWTA 3ABSA 4NNBA 2NWRA 3Q58A 2PRHA 4NILA 5ABHA 3GU9A 3WLLA 1JCYA 2D2HA 3Q45A 4NASA 1TPB1 1AW5A 1VYRA 4C6KA 3W7QA 3PB2A 4MPKA 2YW4A 6PTDA 3VUPA 4NAFB 2XU2A 3A5FA 1MDLA 3BLPX 1FDZA 4AX7A 1GOOA 3T0AA 1IGWA 5FI8A 1OFQA 1ZJIA 4NI8A 4TIMA 1O7AA 4NIRA 3APTA 1JI2A 1DTNA 4QNEA 4DJDA 4P7RA 3MMUA 3PZ9A 1LWIA 2ALRA 4PUUA 1JQXA 1LROA 1LP6A 1SO4A 5FJOA 1KCZA 3LM7A 1HF6A 4UNLA 1QAPA 1VCGA 2VUYA 3BAXA 1MO0A 5IOBA 1JCNA 4F48A 2OKOA 3SM0A 3TYUA 1UUMA 4JNYA 3IANA 1EYEA 4LNYA 2VXNA 3AYRA 4XIMA 4FNSA 4CN4A 3GHRA 1SW0A 3FVMA 3C0LA 3MBDA 3UP8A 2V9DA 1Q85A 2X8RA 4JFSA 5CC3A 3N18A 1H51A 3M16A 2VVSA 1JYWA 3LCHA 3PAJA 4FI4A 5IFPA 2XIBA 4S2BA 9RUBA 5JBDA 1XXXA 3W7EA 1WPCA 1KWGA 4DWSD 1EX5A 5CG7A 4IGSA 2GUYA 5HJLA 1D2KA 4C6CA 2V69A 3H4XA 2DY3A 5LNRA 2V5KA 4BEUA 1PHQA 3UESA 2HWGA 4X63A 1AW1A 2FVMA 4J40A 3T2PA 2GVYA 3VIFA 1TIWA 2J74A 3NPUA 3RPDA 4UTJA 4C91A 1LM1A 4JIHA 4C5ZA 3W2LA 3UWVA 3F4VA 5HQLA 3COTA 3WH9A 1X6LA 1RQEA 4HGXA 1AQFA 1EEPA 4RNFA 4QGCA 2Q02A 1IEIA 1E6PA 1C8XA 4LRSA 3IJ6A 3IIZA 2GVLA 3FAXA 4UMBA 5G1YA 3H23A 1UWUA 3WEOA 4ZOCA 1DIDA 2CLOA 4ML4A 3IIVA 1SQ7A 4NYUA 4E3TA 1CT5A 3CUJA 1UPPA 1XSKA 4AF0B 2RDXA 3CTTA 5CAHA 1V0NA 3FDGA 4I9MA 3WUGA 4HSHA 4TQTA 4U5IA 3PBMA 2WM0A 4IG2B 4YVXA 4QAIA 2ZOXA 4J2PA 3WUEA 3S2MA 3B97A 5CGTA 3QC3A 5CGQA 1A3WA 1CGUA 3H6OA 3TN4A 4DBUA 5I09A 1TTIA 2G95A 4G6CA 1AL7A 4DRSA 3NQFA 3W1UA 1G67A 4YN5A 1Q65A 2E6AA 1C7TA 2WV8A 4PTVA 3Q67A 1V4YA 1KM2A 2XZ9A 2ZUUA 2DH2A 3V3WA 3KHDA 3VOCA 5LGXA 3OA5A 3VOJA 1KBKA 1D8CA 1PCWA 2P50A 5AC5A 1M03A 4A8IA 4GX9A 3AZRA 2UV8G 2J9XA 3R8GA 5DMLA 4ZOAA 4HOXA 4RK8A 4H2CA 3IACA 4FX8A 4LS1A 4H04A 2BASA 4W8LA 3EWDA 3I4KA 3THQA 3UW6A 4L80A 3UJRA 1UUQA 1T41A 2Z1KA 5AHLA 1KTBA 4I3GA 5G4HC 1BEUA 1PWLA 1M5WA 1VEOA 3ZLGA 2GSJA 3EWYA 5LIYX 3ZLFA 1I1WA 1K3UA 4HU3A 4NAEA 5HXMA 2ZFAA 3GXTA 5AHEA 5J04A 3BO9A 1KA9F 4MGGA 1BF2A 4XX6A 4C6FA 3FNDA 5PTDA 2BODX 3FYPA 1Q63A 3O6DA 2Y5EA 3P60A 4LT9A 4KEZA 3R7MA 4NJIA 2XFRA 1G69A 1Y0EA 3UG5A 4ZGYA 4EP8C 3W0KA 5DX7A 1VCVA 1JF6A 3CL6A 4TX6A 1PS9A 3FXYA 3AIBA 1GHRA 4U2ZA 1OCJA 3TQ0A 3LQLA 4IUOA 3NVTA 4KERA 3BOLA 3O1NA 5AHIA 3WNPA 3M5ZA 3EMZA 1TJ2A 4U10A 4AFYA 1JFHA 2O7SA 3MUCA 3ZXWA 3A9IA 1TVPA 2AGTA 4HNLA 2G97A 1S1RA 5AKQA 5A6TC 1CGYA 4UFJA 2QF8A 4LYQA 2DU2A 4E6MA 1AQ0A 4GIEA 4AY1A 5K9CA 4FMVA 3PBUA 3KL3A 3BH4A 3CZLA 2VC6A 3VNKA 1QVBA 3TAKA 1E4IA 3L4VA 2QW5A 4JFWA 1UQYA 2REQB 5C54A 5C7VA 1THFD 4TVUA 1PZ2A 1MW3A 1J8VA 1F2JA 1REQB 4E2OA 2OSWA 4DXVA 1UJQA 3CT7A 5AZ1A 3XINA 1CLVA 4D6EA 2GGGA 1DQWA 3KBVA 1DHPA 4I6KA 1W9DM 5I2UA 3ZSSA 3UG8A 2PDBA 4LY8A 1TIMA 2X1IA 3K30A 3LHTA 2V5BA 4TOQA 1CGWA 2PU1A 1DV7A 4Q6JA 3GH5A 2FVLA 1OFBA 1UH4A 2EGZA 3NZ1A 5A8PA 3S5OA 1XDLA 2V2HA 2ZZ3A 4Q8TA 3D5HA 3EXTA 1V6XA 4TVDA 2GQAA 3SCRA 4XAYA 4IF2A 3N12A 2NSOA 3I6TA 4EE9A 4Y9MA 4KESA 1EOKA 2WMKA 3A24A 3QZ6A 1Z44A 2HS8A 2XVNA 1OYAA 1C7SA 3W00A 3WLJA 1M7XA 2WMIB 4W85A 3CZ8A 2VGFA 1VPXA 3RLGA 1YPIA 4PMNA 3BAKA 1HJWA 2E5BA 1SW7A 1OFAA 3W7GA 4BHYA 3VCRA 3L4YA 2VEFA 4JIEA 1M01A 1QPRA 1OC7A 2GGIA 4J3XA 3ORWA 2OQLA 1WDWA 3HURA 3TAOA 3GUWA 4Q4MA 4QAWA 2FZ8A 2VEPA 1YBQB 2WOQA 1UR0A 3GVRA 3WD2A 3S5SA 1LQ0A 5A5WA 1XDJA 2DW7A 3CAKA 4YU1A 4QITA 2FPVA 1Q66A 2ZICA 1OCBA 4IOTA 1TE1A 1E5NA 2B4GA 4Y9AA 2F2KA 3OPSA 5KEZA 4IISA 5I00A 3RJXA 3GVGA 2VT0A 1TWWA 2G41A 3CK5A 3M0YA 1HT6A 1R38A 2X1RA 3S42A 3AS1A 3LBCA 1WKDA 1JJKA 2V3EA 4QJ5B 4BI6A 4P7LA 4F9JA 3VIMA 4NYYA 4IIFA 2ZRVA 4EVZA 3UWYA 2KAUC 4IFKA 1DQUA 1MQPA 2Y8UA 2FH8A 3CPUA 5A8GA 2YDQA 4YYCA 4GBUA 3VD4A 3SFWA 3SURA 1WQ5A 3RNDA 3UR8A 4NXKA 3JRKA 1P6CA 3T0TA 5LSMA 3HPFA 4C5YA 5C71A 4NZ1A 2WZTA 4XZ9A 3QGKC 5AECA 3QY7A 4GUJA 1DPMA 1JD9A 1SSGA 2WAGA 5JXQA 1UP3A 4JQ3A 1T6MA 3DENA 1PKLA 3VO0A 1UWIA 2NV1A 4J3VA 3ARRA 3LV5A 2WZIA 4AH7A 1C90A 2ZUVA 4GI6A 5CZTA 2ZA2A 4F40A 1YW1A 2DZUA 5CC7A 4M1BA 3DAQA 3ZLHA 1F6PA 2Q8LA 5H8PA 3FLUA 3TTQA 2X42A 4TR9A 3IAPA 4EAYA 2NUXA 1H0IA 3IGSA 4N4PA 5JH1A 5SWUA 3DI0A 2BOFX 3M46A 3SCTA 4W86A 1KV8A 3E9AA 1K9EA 3R58A 1FWAC 2CZ5A 3IIOA 1KM3A 4GLEA 2HK0A 3W28A 1OD0A 1R3VA 3V5CA 2F6KA 5FA5A 1DJHA 5XIMA 3T2OA 2DSKA 4OOZA 1LCOA 4BF5A 3LTYA 1QPKA 3RCYA 3FJ6A 3P0XA 5BMXA 2XSAA 5BWFA 4V27A 1IR2A 3IIPA 2QUNA 1RLCL 3VD5A 4DJDC 2CBIA 3WJZA 2A3CA 4E3VA 4F0LA 3DC0A 4DYJA 1EGVA