3QYBA

X-ray crystal structure of human tbc1d4 (as160) rabgap domain
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
297
structure length
297
Chain Sequence
HMKVKLDYEEVGACQKEVLITWDKKLLNCRAKIRCDMEDIHTLLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKELLKQLTAQQHAILVDLGRTFPTHPYFSVQLGPGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLHMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEISPSLYAAPWFLTLFASQFSLGFVARVFDIIFLQGTEVIFKVALSLLSSQETLIMECESFENIVEFLKNTLPDMNTSEMEKIITQVFEMDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of human TBC1D1 and TBC1D4 (AS160) RabGTPase-activating protein (RabGAP) domains reveal critical elements for GLUT4 translocation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
molecule keywords TBC1 domain family member 4
total genus 91
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2011-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 3qybA02
1.10.10.2750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3qybA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3qybA03
1FKMA 2G77A 3QWLA 4P17A 3QYBA 3QYEA 3HZJA 2QFZA 4HLQA 5EJCA 4Z6YA 4NC6A 2QQ8A 4HL4A
chains in the Genus database with same CATH superfamily
4GRIA 2IJLA 2HZTA 4YELA 5M5WJ 4XKCA 4A3EJ 3W2WA 3BBZA 1S5LC 1W5TA 2W24A 2C6YA 3HOZJ 4XOTA 5BPVA 4PGHA 5KPTA 3ZQGA 4E7SA 2HKXA 3FBIB 3VDUA 2IA0A 4MGZE 4IHVA 2CU7A 3R4KA 2Y0QA 1R6BX 1HNWM 1OIUB 3I56I 1C7YA 4BXUA 4IRHA 1KZHA 1IAWA 1WVRA 4A0ZA 4KDPA 4LFAM 4CCOA 4PSXA 4AW4A 2R3SA 3E6BA 3NRVA 4D0PA 1ZQ3P 2M0CA 3P9IA 1ZTRA 2GIZA 3K4MA 1G3TA 4PK4A 3QU3A 3MHVC 2BGCA 1UHSA 3MN2A 3TQNA 5B66C 1G8XA 3G4SI 2OV7A 3FX3A 4XN0A 1EF4A 3AG1H 3U6OA 4A12A 1FMWA 1IZ1A 4WURA 2R93J 1V34A 1YFHA 2Y20A 1VQNI 5LFAA 3CTAA 2X6WA 1L1TA 1O3SA 2BEOA 2VOPA 1IBKM 3NQOA 2BY2A 5EG0A 5DQVA 3A0BC 1QRYA 4KLNA 5E26A 1D0LA 4JI4M 3T8TA 2KP6A 3S3NA 2AHMA 1P92A 2ZC2A 4M6XA 3LFKA 4CCKA 5ITUA 5FTMA 1W5CC 2FF4A 5FROA 3CO6C 4JI6M 1N78A 3HGGA 4EOOB 7CATA 2L6OA 1HXDA 4L9JA 1TD6A 3ABUA 2MW8A 1R5ID 3GTLJ 4HQEA 2MH8A 1GUUA 2VQCA 1J09A 3VYHB 2C5XB 4EONB 1ZG3A 2WADA 1X1AA 2DA6A 3BTLA 3FXLA 2LREA 4DYRA 1IF1A 3PIPF 3RCOA 2XF6A 2I7PA 4M9SA 2PBIA 1JJ8C 3J81K 1BC8C 2VPRA 4EJWA 4KJZA 2XLJA 1VQMI 2A07F 2M4GA 2FOIC 2ZBKB 5FD5A 1ZLJA 1FLIA 2KRHA 2M0MA 5D5XB 5HOOA 4HZFA 2VBZA 3A1YA 2H27A 1LFUP 2FFJA 3GPUA 4BY7J 2K40A 4BUPA 5J47A 1NY6A 2R4EA 3SYKA 5GPAA 5FB2A 1FT9A 4NNJA 3BWGA 3FUXA 5CYIB 2VL8A 3QP6A 3KCCA 4MEYF 1O3QA 3R0AA 2O5RA 4FX3B 4KIBA 1QGPA 1LTMA 3PFIA 2E71A 1VOLA 1Y8RB 1MJAA 4LFUA 3PSIA 4C30A 2O0YA 4Q47A 2L2DA 2DT5A 3LSHA 4OU7A 4TV7A 2YU3A 2H1KA 1MJGM 3H36A 2XAUA 2KHHA 2ZTDA 2WY7Q 3S16J 2QDYB 1EIJA 1DGRM 1XGNA 3RPUA 1YYVA 2DJIA 3C58A 2CHGA 1UNLD 5EEHA 5LMUM 2LYCA 2VJ4A 2XHKA 4EVIA 1AOYA 4EC9B 4ESJA 4X1EA 1Z6RA 2FMYA 2R7GA 1E9HB 4ROCA 4M6VA 2XFSA 1HT2E 1BIAA 2BYVE 3E5XA 3V4GA 4AUXA 4OB1B 4F70B 2XSZA 2EV0A 4DZJA 2XUBA 2MH2A 3A0HC 5JHFA 1X1BA 2KDLA 2IEKA 3I59B 2H8WA 1JKOC 4NHJA 4NSTB 4IKFA 1VF9A 1ONVA 4GKJM 3LW5F 1DGWY 2ZZDB 3X25B 1TWHJ 3ZMUA 2QKLB 1IXRC 2L4MA 3V8LA 2LSOA 3VK7A 3G1MA 1FOXA 1I39A 2R7OA 1W0TA 3J7AY 4C9YA 4N9IA 2VBYA 5EEAA 1DGBA 3M07A 4XORA 4GYIA 2E1MB 4XSXF 2PMZA 3OY9A 3I54A 2JK3A 1WSUA 4BBAA 3B02A 3CCLI 1KQ9A 1WJFA 3TO9A 1ZKGA 3E3VA 1H9TA 1KU9A 2LC2A 4Z6YA 2NVTJ 5IDPB 2Y69H 1XB4A 2P4WA 3HXLA 4XRSG 1UFZA 4LJ5A 1HNXM 1FTTA 5CEIB 2DZOB 3K8ZA 4HEOA 4NL4H 3CESA 3GZNB 4ZDLA 5J4VA 3J80S 4IO9F 3KSXA 3OL3A 3L25A 4PUSA 3P7NA 5D6FA 2ESHA 4XRSA 5LMNM 1BI2A 4A93J 4BBSJ 3D8LA 1OTRA 1ZV1A 1QNTA 2C9OA 2QGSA 4CDGA 6PAXA 3GO8A 3TWMA 2D7HA 5E8IA 1QDRA 4LJZF 3I64A 1JOWA 5DS9A 5ILUA 3BR3A 5CLSA 2IA2A 4HF0A 1GJTA 1MIJA 4FD2A 2FH0A 2R18A 3OOUA 5FD6A 3T1HM 1B9NA 2RC4A 2QQ9A 2LVAA 4GH9A 2UWMA 3CJNA 1XS9A 1K79A 1ACIA 4MFDA 2XPVA 1SXJE 3DU6A 4XNFA 4EOMB 4MTEA 1R71A 2KHMA 3DEUA 4E4HA 3ZQFA 3HOYJ 4BCQB 2I8DA 5GPCA 1SFUA 1AHDP 1K3XA 4B4CA 5FJ8J 1KU2A 3BY6A 1VEKA 5B1AH 5HODA 2ZO4A 2PLYA 2CQXA 4Y3OA 2IGMA 4BH9A 1SFKA 3L7WA 4P9FA 1C0WA 4YC3B 1APLC 5GADJ 2NXNB 2V1XA 4YOZA 2LBFA 1G4AE 2CFOA 1X1CA 5GP9A 2GM4A 1ZG5A 2HTSA 1XMOM 2WV1A 4A3LJ 4FISA 4P55A 1O9KA 1RPWA 4IL6C 2CYYA 1D2NA 2P81A 3R6SA 3UR3C 4BS9A 2RNGA 5ITYA 4DR1M 2FNPA 3Q0UA 1W1WE 4D80A 3U6DA 2K4BA 2R7VA 1KU3A 5KPZA 3BLRB 3M0EA 1S7EA 4AKIA 4ZH4F 4ZYEA 3V7SA 2LOOA 5LBQA 2ZJRF 1SANA 4EJVA 2E5ZA 3FRIA 4KICA 4NB5A 5D4RA 4M74A 2QZ8A 3PSFA 1PVEA 5CKTA 4IBJA 1HR0M 1VQ9I 4CA0A 3FKEA 3AG3H 3BLHB 2DWLA 2DODA 2M7AA 2XKPA 5EG0B 2F4MB 1T08B 3LSRA 3DDQB 1G59A 3DA1A 1WCMJ 1YLAA 3EIEA 4NC8A 1GDTA 3KHIA 4M3DA 3GXOA 3L28A 1RNLA 3E1SA 3K4BA 3DEEA 4M3GA 3UZUA 1ZG1A 1NK2P 5C4XJ 3B73A 1ZR4A 2PMIB 3GTQJ 2HYGD 3OYEA 1JSUB 2IN3A 2VI6A 1OPCA 2ELKA 3BZCA 2C6TB 2XSDC 5LHHA 2VKEA 3W0FA 3SMPA 3EUKL 3L29A 3MZ8A 2KFDA 4KODA 2GA1A 4GKKM 5LGUA 3LQ5B 2FSWA 3QU6A 5FKLA 5E3OA 3OYFA 3W6VA 2CWBA 2L7MP 2BS3A 3OYBA 2LVOC 5F0HA 1QPMA 4R79A 2Y9YA 1V5GA 4D7NA 3GQ3A 4JX6A 3FXQA 1WJEA 2GA2A 1FYLA 4GGGA 4M72A 3GRVA 2HYJA 2CHQA 3R8FA 3DF8A 3Q5FA 2M5ZA 4LITA 2FE8A 1S6LA 3JCUC 3S8PA 2MGWA 3ASNH 3LNQA 2CGPA 2CQ7A 1PJIA 2GNOA 2BJVA 1P4XA 1P9QC 3MKYB 2D45A 2WPAB 3FYCA 2CFXA 4RAZA 5CVJA 1U78A 3ZC7B 3K0LA 1R1VA 2IVMA 1T39A 1Z6TA 5EP2A 3GLGB 1ETWA 1O57A 1IN5A 2R7RA 2Y9ZA 1UGSB 3GZ5A 4BB9A 5E1ZB 4N9HA 1IJWC 2DHYA 4FCTA 3HYIA 4L9TA 2QCOA 1U6GA 4OU0A 1QAQA 2BJWA 3Q8GA 3K1MA 3IUOA 3FUVA 4M0DA 3Q9VA 1T2KA 2JZYA 1BBYA 3DPTA 4RLQA 5HDNA 2JN6A 4HLXA 5LEJA 3CCRI 2G8LA 2JVGA 3QQAA 3J7ZI 2EFOA 3KP2A 2ZPEB 1XGSA 3KXEC 2LKSA 3D5LA 3E5UA 4AVZA 3OYDA 3LAPA 3PUBA 2R7TA 4IBKA 5EXXA 3S15J 3ONQA 2BXZA 2DAKA 5J6XA 1PUFA 3ABMH 5E20A 3AG2H 2DMUA 3F5XB 5JI3E 1I1GA 4KRDB 3DTEA 1H8AC 3AKZA 4EGYA 1HF0A 4IQJA 2LK2A 3IWZA 1IN6A 3IHUA 3QYFA 1Q3BA 1YRNA 4IHTA 1R4MB 3ULQB 1QQWA 3E7LA 3BR5A 4L18B 4DQ2A 1GVDA 2KW0A 1LPQA 4DIQA 1AKHB 2DAMA 4AI6A 1ORYB 3GLHB 2VC1A 3EPZA 3U1KA 2B3TA 1IN4A 5L3DA 3E9SA 4WCGA 1D3YA 3HPHA 3ESWB 1XB2B 1NTCA 4D1QA 2MGQA 1T3TA 2OAZA 1YIJI 3CTWB 4GCVA 5IP9J 2CW8A 2GXAA 2CJMB 4CGZA 2AHJB 4N4OB 2YU9J 2JA2A 1BR1A 1WWXA 4BDYA 1DU6A 4MEXF 2WY8Q 2KJCA 2W4SA 2VPLA 2L9VA 4MTDA 1V5FA 2DWZB 2LKXA 1HLVA 4GC9A 1VQ6I 3ZMTA 3FM3A 5ICCA 1YIOA 5C1BA 4DYQA 1LUJB 5FKNA 4BCNB 3SAVA 3SXYA 1Y1WJ 1KYWA 3HJSA 1QAOA 3CUOA 2VIIA 3H5RA 1GY3B 4KITB 2Y48A 2PJRB 1OL1B 1W5SA 3WHKA 1IQPA 1NY5A 3U6LA 1H4LD 5HS8A 4DR3M 5FGKB 5IZ7D 3BG3A 4IIWA 1YW8A 3Q3SA 3ZMSA 1ZP2A 3S14J 1XD7A 1TC3C 1XHBA 1T0FA 5L3EA 3CP2A 4OMZA 3S1MJ 3VYTB 2XSZD 4XK8F 5IT9S 4BCMD 2VJJA 4RKUF 3KFWX 1XSDA 1UM8A 3AOGA 4L9NA 4LD5A 4N4NB 3CCEI 3K7AM 1K4TA 1RUOA 2KRFA 1K4SA 1A31A 5K1YA 3H3ZA 2MFZA 2W9ZA 5ICGA 2NRAC 4W1UA 4BHPA 3SARA 1WPKA 3EUAA 1YO5C 2QSGX 3HHHA 1VG5A 4L15A 3I5UA 1FP1D 1U5TA 2B7EA 2TRTA 4BACA 3SQNA 4ZYAA 3F8BA 5E8GA 2C5OB 4EIWA 2QYOA 3K9PA 2G7HA 4E7IA 3BR6A 1T6OA 1RESA 3WE2A 4LCBA 3X2QH 1X58A 1KU7A 2LFBA 4KUMA 4FT8A 2OO9A 1TWCJ 3IECA 3DEWA 2DA5A 4NC7A 1L8QA 2LH0A 1VQKI 5J1UA 2LW4A 4AKHA 1JGSA 1FBUA 5KQDA 1K82A 2ZNYA 2MJ5B 3S17J 2UZDB 2ERCA 3LOCA 1Y8QB 2E19A 2MLGA 3W6JB 3QZ9B 2F4OB 3WGGA 2I53A 1OCCH 3M6AA 1WGNA 2GXGA 4CGYB 3CCYA 4KNYA 3CMEI 2RVCA 1BC7C 1J7KA 2MABA 4W97A 4C2TA 4EJTA 2LY2A 2ZJQF 3K10A 2YPRA 2W7NA 2H8RA 4U0WA 4B7GA 1HDPA 1ZELA 3H3UA 3GTOJ 2VDBB 3P9CA 1N4MA 3SEQA 3IHPA 2F5QA 1W7PD 4KIFA 5IDNB 2OZ6A 1HW1A 1XMKA 4JK1X 2HEOA 2QCUA 2BHYA 2RDPA 5JVTA 4BCQD 4AYBN 2CQKA 1RI7A 2K7LA 1JR3D 4IBCA 1UFMA 2EB7A 3GLLA 5EYRA 3TNWB 3G1OA 3THGA 2FBHA 4F92B 4NUBA 2V1DA 3AL0B 3DXJF 3TEDA 3F8CA 4DBGB 1ZH5A 1DPUA 2R5YA 1V5EA 3B9PA 2V6ZM 2ZM6M 1O7LA 1WJ7A 1GXPA 2VF7A 2PK9B 4DV5M 3TOBA 2BVLA 2OCCH 2KKOA 3DTKA 2LBCA 3D5RC 3DCFA 2DK8A 4EJUA 4ZYDA 3CCSI 4LJ4A 5HDGA 4BCJB 2RGOA 3LSGA 5B5EC 4Y52J 3CZ6A 5CYVA 3PNYA 4PCQA 1P7JA 1R6RA 1HSTA 2HVQA 3P9KA 2XGEA 1D3UB 2HDWA 2Y0SA 3WTWC 2M3AA 2LHGA 2K27A 1NG6A 3HKZA 2M34A 1JI8A 4E7LA 1KXUA 3C2BA 3DKXA 1WRJA 2ISYA 3AJIB 1UELB 3VODA 4A3CJ 4LK0F 3GP1A 1D0KA 5ITRA 3OS1A 3HGIA 1IY2A 2UXNA 3C18A 3ZN0A 1LKXA 3JAMK 3SHGB 3M8EA 2GIVA 2C9CA 2JUCA 3D1NI 3KP6A 4B48A 2W2HA 2XROA 1MW7A 4UV8A 4EATA 1STZA 3UNGC 3KZIC 2FEZA 1DP3A 2XGDA 5IT9K 2R65A 3MY5B 3POMA 4RBOA 1Y0NA 4D5FA 4XQFA 2CWEA 3WTTC 1JT6A 4E7HA 3JTGA 4E70A 3M03A 2EFPA 4DV1M 2F5DA 2QWWA 4RB0A 1UNHD 2UZKA 2JA7J 2ZPHB 1P7IA 3PNVA 2LF7A 4I8OA 2JA5J 4BE2A 2IS1A 3PO2J 4BXFA 3ZQLA 1TH4A 3JSOA 4J00A 3FK7A 4UV9A 2ELHA 1OFCX 2HQ5A 5HNFA 1MNMC 4Q5SF 2KMUA 3FXMA 1CGPA 3DOGB 5IHYA 3DKYA 1B72A 1GH6B 3I9V2 3K4KA 5EGOA 4BXXX 2G77A 4ELJA 4EOJB 1FZPB 5ITXA 1D0YA 2EIJH 4ZDPA 2JWSA 2OU2A 3G2BA 4QPQA 1XXHE 4ANRA 3T15A 2F5FA 1NH3A 2E34A 3OV8A 4JYKA 2PJRA 2CQNA 2FJ1A 1R36A 2NNNA 3J2PB 3L9FA 4F7ZA 4PJLA 4XN3A 3I04M 2F4VM 3OYLA 3SYLA 4TTHA 4X62M 4B44A 3HX3A 1IXSB 4NSOB 4ZPXA 1X4OA 2O01F 5EJCA 2G9WA 2XPUA 3GEZA 3LSJA 2C5RA 2LKPA 2X1DA 3MEXA 4W5WA 2NOGA 3SBJA 3H5NA 3RKXA 5E17F 2HOAA 3JREA 4XKBA 4I09A 3OYKA 4JI8M 4HNTA 3MK6A 1BR4A 2KL4A 3BCAA 2PK2A 3WTXC 2XAHA 3BQZA 4I98B 1O3TA 1OYIA 3QYBA 3BHUB 4A5NA 1TR8A 1MSEC 3IG8A 1LFPA 2FMLA 3GBGA 1U9OA 2HHHM 4Y17A 1H24B 3X24B 4S0HB 3CMYA 2HDDA 2QM3A 3BG7A 2ID3A 4LG0B 3JRBA 4XGIA 3WHCA 4YFXF 4NQWA 5E3MA 3CDLA 4I6ZA 3GF2A 5D8KB 3GTKJ 4B7HA 1RU3A 4JI0M 3B89A 2DWNA 2V9VA 2VQLA 3VPRA 1GKIA 2DNAA 1HKSA 2EIMH 3HOXJ 4CRLB 1ENWA 2FX0A 3K2ZA 3U6PA 3IWFA 3IKVA 4PFPA 3HL2A 2XF7A 4WWCA 1AU7A 1VDLA 4DV7M 1H1PB 2CUFA 2L4FA 4M3EA 1QHGA 3FXUA 3ZMDA 1BA5A 4BL0B 4DR2M 5FO5A 1VI0A 2A6HF 3ZXSA 2Y0MA 5D4SA 2LWXA 5IT3A 5K5RA 4IJEA 4X65M 3D8BA 4AG5A 5BR8M 2WTEA 1DGGA 4AZFA 3HRUA 4XL9A 5H2FC 3FM5A 4ZZDA 4YG2F 5J8FA 4JQFA 1ZMUA 1VYWB 1QHHD 2EKKA 3KEOA 2BE5F 2ZCFB 1IG7A 4KT6A 2DT7B 5K7FA 3VYUB 3ELKA 3GMEA 3WE3A 3VYSB 1YOVB 1R1TA 3FXOA 1PP7U 1IRGA 3MZHA 4BQOA 4UNOA 1QU3A 2R5YB 1FSHA 2UZLB 2H5XA 3I51A 2K9DA 5D6EA 1UGQB 1NJFA 1VQ4I 2ZAMA 3TW7A 1QBJA 1D5YA 3UK6A 1H1QB 3BROA 3IH4A 3HM5A 4WF2A 4XMYA 2WSFF 4A5MA 4IZZA 1HQCA 2J5OA 2Z16A 3K1PA 4BHCA 1ITYA 3DJBA 2IGOA 2M60A 3V42A 4AQYM 2OCEA 2DI0A 2R7WA 2CJJA 1ZLKA 1X1DA 1IBLM 4L0YB 4QHSA 5JR3A 3A42A 1BI1A 1XSVA 1JGGA 1SAXA 2FNAA 1DV0A 1ULYA 1UHWA 2IGKA 2MBFA 1R5HA 2WZJA 3NEUA 4C3HJ 1R5GA 5JLXA 1N33M 4IBIA 4Q7JA 4JN6A 1R2ZA 2V9KA 2XGCA 3U5ZB 1FNNA 2Y21A 3K2AA 3QODA 1OFIA 2IBDA 2Y75A 1H6UA 3LMMA 3VLFB 2O8XA 2C5NB 2Z99A 3U2RA 2NOJB 3M8JA 2YS9A 4CCJA 3B7QA 3U60B 4F7SB 3FF5A 3CJRB 2IW9B 1E3OC 2FQ3A 3WU2C 3NWSA 3H3VK 1KA8A 2W00A 4L9VA 2WB1N 4KRCB 3GTMJ 3U6EA 2L9SA 3RKYA 5E3NA 2KR6A 2LNBA 2IVXA 3DTIA 4B8XA 4AIKA 1Z5CA 1EH7A 2FOKA 2Z2SB 2Z5UA 2QSHX 1BW5A 1R4GA 1CF7A 1MD0A 4KA4A 5FLVA 1BJAA 1UG0A 3I4MJ 2ECCA 1YW9A 2Z8YM 1BVSA 1TWAJ 5LD2C 1K83J 2LY9A 2ZCWA 1P5EB 5F0CA 5JI6A 4EQQA 3CDIA 3OR2C 2H09A 1WFXA 5KAIC 2X0LA 5AIPA 5FFZA 2QVOA 4MGYE 2VQFM 4BGDA 2QQAA 5EP1A 4HLYA 3GTMS 4I0AA 4XONA 1OFHA 4HNVA 3S93A 3HRSA 1HBXG 4ITQA 3ZQQA 3LSMA 1YQAA 2Z33A 1RRJA 2LTPA 3C2GA 4XRMA 4L4UA 4DW6A 3J7AS 5FRNA 1ETOA 3BLQB 3RPUD 3W3CA 4FE7A 4XLEA 1GL7A 2VUMJ 3ABLH 2LVQD 3EJ1B 4X0GA 2M9HA 2A6EF 1LDKB 4BU2A 3HY5A 5DM7F 3OMYA 1HC8A 2V1UA 2HYFA 2KNAA 2IP2A 2WSCF 1PM5A 1Z67A 3MWMA 4CYCA 3J7YJ 1UB9A 1TFBA 3KPHA 3PO3S 1E9SA 1N32M 1R7JA 4FETA 4NQWB 3X20B 1XCVA 4YFNF 3OSGA 2EWNA 1O9KB 2P5KA 1H25B 4YIFA 4EOQB 2OOBA 4X6AJ 5HLHA 2QHOB 2QP9X 3U5ZA 2UV1A 4A2UA 3IV5A 2VJIA 3S2HJ 3QHRB 4MLOA 4DV3M 2HI3A 1HT1E 2MC4A 2LMDA 2ZPIB 2UUZA 1X3WB 2VOOA 3HOWJ 4DUZM 4MO7A 4U7BA 2E35A 1UGRB 1EE8A 1PJRA 1H28B 5A2QZ 4EOPB 4DR4M 4KISA 1SMTA 2E1MC 3F8NA 2WMAB 4HA8A 1MMGA 2EZLA 4CJ6A 4PJMA 1PUEE 2DAIA 3MJ5A 2KIQA 3E6CC 1D0XA 3SZPA 3VKGA 3HG9A 3O6BB 1RR8C 4OAZA 3ZQHA 2C98A 2W48A 4F93B 1YG2A 3BLYA 2GOXB 1N36M 3HSFA 3L09A 4BAYA 2ZMEC 2JY6B 4BQNA 2DZLA 2M2EA 1O3RA 2JQ7A 2YUSA 2PX9A 2I10A 2OBPA 3Q0WA 2UUAM 3JTHA 2NVUB 4WW0A 1SD5A 2R7XA 2F2CA 1AKHA 3LA7A 1MBKA 2XSJC 2LLKA 2UUBM 2LTUA 4B3AA 3HU1A 4IBGA 5TISC 2G7UA 3TBIA 1PKDB 1TF0B 2CUZA 4YHHM 2N8GA 4BLCA 2HS5A 2E7WA 3E21A 3WU0A 1IXSA 5E1WA 3LSPA 5DTDA 2I7NA 2W25A 4HX7A 1ZGJA 3BJOA 1Q02A 2N35A 3O0GD 4LGMA 2HTJA 3RKWA 1M1EB 3ROUA 5TGTA 4HBLA 3FMRA 1IW7F 4EM2A 2X6XA 1UNGD 2Z9OA 1O7FA 3BPVA 4CHUA 1SXJA 1K61A 1YS7A 5HBHB 3FTFA 5LRRA 5H20A 3DZDA 2EA2A 4GEWA 2E1NA 3BG5A 4EM0B 4G6QA 4UHTA 1A5TA 4CO8A 5DFLA 2ETHA 3Q9SA 3VSKA 3BOSA 1IO2A 2F2EA 2V7FA 3CDHA 4MB7A 3MD2A 3TW6A 3E4RA 2KJBA 3RI4A 2DPDA 2O9LA 1XO2A 3QYGB 2KRCA 2XFTA 4DUYM 1LQ1A 2Z4SA 1ZR2A 2ZAOA 2JJ7A 3SDBA 3BR0A 1IXZA 3RE8A 3NBIA 3GPXA 4U87A 2ID6A 2O6GE 2KZGA 4PFOA 2WB1A 5CJ9A 1CF7B 4RLFA 4RM2A 2M87A 3RJPA 3L2UA 3LQRA 4LFCM 1XDSA 1S29A 3CGWA 3JAMZ 4JI1M 2VQEM 3GLHA 4JX5A 1R4NB 4ZJZA 4ZGJB 1B6AA 4MH0E 3HO8A 1JHFA 3KP0E 3A8OB 4D7MA 2QBYB 2RV8A 2Y0TA 3HHGA 4G3OA 3E46A 2KNZA 3V7CA 4AVPA 4XBOA 1ETVA 1QUSA 4Q4ZF 2W9FA 1S9HA 1IRFA 4IEJA 3E6DA 4A3MJ 4ZYGA 3I4NJ 3BXWA 4F7LB 3BOQA 2DWMA 4R1HA 4II2A 3KS8A 4KYWA 1DGHA 2CV0A 4R3DA 1HW5A 5F27A 3GFMA 4FWDA 4ZGEB 3VYRB 2WIHB 3BG6A 3VFZA 4II7A 2D1VA 3FIWA 1SFOJ 2KPMA 3HHZA 2R4JA 3R61A 2IS2A 3GO5A 4CH7A 4BQAA 4FQGA 4XKVA 4R7GA 1P4AA 3RQ4A 1V54H 4JBAA 3GCMA 1TTYA 1SAUA 4ZC3A 2CW7A 3KP3A 1XX5A 4RGSA 2Q1ZB 1W98B 5I5ZB 1QMZB 3HU3A 2NS8A 4X64M 1MH3A 3A46A 3L2RA 1L2BA 1G3YA 4CSWA 3Q8XA 1SFEA 1Y8GA 1P3QQ 1V33A 3B7ZA 3FUWA 1L2DA 5DCMA 2BW3B 4C2UA 1X19A 5GTHC 1R9TJ 2W82A 3KOYE 2NS7A 3LVVA 1PRBA 3CF6E 2DMTA 4XLPF 4OIPF 4BKXA 4HLQA 3KOXE 3GLXA 4OX9M 1B1BA 4NXMM 2BOLA 3GFIA 2DFEA 3HB9A 1JKQC 1NVMA 2C96A 2VE8A 3KZYA 3TNHB 2FE3A 3U6QA 5IYBJ 2X1NB 4LF4M 5BS6A 3BT9A 1AA7A 2JXNA 3FHZA 1XCBA 2HPMA 1IN7A 1Q39A 2OQGA 1SC7A 2XF5A 4Y15A 3WHLA 1SD4A 2K5CA 3PQKA 4ZZLA 1OCOH 5IYCJ 3S1NJ 4BE0A 2UUCM 5JLWA 1IDYA 5L2WB 4U7DA 4B43A 2YX7A 4DV4M 3ML6A 2ZXIA 1FKMA 1AUAA 4PDGA 2QENA 4MGIE 1WJBA 3KP1E 2OPTA 3IH3A 4LLGF 1OIPA 2EV5A 2L7ZA 3ZOBA 3T38A 1FJGM 1D0MA 2RAEA 1QO0D 5CPRB 4HX8A 5BNJB 2DJNA 4DR6M 4BDZA 2G5GX 1QLBA 4HSTA 2ECBA 3CCUI 4F7JB 3IRQA 4XKWA 1Z59A 3BR2A 3LQQA 2HWJA 1OGUB 2ADUA 1I94M 1G71A 2AQFA 4M9ZA 3F9KA 1J0RA 3ZQJA 5EF6A 4IRIA 1IDZA 4WP2A 2MC3A 1B59A 2JY8A 1FWZA 3T6PA 2VONA 1MNEA 5IY5H 4HYEA 2EUFA 3K70D 1MX0A 3ZN1A 3F3XA 3PO3J 1MN3A 3KEYA 1QQIA 3RKQA 2DTZA 4G7HF 3V76A 3HJEA 4V19K 1GUXA 1MJ9A 1LE8A 3OSFA 4F2LA 2B9SA 4IF4A 2QA4I 3A45A 2VIXA 3LSTA 1ERDA 2FA5A 1H1SB 2DFFA 2EFWA 1U0JA 3FZVA 2EO2A 3L27A 1VEJA 2D7GA 3A01A 4IHXA 3KFUG 1PGYA 4EORB 2EZKA 5FKOA 9ANTA 1G8PA 1JQJC 1AIPC 1B9MA 4JYAM 3KW6A 1TNSA 3HKPA 4PDKA 1HW2A 2PJPA 2P5TA 1Q1HA 3JRFA 3GX4X 4L5JA 3VFDA 1Y1VJ 5BPDA 3K4LA 2WXVB 1G41A 4MGHA 3VB2A 4P16A 4V2GA 3HOVJ 3HUGA 5LGTA 3MMYB 2V79A 2BS4A 1TDZA 1MBJA 3SYTA 4MFEA 5GAHJ 3CLQA 3JRDA 5B3SH 5EXSA 4PCZA 4HOBA 4X66M 1Q1VA 5DDGA 5K5QA 3EYYA 2OTLI 2O25A 3ABTA 2CV2A 3JRIA 3ABKH 1QANA 2DMNA 1L3LA 1BJZA 3BZ6A 3H35A 1T33A 1ZN2A 5FLMJ 1R1UA 4ZGDB 4AIDA 3CCQI 2L7IA 2GQQA 1BR2A 3MQ0A 4HV6A 4I7HA 2VB6A 4CXAB 1R5LA 1ETYA 1K6YA 5ILVA 4CFMB 1BI3A 1Q3CA 1T43A 1RKTA 2MSYA 3IP4B 4G94A 4YOSA 3O3KA 4F3QA 2VASA 5D5WB 2W96A 2BBYA 1QZMA 3A03A 1UCRA 3H9JA 1ZAOA 1VQ1A 1TZLA 5L3BA 2KIMA 5IPAA 2F5EA 3SDGA 5K5OA 2PMUA 1USSA 2MD0A 1HCRA 2WAEA 3UMMA 1TQMA 4PGGA 2DKLA 3DV8A 4QOSA 2XH9A 5LEKA 3JSPA 3H9GA 5D5VB 1ZGAA 2VT2A 1N25A 1QZEA 3ZR8X 1U8BA 3EYIA 2LVSA 3F6OA 2OZUA 4HQMA 1OCZH 3HPGA 3TDUC 4ETSA 2O61A 1IREB 1K3WA 3M1EA 2CYZB 2UZEB 1XMXA 2DQRA 2K9NA 5FKKA 3TOAA 2X51A 3N05A 1N34M 2L02A 3OIOA 3BHTB 4EOSB 3S2WA 2CSOA 3I4PA 2HZDA 1ZMWA 2VBWA 3R60A 4GDFA 1A35A 2V6CA 2K3PA 3VEPA 1GLNA 3RQIA 4FE4A 3TWLA 4BCIB 5HLGA 3ZQCA 1E2XA 4IHWA 3FBNB 2O03A 4OW0A 1SVOA 1ON1A 1XC8A 4HL4A 3ZGKA 1TQIA 4XBFA 5EQTA 2XKOA 1OJLA 4B7FA 1NHGC 4YRVA 4CFUB 2CW0F 4DR5M 2BZTA 1OAIA 4A6DA 4G6DA 3SZTA 4G4QA 3PM1A 5IP6A 2R7FA 2M45A 4A3JJ 5ITTA 2NVQJ 3WTYC 4IJAA 3MZYA 2IAIA 4AD9A 1TGUA 2E5NA 4I4LA 4XIDA 5EP4A 1NV9A 3GW2A 2X6YA 1D0ZA 2Y2ZA 3KLOA 4CIZA 1ZQ9A 1WJ5A 1OAOC 5ILSA 3A8LB 5L3GA 4P5OA 3KLNA 3MKZA 5LMKB 4RAYA 1BOBA 3L26A 1Z3XA 1LEAA 3E0JB 4EOLB 5E18F 2JZ1A 3IRRA 3ILKA 2UU9M 1TP4A 1KFVA 5A2QK 4BCPB 4H4KC 1PUFB 5E6JA 5F6FA 1J5EM 3VDPA 3ECHA 3I59A 3G73A 2DDBA 4HF1A 3W0LB 2VKHA 4KFCA 4F7NB 4I3ZB 5ITXE 4DV0M 4II3A 1AHJB 4PD2A 2E7XA 4A3GJ 1D1CA 5IF1B 2DYSH 2V22B 2CZ1B 2DOFA 2ICWG 3U60A 2FQ4A 3FHNA 1OQYA 1I6HJ 4CCNA 1LVKA 4CZCA 2DOAA 4J19A 1EFUB 1VNDA 3HIFA 5DCMB 1MMAA 2STWA 1IRZA 1U5TB 3HTSB 5FTKA 2DMQA 3JW4A 2WC2A 2IPQX 2AO9A 4QTRA 1XGOA 4H0EA 2CRUA 5DYMA 2QFZA 3GLIB 4B09A 3J80Z 3V8KA 4FCYA 1V3FA 1EH6A 3L2AA 5LRSA 2KZVA 3U6CA 4L78A 2HOTA 4IHYA 3VSLA 1TDHA 2CE7A 1R58A 4FTHA 4B3SM 4GYGA 1HOMA 1OR7A 2DO7A 4BE1A 2STTA 4OMYA 2WAFA 2F48A 4FWGA 1JTXA 3DU5A 1WJDA 1XSXA 4QSHA 2DFHA 2FXAA 4G4OA 4I02A 3CCMI 2NNYA 2ELJA 1DO0A 5DYIA 1T6SA 2Z7JA 3A01B 2B0LA 1TBXA 1ZGWA 5J1YA 2C4GB 2DA4A 2RREA 3UGJA 1L2CA 2K6BA 2NVYJ 3ASOH 4KT0F 3BZKA 3QWLA 2A61A 3BTIA 3I4VA 4JI7M 1H26B 3C3DA 1LJ9A 4BY1J 3L2CA 1V29B 4C3JJ 2YQZA 1VQLI 1XXHA 1UAAA 3ZQIA 5FLXZ 3C1DA 2XPWA 4M71A 3FXKA 3MVPA 5IP7J 2DW4A 4M0WA 1W7PA 4UVAA 3H9QA 4Y33A 2UXBM 3HTUA 1A36A 3L1PA 3U61A 1CQTA 3H0DA 3GVAA 3ERMA 4AM3A 4S12A 2L2OA 3GLFA 2PQ8A 1OKRA 1H88C 5ICPB 2DCEA 3BG9A 2DU9A 1FP2A 2DXCB 2R7QA 2HL7A 1JUSA 2HOEA 4UB8C 5LHIA 4ENKA 3A98B 5LQFB 2V9PA 1WI9A 1B4AA 4UB6C 4A0XA 1EJ9A 3K7AJ 2NQ8C 1Z7UA 4KT5C 4L5EA 2VQHA 2HU9A 2WA0A 3GZ6A 1J75A 3D0SA 3KYLA 1FSEA 1RZ4A 1F43A 1AD6A 1ODDA 3LSIA 3QRFF 2LVPC 3RGPA 2CS3A 3VK8A 3KP5A 2ME0A 2EZHA 5E79C 5KAFC 2E2IJ 2OTJI 4GHLA 4MQ9F 3OS2A 2CV1A 4BEHB 1KONA 1QA6A 4LB6B 4A3VB 2XC7A 2A69F 5BQTA 2HGCA 4A3IJ 2DD4B 5F1JA 1GV5A 3M8FA 4RF1A 1OCRH 3LA2A 2ZJPF 4IBDA 5L8RF 4ZDOA 4G6ZA 2JMWA 4FVMA 2ZPBB 1SVLA 2HWVA 2HPIA 2LH9A 1A04A 5FLXS 1VZ0A 3SHFA 2D2WA 5KK1A 1NV8A 2EFNA 2HXIA 4LJ8A 4MM3B 4XICA 1LDDA 2KZUA 1MMNA 3PVSA 2V6EA 2CUJA 4LOCA 1IRXA 3EETA 2HQNA 1HKQA 2EH3A 2LRDA 3PL8A 4WXDA 2HQAA 1F36A 5CVVA 3QZ5B 3K9OA 2XV4S 3P5JA 2D7EA 2DAOA 3OTOM 3KYCB 4ABZA 5GAEJ 1NK3P 4TUWA 1TWFJ 4Y4RA 2HCBA 2ZB9A 2ZMEA 2ZFWA 3WG9A 5F1RA 1JSTB 2X4AA 4EJOA 3A4CA 2L3DA 4CYCB 2WMBB 1QVRA 2CHVA 2H6BA 1Z7LA 4HF2A 2EPFA 2F5CA 2CH0A 4XM3A 4UY8I 5CQEA 3WGHA 1JUPA 1G3SA 1P4WA 2H1RA 1UMQA 3CC4I 4HSRA 4WX9A 2KDZA 2MR9A 1HNZM 3ZCOA 4RGRA 2YFQA 2R46A 2ZTCA 1FOWA 3QPLA 2IRFG 3GLIA 3KOZE 3GLIE 4EM1A 4ELLA 2L4EA 1MBGA 3F6VA 1WJAA 5HBJB 1HKTA 2D5VA 2DI3A 1HDDC 5GAGJ 1G3WA 2M7BA 4LGWA 3FK6A 1XGMA 3TO6A 3E5QA 4Y28F 2K9SA 3JRAA 2QPAA 1SXJC 3MIAB 5DV5A 2ZXHA 2ZPFB 3RYRA 4O3MA 1XXHB 2XF3A 3CF0A 2BXYA 3CF5F 3ZCBB 2Q2EA 5AONA 2QF7A 2QUFA 2R7DA 3A2KA 1WGLA 1F1ZA 1RKWA 3FUUA 1Z0XA 2BV6A 1GJSA 4ZYHA 4QLCU 1L1ZA 3F21A 1WGXA 1SEUA 3TO7A 3K70C 4A69C 3TWKA 1W4MA 2R45A 3B6CA 3DFGA 4PJ0C 1YW7A 4OINF 2YX4A 5BNGA 2K9QA 1EKEA 2P5VA 2P5LC 1EV7A 3TMOA 3RFWA 1BN5A 2X9DA 5TJJA 2E1CA 2BVMA 3COAC 3FKIJ 4QOZC 4GMQA 4BCOB 5D5UB 1G2HA 2P7CB 3W2VA 3WTVC 3ERED 1XDUA 4HRIA 4G4RA 1GVJA 1GT0C 2EFQA 1DGHB 1QPIA 2AXTC 2L01A 5EZHA 5DD8A 2DOEA 1BW6A 1WJCA 1REPC 3TP0A 2KMGA 4ROEA 1ETXA 2R5ZB 2Z3XA 3SEZA 4JP0A 4GFBA 4LLLA 5EP3A 2DPUA 3NWLA 2KNVA 1VFCA 2C99A 3R0JA 4BCND 1O4XA 1OISA 5C18A 2HXOA 5KNLA 1DPRA 3GYHX 2KT0A 3MFKA 4JI5M 2TCTA 1MMSA 3BC8A 3KZZA 4CFUD 2RQPA 5J3LA 1PP8F 3ZH9B 2WEVB 4LY6A 2JUGA 1SMYF 3SZGA 2MA3A 3V7RA 3WVDB 1FYKA 1F4IA 3CUQC 2R6FA 2BS2A 2WWYA 4JXJA 4WXHA 2GZWA 1E17A 1BL0A 3TGNA 2K4JA 2OQ4A 2FRHA 4XLCA 3A8MB 5HVYB 2CCIB 2YSRA 2ZKZA 3TPZA 3CMMA 1BU2A 1E32A 4RAFA 3VYGB 4IBBA 1E3HA 1YRNB 2QDJA 4FCWA 4DNCA 1X4PA 3JR5A 4CUGA 5EFQB 1XMAA 2K85A 4KIGA 4QIWN 5FTNA 4EOIB 1F9NA 3RSNA 1WQ2A 2QSFX 1ZHFA 2X6OA 3HHTB 5HS7A 3M4OJ 2CZ7B 1MKMA 2J5YA 4LRTA 1LDJA 1DGFA 1U8RA 4B3MM 2OQRA 3DBLB 3RGSA 3F92A 2X1CA 3KIOA 2DA1A 4M3BA 1NG7A 4XOPA 2W85A 5IT9Z 4OGRB 5M3MJ 2QZ4A 2P6TA 5L3CA 1V55H 3RPQA 1WIVA 2C5VB 1MGTA 1IUYA 5EXTA 1FEXA 2R7ZJ 2H6CA 5ICFA 3L00A 1S7OA 3LSKA 2CCHB 4DGWB 4E7KA 3FMSA 1VQ8I 1H27B 1F4KA 3X28B 1UJ8A 1RC9A 4I99C 4GIPA 4UUVA 1GL6A 2M8EA 3S32A 3MMPA 2IGNA 2EA4A 1T38A 3OYGA 3FWEA 2OC6A 3QP5A 1JTYA 2R62A 5ICEA 3M3YJ 2WJ9A 3JRHA 3C3WA 4NDLA 4LRSA 2F5VA 4OIOF 2BY0A 1NHWC 3HJQA 4PJJA 4A3DJ 3I55I 3KSJA 5HLTA 1FMVA 4BEHA 4JV5M 2L9NA 2L7HA 4LG2A 3OWTA 3QAHA 4MHGA 1I50J 3DBRB 1JT0A 2VBXA 1YTYA 4A3KJ 1NJGA 4EOKB 2KIUA 1SXJD 2X1EA 2ZMEB 3OYIA 1TT0A 2PN6A 2FUG2 2K86A 2OUMA 2FBIA 2XAQA 4KMUX 1OR7C 3T1BA 2Z4RA 1XPXA 4JX4A 1PDNC 2KEBA 3SMSA 4E7ZA 1LFBA 4LZZA 1J5YA 3JR9A 3HOTA 3FTDA 1MDMB 2M5WA 4AWXB 4RA2A 2WFYB 4FCVA 4DOZA 2EBIA 2ZSIB 3FMQA 1VQOI 2ACJA 2RNJA 4LF6M 3SATA 3BP8A 1GUXB 3LFUA 4QNRA 3HRMA 2A5YB 5KCMA 3MKWB 2EK5A 1T8IA 2DMEA 1G3IA 3KP7A 3HJ8A 3KP4A 1FOKA 4O5VA 3SFIA 1QVUA 4IVNA 2HDCA 4MGRA 2VJ5A 3HOSA 4ESBA 5HNHA 5HVQC 2Q2EB 2E1OA 3FISA 3K4JA 3LCVB 3N4MA 4IRGA 3GQ5A 4KN7X 4IPAA 4KN4X 3K92A 1Y0UA 4XLAA 1I4WA 4ENJA 1Y39A 3DWLE 4CYDA 2R5ZA 1IXCA 4CZZA 3FYDA 2DD5B 4XR6A 1FY7A 2E60A 3F8FA 3GPYA 2F5OA 4DZPA 3CMAI 1FPQA 3CJTB 4CFVB 2JA6J 2X85A 5L3FA 3I71A 2KA6B 3WGIA 5KQ8A 5IOYA 1OIZA 1MZBA 2V1NA 2L7KA 1MU5A 2XRLA 4IX7A 3RGFB 2AXLA 1CUKA 3DQVC 4D82A 4D81A 3PUFA 2ME6A 5FRMA 3QOPA 2IXSA 5F64A 1IUFA 3S1RJ 1FIPA 4Z8XA 2EILH 2O7OA 1T95A 3J80K 1WXQA 2CO5A 2BWBA 4F55A 3OS0A 2VODA 2P0WA 2WV0A 3HBLA 3D5SC 4G7ZF 1D5VA 1YX3A 2DBBA 3OYNA 1FBQA 5J8CA 3IL2A 1K78A 2HVSA 3ZMZA 2YR0A 4KO8A 3K1JA 4BJTA 2R44A 2R7SA 4BY1X 2ZANA 2V1CA 3HEFA 4ANJA 4L6V6 1QYRA 4I5SA 3B7NA 1P6RA 3A8HB 4G6LB 4NC6A 3OR1C 1JKRC 3TL4X 3U1DA 1ON2A 2FD5A 3O2PE 1HJPA 5H37D 5LGNA 3Q0VA 1W0UA 1SFXA 2VXDA 1AWCA 1GHCA 1B8IB 4U0YA 4WK8F 4YOOA 5BPIA 3FKJA 1ZRDA 4DV6M 1X3ZB 3C2HA 1YJ9I 2UXXA 4F91B 1YE9A 2LG4A 4CICA 2LVNC 3R9XB 1RETA 1OI9B 2P8TA 5IYDJ 1PJQA 2J5PA 2L54A 4G9YA 2KXEA 1HQYE 4HG2A 3HWSA 5AIQA 3W6KB 3H4CA 5C4JJ 3KX2A 1OKWB 5GKNA 2XGXA 2F4IA 1SXJB 2JPBA 1MNDA 2CP8A 1WI3A 2YR2A 2P6SA 1Z21A 3WHBA 4RF0A 4UN2B 1FX7A 2JVHA 3HKZN 4P96A 3GTJJ 2Y0SN 2A05A 1QUTA 5EEGA 4OOIA 2L9RA 2DK5A 1ZYRF 2HQRA 3CP8A 5H6QA 5ED4A 4IQ4A 1MBFA 1MBEA 3QAUA 2GAUA 4WXCA 5ERIA 1BI0A 2D0QB 1F5QB 3EOCB 3REOA 3QHWB 3WTSC 4RGXA 2L4AA 4GC5A 2ZJ2A 1W7PB 4HDVA 1FBSA 4E7JA 1IY0A 2LF8A 1MMDA 4HX4A 1IBMM 1TW2A 2HNHA 2ZNZA 4EV0A 2HOSA 1BM9A 1JKWA 2JGZB 2KQRA 2IW8B 3EUHC 3S1QJ 1X37A 2NYXA 5M5YJ 2CMPA 1IM2A 2IA1A 1Y6IA 4RGUA 1UZCA 4LLNA 1MDMA 2JZ0A 3RZOJ 3C9PA 3FXRA 2JNHA 4LF9M 3HDDA 3TP3A 3T5XA 2QKMB 1WZ2A 3S3OA 1QDTA 1R23A 4I01A 2PHGA 1X3UA 3GLFB 2LNHC 1H89C 2DAGA 1U9NA 2CQQA 2A68F 2KZSA 4JI2M 4PJNA 3B74A 3U9GA 4P9UA 1K6OA 4IJFA 3I58A 2DLLA 4V2FA 4BJ6C 4OWRB 3J7AO 1XTAA 3AOEA 5E3LA 2XAJA 4AU7A 5DD4A 2IS4A 1C9BA 3CUQB 4BBRJ 3DTOA 2UXCM 2ZPGB 3BHVB 1OKVB 4U0VA 2CEAA 2K9MA 5EGOB 1Z5AA 2ESNA 2LY1A 4RNAA 1S3JA 2DMPA 4OAYA 2X4HA 2EIKH 1RIOH 2IW6B 4LIUA 3RYPA 2DZNB 3ISPA 1YX5A 4OIQF 4FHTA 1SG9A 5DYGA 2EV6A 2Z1DA 3M9AA 1XWIA 2QEXI 2M8GX 4BQQA 5DQWA 1KYIA 2XRNA 2V26A 2X8AA 3DPLC 1JKPC 2RKOA 4G8XA 1YS6A 4FASD 4LFBM 4UUTA 3H0GJ 3LAJA 3ECOA 5TRDA 5J4YA 5IREB 2I5UA 3DLLF 2I40B 5C3EJ 5BOXA 2O8KA 3BJ6A 4OVZA 5F3WA 2O3FA 4JI3M 4I76A 1D1BA 1FOYA 1MSFC 3OOPA 3ZMVA 2G0EA 4ON0A 2Y30A 4BNCA 1AISB 1Z9CA 4BCGB 3PFYA 3GLGE 1Z05A 3ZQ7A 4BY7X 2KRUA 3LL7A 4KMFA 2J7OA 1E9RA 2OOAA 4CHTB 5JI2E 4MQVA 4AIHA 3W2AA 1ETKA 5KPRA 1X2NA 5J1RA 2VT3A 4CISA 4B47A 1JXSA 4NSRA 3WU1B 4NRWA 4B3RM 2EQRA 4A3BJ 3PIOF 3S2DJ 4DJAA 2RN7A 4QNMA 4LGYA 3WTZA 1XNRM 1V4RA 2W57A 1IN8A 2LP0A 1IGNA 1OYWA 5F04A 3CCVI 1D8JA 3K69A 1OCTC 3K9TA 4FM4B 1SD6A 3T8RA 4UUSA 3TQSA 4I2OA 1E7PA 5HS9A 3CQZJ 5GTIC 2L5QA 3K6GA 2DHRA 5FSWA 2EUCA 3CCJI 1LB2A 1V92A 3JR4A 5ITQA 1KYZA 1USTA 1WH5A 2W1OA 1TT5B 2ZXWH 3BTJA 4QHTA 3CJQB 1BOAA 3F8MA 3GFJA 4M6YA 5DUKA 2EKFA 4NXNM 4AG6A 1VDDA 3SASA 1NHAA 2E36A 3FXJA 1JR3A 2HFHA 4RAGA 1JUMA 4XRFA 1P2FA 1LNWA 2DPPB 2HVRA 3W68A 1YJNI 3A8GB 3GQ4A 4M9XA 4AC0A 2LHCA 1GABA 3PQJA 3VWBA 4R8HA 1YI2I 1GXQA 1TQPA 4Y7NJ 2CZ6B 3UJNA 2RRUA 3GLHE 2D1HA 3EUHA 3FRHA 2PI0A 2MG4A 3IH2A 4L0ZB 1S7AA 2MYSA 1KGSA 4RB3C 3A02A 2HAKA 2GOMA 4BCHB 1JR3E 1JJ6C 1A6IA 3SFZA 1POGA 1I3QJ 4LJ6A 1ETQA 2XVCA 3OIPA 2X49A 4B3XA 5DNYA 1KQ8A 4BCMB 4BJ5C 4CFNB 4Q48A 4LB5A 2MROB 3FUTA 4LMYA 5LLQA 4IHSA 2WBMA 4NBQA 1G6NA 1I5ZA 1YUBA 2L0KA 4C2MJ 3MKLA 4R71A 3TN8B 1T0FC 4D5CA 3FE3A 2RKHA 2BKZB 3QPHA 4YY3M 3H1CA 4B3TM 2DXIA 2IT0A 2XAGA 5FKMA 4UVBA 4LJ7A 4PDIA 3K2LA 1YITI 1TL8A 1QZYA 4ENNA 4Z2YA 1Z5BA 4IBFA 3DPUA 5F0FA 2DFIA 1IY1A 3EDPA 5HNBB 1MBHA 2LBFB 4EGZA 4F6SB 1U3EM 4DYCA 5C44J 3X26B 5M3FJ 2L7FP 5JFRA 3DLAA 2XAFA 5CVIA 2MD5A 2DDAA 2EJRA 2R4GA 2ZXJA 1N77A 4Y13A 3I01M 4XLNF 3QPSA 1XG1A 3OYAA 2DT6A 1QAMA 2DENA 3AV0A 2VXZA 3LWFA 2ZFUA 3PXGA 1RUNA 1F5TA 4PZJA 2VC0A 3RIRA 3FTEA 1I6XA 5IOZA 2QGUA 2JSPA 5HQ0B 3CLOA 1JHHA 4P1WA 3H4MA 4CFXB 8CATA 3G71I 3UKGA 2VF8A 2DQLA 2FOWA 3HZJA 3HGYA 2JSCA 2WAQN 4YFKF 1ZARA 5FFXA 4S04A 5JVGF 3KVWA 4HAMA 5A2QS 4EEFG 3CC7I 3MY1B 4CCMA 2B63J 3DOAA 3CO7C 4MIMA 1L0OC 1SVMA 2H1LA 3RZDJ 1X2MA 3BQYA 3VKHA 3F72A 1PYVA 2DTRA 3IG5A 1U5TC 1TW3A 3H5AA 4IBEA 2GQFA 4GHAA 1R00A 3HUGB 2JRTA 2K02A 1I1SA 4QPOA 1FVVB 3DDPB 1PJTA 3QOEA 2E5LM 3FD9A 2ZBKA 4LIVA 4DV2M 4OIRF 4FWHA 4UUSB 3L2VA 1ZRCA 1X1PA 3AFHA 3EIHA 5K7ZA 3OYCA 2RQQA 3GFLA 2CRGA 1G4DA 4L16A 1A6QA 3BTCA 2DN0A 1YHQI 1IC8A 1UGPB 4YIIA 1E0EA 3BDDA 1Z91A 1DUXC 4REZA 3LA3A 1UG2A 3PJRA 3JRCA 1Y56A 2BHZA 3H4JA 4HDUA 2F5SA 2JWTA 1JB0F 2G3QA 4K2EA 1DU0A 3GRYA 4YIRX 1MH4A 2KDOA 4HEA2 3J81Z 2LXEA 2GBYA 1T56A 1D8KA 1OMIA 3VDXA 3U6SA 4J01A 3U21A 3EIDB 5DCFA 2XASA 2IW5A 3GTPJ 3M7GA 3LVWA 2BY3A 5HDKA 5KHDA 2BY1A 2B9RA 1IFYA 2PFBA 3HC7A 2PEXA 1FIAA 2AQEA 1MJBA 1XN7A 2COMA 4G6TB 4RDUA 4PSWA 1KQ0A 3J7BA 1IV8A 3IAM2 2W99A 3BJAA 3CD6I 4F1IA 3HHXA 4UN0A 1QZZA 2FBKA 3H92A 4UVCA 5KO3A 1EH8A 1PJJA 1OYYA 4G12A 1S8NA 1WHCA 4Y72B 5FTLA 1Z77A 1DDNA 2DA3A 1NO1A 3HSRA 4U88A 4II5B 2IS6A 2DA7A 3T1YM 4ENMA 5DM6F 2L09A 3EQLF 3BCBA 2PJQA 3KOWE 1A5JA 4P17A 4NRVA 3AG4H 4A6EA 4AYBA 1W36D 1B72B 3I3LA 4CFWB 1ZAEA 3LCUA 4F52A 3JAMS 2P7VB 3C7JA 4HV5A 3G6EI 2Q8KA 1J59A 2HR3A 2XZUA 3F0CA 3I53A 3K1NA 5CQGA 3GRRA 4BHBA 2JP7A 2DYRH 5B1BH 2RGHA 5DUIA 5FGMA 3I0TA 5KVRA 3HU2A 3J81S 3S3MA 4I0BA 1FTZA 2WHBB 2KISA 2VQGA 4GXOA 2AHQA 3OYJA 4ITVA 2WAQA 1E94E 4F6WB 2EINH 4FX4A 3AOEC 3NBXX 2OF7A 4IOAF 1TH2A 4B08A 4O6JA 2R7UA 3OL4A 1I3AA 4LF5M 3KS4A 1VQPI 1VEGA 2OJED 2QQBA 2XB5A 2FS1A 4HPQA 4MNUA 2R92J 1XC5A 4L5IA 2A3SA 1UHMA 3DKWA 2F6CA 4UXNA 3E97A 2VKVA 2RGVA 4HNUA 2BW3A 4A3FJ 3TNIB 1DO2A 2DXBB 1LV7A 5F08A 3GWZA 2LD5A 1JE8A 2OPFA 1GO5A 2V4JC 3ZP5A 3GLGA 5J40A 2JPCA 1TH3A 5JHUA 4QWQA 4BBRM 4HW0A 3GUDA 2BWEA 1E3PA 3KEQA 4BCFB 1ZMVA 3B6AA 1GVNA 2XZFA 1NNJA 1N75A 2VKDA 4ZTFA 5M5XJ 2BPMB 3SAWA 4PT5A 2EZIA 1TLHB 4RODA 3OYMA 1FC3A 3HHWA 2KRKA 3GPPA 2XB0X 2APLA 3G3ZA 4M3FA 2WIPB 2MLKA 3QPTA 3VOEA 4A0YA 4B1RA 1R49A 2GXBA 1YSYA 1WHUA 2PG4A 4DR7M 4RB1A 3DFZA 3AL0C 2COBA 2TDXA 3M1CA 1DP7P 1XMQM 3DP7A 4ZTJA 3L2WA 1H9GA 4CXFA 1R7RA 2JUJA 3G33B 2LR8A 2QQ8A 2F5NA 2EJSA 1SD7A 2GLOA 3GLFE 3MCZA 4XK4A 3DL1A 3BR1A 3BPXA 2MH9A 4OB0B 2H94A 4LK1F 4OB3B 3N97A 2DVWB 1ORKA 4JOMA 1J2XA 2WSEF 1QVTA 3O8HA 4BYYA 1IV6A 4BXXJ 2XEPA 3O8GA 4ASNA 1OLTA 1ENHA 5CVRA 5EXPA 2X48A 4K0KM 4DBQA 4IOCF 4XSZF 2QBYA 4LG0A 3F22A 4M73A 4RB2C 4D9JA 3IKTA 1XNQM 4OR5B 4XLHA 4LF8M 2FU4A 3C3EA 3RDIA 3QYHB 3ZRGA 1PJSA 5LHGA 1OKSA 2UUEB 3HOUJ 1K78B 4XLFA 2A6TA 1VINA 1B8IA 1TWGJ 5D8LB 3TKYA 4G4NA 3HSEA 2NAZA 3MAJA 3KYDB 3JRGA 3T0YA 1RR7A 3B57A 2VE9A 1FINB 2QNJA 2DA2A 3SAUA 1NNUC 2CG4A 3FDYA 2Y31A 2M30A 5H6RA 1VQ5I 2UZBB 1W36C 4LZJA 5DEQA 2PMHA 3L2QA 5BMZA 1FYMA 1YLFA 2CZ0B 4LF7M 3SC3A 1WKMA 1YJWI 1OCPA 3RTRA 2K47A 4L8RC 2QLZA 1R2YA 3TDZC 1FJLA 1KSFX 3TE6A 2UXDM 1TTEA 1U2WA 3E6MA 1S72I 2AS5F 3QXEB 3KE2A 3HHYA 2R0IA 5HBEB 3V8JA 3F23A 2K9LA 1H0MA 3FTCA 2GWRA 2DAEA 2OA4A 5K7HA 4KHPM 3ZPLA 4ESFA 1I27A 2LDUA 4LG3A 1DQUA 1LE8B 1H1RB 2E2HJ 2JA8J 4LJAA 2R0QC 1WR1B 3K4CA 1HA8A 4NOOB 4OVZB 3G1LA 3IAS2 3K4NA 2F5PA 4RS8A 2HKJA 1LEBA 5HLIA 3DBHB 4RM3A 3HRTA 4FW9A 2W84A 2JT1A 2CUEA 4RMNA 1URCB 2ISZA 2KIFA 1OL2B 4C3IJ 1K7AA 2JY7A 2M1BA 5EDNA 2Q0OA 3KDSE 5EZGA 3NDQA 4S05A 3NARA 4AIJA 4BCKB 3IC7A 5CVUA 3NAUA 4GITA 4E6KG 3CC2I 1VQ7I 2NS0A 3PNTA 2J7NA 1S3SA 4AKGA 3J27B 4FX0A 3WODF 3U61B 1T98A 1ZREA 2A5WA 4LJ9A 5ACBA 1HSJA 1VTNC 4BBSM 2JY5A 5E1XA 3CUQA 3GRUA 1NSFA 2XDVA 1TNTA 3W67A 2XGNA 1GV2A 4N0BA 4F6UB 5FTJA 3AAFA 1EA3A 2K3FA 3OIQA 3KETA 3MI9B 3WVEB 1ZRFA 4I81A 2NVXJ 1ZK8A 2OD5A 2PMZN 5FLXK 3CF2A 1WH7A 4IMYB 2KLOA 4CCLA 3OYHA 2G9XB 2Z3YA 3NWTA 1BIBA 1G3NC 4G7OF 1J9IA 2BNKA 2YNMD 3WTUC 2VLAA 2E2JJ 4YEJA 1Z3YA 2EA0A 2HKOA 3WG7H 3I4YA 4GO1A 4DBRA 1C1KA 2K0BX 2ZSHB 5IWAM 4MGKE 2JRMA 3SJMA 4EC8B 4EMSA 4OB2B 1D1AA 3U6MA 1OIYB 1Z1DA 2XIGA 2VN2A 3QYEA 4IXAA 3GTGJ 1LVAA 2JTVA 2M4KA 1R22A
chains in the Genus database with same CATH topology
1LKXA 2VASA 4GRIA 4YELA 4XKCA 3H9JA 3W2WA 4B48A 1TZLA 1MW7A 4XOTA 4E7JA 4EATA 3UNGC 1MMDA 1DP3A 4E7SA 3FBIB 2MD0A 2HNHA 2WAEA 4XQFA 2KQRA 4E7HA 3H9GA 3EUHC 3ZR8X 2CMPA 1Y6IA 4CCOA 3HPGA 2ZPHB 4PSXA 1IREB 2CYZB 3PNVA 2IS1A 4BE2A 2X51A 3K4MA 3N05A 4PK4A 4BXFA 4J00A 2QKMB 1G8XA 2OV7A 3S3OA 4XN0A 2HZDA 1FMWA 5HNFA 2K3PA 4PJNA 2KMUA 1GLNA 3DKYA 4BJ6C 5LFAA 3I9V2 3K4KA 2X6WA 4OWRB 2G77A 4AU7A 2IS4A 3FBNB 1D0YA 4ZDPA 2ZPGB 4HL4A 3ZGKA 3G2BA 2K9MA 4QPQA 2LY1A 4YRVA 2KP6A 2PJRA 3S3NA 4OAYA 4CCKA 4LIUA 1YX5A 4PJLA 4XN3A 5FROA 3OYLA 1N78A 2Z1DA 4B44A 2E5NA 1X4OA 5EJCA 4BQQA 2X1DA 2V26A 3H5NA 1D0ZA 2X6YA 2VQCA 3DPLC 1J09A 3VYHB 2WADA 1X1AA 1WJ5A 4XKBA 4FASD 2LREA 3OYKA 3A8LB 4P5OA 3MKZA 3RCOA 2XF6A 4HNTA 1BR4A 2KL4A 3BCAA 1BOBA 4KJZA 1Z3XA 3E0JB 2M4GA 2ZPIB 3QYBA 2KRHA 2M0MA 5HOOA 1D1BA 3A1YA 4H4KC 1LFPA 3GBGA 3X24B 4BUPA 3BG7A 2VKHA 3PFYA 4NNJA 2VL8A 4II3A 1AHJB 3LL7A 2O5RA 1D1CA 2CZ1B 3W2AA 2VQLA 3FHNA 3PSIA 4B47A 4CCNA 3LSHA 1LVKA 4PFPA 3HL2A 2XF7A 4DJAA 2DOAA 4CZCA 2XAUA 2WY7Q 2QDYB 1MMAA 1DGRM 1QHGA 4BL0B 2DJIA 3ZXSA 2QFZA 2LYCA 2VJ4A 4XL9A 4FM4B 4JQFA 1E7PA 2KZVA 3VSLA 1QHHD 2L5QA 3K6GA 4M6VA 2ZCFB 4OB1B 4BE1A 2W1OA 4KT6A 2DT7B 3CJQB 2WAFA 3VYUB 4C30A 3DU5A 3VYSB 1WJDA 4QSHA 4BQOA 1X1BA 5JHFA 1QU3A 2ELJA 2DPPB 4IKFA 3A8GB 1UGQB 1DGWY 2ZZDB 3VWBA 3TW7A 2RREA 3X25B 2QKLB 4XMYA 2CZ6B 2R7OA 4IZZA 3QWLA 3J7AY 4C9YA 2Z16A 2MYSA 4XORA 2E1MB 2IGOA 2PMZA 3V42A 3OY9A 1V29B 2GOMA 1UAAA 2R7WA 1X1DA 1WJFA 2LC2A 4Z6YA 3OIPA 3HXLA 4B3XA 2IGKA 4BJ5C 3H9QA 4Y33A 2V9KA 3CESA 4ZDLA 3H0DA 3OL3A 3QODA 2WBMA 2L2OA 4PUSA 3LMMA 2DCEA 2NOJB 3M8JA 4CCJA 3BG9A 2DXCB 1T0FC 2R7QA 3CJRB 2DXIA 2VQHA 2HU9A 2WA0A 3NWSA 2W00A 3KYLA 3DPUA 2KR6A 2L9SA 3LSIA 3OOUA 2LBFB 2CS3A 3DTIA 2Z2SB 1UGPB 3X26B 3OS2A 3DLAA 4BEHB 2CV1A 1KONA 2UWMA 2R4GA 2XC7A 1N77A 1UG0A 3OYAA 2DT6A 3DU6A 2DD4B 4XNFA 4MFDA 2VXZA 2ZFUA 5LD2C 4ZDOA 2KHMA 4E4HA 2I8DA 2ZPBB 2HPIA 2LH9A 2JSPA 1VZ0A 4P1WA 3OR2C 1WFXA 4Y3OA 2IGMA 1MMNA 2V6EA 1SFKA 2CUJA 4LOCA 1IRXA 4BGDA 2LRDA 3HZJA 3PL8A 2HQAA 3QZ5B 4XONA 2LBFA 4HNVA 1X1CA 2CFOA 3S93A 4CCMA 3ZQQA 3LSMA 4Y4RA 3C2GA 4BS9A 3UR3C 5FRNA 4MIMA 2RNGA 3RPUD 3VKHA 1PYVA 3W3CA 4XLEA 3H5AA 2R7VA 3HUGB 3A4CA 4QPOA 4AKIA 3QOEA 4X0GA 1Z7LA 4LIVA 3L2VA 4XM3A 2LOOA 2CH0A 1LDKB 4BU2A 3AFHA 3OYCA 2E5ZA 2RQQA 3OMYA 5CQEA 4ZGEB 3PSFA 5CKTA 4HSRA 4CA0A 3ZCOA 2M7AA 4FETA 4NQWB 3X20B 1E0EA 3PJRA 1G59A 1WJAA 4NC8A 1Y56A 3KHIA 2M7BA 2UV1A 2VJIA 4MLOA 3E1SA 3K4BA 3DEEA 2KDOA 4HEA2 2MC4A 4J01A 2UUZA 3VDXA 2ZXHA 3U21A 3OYEA 4U7BA 2ZPFB 1UGRB 1PJRA 4KISA 5KHDA 3EUKL 2E1MC 1MMGA 3HC7A 4PJMA 2QF7A 3OYFA 1D0XA 3HG9A 2AQEA 3A2KA 3VKGA 4OAZA 4F93B 3OYBA 2HVRA 4G6TB 3BLYA 2BS3A 2GOXB 4PSWA 4R79A 1V5GA 3IAM2 3K70C 4BQNA 4JX6A 1WJEA 2R7XA 3TMOA 2XSJC 2BVMA 4LITA 3S8PA 2IS6A 3TBIA 3W2VA 3BCBA 2CUZA 4P17A 4AYBA 1W36D 4HRIA 3I3LA 3MKYB 1P9QC 4F52A 1WJCA 5CQGA 2KMGA 3SEZA 1UGSB 2R7RA 5TGTA 3S3MA 2X6XA 2VQGA 3OYJA 4ITVA 2WAQA 5KNLA 3IUOA 2R7UA 3BC8A 3OL4A 3DPTA 4RLQA 3BG5A 4HPQA 2JVGA 2JUGA 3SZGA 3VSKA 4ELJA 2ZPEB 2F6CA 3OYDA 2V7FA 3D5LA 3TW6A 3MD2A 4AVZA 2BS2A 3WVDB 3QYGB 3PUBA 4HNUA 2BW3A 2R7TA 2KRCA 2DXBB 3ONQA 4XLCA 3A8MB 3SDBA 2V4JC 3CMMA 3VYGB 4U87A 3DTEA 2QDJA 3AKZA 4BBRM 4PFOA 2WB1A 4IQJA 1X4PA 4RLFA 4RM2A 4CUGA 3L2UA 1N75A 2VKDA 3RSNA 4ZTFA 3HHTB 3QYFA 4JX5A 4ZJZA 4ZGJB 2CZ7B 3HO8A 3A8OB 3OYMA 2X1CA 4XOPA 1NG7A 4DIQA 4AI6A 3EPZA 1S9HA 3HPHA 4D1QA 4II2A 3LSKA 2CW8A 4DGWB 4E7KA 3X28B 2CV0A 3AL0C 2AHJB 4N4OB 2JA2A 1BR1A 3M1CA 4BDYA 2WY8Q 2W4SA 2IGNA 3S32A 3VYRB 4ZTJA 3OYGA 2VPLA 2OC6A 3BG6A 3L2WA 1V5FA 2WJ9A 2KPMA 2IS2A 2QQ8A 2F5VA 4CH7A 4PJJA 4XKVA 3DL1A 5HLTA 1FMVA 4BEHA 3RQ4A 4OB0B 3H5RA 2L9NA 3OWTA 4KITB 2PJRB 1SAUA 4ZC3A 2CW7A 4OB3B 2Q1ZB 4JOMA 2X1EA 3OYIA 1TT0A 2FUG2 2OUMA 3L2RA 3BG3A 1OR7C 4CSWA 1OLTA 4JX4A 4E7ZA 4DBQA 3HOTA 2BW3B 4C2UA 1X19A 3CP2A 2W82A 3VYTB 4DOZA 4D9JA 2ZSIB 2VJJA 4XLHA 3LFUA 5KCMA 3MKWB 3QYHB 3ZRGA 4N4NB 4HLQA 2BOLA 4XLFA 2A6TA 2MFZA 3HB9A 3EUAA 2VJ5A 3HOSA 5HNHA 5HVQC 2Q2EB 3K4JA 4BACA 3FDYA 4ZYAA 1AA7A 4XLAA 1W36C 2HPMA 4E7IA 3DWLE 2CZ0B 3L2QA 2XF5A 2DD5B 4XR6A 2E60A 3RTRA 2K5CA 4NC7A 4BE0A 2X85A 4B43A 3QXEB 4AKHA 1FKMA 2ZXIA 2K9LA 1WJBA 2V1NA 2L7KA 4IX7A 3QZ9B 3DQVC 4LG3A 1DQUA 5FRMA 5CPRB 2IXSA 4BDZA 3K4CA 1HA8A 2MABA 3IAS2 1QLBA 4HSTA 3K4NA 4C2TA 2LY2A 3K10A 4XKWA 2W7NA 4RM3A 4RMNA 1T95A 4F55A 3OS0A 1ZELA 2P0WA 3HBLA 2AQFA 3D5SC 3F9KA 1YX3A 3OYNA 2HVSA 3SEQA 4BJTA 2R7SA 4E6KG 1MNEA 3K70D 3PNTA 4ANJA 4AKGA 3KEYA 3A8HB 4NC6A 3OR1C 2A5WA 3TL4X 4BBSM 2VIXA 4F92B 4NUBA 2VXDA 3AL0B 1ERDA 2XDVA 1U0JA 1V5EA 3FKJA 1EA3A 3OIQA 3C2HA 4F91B 3WVEB 1YE9A 2BVLA 2LG4A 3DTKA 3D5RC 3CF2A 3K4LA 4HG2A 3H4CA 3LSGA 2KLOA 3MMYB 3CZ6A 2BS4A 3KX2A 3SYTA 4CCLA 3OYHA 4MFEA 3NWTA 3PNYA 2F4IA 2VLAA 1MNDA 4YEJA 1R6RA 1Z3YA 2HVQA 2CV2A 1Z21A 2HDWA 2Y0SA 2JVHA 2M3AA 1NG6A 3H35A 4DBRA 4ZGDB 3HKZA 2ZSHB 1JI8A 4E7LA 1BR2A 3DKXA 4OB2B 1D1AA 3CP8A 2VB6A 4IQ4A 1K6YA 1UELB 3QYEA 2M4KA 3IP4B 3OS1A 2D0QB 4F3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKM A;  2G77 A;  3QWL A;  4P17 A;  3QYB A;  3QYE A;  3HZJ A;  2QFZ A;  4HLQ A;  5EJC A;  4Z6Y A;  4NC6 A;  2QQ8 A;  4HL4 A; 
#chains in the Genus database with same CATH topology
 4GRI A;  2IJL A;  2HZT A;  4YEL A;  5M5W J;  4XKC A;  4A3E J;  3W2W A;  3BBZ A;  1S5L C;  1W5T A;  2W24 A;  2C6Y A;  3HOZ J;  4XOT A;  5BPV A;  4PGH A;  5KPT A;  3ZQG A;  4E7S A;  2HKX A;  3FBI B;  3VDU A;  2IA0 A;  4MGZ E;  4IHV A;  2CU7 A;  3R4K A;  2Y0Q A;  1R6B X;  1HNW M;  1OIU B;  3I56 I;  1C7Y A;  4BXU A;  4IRH A;  1KZH A;  1IAW A;  1WVR A;  4A0Z A;  4KDP A;  4LFA M;  4CCO A;  4PSX A;  4AW4 A;  2R3S A;  3E6B A;  3NRV A;  4D0P A;  1ZQ3 P;  2M0C A;  3P9I A;  1ZTR A;  2GIZ A;  3K4M A;  1G3T A;  4PK4 A;  3QU3 A;  3MHV C;  2BGC A;  1UHS A;  3MN2 A;  3TQN A;  5B66 C;  1G8X A;  3G4S I;  2OV7 A;  3FX3 A;  4XN0 A;  1EF4 A;  3AG1 H;  3U6O A;  4A12 A;  1FMW A;  1IZ1 A;  4WUR A;  2R93 J;  1V34 A;  1YFH A;  2Y20 A;  1VQN I;  5LFA A;  3CTA A;  2X6W A;  1L1T A;  1O3S A;  2BEO A;  2VOP A;  1IBK M;  3NQO A;  2BY2 A;  5EG0 A;  5DQV A;  3A0B C;  1QRY A;  4KLN A;  5E26 A;  1D0L A;  4JI4 M;  3T8T A;  2KP6 A;  3S3N A;  2AHM A;  1P92 A;  2ZC2 A;  4M6X A;  3LFK A;  4CCK A;  5ITU A;  5FTM A;  1W5C C;  2FF4 A;  5FRO A;  3CO6 C;  4JI6 M;  1N78 A;  3HGG A;  4EOO B;  7CAT A;  2L6O A;  1HXD A;  4L9J A;  1TD6 A;  3ABU A;  2MW8 A;  1R5I D;  3GTL J;  4HQE A;  2MH8 A;  1GUU A;  2VQC A;  1J09 A;  3VYH B;  2C5X B;  4EON B;  1ZG3 A;  2WAD A;  1X1A A;  2DA6 A;  3BTL A;  3FXL A;  2LRE A;  4DYR A;  1IF1 A;  3PIP F;  3RCO A;  2XF6 A;  2I7P A;  4M9S A;  2PBI A;  1JJ8 C;  3J81 K;  1BC8 C;  2VPR A;  4EJW A;  4KJZ A;  2XLJ A;  1VQM I;  2A07 F;  2M4G A;  2FOI C;  2ZBK B;  5FD5 A;  1ZLJ A;  1FLI A;  2KRH A;  2M0M A;  5D5X B;  5HOO A;  4HZF A;  2VBZ A;  3A1Y A;  2H27 A;  1LFU P;  2FFJ A;  3GPU A;  4BY7 J;  2K40 A;  4BUP A;  5J47 A;  1NY6 A;  2R4E A;  3SYK A;  5GPA A;  5FB2 A;  1FT9 A;  4NNJ A;  3BWG A;  3FUX A;  5CYI B;  2VL8 A;  3QP6 A;  3KCC A;  4MEY F;  1O3Q A;  3R0A A;  2O5R A;  4FX3 B;  4KIB A;  1QGP A;  1LTM A;  3PFI A;  2E71 A;  1VOL A;  1Y8R B;  1MJA A;  4LFU A;  3PSI A;  4C30 A;  2O0Y A;  4Q47 A;  2L2D A;  2DT5 A;  3LSH A;  4OU7 A;  4TV7 A;  2YU3 A;  2H1K A;  1MJG M;  3H36 A;  2XAU A;  2KHH A;  2ZTD A;  2WY7 Q;  3S16 J;  2QDY B;  1EIJ A;  1DGR M;  1XGN A;  3RPU A;  1YYV A;  2DJI A;  3C58 A;  2CHG A;  1UNL D;  5EEH A;  5LMU M;  2LYC A;  2VJ4 A;  2XHK A;  4EVI A;  1AOY A;  4EC9 B;  4ESJ A;  4X1E A;  1Z6R A;  2FMY A;  2R7G A;  1E9H B;  4ROC A;  4M6V A;  2XFS A;  1HT2 E;  1BIA A;  2BYV E;  3E5X A;  3V4G A;  4AUX A;  4OB1 B;  4F70 B;  2XSZ A;  2EV0 A;  4DZJ A;  2XUB A;  2MH2 A;  3A0H C;  5JHF A;  1X1B A;  2KDL A;  2IEK A;  3I59 B;  2H8W A;  1JKO C;  4NHJ A;  4NST B;  4IKF A;  1VF9 A;  1ONV A;  4GKJ M;  3LW5 F;  1DGW Y;  2ZZD B;  3X25 B;  1TWH J;  3ZMU A;  2QKL B;  1IXR C;  2L4M A;  3V8L A;  2LSO A;  3VK7 A;  3G1M A;  1FOX A;  1I39 A;  2R7O A;  1W0T A;  3J7A Y;  4C9Y A;  4N9I A;  2VBY A;  5EEA A;  1DGB A;  3M07 A;  4XOR A;  4GYI A;  2E1M B;  4XSX F;  2PMZ A;  3OY9 A;  3I54 A;  2JK3 A;  1WSU A;  4BBA A;  3B02 A;  3CCL I;  1KQ9 A;  1WJF A;  3TO9 A;  1ZKG A;  3E3V A;  1H9T A;  1KU9 A;  2LC2 A;  4Z6Y A;  2NVT J;  5IDP B;  2Y69 H;  1XB4 A;  2P4W A;  3HXL A;  4XRS G;  1UFZ A;  4LJ5 A;  1HNX M;  1FTT A;  5CEI B;  2DZO B;  3K8Z A;  4HEO A;  4NL4 H;  3CES A;  3GZN B;  4ZDL A;  5J4V A;  3J80 S;  4IO9 F;  3KSX A;  3OL3 A;  3L25 A;  4PUS A;  3P7N A;  5D6F A;  2ESH A;  4XRS A;  5LMN M;  1BI2 A;  4A93 J;  4BBS J;  3D8L A;  1OTR A;  1ZV1 A;  1QNT A;  2C9O A;  2QGS A;  4CDG A;  6PAX A;  3GO8 A;  3TWM A;  2D7H A;  5E8I A;  1QDR A;  4LJZ F;  3I64 A;  1JOW A;  5DS9 A;  5ILU A;  3BR3 A;  5CLS A;  2IA2 A;  4HF0 A;  1GJT A;  1MIJ A;  4FD2 A;  2FH0 A;  2R18 A;  3OOU A;  5FD6 A;  3T1H M;  1B9N A;  2RC4 A;  2QQ9 A;  2LVA A;  4GH9 A;  2UWM A;  3CJN A;  1XS9 A;  1K79 A;  1ACI A;  4MFD A;  2XPV A;  1SXJ E;  3DU6 A;  4XNF A;  4EOM B;  4MTE A;  1R71 A;  2KHM A;  3DEU A;  4E4H A;  3ZQF A;  3HOY J;  4BCQ B;  2I8D A;  5GPC A;  1SFU A;  1AHD P;  1K3X A;  4B4C A;  5FJ8 J;  1KU2 A;  3BY6 A;  1VEK A;  5B1A H;  5HOD A;  2ZO4 A;  2PLY A;  2CQX A;  4Y3O A;  2IGM A;  4BH9 A;  1SFK A;  3L7W A;  4P9F A;  1C0W A;  4YC3 B;  1APL C;  5GAD J;  2NXN B;  2V1X A;  4YOZ A;  2LBF A;  1G4A E;  2CFO A;  1X1C A;  5GP9 A;  2GM4 A;  1ZG5 A;  2HTS A;  1XMO M;  2WV1 A;  4A3L J;  4FIS A;  4P55 A;  1O9K A;  1RPW A;  4IL6 C;  2CYY A;  1D2N A;  2P81 A;  3R6S A;  3UR3 C;  4BS9 A;  2RNG A;  5ITY A;  4DR1 M;  2FNP A;  3Q0U A;  1W1W E;  4D80 A;  3U6D A;  2K4B A;  2R7V A;  1KU3 A;  5KPZ A;  3BLR B;  3M0E A;  1S7E A;  4AKI A;  4ZH4 F;  4ZYE A;  3V7S A;  2LOO A;  5LBQ A;  2ZJR F;  1SAN A;  4EJV A;  2E5Z A;  3FRI A;  4KIC A;  4NB5 A;  5D4R A;  4M74 A;  2QZ8 A;  3PSF A;  1PVE A;  5CKT A;  4IBJ A;  1HR0 M;  1VQ9 I;  4CA0 A;  3FKE A;  3AG3 H;  3BLH B;  2DWL A;  2DOD A;  2M7A A;  2XKP A;  5EG0 B;  2F4M B;  1T08 B;  3LSR A;  3DDQ B;  1G59 A;  3DA1 A;  1WCM J;  1YLA A;  3EIE A;  4NC8 A;  1GDT A;  3KHI A;  4M3D A;  3GXO A;  3L28 A;  1RNL A;  3E1S A;  3K4B A;  3DEE A;  4M3G A;  3UZU A;  1ZG1 A;  1NK2 P;  5C4X J;  3B73 A;  1ZR4 A;  2PMI B;  3GTQ J;  2HYG D;  3OYE A;  1JSU B;  2IN3 A;  2VI6 A;  1OPC A;  2ELK A;  3BZC A;  2C6T B;  2XSD C;  5LHH A;  2VKE A;  3W0F A;  3SMP A;  3EUK L;  3L29 A;  3MZ8 A;  2KFD A;  4KOD A;  2GA1 A;  4GKK M;  5LGU A;  3LQ5 B;  2FSW A;  3QU6 A;  5FKL A;  5E3O A;  3OYF A;  3W6V A;  2CWB A;  2L7M P;  2BS3 A;  3OYB A;  2LVO C;  5F0H A;  1QPM A;  4R79 A;  2Y9Y A;  1V5G A;  4D7N A;  3GQ3 A;  4JX6 A;  3FXQ A;  1WJE A;  2GA2 A;  1FYL A;  4GGG A;  4M72 A;  3GRV A;  2HYJ A;  2CHQ A;  3R8F A;  3DF8 A;  3Q5F A;  2M5Z A;  4LIT A;  2FE8 A;  1S6L A;  3JCU C;  3S8P A;  2MGW A;  3ASN H;  3LNQ A;  2CGP A;  2CQ7 A;  1PJI A;  2GNO A;  2BJV A;  1P4X A;  1P9Q C;  3MKY B;  2D45 A;  2WPA B;  3FYC A;  2CFX A;  4RAZ A;  5CVJ A;  1U78 A;  3ZC7 B;  3K0L A;  1R1V A;  2IVM A;  1T39 A;  1Z6T A;  5EP2 A;  3GLG B;  1ETW A;  1O57 A;  1IN5 A;  2R7R A;  2Y9Z A;  1UGS B;  3GZ5 A;  4BB9 A;  5E1Z B;  4N9H A;  1IJW C;  2DHY A;  4FCT A;  3HYI A;  4L9T A;  2QCO A;  1U6G A;  4OU0 A;  1QAQ A;  2BJW A;  3Q8G A;  3K1M A;  3IUO A;  3FUV A;  4M0D A;  3Q9V A;  1T2K A;  2JZY A;  1BBY A;  3DPT A;  4RLQ A;  5HDN A;  2JN6 A;  4HLX A;  5LEJ A;  3CCR I;  2G8L A;  2JVG A;  3QQA A;  3J7Z I;  2EFO A;  3KP2 A;  2ZPE B;  1XGS A;  3KXE C;  2LKS A;  3D5L A;  3E5U A;  4AVZ A;  3OYD A;  3LAP A;  3PUB A;  2R7T A;  4IBK A;  5EXX A;  3S15 J;  3ONQ A;  2BXZ A;  2DAK A;  5J6X A;  1PUF A;  3ABM H;  5E20 A;  3AG2 H;  2DMU A;  3F5X B;  5JI3 E;  1I1G A;  4KRD B;  3DTE A;  1H8A C;  3AKZ A;  4EGY A;  1HF0 A;  4IQJ A;  2LK2 A;  3IWZ A;  1IN6 A;  3IHU A;  3QYF A;  1Q3B A;  1YRN A;  4IHT A;  1R4M B;  3ULQ B;  1QQW A;  3E7L A;  3BR5 A;  4L18 B;  4DQ2 A;  1GVD A;  2KW0 A;  1LPQ A;  4DIQ A;  1AKH B;  2DAM A;  4AI6 A;  1ORY B;  3GLH B;  2VC1 A;  3EPZ A;  3U1K A;  2B3T A;  1IN4 A;  5L3D A;  3E9S A;  4WCG A;  1D3Y A;  3HPH A;  3ESW B;  1XB2 B;  1NTC A;  4D1Q A;  2MGQ A;  1T3T A;  2OAZ A;  1YIJ I;  3CTW B;  4GCV A;  5IP9 J;  2CW8 A;  2GXA A;  2CJM B;  4CGZ A;  2AHJ B;  4N4O B;  2YU9 J;  2JA2 A;  1BR1 A;  1WWX A;  4BDY A;  1DU6 A;  4MEX F;  2WY8 Q;  2KJC A;  2W4S A;  2VPL A;  2L9V A;  4MTD A;  1V5F A;  2DWZ B;  2LKX A;  1HLV A;  4GC9 A;  1VQ6 I;  3ZMT A;  3FM3 A;  5ICC A;  1YIO A;  5C1B A;  4DYQ A;  1LUJ B;  5FKN A;  4BCN B;  3SAV A;  3SXY A;  1Y1W J;  1KYW A;  3HJS A;  1QAO A;  3CUO A;  2VII A;  3H5R A;  1GY3 B;  4KIT B;  2Y48 A;  2PJR B;  1OL1 B;  1W5S A;  3WHK A;  1IQP A;  1NY5 A;  3U6L A;  1H4L D;  5HS8 A;  4DR3 M;  5FGK B;  5IZ7 D;  3BG3 A;  4IIW A;  1YW8 A;  3Q3S A;  3ZMS A;  1ZP2 A;  3S14 J;  1XD7 A;  1TC3 C;  1XHB A;  1T0F A;  5L3E A;  3CP2 A;  4OMZ A;  3S1M J;  3VYT B;  2XSZ D;  4XK8 F;  5IT9 S;  4BCM D;  2VJJ A;  4RKU F;  3KFW X;  1XSD A;  1UM8 A;  3AOG A;  4L9N A;  4LD5 A;  4N4N B;  3CCE I;  3K7A M;  1K4T A;  1RUO A;  2KRF A;  1K4S A;  1A31 A;  5K1Y A;  3H3Z A;  2MFZ A;  2W9Z A;  5ICG A;  2NRA C;  4W1U A;  4BHP A;  3SAR A;  1WPK A;  3EUA A;  1YO5 C;  2QSG X;  3HHH A;  1VG5 A;  4L15 A;  3I5U A;  1FP1 D;  1U5T A;  2B7E A;  2TRT A;  4BAC A;  3SQN A;  4ZYA A;  3F8B A;  5E8G A;  2C5O B;  4EIW A;  2QYO A;  3K9P A;  2G7H A;  4E7I A;  3BR6 A;  1T6O A;  1RES A;  3WE2 A;  4LCB A;  3X2Q H;  1X58 A;  1KU7 A;  2LFB A;  4KUM A;  4FT8 A;  2OO9 A;  1TWC J;  3IEC A;  3DEW A;  2DA5 A;  4NC7 A;  1L8Q A;  2LH0 A;  1VQK I;  5J1U A;  2LW4 A;  4AKH A;  1JGS A;  1FBU A;  5KQD A;  1K82 A;  2ZNY A;  2MJ5 B;  3S17 J;  2UZD B;  2ERC A;  3LOC A;  1Y8Q B;  2E19 A;  2MLG A;  3W6J B;  3QZ9 B;  2F4O B;  3WGG A;  2I53 A;  1OCC H;  3M6A A;  1WGN A;  2GXG A;  4CGY B;  3CCY A;  4KNY A;  3CME I;  2RVC A;  1BC7 C;  1J7K A;  2MAB A;  4W97 A;  4C2T A;  4EJT A;  2LY2 A;  2ZJQ F;  3K10 A;  2YPR A;  2W7N A;  2H8R A;  4U0W A;  4B7G A;  1HDP A;  1ZEL A;  3H3U A;  3GTO J;  2VDB B;  3P9C A;  1N4M A;  3SEQ A;  3IHP A;  2F5Q A;  1W7P D;  4KIF A;  5IDN B;  2OZ6 A;  1HW1 A;  1XMK A;  4JK1 X;  2HEO A;  2QCU A;  2BHY A;  2RDP A;  5JVT A;  4BCQ D;  4AYB N;  2CQK A;  1RI7 A;  2K7L A;  1JR3 D;  4IBC A;  1UFM A;  2EB7 A;  3GLL A;  5EYR A;  3TNW B;  3G1O A;  3THG A;  2FBH A;  4F92 B;  4NUB A;  2V1D A;  3AL0 B;  3DXJ F;  3TED A;  3F8C A;  4DBG B;  1ZH5 A;  1DPU A;  2R5Y A;  1V5E A;  3B9P A;  2V6Z M;  2ZM6 M;  1O7L A;  1WJ7 A;  1GXP A;  2VF7 A;  2PK9 B;  4DV5 M;  3TOB A;  2BVL A;  2OCC H;  2KKO A;  3DTK A;  2LBC A;  3D5R C;  3DCF A;  2DK8 A;  4EJU A;  4ZYD A;  3CCS I;  4LJ4 A;  5HDG A;  4BCJ B;  2RGO A;  3LSG A;  5B5E C;  4Y52 J;  3CZ6 A;  5CYV A;  3PNY A;  4PCQ A;  1P7J A;  1R6R A;  1HST A;  2HVQ A;  3P9K A;  2XGE A;  1D3U B;  2HDW A;  2Y0S A;  3WTW C;  2M3A A;  2LHG A;  2K27 A;  1NG6 A;  3HKZ A;  2M34 A;  1JI8 A;  4E7L A;  1KXU A;  3C2B A;  3DKX A;  1WRJ A;  2ISY A;  3AJI B;  1UEL B;  3VOD A;  4A3C J;  4LK0 F;  3GP1 A;  1D0K A;  5ITR A;  3OS1 A;  3HGI A;  1IY2 A;  2UXN A;  3C18 A;  3ZN0 A;  1LKX A;  3JAM K;  3SHG B;  3M8E A;  2GIV A;  2C9C A;  2JUC A;  3D1N I;  3KP6 A;  4B48 A;  2W2H A;  2XRO A;  1MW7 A;  4UV8 A;  4EAT A;  1STZ A;  3UNG C;  3KZI C;  2FEZ A;  1DP3 A;  2XGD A;  5IT9 K;  2R65 A;  3MY5 B;  3POM A;  4RBO A;  1Y0N A;  4D5F A;  4XQF A;  2CWE A;  3WTT C;  1JT6 A;  4E7H A;  3JTG A;  4E70 A;  3M03 A;  2EFP A;  4DV1 M;  2F5D A;  2QWW A;  4RB0 A;  1UNH D;  2UZK A;  2JA7 J;  2ZPH B;  1P7I A;  3PNV A;  2LF7 A;  4I8O A;  2JA5 J;  4BE2 A;  2IS1 A;  3PO2 J;  4BXF A;  3ZQL A;  1TH4 A;  3JSO A;  4J00 A;  3FK7 A;  4UV9 A;  2ELH A;  1OFC X;  2HQ5 A;  5HNF A;  1MNM C;  4Q5S F;  2KMU A;  3FXM A;  1CGP A;  3DOG B;  5IHY A;  3DKY A;  1B72 A;  1GH6 B;  3I9V 2;  3K4K A;  5EGO A;  4BXX X;  2G77 A;  4ELJ A;  4EOJ B;  1FZP B;  5ITX A;  1D0Y A;  2EIJ H;  4ZDP A;  2JWS A;  2OU2 A;  3G2B A;  4QPQ A;  1XXH E;  4ANR A;  3T15 A;  2F5F A;  1NH3 A;  2E34 A;  3OV8 A;  4JYK A;  2PJR A;  2CQN A;  2FJ1 A;  1R36 A;  2NNN A;  3J2P B;  3L9F A;  4F7Z A;  4PJL A;  4XN3 A;  3I04 M;  2F4V M;  3OYL A;  3SYL A;  4TTH A;  4X62 M;  4B44 A;  3HX3 A;  1IXS B;  4NSO B;  4ZPX A;  1X4O A;  2O01 F;  5EJC A;  2G9W A;  2XPU A;  3GEZ A;  3LSJ A;  2C5R A;  2LKP A;  2X1D A;  3MEX A;  4W5W A;  2NOG A;  3SBJ A;  3H5N A;  3RKX A;  5E17 F;  2HOA A;  3JRE A;  4XKB A;  4I09 A;  3OYK A;  4JI8 M;  4HNT A;  3MK6 A;  1BR4 A;  2KL4 A;  3BCA A;  2PK2 A;  3WTX C;  2XAH A;  3BQZ A;  4I98 B;  1O3T A;  1OYI A;  3QYB A;  3BHU B;  4A5N A;  1TR8 A;  1MSE C;  3IG8 A;  1LFP A;  2FML A;  3GBG A;  1U9O A;  2HHH M;  4Y17 A;  1H24 B;  3X24 B;  4S0H B;  3CMY A;  2HDD A;  2QM3 A;  3BG7 A;  2ID3 A;  4LG0 B;  3JRB A;  4XGI A;  3WHC A;  4YFX F;  4NQW A;  5E3M A;  3CDL A;  4I6Z A;  3GF2 A;  5D8K B;  3GTK J;  4B7H A;  1RU3 A;  4JI0 M;  3B89 A;  2DWN A;  2V9V A;  2VQL A;  3VPR A;  1GKI A;  2DNA A;  1HKS A;  2EIM H;  3HOX J;  4CRL B;  1ENW A;  2FX0 A;  3K2Z A;  3U6P A;  3IWF A;  3IKV A;  4PFP A;  3HL2 A;  2XF7 A;  4WWC A;  1AU7 A;  1VDL A;  4DV7 M;  1H1P B;  2CUF A;  2L4F A;  4M3E A;  1QHG A;  3FXU A;  3ZMD A;  1BA5 A;  4BL0 B;  4DR2 M;  5FO5 A;  1VI0 A;  2A6H F;  3ZXS A;  2Y0M A;  5D4S A;  2LWX A;  5IT3 A;  5K5R A;  4IJE A;  4X65 M;  3D8B A;  4AG5 A;  5BR8 M;  2WTE A;  1DGG A;  4AZF A;  3HRU A;  4XL9 A;  5H2F C;  3FM5 A;  4ZZD A;  4YG2 F;  5J8F A;  4JQF A;  1ZMU A;  1VYW B;  1QHH D;  2EKK A;  3KEO A;  2BE5 F;  2ZCF B;  1IG7 A;  4KT6 A;  2DT7 B;  5K7F A;  3VYU B;  3ELK A;  3GME A;  3WE3 A;  3VYS B;  1YOV B;  1R1T A;  3FXO A;  1PP7 U;  1IRG A;  3MZH A;  4BQO A;  4UNO A;  1QU3 A;  2R5Y B;  1FSH A;  2UZL B;  2H5X A;  3I51 A;  2K9D A;  5D6E A;  1UGQ B;  1NJF A;  1VQ4 I;  2ZAM A;  3TW7 A;  1QBJ A;  1D5Y A;  3UK6 A;  1H1Q B;  3BRO A;  3IH4 A;  3HM5 A;  4WF2 A;  4XMY A;  2WSF F;  4A5M A;  4IZZ A;  1HQC A;  2J5O A;  2Z16 A;  3K1P A;  4BHC A;  1ITY A;  3DJB A;  2IGO A;  2M60 A;  3V42 A;  4AQY M;  2OCE A;  2DI0 A;  2R7W A;  2CJJ A;  1ZLK A;  1X1D A;  1IBL M;  4L0Y B;  4QHS A;  5JR3 A;  3A42 A;  1BI1 A;  1XSV A;  1JGG A;  1SAX A;  2FNA A;  1DV0 A;  1ULY A;  1UHW A;  2IGK A;  2MBF A;  1R5H A;  2WZJ A;  3NEU A;  4C3H J;  1R5G A;  5JLX A;  1N33 M;  4IBI A;  4Q7J A;  4JN6 A;  1R2Z A;  2V9K A;  2XGC A;  3U5Z B;  1FNN A;  2Y21 A;  3K2A A;  3QOD A;  1OFI A;  2IBD A;  2Y75 A;  1H6U A;  3LMM A;  3VLF B;  2O8X A;  2C5N B;  2Z99 A;  3U2R A;  2NOJ B;  3M8J A;  2YS9 A;  4CCJ A;  3B7Q A;  3U60 B;  4F7S B;  3FF5 A;  3CJR B;  2IW9 B;  1E3O C;  2FQ3 A;  3WU2 C;  3NWS A;  3H3V K;  1KA8 A;  2W00 A;  4L9V A;  2WB1 N;  4KRC B;  3GTM J;  3U6E A;  2L9S A;  3RKY A;  5E3N A;  2KR6 A;  2LNB A;  2IVX A;  3DTI A;  4B8X A;  4AIK A;  1Z5C A;  1EH7 A;  2FOK A;  2Z2S B;  2Z5U A;  2QSH X;  1BW5 A;  1R4G A;  1CF7 A;  1MD0 A;  4KA4 A;  5FLV A;  1BJA A;  1UG0 A;  3I4M J;  2ECC A;  1YW9 A;  2Z8Y M;  1BVS A;  1TWA J;  5LD2 C;  1K83 J;  2LY9 A;  2ZCW A;  1P5E B;  5F0C A;  5JI6 A;  4EQQ A;  3CDI A;  3OR2 C;  2H09 A;  1WFX A;  5KAI C;  2X0L A;  5AIP A;  5FFZ A;  2QVO A;  4MGY E;  2VQF M;  4BGD A;  2QQA A;  5EP1 A;  4HLY A;  3GTM S;  4I0A A;  4XON A;  1OFH A;  4HNV A;  3S93 A;  3HRS A;  1HBX G;  4ITQ A;  3ZQQ A;  3LSM A;  1YQA A;  2Z33 A;  1RRJ A;  2LTP A;  3C2G A;  4XRM A;  4L4U A;  4DW6 A;  3J7A S;  5FRN A;  1ETO A;  3BLQ B;  3RPU D;  3W3C A;  4FE7 A;  4XLE A;  1GL7 A;  2VUM J;  3ABL H;  2LVQ D;  3EJ1 B;  4X0G A;  2M9H A;  2A6E F;  1LDK B;  4BU2 A;  3HY5 A;  5DM7 F;  3OMY A;  1HC8 A;  2V1U A;  2HYF A;  2KNA A;  2IP2 A;  2WSC F;  1PM5 A;  1Z67 A;  3MWM A;  4CYC A;  3J7Y J;  1UB9 A;  1TFB A;  3KPH A;  3PO3 S;  1E9S A;  1N32 M;  1R7J A;  4FET A;  4NQW B;  3X20 B;  1XCV A;  4YFN F;  3OSG A;  2EWN A;  1O9K B;  2P5K A;  1H25 B;  4YIF A;  4EOQ B;  2OOB A;  4X6A J;  5HLH A;  2QHO B;  2QP9 X;  3U5Z A;  2UV1 A;  4A2U A;  3IV5 A;  2VJI A;  3S2H J;  3QHR B;  4MLO A;  4DV3 M;  2HI3 A;  1HT1 E;  2MC4 A;  2LMD A;  2ZPI B;  2UUZ A;  1X3W B;  2VOO A;  3HOW J;  4DUZ M;  4MO7 A;  4U7B A;  2E35 A;  1UGR B;  1EE8 A;  1PJR A;  1H28 B;  5A2Q Z;  4EOP B;  4DR4 M;  4KIS A;  1SMT A;  2E1M C;  3F8N A;  2WMA B;  4HA8 A;  1MMG A;  2EZL A;  4CJ6 A;  4PJM A;  1PUE E;  2DAI A;  3MJ5 A;  2KIQ A;  3E6C C;  1D0X A;  3SZP A;  3VKG A;  3HG9 A;  3O6B B;  1RR8 C;  4OAZ A;  3ZQH A;  2C98 A;  2W48 A;  4F93 B;  1YG2 A;  3BLY A;  2GOX B;  1N36 M;  3HSF A;  3L09 A;  4BAY A;  2ZME C;  2JY6 B;  4BQN A;  2DZL A;  2M2E A;  1O3R A;  2JQ7 A;  2YUS A;  2PX9 A;  2I10 A;  2OBP A;  3Q0W A;  2UUA M;  3JTH A;  2NVU B;  4WW0 A;  1SD5 A;  2R7X A;  2F2C A;  1AKH A;  3LA7 A;  1MBK A;  2XSJ C;  2LLK A;  2UUB M;  2LTU A;  4B3A A;  3HU1 A;  4IBG A;  5TIS C;  2G7U A;  3TBI A;  1PKD B;  1TF0 B;  2CUZ A;  4YHH M;  2N8G A;  4BLC A;  2HS5 A;  2E7W A;  3E21 A;  3WU0 A;  1IXS A;  5E1W A;  3LSP A;  5DTD A;  2I7N A;  2W25 A;  4HX7 A;  1ZGJ A;  3BJO A;  1Q02 A;  2N35 A;  3O0G D;  4LGM A;  2HTJ A;  3RKW A;  1M1E B;  3ROU A;  5TGT A;  4HBL A;  3FMR A;  1IW7 F;  4EM2 A;  2X6X A;  1UNG D;  2Z9O A;  1O7F A;  3BPV A;  4CHU A;  1SXJ A;  1K61 A;  1YS7 A;  5HBH B;  3FTF A;  5LRR A;  5H20 A;  3DZD A;  2EA2 A;  4GEW A;  2E1N A;  3BG5 A;  4EM0 B;  4G6Q A;  4UHT A;  1A5T A;  4CO8 A;  5DFL A;  2ETH A;  3Q9S A;  3VSK A;  3BOS A;  1IO2 A;  2F2E A;  2V7F A;  3CDH A;  4MB7 A;  3MD2 A;  3TW6 A;  3E4R A;  2KJB A;  3RI4 A;  2DPD A;  2O9L A;  1XO2 A;  3QYG B;  2KRC A;  2XFT A;  4DUY M;  1LQ1 A;  2Z4S A;  1ZR2 A;  2ZAO A;  2JJ7 A;  3SDB A;  3BR0 A;  1IXZ A;  3RE8 A;  3NBI A;  3GPX A;  4U87 A;  2ID6 A;  2O6G E;  2KZG A;  4PFO A;  2WB1 A;  5CJ9 A;  1CF7 B;  4RLF A;  4RM2 A;  2M87 A;  3RJP A;  3L2U A;  3LQR A;  4LFC M;  1XDS A;  1S29 A;  3CGW A;  3JAM Z;  4JI1 M;  2VQE M;  3GLH A;  4JX5 A;  1R4N B;  4ZJZ A;  4ZGJ B;  1B6A A;  4MH0 E;  3HO8 A;  1JHF A;  3KP0 E;  3A8O B;  4D7M A;  2QBY B;  2RV8 A;  2Y0T A;  3HHG A;  4G3O A;  3E46 A;  2KNZ A;  3V7C A;  4AVP A;  4XBO A;  1ETV A;  1QUS A;  4Q4Z F;  2W9F A;  1S9H A;  1IRF A;  4IEJ A;  3E6D A;  4A3M J;  4ZYG A;  3I4N J;  3BXW A;  4F7L B;  3BOQ A;  2DWM A;  4R1H A;  4II2 A;  3KS8 A;  4KYW A;  1DGH A;  2CV0 A;  4R3D A;  1HW5 A;  5F27 A;  3GFM A;  4FWD A;  4ZGE B;  3VYR B;  2WIH B;  3BG6 A;  3VFZ A;  4II7 A;  2D1V A;  3FIW A;  1SFO J;  2KPM A;  3HHZ A;  2R4J A;  3R61 A;  2IS2 A;  3GO5 A;  4CH7 A;  4BQA A;  4FQG A;  4XKV A;  4R7G A;  1P4A A;  3RQ4 A;  1V54 H;  4JBA A;  3GCM A;  1TTY A;  1SAU A;  4ZC3 A;  2CW7 A;  3KP3 A;  1XX5 A;  4RGS A;  2Q1Z B;  1W98 B;  5I5Z B;  1QMZ B;  3HU3 A;  2NS8 A;  4X64 M;  1MH3 A;  3A46 A;  3L2R A;  1L2B A;  1G3Y A;  4CSW A;  3Q8X A;  1SFE A;  1Y8G A;  1P3Q Q;  1V33 A;  3B7Z A;  3FUW A;  1L2D A;  5DCM A;  2BW3 B;  4C2U A;  1X19 A;  5GTH C;  1R9T J;  2W82 A;  3KOY E;  2NS7 A;  3LVV A;  1PRB A;  3CF6 E;  2DMT A;  4XLP F;  4OIP F;  4BKX A;  4HLQ A;  3KOX E;  3GLX A;  4OX9 M;  1B1B A;  4NXM M;  2BOL A;  3GFI A;  2DFE A;  3HB9 A;  1JKQ C;  1NVM A;  2C96 A;  2VE8 A;  3KZY A;  3TNH B;  2FE3 A;  3U6Q A;  5IYB J;  2X1N B;  4LF4 M;  5BS6 A;  3BT9 A;  1AA7 A;  2JXN A;  3FHZ A;  1XCB A;  2HPM A;  1IN7 A;  1Q39 A;  2OQG A;  1SC7 A;  2XF5 A;  4Y15 A;  3WHL A;  1SD4 A;  2K5C A;  3PQK A;  4ZZL A;  1OCO H;  5IYC J;  3S1N J;  4BE0 A;  2UUC M;  5JLW A;  1IDY A;  5L2W B;  4U7D A;  4B43 A;  2YX7 A;  4DV4 M;  3ML6 A;  2ZXI A;  1FKM A;  1AUA A;  4PDG A;  2QEN A;  4MGI E;  1WJB A;  3KP1 E;  2OPT A;  3IH3 A;  4LLG F;  1OIP A;  2EV5 A;  2L7Z A;  3ZOB A;  3T38 A;  1FJG M;  1D0M A;  2RAE A;  1QO0 D;  5CPR B;  4HX8 A;  5BNJ B;  2DJN A;  4DR6 M;  4BDZ A;  2G5G X;  1QLB A;  4HST A;  2ECB A;  3CCU I;  4F7J B;  3IRQ A;  4XKW A;  1Z59 A;  3BR2 A;  3LQQ A;  2HWJ A;  1OGU B;  2ADU A;  1I94 M;  1G71 A;  2AQF A;  4M9Z A;  3F9K A;  1J0R A;  3ZQJ A;  5EF6 A;  4IRI A;  1IDZ A;  4WP2 A;  2MC3 A;  1B59 A;  2JY8 A;  1FWZ A;  3T6P A;  2VON A;  1MNE A;  5IY5 H;  4HYE A;  2EUF A;  3K70 D;  1MX0 A;  3ZN1 A;  3F3X A;  3PO3 J;  1MN3 A;  3KEY A;  1QQI A;  3RKQ A;  2DTZ A;  4G7H F;  3V76 A;  3HJE A;  4V19 K;  1GUX A;  1MJ9 A;  1LE8 A;  3OSF A;  4F2L A;  2B9S A;  4IF4 A;  2QA4 I;  3A45 A;  2VIX A;  3LST A;  1ERD A;  2FA5 A;  1H1S B;  2DFF A;  2EFW A;  1U0J A;  3FZV A;  2EO2 A;  3L27 A;  1VEJ A;  2D7G A;  3A01 A;  4IHX A;  3KFU G;  1PGY A;  4EOR B;  2EZK A;  5FKO A;  9ANT A;  1G8P A;  1JQJ C;  1AIP C;  1B9M A;  4JYA M;  3KW6 A;  1TNS A;  3HKP A;  4PDK A;  1HW2 A;  2PJP A;  2P5T A;  1Q1H A;  3JRF A;  3GX4 X;  4L5J A;  3VFD A;  1Y1V J;  5BPD A;  3K4L A;  2WXV B;  1G41 A;  4MGH A;  3VB2 A;  4P16 A;  4V2G A;  3HOV J;  3HUG A;  5LGT A;  3MMY B;  2V79 A;  2BS4 A;  1TDZ A;  1MBJ A;  3SYT A;  4MFE A;  5GAH J;  3CLQ A;  3JRD A;  5B3S H;  5EXS A;  4PCZ A;  4HOB A;  4X66 M;  1Q1V A;  5DDG A;  5K5Q A;  3EYY A;  2OTL I;  2O25 A;  3ABT A;  2CV2 A;  3JRI A;  3ABK H;  1QAN A;  2DMN A;  1L3L A;  1BJZ A;  3BZ6 A;  3H35 A;  1T33 A;  1ZN2 A;  5FLM J;  1R1U A;  4ZGD B;  4AID A;  3CCQ I;  2L7I A;  2GQQ A;  1BR2 A;  3MQ0 A;  4HV6 A;  4I7H A;  2VB6 A;  4CXA B;  1R5L A;  1ETY A;  1K6Y A;  5ILV A;  4CFM B;  1BI3 A;  1Q3C A;  1T43 A;  1RKT A;  2MSY A;  3IP4 B;  4G94 A;  4YOS A;  3O3K A;  4F3Q A;  2VAS A;  5D5W B;  2W96 A;  2BBY A;  1QZM A;  3A03 A;  1UCR A;  3H9J A;  1ZAO A;  1VQ1 A;  1TZL A;  5L3B A;  2KIM A;  5IPA A;  2F5E A;  3SDG A;  5K5O A;  2PMU A;  1USS A;  2MD0 A;  1HCR A;  2WAE A;  3UMM A;  1TQM A;  4PGG A;  2DKL A;  3DV8 A;  4QOS A;  2XH9 A;  5LEK A;  3JSP A;  3H9G A;  5D5V B;  1ZGA A;  2VT2 A;  1N25 A;  1QZE A;  3ZR8 X;  1U8B A;  3EYI A;  2LVS A;  3F6O A;  2OZU A;  4HQM A;  1OCZ H;  3HPG A;  3TDU C;  4ETS A;  2O61 A;  1IRE B;  1K3W A;  3M1E A;  2CYZ B;  2UZE B;  1XMX A;  2DQR A;  2K9N A;  5FKK A;  3TOA A;  2X51 A;  3N05 A;  1N34 M;  2L02 A;  3OIO A;  3BHT B;  4EOS B;  3S2W A;  2CSO A;  3I4P A;  2HZD A;  1ZMW A;  2VBW A;  3R60 A;  4GDF A;  1A35 A;  2V6C A;  2K3P A;  3VEP A;  1GLN A;  3RQI A;  4FE4 A;  3TWL A;  4BCI B;  5HLG A;  3ZQC A;  1E2X A;  4IHW A;  3FBN B;  2O03 A;  4OW0 A;  1SVO A;  1ON1 A;  1XC8 A;  4HL4 A;  3ZGK A;  1TQI A;  4XBF A;  5EQT A;  2XKO A;  1OJL A;  4B7F A;  1NHG C;  4YRV A;  4CFU B;  2CW0 F;  4DR5 M;  2BZT A;  1OAI A;  4A6D A;  4G6D A;  3SZT A;  4G4Q A;  3PM1 A;  5IP6 A;  2R7F A;  2M45 A;  4A3J J;  5ITT A;  2NVQ J;  3WTY C;  4IJA A;  3MZY A;  2IAI A;  4AD9 A;  1TGU A;  2E5N A;  4I4L A;  4XID A;  5EP4 A;  1NV9 A;  3GW2 A;  2X6Y A;  1D0Z A;  2Y2Z A;  3KLO A;  4CIZ A;  1ZQ9 A;  1WJ5 A;  1OAO C;  5ILS A;  3A8L B;  5L3G A;  4P5O A;  3KLN A;  3MKZ A;  5LMK B;  4RAY A;  1BOB A;  3L26 A;  1Z3X A;  1LEA A;  3E0J B;  4EOL B;  5E18 F;  2JZ1 A;  3IRR A;  3ILK A;  2UU9 M;  1TP4 A;  1KFV A;  5A2Q K;  4BCP B;  4H4K C;  1PUF B;  5E6J A;  5F6F A;  1J5E M;  3VDP A;  3ECH A;  3I59 A;  3G73 A;  2DDB A;  4HF1 A;  3W0L B;  2VKH A;  4KFC A;  4F7N B;  4I3Z B;  5ITX E;  4DV0 M;  4II3 A;  1AHJ B;  4PD2 A;  2E7X A;  4A3G J;  1D1C A;  5IF1 B;  2DYS H;  2V22 B;  2CZ1 B;  2DOF A;  2ICW G;  3U60 A;  2FQ4 A;  3FHN A;  1OQY A;  1I6H J;  4CCN A;  1LVK A;  4CZC A;  2DOA A;  4J19 A;  1EFU B;  1VND A;  3HIF A;  5DCM B;  1MMA A;  2STW A;  1IRZ A;  1U5T B;  3HTS B;  5FTK A;  2DMQ A;  3JW4 A;  2WC2 A;  2IPQ X;  2AO9 A;  4QTR A;  1XGO A;  4H0E A;  2CRU A;  5DYM A;  2QFZ A;  3GLI B;  4B09 A;  3J80 Z;  3V8K A;  4FCY A;  1V3F A;  1EH6 A;  3L2A A;  5LRS A;  2KZV A;  3U6C A;  4L78 A;  2HOT A;  4IHY A;  3VSL A;  1TDH A;  2CE7 A;  1R58 A;  4FTH A;  4B3S M;  4GYG A;  1HOM A;  1OR7 A;  2DO7 A;  4BE1 A;  2STT A;  4OMY A;  2WAF A;  2F48 A;  4FWG A;  1JTX A;  3DU5 A;  1WJD A;  1XSX A;  4QSH A;  2DFH A;  2FXA A;  4G4O A;  4I02 A;  3CCM I;  2NNY A;  2ELJ A;  1DO0 A;  5DYI A;  1T6S A;  2Z7J A;  3A01 B;  2B0L A;  1TBX A;  1ZGW A;  5J1Y A;  2C4G B;  2DA4 A;  2RRE A;  3UGJ A;  1L2C A;  2K6B A;  2NVY J;  3ASO H;  4KT0 F;  3BZK A;  3QWL A;  2A61 A;  3BTI A;  3I4V A;  4JI7 M;  1H26 B;  3C3D A;  1LJ9 A;  4BY1 J;  3L2C A;  1V29 B;  4C3J J;  2YQZ A;  1VQL I;  1XXH A;  1UAA A;  3ZQI A;  5FLX Z;  3C1D A;  2XPW A;  4M71 A;  3FXK A;  3MVP A;  5IP7 J;  2DW4 A;  4M0W A;  1W7P A;  4UVA A;  3H9Q A;  4Y33 A;  2UXB M;  3HTU A;  1A36 A;  3L1P A;  3U61 A;  1CQT A;  3H0D A;  3GVA A;  3ERM A;  4AM3 A;  4S12 A;  2L2O A;  3GLF A;  2PQ8 A;  1OKR A;  1H88 C;  5ICP B;  2DCE A;  3BG9 A;  2DU9 A;  1FP2 A;  2DXC B;  2R7Q A;  2HL7 A;  1JUS A;  2HOE A;  4UB8 C;  5LHI A;  4ENK A;  3A98 B;  5LQF B;  2V9P A;  1WI9 A;  1B4A A;  4UB6 C;  4A0X A;  1EJ9 A;  3K7A J;  2NQ8 C;  1Z7U A;  4KT5 C;  4L5E A;  2VQH A;  2HU9 A;  2WA0 A;  3GZ6 A;  1J75 A;  3D0S A;  3KYL A;  1FSE A;  1RZ4 A;  1F43 A;  1AD6 A;  1ODD A;  3LSI A;  3QRF F;  2LVP C;  3RGP A;  2CS3 A;  3VK8 A;  3KP5 A;  2ME0 A;  2EZH A;  5E79 C;  5KAF C;  2E2I J;  2OTJ I;  4GHL A;  4MQ9 F;  3OS2 A;  2CV1 A;  4BEH B;  1KON A;  1QA6 A;  4LB6 B;  4A3V B;  2XC7 A;  2A69 F;  5BQT A;  2HGC A;  4A3I J;  2DD4 B;  5F1J A;  1GV5 A;  3M8F A;  4RF1 A;  1OCR H;  3LA2 A;  2ZJP F;  4IBD A;  5L8R F;  4ZDO A;  4G6Z A;  2JMW A;  4FVM A;  2ZPB B;  1SVL A;  2HWV A;  2HPI A;  2LH9 A;  1A04 A;  5FLX S;  1VZ0 A;  3SHF A;  2D2W A;  5KK1 A;  1NV8 A;  2EFN A;  2HXI A;  4LJ8 A;  4MM3 B;  4XIC A;  1LDD A;  2KZU A;  1MMN A;  3PVS A;  2V6E A;  2CUJ A;  4LOC A;  1IRX A;  3EET A;  2HQN A;  1HKQ A;  2EH3 A;  2LRD A;  3PL8 A;  4WXD A;  2HQA A;  1F36 A;  5CVV A;  3QZ5 B;  3K9O A;  2XV4 S;  3P5J A;  2D7E A;  2DAO A;  3OTO M;  3KYC B;  4ABZ A;  5GAE J;  1NK3 P;  4TUW A;  1TWF J;  4Y4R A;  2HCB A;  2ZB9 A;  2ZME A;  2ZFW A;  3WG9 A;  5F1R A;  1JST B;  2X4A A;  4EJO A;  3A4C A;  2L3D A;  4CYC B;  2WMB B;  1QVR A;  2CHV A;  2H6B A;  1Z7L A;  4HF2 A;  2EPF A;  2F5C A;  2CH0 A;  4XM3 A;  4UY8 I;  5CQE A;  3WGH A;  1JUP A;  1G3S A;  1P4W A;  2H1R A;  1UMQ A;  3CC4 I;  4HSR A;  4WX9 A;  2KDZ A;  2MR9 A;  1HNZ M;  3ZCO A;  4RGR A;  2YFQ A;  2R46 A;  2ZTC A;  1FOW A;  3QPL A;  2IRF G;  3GLI A;  3KOZ E;  3GLI E;  4EM1 A;  4ELL A;  2L4E A;  1MBG A;  3F6V A;  1WJA A;  5HBJ B;  1HKT A;  2D5V A;  2DI3 A;  1HDD C;  5GAG J;  1G3W A;  2M7B A;  4LGW A;  3FK6 A;  1XGM A;  3TO6 A;  3E5Q A;  4Y28 F;  2K9S A;  3JRA A;  2QPA A;  1SXJ C;  3MIA B;  5DV5 A;  2ZXH A;  2ZPF B;  3RYR A;  4O3M A;  1XXH B;  2XF3 A;  3CF0 A;  2BXY A;  3CF5 F;  3ZCB B;  2Q2E A;  5AON A;  2QF7 A;  2QUF A;  2R7D A;  3A2K A;  1WGL A;  1F1Z A;  1RKW A;  3FUU A;  1Z0X A;  2BV6 A;  1GJS A;  4ZYH A;  4QLC U;  1L1Z A;  3F21 A;  1WGX A;  1SEU A;  3TO7 A;  3K70 C;  4A69 C;  3TWK A;  1W4M A;  2R45 A;  3B6C A;  3DFG A;  4PJ0 C;  1YW7 A;  4OIN F;  2YX4 A;  5BNG A;  2K9Q A;  1EKE A;  2P5V A;  2P5L C;  1EV7 A;  3TMO A;  3RFW A;  1BN5 A;  2X9D A;  5TJJ A;  2E1C A;  2BVM A;  3COA C;  3FKI J;  4QOZ C;  4GMQ A;  4BCO B;  5D5U B;  1G2H A;  2P7C B;  3W2V A;  3WTV C;  3ERE D;  1XDU A;  4HRI A;  4G4R A;  1GVJ A;  1GT0 C;  2EFQ A;  1DGH B;  1QPI A;  2AXT C;  2L01 A;  5EZH A;  5DD8 A;  2DOE A;  1BW6 A;  1WJC A;  1REP C;  3TP0 A;  2KMG A;  4ROE A;  1ETX A;  2R5Z B;  2Z3X A;  3SEZ A;  4JP0 A;  4GFB A;  4LLL A;  5EP3 A;  2DPU A;  3NWL A;  2KNV A;  1VFC A;  2C99 A;  3R0J A;  4BCN D;  1O4X A;  1OIS A;  5C18 A;  2HXO A;  5KNL A;  1DPR A;  3GYH X;  2KT0 A;  3MFK A;  4JI5 M;  2TCT A;  1MMS A;  3BC8 A;  3KZZ A;  4CFU D;  2RQP A;  5J3L A;  1PP8 F;  3ZH9 B;  2WEV B;  4LY6 A;  2JUG A;  1SMY F;  3SZG A;  2MA3 A;  3V7R A;  3WVD B;  1FYK A;  1F4I A;  3CUQ C;  2R6F A;  2BS2 A;  2WWY A;  4JXJ A;  4WXH A;  2GZW A;  1E17 A;  1BL0 A;  3TGN A;  2K4J A;  2OQ4 A;  2FRH A;  4XLC A;  3A8M B;  5HVY B;  2CCI B;  2YSR A;  2ZKZ A;  3TPZ A;  3CMM A;  1BU2 A;  1E32 A;  4RAF A;  3VYG B;  4IBB A;  1E3H A;  1YRN B;  2QDJ A;  4FCW A;  4DNC A;  1X4P A;  3JR5 A;  4CUG A;  5EFQ B;  1XMA A;  2K85 A;  4KIG A;  4QIW N;  5FTN A;  4EOI B;  1F9N A;  3RSN A;  1WQ2 A;  2QSF X;  1ZHF A;  2X6O A;  3HHT B;  5HS7 A;  3M4O J;  2CZ7 B;  1MKM A;  2J5Y A;  4LRT A;  1LDJ A;  1DGF A;  1U8R A;  4B3M M;  2OQR A;  3DBL B;  3RGS A;  3F92 A;  2X1C A;  3KIO A;  2DA1 A;  4M3B A;  1NG7 A;  4XOP A;  2W85 A;  5IT9 Z;  4OGR B;  5M3M J;  2QZ4 A;  2P6T A;  5L3C A;  1V55 H;  3RPQ A;  1WIV A;  2C5V B;  1MGT A;  1IUY A;  5EXT A;  1FEX A;  2R7Z J;  2H6C A;  5ICF A;  3L00 A;  1S7O A;  3LSK A;  2CCH B;  4DGW B;  4E7K A;  3FMS A;  1VQ8 I;  1H27 B;  1F4K A;  3X28 B;  1UJ8 A;  1RC9 A;  4I99 C;  4GIP A;  4UUV A;  1GL6 A;  2M8E A;  3S32 A;  3MMP A;  2IGN A;  2EA4 A;  1T38 A;  3OYG A;  3FWE A;  2OC6 A;  3QP5 A;  1JTY A;  2R62 A;  5ICE A;  3M3Y J;  2WJ9 A;  3JRH A;  3C3W A;  4NDL A;  4LRS A;  2F5V A;  4OIO F;  2BY0 A;  1NHW C;  3HJQ A;  4PJJ A;  4A3D J;  3I55 I;  3KSJ A;  5HLT A;  1FMV A;  4BEH A;  4JV5 M;  2L9N A;  2L7H A;  4LG2 A;  3OWT A;  3QAH A;  4MHG A;  1I50 J;  3DBR B;  1JT0 A;  2VBX A;  1YTY A;  4A3K J;  1NJG A;  4EOK B;  2KIU A;  1SXJ D;  2X1E A;  2ZME B;  3OYI A;  1TT0 A;  2PN6 A;  2FUG 2;  2K86 A;  2OUM A;  2FBI A;  2XAQ A;  4KMU X;  1OR7 C;  3T1B A;  2Z4R A;  1XPX A;  4JX4 A;  1PDN C;  2KEB A;  3SMS A;  4E7Z A;  1LFB A;  4LZZ A;  1J5Y A;  3JR9 A;  3HOT A;  3FTD A;  1MDM B;  2M5W A;  4AWX B;  4RA2 A;  2WFY B;  4FCV A;  4DOZ A;  2EBI A;  2ZSI B;  3FMQ A;  1VQO I;  2ACJ A;  2RNJ A;  4LF6 M;  3SAT A;  3BP8 A;  1GUX B;  3LFU A;  4QNR A;  3HRM A;  2A5Y B;  5KCM A;  3MKW B;  2EK5 A;  1T8I A;  2DME A;  1G3I A;  3KP7 A;  3HJ8 A;  3KP4 A;  1FOK A;  4O5V A;  3SFI A;  1QVU A;  4IVN A;  2HDC A;  4MGR A;  2VJ5 A;  3HOS A;  4ESB A;  5HNH A;  5HVQ C;  2Q2E B;  2E1O A;  3FIS A;  3K4J A;  3LCV B;  3N4M A;  4IRG A;  3GQ5 A;  4KN7 X;  4IPA A;  4KN4 X;  3K92 A;  1Y0U A;  4XLA A;  1I4W A;  4ENJ A;  1Y39 A;  3DWL E;  4CYD A;  2R5Z A;  1IXC A;  4CZZ A;  3FYD A;  2DD5 B;  4XR6 A;  1FY7 A;  2E60 A;  3F8F A;  3GPY A;  2F5O A;  4DZP A;  3CMA I;  1FPQ A;  3CJT B;  4CFV B;  2JA6 J;  2X85 A;  5L3F A;  3I71 A;  2KA6 B;  3WGI A;  5KQ8 A;  5IOY A;  1OIZ A;  1MZB A;  2V1N A;  2L7K A;  1MU5 A;  2XRL A;  4IX7 A;  3RGF B;  2AXL A;  1CUK A;  3DQV C;  4D82 A;  4D81 A;  3PUF A;  2ME6 A;  5FRM A;  3QOP A;  2IXS A;  5F64 A;  1IUF A;  3S1R J;  1FIP A;  4Z8X A;  2EIL H;  2O7O A;  1T95 A;  3J80 K;  1WXQ A;  2CO5 A;  2BWB A;  4F55 A;  3OS0 A;  2VOD A;  2P0W A;  2WV0 A;  3HBL A;  3D5S C;  4G7Z F;  1D5V A;  1YX3 A;  2DBB A;  3OYN A;  1FBQ A;  5J8C A;  3IL2 A;  1K78 A;  2HVS A;  3ZMZ A;  2YR0 A;  4KO8 A;  3K1J A;  4BJT A;  2R44 A;  2R7S A;  4BY1 X;  2ZAN A;  2V1C A;  3HEF A;  4ANJ A;  4L6V 6;  1QYR A;  4I5S A;  3B7N A;  1P6R A;  3A8H B;  4G6L B;  4NC6 A;  3OR1 C;  1JKR C;  3TL4 X;  3U1D A;  1ON2 A;  2FD5 A;  3O2P E;  1HJP A;  5H37 D;  5LGN A;  3Q0V A;  1W0U A;  1SFX A;  2VXD A;  1AWC A;  1GHC A;  1B8I B;  4U0Y A;  4WK8 F;  4YOO A;  5BPI A;  3FKJ A;  1ZRD A;  4DV6 M;  1X3Z B;  3C2H A;  1YJ9 I;  2UXX A;  4F91 B;  1YE9 A;  2LG4 A;  4CIC A;  2LVN C;  3R9X B;  1RET A;  1OI9 B;  2P8T A;  5IYD J;  1PJQ A;  2J5P A;  2L54 A;  4G9Y A;  2KXE A;  1HQY E;  4HG2 A;  3HWS A;  5AIQ A;  3W6K B;  3H4C A;  5C4J J;  3KX2 A;  1OKW B;  5GKN A;  2XGX A;  2F4I A;  1SXJ B;  2JPB A;  1MND A;  2CP8 A;  1WI3 A;  2YR2 A;  2P6S A;  1Z21 A;  3WHB A;  4RF0 A;  4UN2 B;  1FX7 A;  2JVH A;  3HKZ N;  4P96 A;  3GTJ J;  2Y0S N;  2A05 A;  1QUT A;  5EEG A;  4OOI A;  2L9R A;  2DK5 A;  1ZYR F;  2HQR A;  3CP8 A;  5H6Q A;  5ED4 A;  4IQ4 A;  1MBF A;  1MBE A;  3QAU A;  2GAU A;  4WXC A;  5ERI A;  1BI0 A;  2D0Q B;  1F5Q B;  3EOC B;  3REO A;  3QHW B;  3WTS C;  4RGX A;  2L4A A;  4GC5 A;  2ZJ2 A;  1W7P B;  4HDV A;  1FBS A;  4E7J A;  1IY0 A;  2LF8 A;  1MMD A;  4HX4 A;  1IBM M;  1TW2 A;  2HNH A;  2ZNZ A;  4EV0 A;  2HOS A;  1BM9 A;  1JKW A;  2JGZ B;  2KQR A;  2IW8 B;  3EUH C;  3S1Q J;  1X37 A;  2NYX A;  5M5Y J;  2CMP A;  1IM2 A;  2IA1 A;  1Y6I A;  4RGU A;  1UZC A;  4LLN A;  1MDM A;  2JZ0 A;  3RZO J;  3C9P A;  3FXR A;  2JNH A;  4LF9 M;  3HDD A;  3TP3 A;  3T5X A;  2QKM B;  1WZ2 A;  3S3O A;  1QDT A;  1R23 A;  4I01 A;  2PHG A;  1X3U A;  3GLF B;  2LNH C;  1H89 C;  2DAG A;  1U9N A;  2CQQ A;  2A68 F;  2KZS A;  4JI2 M;  4PJN A;  3B74 A;  3U9G A;  4P9U A;  1K6O A;  4IJF A;  3I58 A;  2DLL A;  4V2F A;  4BJ6 C;  4OWR B;  3J7A O;  1XTA A;  3AOE A;  5E3L A;  2XAJ A;  4AU7 A;  5DD4 A;  2IS4 A;  1C9B A;  3CUQ B;  4BBR J;  3DTO A;  2UXC M;  2ZPG B;  3BHV B;  1OKV B;  4U0V A;  2CEA A;  2K9M A;  5EGO B;  1Z5A A;  2ESN A;  2LY1 A;  4RNA A;  1S3J A;  2DMP A;  4OAY A;  2X4H A;  2EIK H;  1RIO H;  2IW6 B;  4LIU A;  3RYP A;  2DZN B;  3ISP A;  1YX5 A;  4OIQ F;  4FHT A;  1SG9 A;  5DYG A;  2EV6 A;  2Z1D A;  3M9A A;  1XWI A;  2QEX I;  2M8G X;  4BQQ A;  5DQW A;  1KYI A;  2XRN A;  2V26 A;  2X8A A;  3DPL C;  1JKP C;  2RKO A;  4G8X A;  1YS6 A;  4FAS D;  4LFB M;  4UUT A;  3H0G J;  3LAJ A;  3ECO A;  5TRD A;  5J4Y A;  5IRE B;  2I5U A;  3DLL F;  2I40 B;  5C3E J;  5BOX A;  2O8K A;  3BJ6 A;  4OVZ A;  5F3W A;  2O3F A;  4JI3 M;  4I76 A;  1D1B A;  1FOY A;  1MSF C;  3OOP A;  3ZMV A;  2G0E A;  4ON0 A;  2Y30 A;  4BNC A;  1AIS B;  1Z9C A;  4BCG B;  3PFY A;  3GLG E;  1Z05 A;  3ZQ7 A;  4BY7 X;  2KRU A;  3LL7 A;  4KMF A;  2J7O A;  1E9R A;  2OOA A;  4CHT B;  5JI2 E;  4MQV A;  4AIH A;  3W2A A;  1ETK A;  5KPR A;  1X2N A;  5J1R A;  2VT3 A;  4CIS A;  4B47 A;  1JXS A;  4NSR A;  3WU1 B;  4NRW A;  4B3R M;  2EQR A;  4A3B J;  3PIO F;  3S2D J;  4DJA A;  2RN7 A;  4QNM A;  4LGY A;  3WTZ A;  1XNR M;  1V4R A;  2W57 A;  1IN8 A;  2LP0 A;  1IGN A;  1OYW A;  5F04 A;  3CCV I;  1D8J A;  3K69 A;  1OCT C;  3K9T A;  4FM4 B;  1SD6 A;  3T8R A;  4UUS A;  3TQS A;  4I2O A;  1E7P A;  5HS9 A;  3CQZ J;  5GTI C;  2L5Q A;  3K6G A;  2DHR A;  5FSW A;  2EUC A;  3CCJ I;  1LB2 A;  1V92 A;  3JR4 A;  5ITQ A;  1KYZ A;  1UST A;  1WH5 A;  2W1O A;  1TT5 B;  2ZXW H;  3BTJ A;  4QHT A;  3CJQ B;  1BOA A;  3F8M A;  3GFJ A;  4M6Y A;  5DUK A;  2EKF A;  4NXN M;  4AG6 A;  1VDD A;  3SAS A;  1NHA A;  2E36 A;  3FXJ A;  1JR3 A;  2HFH A;  4RAG A;  1JUM A;  4XRF A;  1P2F A;  1LNW A;  2DPP B;  2HVR A;  3W68 A;  1YJN I;  3A8G B;  3GQ4 A;  4M9X A;  4AC0 A;  2LHC A;  1GAB A;  3PQJ A;  3VWB A;  4R8H A;  1YI2 I;  1GXQ A;  1TQP A;  4Y7N J;  2CZ6 B;  3UJN A;  2RRU A;  3GLH E;  2D1H A;  3EUH A;  3FRH A;  2PI0 A;  2MG4 A;  3IH2 A;  4L0Z B;  1S7A A;  2MYS A;  1KGS A;  4RB3 C;  3A02 A;  2HAK A;  2GOM A;  4BCH B;  1JR3 E;  1JJ6 C;  1A6I A;  3SFZ A;  1POG A;  1I3Q J;  4LJ6 A;  1ETQ A;  2XVC A;  3OIP A;  2X49 A;  4B3X A;  5DNY A;  1KQ8 A;  4BCM B;  4BJ5 C;  4CFN B;  4Q48 A;  4LB5 A;  2MRO B;  3FUT A;  4LMY A;  5LLQ A;  4IHS A;  2WBM A;  4NBQ A;  1G6N A;  1I5Z A;  1YUB A;  2L0K A;  4C2M J;  3MKL A;  4R71 A;  3TN8 B;  1T0F C;  4D5C A;  3FE3 A;  2RKH A;  2BKZ B;  3QPH A;  4YY3 M;  3H1C A;  4B3T M;  2DXI A;  2IT0 A;  2XAG A;  5FKM A;  4UVB A;  4LJ7 A;  4PDI A;  3K2L A;  1YIT I;  1TL8 A;  1QZY A;  4ENN A;  4Z2Y A;  1Z5B A;  4IBF A;  3DPU A;  5F0F A;  2DFI A;  1IY1 A;  3EDP A;  5HNB B;  1MBH A;  2LBF B;  4EGZ A;  4F6S B;  1U3E M;  4DYC A;  5C44 J;  3X26 B;  5M3F J;  2L7F P;  5JFR A;  3DLA A;  2XAF A;  5CVI A;  2MD5 A;  2DDA A;  2EJR A;  2R4G A;  2ZXJ A;  1N77 A;  4Y13 A;  3I01 M;  4XLN F;  3QPS A;  1XG1 A;  3OYA A;  2DT6 A;  1QAM A;  2DEN A;  3AV0 A;  2VXZ A;  3LWF A;  2ZFU A;  3PXG A;  1RUN A;  1F5T A;  4PZJ A;  2VC0 A;  3RIR A;  3FTE A;  1I6X A;  5IOZ A;  2QGU A;  2JSP A;  5HQ0 B;  3CLO A;  1JHH A;  4P1W A;  3H4M A;  4CFX B;  8CAT A;  3G71 I;  3UKG A;  2VF8 A;  2DQL A;  2FOW A;  3HZJ A;  3HGY A;  2JSC A;  2WAQ N;  4YFK F;  1ZAR A;  5FFX A;  4S04 A;  5JVG F;  3KVW A;  4HAM A;  5A2Q S;  4EEF G;  3CC7 I;  3MY1 B;  4CCM A;  2B63 J;  3DOA A;  3CO7 C;  4MIM A;  1L0O C;  1SVM A;  2H1L A;  3RZD J;  1X2M A;  3BQY A;  3VKH A;  3F72 A;  1PYV A;  2DTR A;  3IG5 A;  1U5T C;  1TW3 A;  3H5A A;  4IBE A;  2GQF A;  4GHA A;  1R00 A;  3HUG B;  2JRT A;  2K02 A;  1I1S A;  4QPO A;  1FVV B;  3DDP B;  1PJT A;  3QOE A;  2E5L M;  3FD9 A;  2ZBK A;  4LIV A;  4DV2 M;  4OIR F;  4FWH A;  4UUS B;  3L2V A;  1ZRC A;  1X1P A;  3AFH A;  3EIH A;  5K7Z A;  3OYC A;  2RQQ A;  3GFL A;  2CRG A;  1G4D A;  4L16 A;  1A6Q A;  3BTC A;  2DN0 A;  1YHQ I;  1IC8 A;  1UGP B;  4YII A;  1E0E A;  3BDD A;  1Z91 A;  1DUX C;  4REZ A;  3LA3 A;  1UG2 A;  3PJR A;  3JRC A;  1Y56 A;  2BHZ A;  3H4J A;  4HDU A;  2F5S A;  2JWT A;  1JB0 F;  2G3Q A;  4K2E A;  1DU0 A;  3GRY A;  4YIR X;  1MH4 A;  2KDO A;  4HEA 2;  3J81 Z;  2LXE A;  2GBY A;  1T56 A;  1D8K A;  1OMI A;  3VDX A;  3U6S A;  4J01 A;  3U21 A;  3EID B;  5DCF A;  2XAS A;  2IW5 A;  3GTP J;  3M7G A;  3LVW A;  2BY3 A;  5HDK A;  5KHD A;  2BY1 A;  2B9R A;  1IFY A;  2PFB A;  3HC7 A;  2PEX A;  1FIA A;  2AQE A;  1MJB A;  1XN7 A;  2COM A;  4G6T B;  4RDU A;  4PSW A;  1KQ0 A;  3J7B A;  1IV8 A;  3IAM 2;  2W99 A;  3BJA A;  3CD6 I;  4F1I A;  3HHX A;  4UN0 A;  1QZZ A;  2FBK A;  3H92 A;  4UVC A;  5KO3 A;  1EH8 A;  1PJJ A;  1OYY A;  4G12 A;  1S8N A;  1WHC A;  4Y72 B;  5FTL A;  1Z77 A;  1DDN A;  2DA3 A;  1NO1 A;  3HSR A;  4U88 A;  4II5 B;  2IS6 A;  2DA7 A;  3T1Y M;  4ENM A;  5DM6 F;  2L09 A;  3EQL F;  3BCB A;  2PJQ A;  3KOW E;  1A5J A;  4P17 A;  4NRV A;  3AG4 H;  4A6E A;  4AYB A;  1W36 D;  1B72 B;  3I3L A;  4CFW B;  1ZAE A;  3LCU A;  4F52 A;  3JAM S;  2P7V B;  3C7J A;  4HV5 A;  3G6E I;  2Q8K A;  1J59 A;  2HR3 A;  2XZU A;  3F0C A;  3I53 A;  3K1N A;  5CQG A;  3GRR A;  4BHB A;  2JP7 A;  2DYR H;  5B1B H;  2RGH A;  5DUI A;  5FGM A;  3I0T A;  5KVR A;  3HU2 A;  3J81 S;  3S3M A;  4I0B A;  1FTZ A;  2WHB B;  2KIS A;  2VQG A;  4GXO A;  2AHQ A;  3OYJ A;  4ITV A;  2WAQ A;  1E94 E;  4F6W B;  2EIN H;  4FX4 A;  3AOE C;  3NBX X;  2OF7 A;  4IOA F;  1TH2 A;  4B08 A;  4O6J A;  2R7U A;  3OL4 A;  1I3A A;  4LF5 M;  3KS4 A;  1VQP I;  1VEG A;  2OJE D;  2QQB A;  2XB5 A;  2FS1 A;  4HPQ A;  4MNU A;  2R92 J;  1XC5 A;  4L5I A;  2A3S A;  1UHM A;  3DKW A;  2F6C A;  4UXN A;  3E97 A;  2VKV A;  2RGV A;  4HNU A;  2BW3 A;  4A3F J;  3TNI B;  1DO2 A;  2DXB B;  1LV7 A;  5F08 A;  3GWZ A;  2LD5 A;  1JE8 A;  2OPF A;  1GO5 A;  2V4J C;  3ZP5 A;  3GLG A;  5J40 A;  2JPC A;  1TH3 A;  5JHU A;  4QWQ A;  4BBR M;  4HW0 A;  3GUD A;  2BWE A;  1E3P A;  3KEQ A;  4BCF B;  1ZMV A;  3B6A A;  1GVN A;  2XZF A;  1NNJ A;  1N75 A;  2VKD A;  4ZTF A;  5M5X J;  2BPM B;  3SAW A;  4PT5 A;  2EZI A;  1TLH B;  4ROD A;  3OYM A;  1FC3 A;  3HHW A;  2KRK A;  3GPP A;  2XB0 X;  2APL A;  3G3Z A;  4M3F A;  2WIP B;  2MLK A;  3QPT A;  3VOE A;  4A0Y A;  4B1R A;  1R49 A;  2GXB A;  1YSY A;  1WHU A;  2PG4 A;  4DR7 M;  4RB1 A;  3DFZ A;  3AL0 C;  2COB A;  2TDX A;  3M1C A;  1DP7 P;  1XMQ M;  3DP7 A;  4ZTJ A;  3L2W A;  1H9G A;  4CXF A;  1R7R A;  2JUJ A;  3G33 B;  2LR8 A;  2QQ8 A;  2F5N A;  2EJS A;  1SD7 A;  2GLO A;  3GLF E;  3MCZ A;  4XK4 A;  3DL1 A;  3BR1 A;  3BPX A;  2MH9 A;  4OB0 B;  2H94 A;  4LK1 F;  4OB3 B;  3N97 A;  2DVW B;  1ORK A;  4JOM A;  1J2X A;  2WSE F;  1QVT A;  3O8H A;  4BYY A;  1IV6 A;  4BXX J;  2XEP A;  3O8G A;  4ASN A;  1OLT A;  1ENH A;  5CVR A;  5EXP A;  2X48 A;  4K0K M;  4DBQ A;  4IOC F;  4XSZ F;  2QBY A;  4LG0 A;  3F22 A;  4M73 A;  4RB2 C;  4D9J A;  3IKT A;  1XNQ M;  4OR5 B;  4XLH A;  4LF8 M;  2FU4 A;  3C3E A;  3RDI A;  3QYH B;  3ZRG A;  1PJS A;  5LHG A;  1OKS A;  2UUE B;  3HOU J;  1K78 B;  4XLF A;  2A6T A;  1VIN A;  1B8I A;  1TWG J;  5D8L B;  3TKY A;  4G4N A;  3HSE A;  2NAZ A;  3MAJ A;  3KYD B;  3JRG A;  3T0Y A;  1RR7 A;  3B57 A;  2VE9 A;  1FIN B;  2QNJ A;  2DA2 A;  3SAU A;  1NNU C;  2CG4 A;  3FDY A;  2Y31 A;  2M30 A;  5H6R A;  1VQ5 I;  2UZB B;  1W36 C;  4LZJ A;  5DEQ A;  2PMH A;  3L2Q A;  5BMZ A;  1FYM A;  1YLF A;  2CZ0 B;  4LF7 M;  3SC3 A;  1WKM A;  1YJW I;  1OCP A;  3RTR A;  2K47 A;  4L8R C;  2QLZ A;  1R2Y A;  3TDZ C;  1FJL A;  1KSF X;  3TE6 A;  2UXD M;  1TTE A;  1U2W A;  3E6M A;  1S72 I;  2AS5 F;  3QXE B;  3KE2 A;  3HHY A;  2R0I A;  5HBE B;  3V8J A;  3F23 A;  2K9L A;  1H0M A;  3FTC A;  2GWR A;  2DAE A;  2OA4 A;  5K7H A;  4KHP M;  3ZPL A;  4ESF A;  1I27 A;  2LDU A;  4LG3 A;  1DQU A;  1LE8 B;  1H1R B;  2E2H J;  2JA8 J;  4LJA A;  2R0Q C;  1WR1 B;  3K4C A;  1HA8 A;  4NOO B;  4OVZ B;  3G1L A;  3IAS 2;  3K4N A;  2F5P A;  4RS8 A;  2HKJ A;  1LEB A;  5HLI A;  3DBH B;  4RM3 A;  3HRT A;  4FW9 A;  2W84 A;  2JT1 A;  2CUE A;  4RMN A;  1URC B;  2ISZ A;  2KIF A;  1OL2 B;  4C3I J;  1K7A A;  2JY7 A;  2M1B A;  5EDN A;  2Q0O A;  3KDS E;  5EZG A;  3NDQ A;  4S05 A;  3NAR A;  4AIJ A;  4BCK B;  3IC7 A;  5CVU A;  3NAU A;  4GIT A;  4E6K G;  3CC2 I;  1VQ7 I;  2NS0 A;  3PNT A;  2J7N A;  1S3S A;  4AKG A;  3J27 B;  4FX0 A;  3WOD F;  3U61 B;  1T98 A;  1ZRE A;  2A5W A;  4LJ9 A;  5ACB A;  1HSJ A;  1VTN C;  4BBS M;  2JY5 A;  5E1X A;  3CUQ A;  3GRU A;  1NSF A;  2XDV A;  1TNT A;  3W67 A;  2XGN A;  1GV2 A;  4N0B A;  4F6U B;  5FTJ A;  3AAF A;  1EA3 A;  2K3F A;  3OIQ A;  3KET A;  3MI9 B;  3WVE B;  1ZRF A;  4I81 A;  2NVX J;  1ZK8 A;  2OD5 A;  2PMZ N;  5FLX K;  3CF2 A;  1WH7 A;  4IMY B;  2KLO A;  4CCL A;  3OYH A;  2G9X B;  2Z3Y A;  3NWT A;  1BIB A;  1G3N C;  4G7O F;  1J9I A;  2BNK A;  2YNM D;  3WTU C;  2VLA A;  2E2J J;  4YEJ A;  1Z3Y A;  2EA0 A;  2HKO A;  3WG7 H;  3I4Y A;  4GO1 A;  4DBR A;  1C1K A;  2K0B X;  2ZSH B;  5IWA M;  4MGK E;  2JRM A;  3SJM A;  4EC8 B;  4EMS A;  4OB2 B;  1D1A A;  3U6M A;  1OIY B;  1Z1D A;  2XIG A;  2VN2 A;  3QYE A;  4IXA A;  3GTG J;  1LVA A;  2JTV A;  2M4K A;  1R22 A; 
#chains in the Genus database with same CATH homology
 1LKX A;  2VAS A;  4GRI A;  4YEL A;  4XKC A;  3H9J A;  3W2W A;  4B48 A;  1TZL A;  1MW7 A;  4XOT A;  4E7J A;  4EAT A;  3UNG C;  1MMD A;  1DP3 A;  4E7S A;  3FBI B;  2MD0 A;  2HNH A;  2WAE A;  4XQF A;  2KQR A;  4E7H A;  3H9G A;  3EUH C;  3ZR8 X;  2CMP A;  1Y6I A;  4CCO A;  3HPG A;  2ZPH B;  4PSX A;  1IRE B;  2CYZ B;  3PNV A;  2IS1 A;  4BE2 A;  2X51 A;  3K4M A;  3N05 A;  4PK4 A;  4BXF A;  4J00 A;  2QKM B;  1G8X A;  2OV7 A;  3S3O A;  4XN0 A;  2HZD A;  1FMW A;  5HNF A;  2K3P A;  4PJN A;  2KMU A;  1GLN A;  3DKY A;  4BJ6 C;  5LFA A;  3I9V 2;  3K4K A;  2X6W A;  4OWR B;  2G77 A;  4AU7 A;  2IS4 A;  3FBN B;  1D0Y A;  4ZDP A;  2ZPG B;  4HL4 A;  3ZGK A;  3G2B A;  2K9M A;  4QPQ A;  2LY1 A;  4YRV A;  2KP6 A;  2PJR A;  3S3N A;  4OAY A;  4CCK A;  4LIU A;  1YX5 A;  4PJL A;  4XN3 A;  5FRO A;  3OYL A;  1N78 A;  2Z1D A;  4B44 A;  2E5N A;  1X4O A;  5EJC A;  4BQQ A;  2X1D A;  2V26 A;  3H5N A;  1D0Z A;  2X6Y A;  2VQC A;  3DPL C;  1J09 A;  3VYH B;  2WAD A;  1X1A A;  1WJ5 A;  4XKB A;  4FAS D;  2LRE A;  3OYK A;  3A8L B;  4P5O A;  3MKZ A;  3RCO A;  2XF6 A;  4HNT A;  1BR4 A;  2KL4 A;  3BCA A;  1BOB A;  4KJZ A;  1Z3X A;  3E0J B;  2M4G A;  2ZPI B;  3QYB A;  2KRH A;  2M0M A;  5HOO A;  1D1B A;  3A1Y A;  4H4K C;  1LFP A;  3GBG A;  3X24 B;  4BUP A;  3BG7 A;  2VKH A;  3PFY A;  4NNJ A;  2VL8 A;  4II3 A;  1AHJ B;  3LL7 A;  2O5R A;  1D1C A;  2CZ1 B;  3W2A A;  2VQL A;  3FHN A;  3PSI A;  4B47 A;  4CCN A;  3LSH A;  1LVK A;  4PFP A;  3HL2 A;  2XF7 A;  4DJA A;  2DOA A;  4CZC A;  2XAU A;  2WY7 Q;  2QDY B;  1MMA A;  1DGR M;  1QHG A;  4BL0 B;  2DJI A;  3ZXS A;  2QFZ A;  2LYC A;  2VJ4 A;  4XL9 A;  4FM4 B;  4JQF A;  1E7P A;  2KZV A;  3VSL A;  1QHH D;  2L5Q A;  3K6G A;  4M6V A;  2ZCF B;  4OB1 B;  4BE1 A;  2W1O A;  4KT6 A;  2DT7 B;  3CJQ B;  2WAF A;  3VYU B;  4C30 A;  3DU5 A;  3VYS B;  1WJD A;  4QSH A;  4BQO A;  1X1B A;  5JHF A;  1QU3 A;  2ELJ A;  2DPP B;  4IKF A;  3A8G B;  1UGQ B;  1DGW Y;  2ZZD B;  3VWB A;  3TW7 A;  2RRE A;  3X25 B;  2QKL B;  4XMY A;  2CZ6 B;  2R7O A;  4IZZ A;  3QWL A;  3J7A Y;  4C9Y A;  2Z16 A;  2MYS A;  4XOR A;  2E1M B;  2IGO A;  2PMZ A;  3V42 A;  3OY9 A;  1V29 B;  2GOM A;  1UAA A;  2R7W A;  1X1D A;  1WJF A;  2LC2 A;  4Z6Y A;  3OIP A;  3HXL A;  4B3X A;  2IGK A;  4BJ5 C;  3H9Q A;  4Y33 A;  2V9K A;  3CES A;  4ZDL A;  3H0D A;  3OL3 A;  3QOD A;  2WBM A;  2L2O A;  4PUS A;  3LMM A;  2DCE A;  2NOJ B;  3M8J A;  4CCJ A;  3BG9 A;  2DXC B;  1T0F C;  2R7Q A;  3CJR B;  2DXI A;  2VQH A;  2HU9 A;  2WA0 A;  3NWS A;  2W00 A;  3KYL A;  3DPU A;  2KR6 A;  2L9S A;  3LSI A;  3OOU A;  2LBF B;  2CS3 A;  3DTI A;  2Z2S B;  1UGP B;  3X26 B;  3OS2 A;  3DLA A;  4BEH B;  2CV1 A;  1KON A;  2UWM A;  2R4G A;  2XC7 A;  1N77 A;  1UG0 A;  3OYA A;  2DT6 A;  3DU6 A;  2DD4 B;  4XNF A;  4MFD A;  2VXZ A;  2ZFU A;  5LD2 C;  4ZDO A;  2KHM A;  4E4H A;  2I8D A;  2ZPB B;  2HPI A;  2LH9 A;  2JSP A;  1VZ0 A;  4P1W A;  3OR2 C;  1WFX A;  4Y3O A;  2IGM A;  1MMN A;  2V6E A;  1SFK A;  2CUJ A;  4LOC A;  1IRX A;  4BGD A;  2LRD A;  3HZJ A;  3PL8 A;  2HQA A;  3QZ5 B;  4XON A;  2LBF A;  4HNV A;  1X1C A;  2CFO A;  3S93 A;  4CCM A;  3ZQQ A;  3LSM A;  4Y4R A;  3C2G A;  4BS9 A;  3UR3 C;  5FRN A;  4MIM A;  2RNG A;  3RPU D;  3VKH A;  1PYV A;  3W3C A;  4XLE A;  3H5A A;  2R7V A;  3HUG B;  3A4C A;  4QPO A;  4AKI A;  3QOE A;  4X0G A;  1Z7L A;  4LIV A;  3L2V A;  4XM3 A;  2LOO A;  2CH0 A;  1LDK B;  4BU2 A;  3AFH A;  3OYC A;  2E5Z A;  2RQQ A;  3OMY A;  5CQE A;  4ZGE B;  3PSF A;  5CKT A;  4HSR A;  4CA0 A;  3ZCO A;  2M7A A;  4FET A;  4NQW B;  3X20 B;  1E0E A;  3PJR A;  1G59 A;  1WJA A;  4NC8 A;  1Y56 A;  3KHI A;  2M7B A;  2UV1 A;  2VJI A;  4MLO A;  3E1S A;  3K4B A;  3DEE A;  2KDO A;  4HEA 2;  2MC4 A;  4J01 A;  2UUZ A;  3VDX A;  2ZXH A;  3U21 A;  3OYE A;  4U7B A;  2ZPF B;  1UGR B;  1PJR A;  4KIS A;  5KHD A;  3EUK L;  2E1M C;  1MMG A;  3HC7 A;  4PJM A;  2QF7 A;  3OYF A;  1D0X A;  3HG9 A;  2AQE A;  3A2K A;  3VKG A;  4OAZ A;  4F93 B;  3OYB A;  2HVR A;  4G6T B;  3BLY A;  2BS3 A;  2GOX B;  4PSW A;  4R79 A;  1V5G A;  3IAM 2;  3K70 C;  4BQN A;  4JX6 A;  1WJE A;  2R7X A;  3TMO A;  2XSJ C;  2BVM A;  4LIT A;  3S8P A;  2IS6 A;  3TBI A;  3W2V A;  3BCB A;  2CUZ A;  4P17 A;  4AYB A;  1W36 D;  4HRI A;  3I3L A;  3MKY B;  1P9Q C;  4F52 A;  1WJC A;  5CQG A;  2KMG A;  3SEZ A;  1UGS B;  2R7R A;  5TGT A;  3S3M A;  2X6X A;  2VQG A;  3OYJ A;  4ITV A;  2WAQ A;  5KNL A;  3IUO A;  2R7U A;  3BC8 A;  3OL4 A;  3DPT A;  4RLQ A;  3BG5 A;  4HPQ A;  2JVG A;  2JUG A;  3SZG A;  3VSK A;  4ELJ A;  2ZPE B;  2F6C A;  3OYD A;  2V7F A;  3D5L A;  3TW6 A;  3MD2 A;  4AVZ A;  2BS2 A;  3WVD B;  3QYG B;  3PUB A;  4HNU A;  2BW3 A;  2R7T A;  2KRC A;  2DXB B;  3ONQ A;  4XLC A;  3A8M B;  3SDB A;  2V4J C;  3CMM A;  3VYG B;  4U87 A;  3DTE A;  2QDJ A;  3AKZ A;  4BBR M;  4PFO A;  2WB1 A;  4IQJ A;  1X4P A;  4RLF A;  4RM2 A;  4CUG A;  3L2U A;  1N75 A;  2VKD A;  3RSN A;  4ZTF A;  3HHT B;  3QYF A;  4JX5 A;  4ZJZ A;  4ZGJ B;  2CZ7 B;  3HO8 A;  3A8O B;  3OYM A;  2X1C A;  4XOP A;  1NG7 A;  4DIQ A;  4AI6 A;  3EPZ A;  1S9H A;  3HPH A;  4D1Q A;  4II2 A;  3LSK A;  2CW8 A;  4DGW B;  4E7K A;  3X28 B;  2CV0 A;  3AL0 C;  2AHJ B;  4N4O B;  2JA2 A;  1BR1 A;  3M1C A;  4BDY A;  2WY8 Q;  2W4S A;  2IGN A;  3S32 A;  3VYR B;  4ZTJ A;  3OYG A;  2VPL A;  2OC6 A;  3BG6 A;  3L2W A;  1V5F A;  2WJ9 A;  2KPM A;  2IS2 A;  2QQ8 A;  2F5V A;  4CH7 A;  4PJJ A;  4XKV A;  3DL1 A;  5HLT A;  1FMV A;  4BEH A;  3RQ4 A;  4OB0 B;  3H5R A;  2L9N A;  3OWT A;  4KIT B;  2PJR B;  1SAU A;  4ZC3 A;  2CW7 A;  4OB3 B;  2Q1Z B;  4JOM A;  2X1E A;  3OYI A;  1TT0 A;  2FUG 2;  2OUM A;  3L2R A;  3BG3 A;  1OR7 C;  4CSW A;  1OLT A;  4JX4 A;  4E7Z A;  4DBQ A;  3HOT A;  2BW3 B;  4C2U A;  1X19 A;  3CP2 A;  2W82 A;  3VYT B;  4DOZ A;  4D9J A;  2ZSI B;  2VJJ A;  4XLH A;  3LFU A;  5KCM A;  3MKW B;  3QYH B;  3ZRG A;  4N4N B;  4HLQ A;  2BOL A;  4XLF A;  2A6T A;  2MFZ A;  3HB9 A;  3EUA A;  2VJ5 A;  3HOS A;  5HNH A;  5HVQ C;  2Q2E B;  3K4J A;  4BAC A;  3FDY A;  4ZYA A;  1AA7 A;  4XLA A;  1W36 C;  2HPM A;  4E7I A;  3DWL E;  2CZ0 B;  3L2Q A;  2XF5 A;  2DD5 B;  4XR6 A;  2E60 A;  3RTR A;  2K5C A;  4NC7 A;  4BE0 A;  2X85 A;  4B43 A;  3QXE B;  4AKH A;  1FKM A;  2ZXI A;  2K9L A;  1WJB A;  2V1N A;  2L7K A;  4IX7 A;  3QZ9 B;  3DQV C;  4LG3 A;  1DQU A;  5FRM A;  5CPR B;  2IXS A;  4BDZ A;  3K4C A;  1HA8 A;  2MAB A;  3IAS 2;  1QLB A;  4HST A;  3K4N A;  4C2T A;  2LY2 A;  3K10 A;  4XKW A;  2W7N A;  4RM3 A;  4RMN A;  1T95 A;  4F55 A;  3OS0 A;  1ZEL A;  2P0W A;  3HBL A;  2AQF A;  3D5S C;  3F9K A;  1YX3 A;  3OYN A;  2HVS A;  3SEQ A;  4BJT A;  2R7S A;  4E6K G;  1MNE A;  3K70 D;  3PNT A;  4ANJ A;  4AKG A;  3KEY A;  3A8H B;  4NC6 A;  3OR1 C;  2A5W A;  3TL4 X;  4BBS M;  2VIX A;  4F92 B;  4NUB A;  2VXD A;  3AL0 B;  1ERD A;  2XDV A;  1U0J A;  1V5E A;  3FKJ A;  1EA3 A;  3OIQ A;  3C2H A;  4F91 B;  3WVE B;  1YE9 A;  2BVL A;  2LG4 A;  3DTK A;  3D5R C;  3CF2 A;  3K4L A;  4HG2 A;  3H4C A;  3LSG A;  2KLO A;  3MMY B;  3CZ6 A;  2BS4 A;  3KX2 A;  3SYT A;  4CCL A;  3OYH A;  4MFE A;  3NWT A;  3PNY A;  2F4I A;  2VLA A;  1MND A;  4YEJ A;  1R6R A;  1Z3Y A;  2HVQ A;  2CV2 A;  1Z21 A;  2HDW A;  2Y0S A;  2JVH A;  2M3A A;  1NG6 A;  3H35 A;  4DBR A;  4ZGD B;  3HKZ A;  2ZSH B;  1JI8 A;  4E7L A;  1BR2 A;  3DKX A;  4OB2 B;  1D1A A;  3CP8 A;  2VB6 A;  4IQ4 A;  1K6Y A;  1UEL B;  3QYE A;  2M4K A;  3IP4 B;  3OS1 A;  2D0Q B;  4F3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...