3QYBA

X-ray crystal structure of human tbc1d4 (as160) rabgap domain
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
297
structure length
297
Chain Sequence
HMKVKLDYEEVGACQKEVLITWDKKLLNCRAKIRCDMEDIHTLLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKELLKQLTAQQHAILVDLGRTFPTHPYFSVQLGPGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLHMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEISPSLYAAPWFLTLFASQFSLGFVARVFDIIFLQGTEVIFKVALSLLSSQETLIMECESFENIVEFLKNTLPDMNTSEMEKIITQVFEMDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of human TBC1D1 and TBC1D4 (AS160) RabGTPase-activating protein (RabGAP) domains reveal critical elements for GLUT4 translocation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
molecule keywords TBC1 domain family member 4
total genus 91
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2011-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 3qybA02
1.10.10.2750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3qybA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3qybA03
2QQ8A 3QWLA 4HLQA 5EJCA 3QYBA 2QFZA 4HL4A 4Z6YA 2G77A 4NC6A 1FKMA 4P17A 3QYEA 3HZJA
chains in the Genus database with same CATH superfamily
3DDPB 2XAUA 2EINH 2HOEA 3HIFA 3T8TA 1UGSB 2HQ5A 1D1CA 4B8XA 3H4JA 2DJIA 4ANJA 2UZKA 4MQ9F 4DV1M 2FE8A 2JT1A 3DL1A 1P7JA 5FFXA 2VQEM 1YG2A 2PK2A 1ODDA 3ZMSA 2ZPGB 1VFCA 1MIJA 1MBFA 1N75A 2DI0A 3NWSA 5K7HA 3NWLA 3TQSA 3QYEA 1FMWA 2DYRH 2JK3A 4CZCA 1G8XA 1XS9A 1VNDA 4W1UA 2HYFA 4BDYA 2CZ0B 3CTWB 2L4AA 4L5EA 1OIUB 3OS1A 1JSUB 4AWXB 2VT3A 1BA5A 2L01A 4XN3A 1CF7A 1R2YA 4E7JA 2ISZA 1YIOA 2HS5A 4LF9M 2J7NA 2IJLA 3VB2A 2R7GA 3FTFA 3J2PB 4U0WA 2ZMEA 5E3OA 1NV9A 1K79A 5FFZA 1N4MA 1FLIA 4BH9A 3V8KA 3SZTA 3GTJJ 2B3TA 4QNRA 5JR3A 2MD5A 1IRFA 1SD6A 2BY0A 3G4SI 3W6VA 4BQNA 3J7AY 2EIJH 3S15J 2Z4SA 2DU9A 3NAUA 2PLYA 4LK0F 1R7RA 5A2QS 4MFEA 4A3LJ 2ZCFB 1XDUA 1KONA 2V1UA 3LFUA 1WJ5A 4L9VA 2GIZA 2DZOB 1V34A 3FTCA 1PYVA 5BNGA 1GVNA 2EFPA 3ISPA 4BXUA 2Z3YA 2L54A 5DS9A 5D5VB 1WJAA 3RZOJ 1HT2E 4XICA 1WI9A 4JI0M 2V6CA 3QYBA 2WZJA 2OCCH 3L00A 3RSNA 4EORB 2CW0F 3TO9A 3D0SA 4EJVA 5LFAA 3P9KA 1TT0A 1ZV1A 5J6XA 4QWQA 2KZUA 2PBIA 4AC0A 4EEFG 2F4VM 4ZGJB 1EKEA 1LDDA 2UXNA 1BI2A 2VKEA 2ZJQF 1I6XA 4JOMA 1Z1DA 1VTNC 2F5SA 1E9RA 2XPVA 1DO0A 1TWGJ 3KP7A 1P4XA 3R0AA 3W2WA 2GWRA 2N8GA 1VYWB 3F92A 3L2RA 4Q4ZF 2L9VA 3LQ5B 2CV2A 1TQPA 3THGA 2X1CA 1ZLKA 3J7AO 1XC8A 2IW6B 3SHGB 3TP0A 4JXJA 4V2GA 2WV0A 3BXWA 1GABA 2HOAA 3I53A 3J81K 2W4SA 1IN4A 1IRXA 3L7WA 4EV0A 3H35A 2E2JJ 3CCSI 3P9CA 1OYWA 1SFUA 1V55H 1SD7A 1Y39A 2UZDB 3LSMA 2R4JA 1MJBA 3B6AA 4B43A 1QZZA 1XMAA 3VSKA 4CHUA 3F8CA 5DM7F 3S2DJ 4G6TB 3I59B 4HYEA 4P55A 5J3LA 4P96A 4LF8M 5FKNA 2LW4A 4PCZA 4UN2B 2DK5A 3HRTA 4RF1A 2YSRA 3VEPA 4KMFA 2QNJA 4XRSA 1OR7A 2LTPA 1TQIA 3GLIE 4LJ5A 3GLXA 2JQ7A 1MX0A 2VJ5A 2O6GE 2A5WA 4PJ0C 1WWXA 2CSOA 1DPUA 1ZELA 1OKRA 2F6CA 2QLZA 4F55A 2K86A 3CO7C 3TPZA 4DBGB 2R0IA 4XLPF 4F6UB 3GO5A 1D0MA 1LV7A 1OIZA 3SDGA 2QSHX 1N25A 5BR8M 4Y52J 3S93A 2W25A 2XH9A 5JI3E 2RRUA 3FYDA 3A8HB 4GC5A 2LH0A 4XKWA 4CFNB 5IYBJ 3FXRA 1Y1VJ 1VQ4I 3M7GA 2ZNYA 2WB1N 3CCMI 1R49A 3V7RA 2CW7A 3HOTA 4E7SA 2CCIB 4LJ8A 3K0LA 4DJAA 2LF7A 1PDNC 2DLLA 1UZCA 2DA1A 5H6QA 1QDTA 4BY7J 1LUJB 2F5QA 2HYJA 3FXOA 4BJ5C 3B89A 3DXJF 4PJNA 5ICGA 3W2AA 2VXDA 3VKHA 1E3PA 1S72I 3I04M 2R46A 3U61B 1EE8A 4IHXA 1RPWA 3LAJA 2WIHB 4PSXA 2Y48A 2LRDA 3A03A 1ZAOA 3ZQFA 2W9ZA 3E46A 3JRCA 2GZWA 5F64A 2A68F 4N4OB 1TFBA 1X3ZB 2CFXA 2QVOA 5L8RF 3W6KB 5DV5A 1LNWA 4E7KA 1WJBA 1FZPB 1LDJA 3PO3J 5K5RA 1D2NA 2VONA 2OTJI 2WIPB 5TGTA 1IUYA 2HWJA 1I1SA 3RGPA 1MMSA 3HHTB 3O6BB 2EUFA 1LKXA 2R7XA 2ZPIB 5J4VA 4IXAA 4PJMA 1PRBA 2IT0A 1H1QB 4F2LA 3RFWA 1IZ1A 4G3OA 3TNWB 1L2CA 1EF4A 4IVNA 2A05A 3SYKA 2MBFA 4YIRX 4BQAA 2NOGA 2MFZA 1N32M 2GAUA 1IDZA 1XSVA 3KFUG 3CLQA 3PUFA 2KDOA 3A0BC 1QU3A 3O0GD 4BJTA 2VLAA 2DA5A 4ENJA 1PUFA 3F3XA 1I50J 1T08B 5EG0A 1R36A 4BCFB 2DAGA 3K8ZA 1BR2A 1YRNB 1JGGA 4KHPM 2EZKA 4AIJA 4LJ6A 2EFWA 3JR4A 2DO7A 3N05A 2YUSA 1IXCA 1HKTA 3U6MA 3FX3A 3IECA 1QMZB 5KNLA 1H1PB 4RM2A 3HHZA 3GLLA 3TDUC 4IBEA 3K10A 1QUTA 4BJ6C 4G94A 3BHTB 4B7FA 1ZARA 3MK6A 4WK8F 3KZZA 4G12A 3BCAA 2ZSHB 2OPTA 4GKJM 2JJ7A 2RNGA 4ZYEA 3GTMJ 4IZZA 3D8LA 4BHPA 2VKDA 2KHMA 1IFYA 1FOYA 1BBYA 3RE8A 3L29A 4CGYB 4I01A 3S1RJ 3OYJA 1QYRA 1VG5A 2LVOC 3B7QA 4V19K 4LF4M 1XB4A 2E7WA 2VL8A 1S7AA 1MMGA 2KIQA 2EK5A 2ZCWA 1FYMA 1ZREA 1W1WE 1BW6A 2RVCA 4LCBA 1IBMM 4P5OA 2MH8A 4X0GA 1SAXA 4D0PA 1F36A 3HU2A 2ZC2A 1WFXA 4DQ2A 3BY6A 5J8CA 4WX9A 5CVJA 5C18A 2WAQA 3FXLA 4HV5A 2EQRA 3JREA 2BNKA 1GV5A 3ZQGA 2ACJA 2KRFA 1HKQA 4D5FA 2FS1A 3HJQA 2DMNA 3C2BA 4NSRA 2L6OA 1IN8A 3HOWJ 4U87A 1JKQC 2Z33A 5HLGA 2JVGA 3TO6A 2IRFG 4YOZA 3GEZA 3Q9SA 2MH9A 2GA1A 1JR3D 2QUFA 1R5ID 4LOCA 3OYDA 3OSGA 3T1YM 3F6OA 3HJSA 4CJ6A 1A6QA 2LG4A 4Y3OA 3HL2A 2KRKA 2CZ6B 3GTLJ 4A3GJ 1HW1A 4D81A 3EUHC 4RGSA 2EBIA 2M87A 1BI1A 1GH6B 4XLNF 1E32A 1D1BA 4RM3A 5JHFA 2VQHA 3KOYE 3NEUA 4HG2A 3GPPA 2DYSH 3FXKA 3HYIA 4MNUA 3WU2C 1FTTA 2YPRA 3KYCB 1HXDA 1DGRM 3RKYA 4HNVA 4A93J 2QF7A 5TISC 1YLAA 3MWMA 3LA7A 3WTSC 4N9IA 4NBQA 1I6HJ 1R5LA 1QHGA 4OVZA 2LKPA 3FM3A 5E79C 1HBXG 4I4LA 1ZRFA 3OYMA 1T43A 1R1VA 3FXQA 5CJ9A 4M6VA 3MKLA 2R5ZA 1K6YA 2B7EA 1UHSA 5K5OA 1QPIA 4LZJA 1H89C 2E2IJ 2YFQA 1IM2A 5ILSA 4R3DA 3W6JB 1DGWY 3IWFA 4E4HA 3KHIA 1OR7C 2EA2A 2X9DA 2W84A 3KZYA 5M5WJ 5FLVA 5HDKA 3O2PE 1BI0A 1KU9A 3MHVC 3HRUA 4YG2F 4XLHA 2GLOA 2BEOA 4CCLA 5LRSA 3IHUA 4F52A 3GRUA 3IUOA 2XSZD 4G6QA 3S1MJ 4XGIA 3H0DA 1FSHA 2QDYB 2MH2A 2HOTA 1B9NA 4E70A 3A0HC 3OR1C 2BY2A 1LE8A 4AW4A 1E7PA 1ENWA 3PVSA 3DOAA 2ZPEB 2BW3B 3WTWC 3F21A 3CCRI 5F3WA 3DV8A 2I53A 2MROB 4A3VB 1H88C 3DLAA 2VBYA 3JTHA 4FCWA 2EKKA 4OIQF 2D2WA 1WI3A 3ZCOA 3I4NJ 1XO2A 1RU3A 2IVMA 4PDKA 3LNQA 2DWNA 3DEWA 3ZQQA 1BOBA 3K1JA 5FTKA 3AFHA 3HU1A 3D5LA 4Q7JA 4TUWA 4X1EA 5IP7J 3FUTA 2G7HA 3SFIA 2C6YA 1E2XA 1G3SA 1QVTA 4X62M 1HOMA 2DPPB 2YQZA 4FE7A 4M9SA 3A02A 2NVUB 1DGBA 4GC9A 1RI7A 1VQKI 3S16J 1ETYA 4NB5A 3ZN0A 4B44A 1MKMA 2XKPA 1DDNA 4GEWA 1IW7F 3FUXA 5LBQA 4J19A 1H8AC 3BG5A 2P6SA 3FMRA 3BCBA 2MA3A 2EA4A 2JWSA 3WTVC 4KFCA 2C5RA 4EOIB 3E21A 1FBQA 3KP3A 3N97A 2DT6A 3MEXA 1GL7A 2E5ZA 4PFPA 5KPTA 2K9LA 3J80S 4XR6A 3DTIA 4EC9B 2DXIA 2EZIA 5H20A 1G3NC 1H24B 1KQ0A 1LFPA 1T39A 2A6EF 2RGVA 2LKSA 3U2RA 1AUAA 1NHGC 4K0KM 2E7XA 2FBIA 3T0YA 1MMDA 1X1BA 4AYBN 4CCNA 3BG6A 3MKWB 4OIPF 2F48A 1QZEA 5EXSA 2VF7A 2DMTA 4OGRB 2DA2A 3SDBA 3QZ5B 1NJGA 4ZDPA 3IL2A 2H8RA 1MGTA 1ZMVA 1U6GA 2HXIA 5DDGA 3A42A 4B3MM 2ZMEC 3BOSA 2KDZA 5JLWA 3MZ8A 3F0CA 3GZNB 4IRGA 1YE9A 2DAEA 3K9PA 5HBEB 1A31A 5B3SH 3P5JA 3CCJI 3RPUD 1J75A 4CICA 4JI1M 4M3BA 3RTRA 1S6LA 3CF0A 3GRVA 1U3EM 3JRIA 1MDMA 2QSFX 3IG8A 1H26B 4ZTFA 5KK1A 3X2QH 2M2EA 1NH3A 2LTUA 3QQAA 4AZFA 4MGHA 3OTOM 1U9OA 3F5XB 1CUKA 3I01M 4XQFA 4BCJB 3FIWA 1W36C 3I56I 1IV6A 5FKOA 4D80A 3EDPA 2R3SA 1W0UA 1DGFA 1UM8A 3KDSE 4CH7A 1R5HA 2D45A 2LVPC 4LRTA 1R23A 1WJEA 3GTKJ 1DGGA 4M0WA 5LGTA 5GP9A 2ELKA 4BEHA 1FPQA 5DD8A 2XSJC 2JUCA 4F6WB 1JUMA 4F93B 2Y30A 3KP1E 1GLNA 2LH9A 2H09A 4ZDOA 5HVYB 2IW9B 2VDBB 4X64M 1MBEA 1RC9A 3LSGA 5C3EJ 4MGKE 1IN6A 3DU6A 2EFNA 3R6SA 4L15A 2VBZA 3D8BA 2ZB9A 2MABA 4HSTA 1OFHA 2I5UA 4EOPB 1H6UA 1SXJE 3C3EA 3F6VA 5EZGA 4EOLB 1G8PA 5DFLA 2W48A 4XLCA 3PL8A 4FISA 4Y7NJ 3AJIB 2KA6B 4BDZA 4OINF 1IRZA 2B9RA 1YSYA 4HNTA 4F7ZA 4JQFA 5F08A 4YHHM 2DODA 2D7GA 3U6PA 4Y4RA 2FBHA 1JHFA 3ILKA 5E18F 2R7VA 1OI9B 4OR5B 2Z7JA 3PUBA 4CA0A 4B48A 1TW3A 1MBKA 3U6SA 2D7HA 2KR6A 4IBBA 1XX5A 3J80K 1A04A 2CHGA 2P6TA 3C2HA 1H27B 1TT5B 4QHTA 3IC7A 4AU7A 1USTA 5ITUA 2FSWA 7CATA 1DP3A 3F8BA 4HDVA 1KSFX 2K3PA 3CUQB 2UZEB 1TWAJ 2L5QA 3LOCA 4II5B 4FCVA 2MC3A 3GYHX 2OZ6A 1UNLD 3DFGA 3MCZA 5FSWA 2XDVA 3ERMA 2UV1A 1VQ6I 3HOUJ 2KDLA 2ETHA 2LD5A 2KL4A 1G2HA 4RKUF 1BC8C 5IZ7D 2L2DA 5EP1A 2L02A 2C99A 1SAUA 1Z3XA 4BBAA 1X19A 4GFBA 4KNYA 3UKGA 1VINA 1WIVA 1I3QJ 3LVWA 1TQMA 4P1WA 2BYVE 5FROA 2G8LA 4HEOA 2GNOA 3QPSA 1W5CC 1G71A 4OIRF 3NBXX 2RC4A 2DN0A 4N4NB 1C7YA 1USSA 4NDLA 2QPAA 4BL0B 1AHJB 2VODA 3BZ6A 2HEOA 5LHHA 5IT9S 1T2KA 3FTDA 4BY1X 2V22B 4UB6C 2YR0A 3KSJA 1VI0A 3VLFB 3VK7A 1WJCA 4PGHA 2XGDA 5L3CA 4NQWA 2QGSA 4IJFA 3HGIA 2HQNA 1I5ZA 5K7FA 5ICFA 3VYUB 4CDGA 4QIWN 3CCYA 5LEKA 3JSOA 1HJPA 4KODA 1XHBA 2M5WA 1DGHB 2LLKA 3KEOA 3MZHA 1UNHD 1OPCA 4FT8A 4L0YB 4IKFA 4EVIA 4PCQA 1F5TA 3H5AA 3BTJA 4MQVA 2PJRA 1EJ9A 1HA8A 3H5RA 1Z5AA 4WXDA 1RUNA 4CCMA 4PDIA 2ELJA 2L7FP 2JSCA 2HXOA 5K1YA 4WWCA 4A12A 1ZAEA 3QYFA 3K4BA 4DR3M 3DEEA 2IN3A 3FXMA 4I0BA 3HU3A 1FSEA 1XXHE 3EUHA 4PSWA 1T6OA 3GLFA 3U5ZB 4ABZA 1BR1A 3T15A 2G5GX 3ABKH 5JVGF 1K61A 2E19A 3OIQA 5FRMA 3R4KA 1XXHA 1IAWA 1DU6A 3EIDB 3WE3A 4HAMA 3ZMVA 3IRQA 2DA6A 4A69C 2JPBA 1OCRH 4B3XA 1KU3A 1RR7A 1HQYE 3TW7A 3EUKL 5DYGA 1FT9A 3TN8B 3GTMS 4V2FA 2ZNZA 3TWMA 2X4AA 1X3WB 4II3A 2P8TA 5HDGA 2FE3A 4YFNF 3TNHB 1KFVA 2Y75A 5CYIB 1XMXA 3QPTA 1ORYB 1TDZA 5B5EC 3ELKA 4A3BJ 3SZGA 3L26A 3OYHA 1VQMI 2KIMA 1HLVA 3TP3A 1R71A 2ME6A 3AG2H 1UHMA 1J0RA 4ZZLA 5HS8A 5D4SA 4ETSA 2A69F 4XSXF 4IX7A 5IDPB 2VBXA 4M72A 3HZJA 3U21A 1HQCA 5IT3A 1FY7A 1T33A 3ZC7B 1PJSA 1P92A 3OL4A 5CKTA 2FU4A 4CISA 1VQNI 1Z7LA 2CUEA 2X48A 5FTLA 2DW4A 1F4KA 1WHCA 2I8DA 3P7NA 1RIOH 1JKWA 2KLOA 3ZMTA 3JCUC 1E94E 4GCVA 2FQ3A 1OL1B 2O01F 1MDMB 4DR5M 4UXNA 4CFMB 1UGPB 3H3UA 2XLJA 2JGZB 3ZN1A 2F2EA 4LF6M 3VDPA 3HJEA 2X85A 4RS8A 2GIVA 3WGHA 2XROA 2C5VB 1SEUA 3GLIA 3KP4A 1ENHA 2X8AA 4ZGEB 2KQRA 2XAQA 1NG7A 3T5XA 3GLIB 5A2QZ 3IKTA 5L2WB 5LMNM 5EXXA 4B08A 1J2XA 1GXPA 2NRAC 3BLRB 1J5YA 5KQ8A 3HOZJ 3I55I 2FX0A 3OV8A 2LBFB 2BXYA 2R5YA 4C2TA 2AHJB 2NS8A 1XMKA 4XSZF 5F1RA 1Q39A 2CS3A 1KQ8A 1FOXA 1EFUB 2JMWA 3CDLA 3DEUA 1SC7A 3UZUA 1BL0A 3SMPA 1ETXA 1V54H 2VJIA 1IN7A 3FYCA 4YFXF 3OYNA 3AKZA 1QGPA 3BHUB 4BEHB 4NC8A 1TLHB 4M3GA 4LGYA 2JXNA 2X0LA 3HSFA 4QTRA 4OAZA 4KJZA 3EYIA 2OOBA 3E5QA 1C1KA 5GAEJ 4OB0B 4F1IA 1ZGAA 3OYGA 3HOSA 2IGOA 5KAFC 2PFBA 3FWEA 3GLHB 4EGZA 2XPWA 3GUDA 3QRFF 1X2MA 2WMBB 2DK8A 3FMSA 4XLEA 1Z91A 4D1QA 3KX2A 3MMYB 1HDPA 1D5VA 5FLXK 2Z8YM 1T38A 3CCQI 1FBSA 2HFHA 3E1SA 3QU3A 3VYTB 2OC6A 5JI6A 3HDDA 5ITXE 4RMNA 3WU1B 3BTIA 4L78A 1IBLM 4MHGA 1FKMA 1SMTA 2PMIB 2LK2A 2KJCA 1T0FA 1IY2A 3FISA 4XM3A 2JVHA 3QYGB 2WSCF 3U61A 4WW0A 2OJED 1JB0F 5ITXA 3CC7I 4JI3M 1NSFA 4UN0A 1YW9A 2ZZDB 3SHFA 3DOGB 2QZ4A 2H94A 2FMLA 2HTJA 2RQQA 5E8IA 2DOFA 4ASNA 1YTYA 1DUXC 1BR4A 2OAZA 1PJTA 3C58A 4KO8A 3SASA 4LF7M 4QPOA 4DUYM 3BG3A 4O5VA 1OKWB 1Z77A 4G4QA 1LJ9A 2P81A 3ROUA 3GFMA 1B6AA 3BWGA 4PJLA 5LLQA 1Q3BA 2EKFA 3HHYA 1RR8C 1QUSA 2BWEA 2HPMA 2HGCA 2LP0A 3GVAA 4MEYF 4M6YA 1QNTA 1DO2A 2ICWG 1FIAA 1FEXA 5ICPB 2Z16A 3TWKA 4KIFA 3ZQLA 1F5QB 4H4KC 4R79A 3RGFB 1G59A 2OTLI 1KXUA 1W5TA 1MMNA 3KCCA 3RZDJ 2BGCA 1IG7A 2JZYA 4I09A 1M1EB 2GXGA 2CJJA 4NRVA 1I1GA 3IWZA 2KRHA 5F04A 4HL4A 1QO0D 2M30A 3ZQIA 1D3UB 1HDDC 4PZJA 2ECBA 3V4GA 2DI3A 2KMUA 4CYCB 2VC1A 3KIOA 5E6JA 4GH9A 4QLCU 3SARA 3C2GA 3E0JB 1MJ9A 5ILVA 3G1LA 4IBGA 3LQRA 4EOQB 2X1DA 1LFUP 2M4GA 2C5XB 1X3UA 3FTEA 3UJNA 1XNQM 1OCZH 1R1UA 1X58A 3E5XA 3H5NA 2H27A 4NUBA 1PP8F 4H0EA 3VKGA 4L4UA 5HS9A 4DR4M 2AO9A 4ITVA 4G7ZF 2DAKA 3Q0UA 4XRMA 4EM2A 4KISA 4DYQA 1XGOA 4I8OA 1VEGA 1BJAA 1WCMJ 4GGGA 3M07A 4Z8XA 3FBNB 1P3QQ 3CCEI 2R5YB 4EJTA 4I6ZA 2R7DA 1Y56A 5CVRA 1JUSA 3ZMDA 3IRRA 1UELB 2X51A 2MGQA 2QSGX 4C3IJ 2K85A 2LKXA 2FRHA 4QHSA 1VZ0A 4BE0A 1UHWA 5CYVA 1G4AE 2VASA 1OTRA 3KE2A 2V1DA 4N0BA 4EONB 2QEXI 1VQLI 1UGQB 2CWBA 2XZFA 1P4AA 2HI3A 4XONA 3ASNH 2W57A 1DPRA 3E97A 3K7AJ 5D5WB 1L8QA 4OOIA 2W24A 1HW5A 4CO8A 3BG7A 1W36D 4PUSA 4CCJA 3A8OB 2R4EA 1EIJA 4DBQA 4P16A 4DIQA 4ROCA 4Y17A 3P9IA 4HF1A 4AIDA 3IV5A 2Q8KA 4DW6A 5HLIA 4I81A 3T1HM 3BZCA 2XB5A 1OCOH 3PSIA 5L3BA 3W0FA 2VUMJ 1AA7A 1TBXA 1XGMA 3R8FA 3M0EA 1XN7A 3Q9VA 2FMYA 3AAFA 1SXJA 5IP9J 2F5PA 2KP6A 5GPCA 2DZNB 3CCUI 1N33M 2ECCA 3EETA 3I58A 1H25B 4ZJZA 5KCMA 1H1SB 1WH7A 2K4JA 3L9FA 5FD5A 4A6DA 3OYKA 3HOYJ 1OYYA 2H6BA 4E7IA 2M3AA 3GLGB 4BCKB 1ZGJA 1J5EM 3PNYA 4B47A 2XRLA 1W5SA 3F8NA 4RF0A 4HDUA 4XK8F 2MGWA 3VDUA 1QPMA 3ZQCA 2DFHA 3U60A 1WJDA 4LLNA 3G71I 3B57A 3KP6A 2IGKA 3QP6A 3OYIA 5FKLA 1XWIA 5IWAM 4AVZA 2BHZA 4U7BA 3OWTA 4RB0A 1S5LC 2E36A 5D6EA 5J8FA 2IW5A 1KU7A 3HHHA 5IF1B 1W7PB 2JSPA 4XK4A 2X4HA 2HTSA 4JK1X 3POMA 2DTZA 4DV4M 2KHHA 5D6FA 3KOZE 1J7KA 3FMQA 4BCQB 5HLTA 3S3OA 1YX3A 2EILH 2OQRA 1H4LD 2HKXA 2ADUA 1CGPA 1JQJC 3GPUA 1PM5A 2FBKA 3QPLA 1Z05A 3R60A 1AHDP 1RKWA 1YIJI 1QVUA 3MFKA 1LE8B 2J5PA 3KEQA 4RB1A 4DV5M 2R7ZJ 1FTZA 3MVPA 3WTZA 4AIKA 3TMOA 2OQ4A 1B72B 3X25B 2HL7A 3RKWA 2V1CA 3GLHA 4AVPA 1WQ2A 1XB2B 2IGNA 2Z99A 3FKJA 3ZGKA 2ZBKB 4L9NA 1FIPA 3LSTA 3QHRB 3QU6A 4BU2A 5GTHC 1F4IA 4FE4A 4PGGA 4KA4A 4IJEA 1QQWA 2VQFM 2WAQN 3L2AA 2G3QA 4F7NB 1Z5BA 4DUZM 2FA5A 4L5JA 2CHVA 1LDKB 2EZLA 2OU2A 4G4OA 4FETA 2PJPA 1IXSA 2QCUA 2DFEA 3CMMA 5EGOA 4R1HA 1FP2A 2M45A 3A45A 2QQAA 3M3YJ 5ITRA 5LEJA 4FM4B 3HOVJ 4M3EA 1OISA 1ZG3A 3FKIJ 3QXEB 2C9CA 4JI8M 2Q1ZB 2VE8A 2O25A 1ZR2A 3K1NA 3ZCBB 2L2OA 2QQ9A 3SYTA 5M3MJ 1QLBA 2R18A 2LDUA 2D5VA 2EIMH 2HDWA 5DCMB 5GADJ 4L6V6 3K1PA 1XPXA 1BIBA 1XGNA 1PVEA 1JJ8C 2L7IA 4GMQA 3IG5A 2NAZA 1GY3B 2QCOA 5HDNA 2VPLA 2Y0MA 4HBLA 3BTCA 1TWCJ 3H92A 3PO2J 3FHNA 3H3VK 2JN6A 3TQNA 4BE1A 1JE8A 1OJLA 4NSOB 3IH4A 5D5UB 2UXBM 2L7HA 2KMGA 2RN7A 3I64A 5IOZA 1A6IA 4AQYM 4G4NA 2DQRA 3UR3C 1XTAA 4MIMA 5IPAA 4DV2M 3FHZA 1SXJC 1R1TA 4C2MJ 1PUFB 4LFBM 1DQUA 1ONVA 3Q0VA 3WHLA 3HM5A 3T1BA 5FTMA 1K6OA 2GQFA 2MLGA 3N4MA 4IBDA 3H4CA 2X49A 3TEDA 3KSXA 4Y72B 4BXXJ 4BLCA 1BM9A 3L27A 1K3XA 1P7IA 5EJCA 3HPGA 2XSZA 3GQ4A 3AV0A 3S17J 4L5IA 3F23A 1ZG1A 3I59A 1MH3A 3K69A 2AXTC 2XF7A 2HNHA 1O3SA 4CRLB 4J01A 5HODA 2PJRB 3CZ6A 3GWZA 1YJNI 2ZKZA 2P5KA 4YIFA 3JRBA 1QAQA 3LSKA 3GTQJ 2B9SA 2WPAB 1RZ4A 4HRIA 1NHWC 4DOZA 2DFFA 1WXQA 3HWSA 2V9VA 2O3FA 1IJWC 1KU2A 2EV0A 2QYOA 5GAGJ 3ZMZA 2CEAA 1S3JA 5HNBB 1ORKA 2N35A 1H9GA 2W00A 3KLOA 1BN5A 2FH0A 3IH3A 1X4OA 2R7FA 3K70C 1E3OC 3TE6A 2HQRA 4Y28F 3L2CA 3RGSA 3BBZA 3BQYA 2X6XA 3FF5A 3GZ5A 4JP0A 3SEZA 1HC8A 5B1BH 1MNEA 3L09A 4JX4A 4QOSA 3G1MA 3RQ4A 2AS5F 4GDFA 3A01B 4DYRA 2ZFUA 2WEVB 4CCOA 2YNMD 3A01A 4YELA 4IEJA 3GTPJ 3BT9A 1Z0XA 3KETA 4IHWA 2M1BA 3QZ9B 2BZTA 4OW0A 4AKIA 2ZTCA 3WU0A 2WB1A 3LCVB 3DWLE 1LVAA 3U6QA 2M7AA 3OOPA 4L0ZB 2DTRA 4D7NA 2V4JC 1APLC 2UUEB 2FOIC 4RGRA 1GUUA 3A98B 1T6SA 2X6WA 3DPTA 2VE9A 2X1NB 2Y20A 1WJ7A 1T3TA 3CF6E 4LJAA 2PEXA 4D7MA 3D5SC 4RDUA 2EFOA 1CQTA 2FNAA 3DFZA 2OZUA 1B59A 1QBJA 2DPUA 2IS6A 5BPIA 3GBGA 1ZQ9A 2CU7A 3B73A 3K4MA 1W0TA 1P2FA 3FM5A 2H5XA 3RDIA 1JT0A 1V3FA 4XKCA 5EEAA 1FYKA 3Q5FA 2A5YB 3CF2A 3FZVA 3HRMA 5CQGA 4KIBA 1FNNA 1I39A 2LR8A 2DWLA 2KIUA 4QPQA 2COBA 4IIWA 2CQNA 2XIGA 3W3CA 1T8IA 4XORA 5FLMJ 1N36M 3K6GA 1H9TA 4N9HA 3MJ5A 5LD2C 4LFAM 3L25A 1FJGM 4F70B 3M6AA 3HPHA 4KLNA 3HC7A 4CCKA 2IGMA 3W68A 1NVMA 2DMPA 4JI4M 1SD4A 4DV0M 4BHCA 3HHXA 3DTKA 5L3FA 1JKOC 2MC4A 2J5YA 3GFJA 3S2WA 2LWXA 1DU0A 4Q5SF 1SVOA 4M9ZA 5EYRA 2KNVA 1FWZA 4CXAB 3GPXA 4A0XA 2QFZA 2EJSA 2OA4A 2AXLA 1X1CA 1Z6TA 3VSLA 1A35A 3VFZA 3K4CA 4OWRB 2J5OA 3HSEA 1YJWI 1E3HA 1YS7A 4DR2M 1YOVB 3GMEA 1QAMA 4FWGA 4LRSA 1Y0UA 2FD5A 3LA2A 4FASD 1REPC 1RUOA 1ZRDA 1FOKA 2XGNA 1SFKA 4XMYA 1XSXA 1JTXA 9ANTA 2ELHA 1FVVB 3BC8A 1EH7A 2P5TA 2ZAOA 1P4WA 2HQAA 3OYBA 3DTOA 4CHTB 4AIHA 3FRIA 5LMUM 3FK6A 4II2A 5LHIA 3MMPA 4RA2A 2ZMEB 2R7OA 1YITI 2NVQJ 1BW5A 3KXEC 4LIVA 2ZO4A 4RLFA 2E35A 1Z7UA 3A8MB 1C9BA 3CLOA 2BVMA 3GZ6A 1KA8A 4JX6A 1G3WA 2V7FA 1U9NA 4BXFA 2G9XB 4M0DA 5EXPA 2KW0A 4MO7A 5EGOB 1IV8A 2K6BA 2EV5A 1JKRC 1I4WA 2DFIA 2DJNA 4PK4A 3V8LA 3WE2A 4A3JJ 4FHTA 1XMQM 3LA3A 4MGIE 4GXOA 5J47A 4DV6M 1G6NA 4UVBA 5J40A 2CQ7A 4OB1B 3KP5A 4RGXA 5CLSA 1Q1VA 3E5UA 5GAHJ 2Y9ZA 3KPHA 4EQQA 1JR3A 4JI7M 2DOEA 2P7VB 2XAJA 2TCTA 3GCMA 3H1CA 4ZYAA 3DLLF 2O8KA 2STTA 1Z59A 1O9KA 3LAPA 2F5VA 2DD5B 1Q1HA 4OMZA 4FX4A 5KQDA 3TNIB 2OV7A 5IT9Z 4Q47A 1IXZA 4A2UA 4LY6A 2C4GB 2RKHA 4E7LA 4FCTA 2XHKA 3TOBA 4NL4H 2MW8A 2BV6A 2R7RA 3K9TA 4XN0A 2FXAA 5ILUA 3BG9A 4MTDA 1D5YA 3CD6I 4X6AJ 3BLYA 5IOYA 2PHGA 3B02A 3MQ0A 1LPQA 5ITYA 3OYCA 2EB7A 3TKYA 4IPAA 2V6EA 4ZC3A 1HT1E 5KHDA 3JRFA 2R92J 4F3QA 2JPCA 4A3FJ 3ZMUA 1R7JA 5L3GA 2AHQA 4RB3C 3LSRA 4IBCA 1SXJB 3K70D 4LGMA 3BP8A 4PT5A 2WAEA 3HKZN 4OIOF 3CO6C 4RAGA 2KT0A 1QHHD 2Z2SB 3RCOA 4RAZA 4OVZB 4IF4A 2LYCA 4EOJB 2JY6B 4AG5A 2KZVA 4EIWA 3V7SA 4DV7M 5LRRA 3Q8XA 5LGUA 3HB9A 3DCFA 1YHQI 3S32A 4ESFA 2LBFA 1LFBA 4XNFA 4FX0A 3DDQB 1GVDA 1WSUA 1OMIA 2VOPA 2L7ZA 2PI0A 2AQEA 3L28A 2CP8A 4R7GA 2F4OB 2OUMA 2FFJA 3K2AA 3BTLA 3JRHA 5M5XJ 2P5LC 5H6RA 3SJMA 2WMAB 4BCQD 4IJAA 2HZDA 1SFEA 3H9QA 2I7PA 2MR9A 2ZANA 2M8EA 4PFOA 4UHTA 1BVSA 3CUQC 1NNUC 4JBAA 2FNPA 2P0WA 3JW4A 4YOSA 4RGUA 4LLGF 4QOZC 5TJJA 4OMYA 2ESNA 1K82A 3I9V2 1PJQA 2CRUA 1JTYA 3X24B 4B3TM 4NHJA 3ZXSA 2K5CA 2LY1A 3DPUA 4JI2M 1HNXM 4HW0A 5AONA 2KXEA 1QANA 2Y0SA 4HNUA 5JVTA 4G7OF 2NQ8C 2F5NA 1IUFA 2IBDA 2ZXHA 3J7BA 1D3YA 5F6FA 2XZUA 3BJOA 4D5CA 2A61A 1HSJA 3ABTA 3B74A 2Q0OA 4EJOA 2ESHA 4KRDB 4FQGA 3ULQB 2A07F 2BS2A 1ERDA 4XLAA 4DR7M 2XF3A 2PG4A 3QP5A 2IP2A 2LNBA 2F5OA 4B4CA 5IYDJ 4IBIA 3OL3A 3LSIA 2WADA 5E1XA 3FE3A 4LB5A 4PDGA 2DAOA 2C5NB 1XDSA 4A0ZA 2L4MA 4Z2YA 3O8GA 4P17A 1F1ZA 2DNAA 2P5VA 2KRCA 4F6SB 2F4IA 1HKSA 5E3NA 1XXHB 4OU7A 4YC3B 1ACIA 4BXXX 2B63J 2LNHC 3KP0E 2CYZB 2L9RA 3M4OJ 1U0JA 2AQFA 4DBRA 5IP6A 1Z9CA 2MG4A 3MN2A 1BI3A 3CF5F 3KS8A 2UXCM 2VJ4A 3HOXJ 4KDPA 2XEPA 5GTIC 4B7GA 4L9JA 2W82A 4KT0F 5BOXA 1T0FC 4A5MA 3E6DA 4EATA 4F7JB 3WTTC 1YI2I 3RPUA 3BOQA 4B3SM 3DBHB 1R2ZA 4YIIA 3WG7H 3L1PA 3GLFE 2R65A 4A5NA 2ZJRF 3SEQA 4C2UA 1SG9A 2K02A 5FGKB 4BCND 2E1NA 3EPZA 2FF4A 2D1VA 1KYIA 3LSHA 1VQ1A 3ECOA 1ULYA 5FJ8J 5FO5A 1PGYA 2EA0A 4BQOA 3PQKA 3DKYA 2M4KA 4C3HJ 1WGLA 5D8LB 1STZA 4KT6A 5IDNB 8CATA 4LF5M 4KYWA 3SATA 3OYEA 1FJLA 4OAYA 2OBPA 1WH5A 2NS7A 2V1NA 2BE5F 5F0HA 2Z9OA 1UFZA 2W9FA 4KRCB 1XCVA 2UUAM 1VQ7I 1G3TA 1VF9A 4HX7A 2J7OA 3EQLF 3KOXE 3G33B 2LBCA 4BS9A 2QQ8A 1GKIA 3WG9A 2G0EA 2QQBA 3DA1A 1QDRA 3U6DA 2R45A 3LWFA 3R61A 1YLFA 4JV5M 1OAIA 5E8GA 5F0FA 1Y8GA 2JZ0A 2PX9A 1TH3A 5K5QA 4F92B 3U6OA 2YU9J 4FTHA 4BCMB 3K4KA 5CEIB 2CZ7B 3J27B 2K7LA 3DBLB 2QKMB 3IP4B 3U5ZA 1VQ9I 1ZP2A 5B66C 4JI5M 4M6XA 5DEQA 3GLGE 5DUKA 5L3EA 1V5EA 3GO8A 1QAOA 2EWNA 2V9KA 4ENKA 1SMYF 5E1WA 2RKOA 3M9AA 3J7ZI 2YX7A 3DQVC 1X2NA 3NQOA 2NYXA 4MGYE 4MB7A 2DT5A 4WCGA 2H1KA 4G6LB 5HBHB 3NBIA 2RNJA 2VIIA 1XC5A 2JY8A 2DHRA 4AG6A 1I27A 4GO1A 3DP7A 4QNMA 4HPQA 2CG4A 1WGNA 1OQYA 3BDDA 3CJNA 2D1HA 1TP4A 4A3DJ 4TTHA 1S8NA 1L1ZA 1BIAA 3CP2A 3EYYA 5KO3A 4CUGA 2WAFA 3AG1H 1QA6A 2L09A 3DU5A 4IBFA 3PXGA 4M3FA 4UB8C 2CV0A 4BY1J 3RYPA 1D8JA 3WHKA 1ZYRF 3GLHE 3S3NA 1YUBA 1FMVA 5E1ZB 3JR5A 5CQEA 1SVLA 3SYLA 1X1DA 3T38A 2KNZA 3BQZA 1ETQA 2VQGA 4MLOA 4ZH4F 1T98A 2O9LA 1VEJA 2WTEA 1FINB 1SD5A 1U8RA 3EJ1B 1WPKA 3VFDA 1NY5A 4OU0A 1AD6A 2QKLB 1OCCH 2OQGA 2ZXJA 3VODA 1AOYA 5DNYA 1GJSA 4ZTJA 4LJ7A 4AKHA 2B0LA 1TR8A 3HJ8A 2CQXA 1K3WA 5GPAA 2DHYA 4HSRA 3U60B 2WBMA 5HS7A 1TD6A 1URCB 3WVEB 2GQQA 4UNOA 3OOUA 1O4XA 4LB6B 5IY5H 2EZHA 2NVYJ 2BJVA 1W7PA 3JAMK 2OPFA 4LITA 2ZPBB 2C98A 5LGNA 4LG0A 1U5TC 3U9GA 4D9JA 4NNJA 2K9NA 2KJBA 2DZLA 2W7NA 1BC7C 4G6DA 1L2BA 3BR5A 3EIEA 2DWZB 1HNZM 1GJTA 3QWLA 4B09A 3L2UA 1VOLA 3U6LA 1WKMA 2JA2A 2KNAA 2GM4A 2VKVA 4UUVA 2IS2A 1IY1A 1DGHA 1UJ8A 2XF5A 3I4MJ 1ETVA 3F8MA 4I7HA 2I40B 1R6RA 2C6TB 3NRVA 5JLXA 4XBOA 2ID3A 2HDCA 2QENA 1EH8A 1TF0B 2WWYA 3ESWB 3NWTA 3TW6A 4J00A 3DBRB 4EJWA 2M7BA 5J1RA 2Y0TA 2C5OB 4BUPA 4ITQA 4F7LB 2V26A 1IO2A 4X65M 4X66M 3FDYA 2HPIA 3CJQB 4GHLA 5L3DA 3GRYA 5IYCJ 1TDHA 5ICEA 3V76A 3H36A 2I7NA 4NSTB 4BACA 4LZZA 1OKSA 5GKNA 4RODA 3I54A 3I71A 3CQZJ 3ZQJA 1XNRM 2ZJ2A 3VYRB 5JHUA 4YRVA 1L3LA 1SVMA 4FD2A 1S9HA 4UV9A 2XSDC 3A8GB 4EOKB 1G3YA 1JSTB 1Y8RB 4UUSA 3MKYB 2G7UA 1G4DA 3ECHA 5I5ZB 3OS2A 2DA3A 2MYSA 1R4NB 1O3TA 2HKJA 4UVCA 2CFOA 5DCMA 3HY5A 1VQ8I 3W2VA 1ZK8A 3CC2I 1U8BA 4BCIB 3KYLA 2WXVB 1GT0C 1V4RA 2P7CB 1ZQ3P 4KITB 4NC6A 3RPQA 2CO5A 4G6ZA 2HYGD 4IL6C 4XRSG 4DZPA 5LMKB 1D0KA 2XPUA 4EMSA 3HKZA 1R6BX 3M8FA 3KYDB 3CC4I 4UVAA 4LD5A 4WF2A 3NDQA 3PO3S 3HX3A 4S0HB 1YFHA 2JA7J 1F9NA 3Q0WA 1MBJA 3PSFA 3E7LA 2WJ9A 1ZRCA 2CJMB 1L1TA 1DV0A 2VI6A 2XKOA 3CMYA 3LSPA 2VN2A 2R6FA 5J1YA 2BBYA 4MM3B 2QGUA 2Y9YA 3DZDA 1T56A 3PIOF 3CCVI 3JAMS 2GXBA 2EUCA 2YR2A 1PJJA 2OCEA 3T6PA 3GF2A 3V7CA 3X28B 2LVAA 3HSRA 4EGYA 1YX5A 2L7KA 2P4WA 3S1NJ 3QHWB 4REZA 5FTJA 2W1OA 3T8RA 2Z5UA 2CGPA 4NXNM 1OAOC 2L9NA 4LJ4A 2ZSIB 1WGXA 2R5ZB 3E9SA 2DD4B 2JA5J 4KIGA 3GFIA 4ENNA 4RNAA 3C3DA 2H6CA 2R7WA 1Y0NA 5ACBA 3IAM2 2IAIA 4PJJA 3CTAA 3VK8A 3WTXC 3IH2A 4RLQA 1HW2A 2WC2A 4LG0B 3SAVA 2O8XA 2ZM6M 3BZKA 4BE2A 3KFWX 1P9QC 1TC3C 1TL8A 1Z67A 3ABLH 2O03A 1H1RB 1TZLA 3E6BA 5IHYA 2QZ8A 2M8GX 1FYLA 2GXAA 3VDXA 2V6ZM 4M73A 2OD5A 1NK2P 3GP1A 1EH6A 1JUPA 2E1MB 2L4FA 4BCOB 4CIZA 4Y33A 4DYCA 2JUJA 1JKPC 4ESBA 4C9YA 3I4YA 5CVUA 4XRFA 2LVNC 2CWEA 3FRHA 4RAFA 4WXHA 4EJUA 1J59A 4WP2A 4IHTA 4CSWA 1FX7A 1OL2B 2K40A 4JYAM 1HR0M 2Z3XA 3UK6A 2E34A 3H4MA 1E9SA 2E5LM 2HVSA 3BHVB 2IS4A 2LMDA 5BPDA 4MGRA 1X1AA 1BU2A 1K4TA 4BBRM 5JFRA 1RRJA 4HX8A 5ICCA 2DVWB 2F5DA 1D8KA 4YFKF 1DP7P 3J7AS 1WHUA 3RKXA 3R9XB 3E4RA 3ABMH 4LFCM 1ON2A 5EP2A 3TDZC 2ZFWA 4MEXF 5E3MA 2LVSA 3VYHB 5FKKA 5F0CA 4EOMB 2A6TA 1GUXA 2K0BX 2IA2A 2ZPHB 4KICA 2M0CA 5DYMA 5BPVA 1HF0A 1MN3A 2V79A 4G8XA 1HCRA 1PJRA 1R00A 3MIAB 1ETWA 1RKTA 2MSYA 3QOEA 4UV8A 2CCHB 3C18A 1VDDA 3M03A 2CQQA 3HBLA 3FK7A 3G1OA 1FBUA 1W7PD 4B3AA 1T95A 2R0QC 2W2HA 1U5TA 4FW9A 3KVWA 2X6YA 2M5ZA 3AG3H 3SQNA 2UUCM 1U5TB 5HQ0B 1IY0A 2EPFA 3LCUA 2KZGA 5EG0B 2F5CA 2QDJA 3QODA 1WZ2A 2MJ5B 3DKWA 1YRNA 2LY2A 3C3WA 4JI6M 5HNHA 1O3RA 3LQQA 1GV2A 2DENA 3CMEI 2R7SA 3REOA 2BY1A 1CF7B 4M3DA 2VIXA 3I51A 4AD9A 3QYHB 3Q3SA 1G3IA 3CGWA 1UG0A 3TL4X 2ZBKA 4B3RM 2CQKA 3HG9A 3I4PA 2UZLB 2LXEA 4A3EJ 3WTUC 2VQCA 2Y0QA 3BR1A 4JN6A 1B9MA 3AOEA 2Y2ZA 1A36A 1TTYA 1MSFC 1IDYA 3VYGB 1ZKGA 1NV8A 1RESA 1S7OA 2VJJA 3QAHA 2ZJPF 4ON0A 2MD0A 1ZG5A 3UNGC 2BY3A 4ESJA 4BBSJ 2VOOA 2K9DA 1GVJA 3L2VA 4EC8B 1V33A 3AOGA 5FTNA 5HBJB 1UG2A 3AL0C 2VPRA 3EIHA 3SAWA 2Y31A 4F7SB 2Y69H 1JT6A 1OLTA 2IA0A 4HOBA 5J1UA 1OFIA 3L2QA 1U2WA 3J81S 2DOAA 2JTVA 4PD2A 2XGXA 3E6CC 2RV8A 4LK1F 1V92A 5AIPA 3HTUA 3LL7A 4D82A 2UUBM 2K3FA 3K4JA 4BAYA 3A2KA 3B6CA 3J81Z 4R8HA 5FRNA 3CJRB 1IREB 4I2OA 3H3ZA 1NG6A 2XAFA 3BROA 3AOEC 4HQMA 5ITTA 1IGNA 4GKKM 1K7AA 1PJIA 3HXLA 1V5FA 2C96A 3MZYA 3BPXA 4XKBA 4HX4A 3G2BA 3F22A 1NK3P 4ANRA 2XFSA 5CVIA 2HOSA 2QP9X 2W96A 1S7EA 2DKLA 1BJZA 4HEA2 1ITYA 3C9PA 3V42A 3CUOA 4B7HA 4L8RC 4BB9A 3ZQ7A 3QOPA 5E3LA 3LFKA 4AUXA 4DGWB 1OGUB 3DF8A 4CYCA 2WV1A 3CCLI 1WRJA 2EIKH 1MU5A 1XCBA 2E60A 2G9WA 2KKOA 5FD6A 4XOTA 1ETKA 4LMYA 4ZYDA 2PK9B 4RBOA 1F43A 4XBFA 4I3ZB 5CVVA 2PMZA 4A0YA 4M71A 1VQ5I 3FXJA 3ZOBA 4U7DA 5DUIA 2M60A 3SFZA 3GX4X 3VWBA 3GTOJ 1S29A 1TTEA 2MLKA 2OOAA 2ZXIA 5E26A 2EJRA 1YYVA 1B1BA 3F8FA 3WHBA 1OIPA 3SZPA 4IOAF 4ZGDB 4LJZF 2CRGA 4LG3A 1MZBA 2JZ1A 1PP7U 3OY9A 3OR2C 2Y21A 2LY9A 2H1RA 1Z21A 4GRIA 2PN6A 2CH0A 3LMMA 5C4JJ 4YY3M 4Y13A 3OSFA 1UMQA 4LGWA 4LLLA 3QAUA 5IREB 1MJAA 2TRTA 1YW8A 2WSFF 4CFVB 4NXMM 2X1EA 2RGOA 2QHOB 3E6MA 3RQIA 3VOEA 4G7HF 4QSHA 3K4LA 1KGSA 1UB9A 4A3IJ 3DKXA 3KOWE 2NNNA 4L18B 4HLQA 3PFYA 2L9SA 2JA8J 2Q2EA 2QWWA 4R71A 5C1BA 2NXNB 4M9XA 3BJ6A 1B8IA 2XRNA 2Q2EB 3I4VA 2IW8B 3HGYA 5DQVA 2CE7A 2R62A 1X1PA 2PQ8A 5EXTA 2K9QA 4HZFA 3H0GJ 3OYFA 3GXOA 3PIPF 4MH0E 1K83J 3B9PA 3LW5F 2R93J 3H9GA 3M1EA 4Y15A 1Y6IA 3WTYC 4EM0B 4W5WA 1IC8A 4NOOB 2PMHA 3B7ZA 1N78A 1K4SA 1ZHFA 1ZMUA 4A6EA 2Y0SN 2VXZA 2BJWA 1K78A 2XGEA 1D0YA 2RREA 4IRIA 1O57A 2ZAMA 5EEHA 2A3SA 2Z1DA 1Z6RA 1PUEE 2HVRA 2LFBA 2DXBB 3CUQA 4BBSM 4YOOA 2FUG2 3H9JA 4GYGA 2LVQD 3LVVA 4LIUA 4LFUA 2HDDA 3K7AM 3X26B 1MBGA 3TBIA 4BHBA 5DD4A 4RB2C 4GYIA 1KZHA 2DAMA 2DAIA 3CDIA 3RYRA 5JI2E 3RIRA 2XC7A 3RI4A 2O0YA 4IHYA 4IQ4A 4CGZA 3M1CA 2CV1A 3MAJA 4ZYGA 4OB3B 1ZTRA 2APLA 2K47A 4DR6M 3G6EI 5DM6F 1FOWA 2FEZA 5D8KB 3PM1A 5BQTA 2IVXA 1TWHJ 1HSTA 2YU3A 3OYAA 2LREA 2F5EA 2HCBA 1ON1A 1QQIA 3I5UA 3GW2A 5DYIA 4U88A 3CDHA 3HHWA 5LQFB 4II7A 1P6RA 4BCNB 3G73A 2WHBB 4IRHA 3NARA 4FWDA 3KEYA 2XF6A 4B1RA 1J09A 1TNTA 2CUJA 3E3VA 1XD7A 3OYLA 2XUBA 3OMYA 2E1MC 1MBHA 4MTEA 3IKVA 2I10A 1D0XA 1SFXA 4NC7A 4NQWB 1AKHB 3DJBA 1AWCA 2XAGA 2KEBA 2JRTA 4KT5C 2G77A 2DWMA 2ERCA 1Q3CA 3FUUA 4IBJA 3D1NI 1AKHA 3JR9A 3MD2A 3JRAA 4L16A 4W97A 2BW3A 4FCYA 1OYIA 1QVRA 1B72A 2FOWA 4I76A 5BS6A 3A1YA 3WODF 2NNYA 2NVXJ 1P5EB 2K27A 2LF8A 4WXCA 5EF6A 1MD0A 3UGJA 5DQWA 2TDXA 3M8EA 4GIPA 2VBWA 5D5XB 3ABUA 4CZZA 3FBIB 3M8JA 4LG2A 1ZMWA 3HKPA 3GFLA 3FXUA 3BR3A 1ZH5A 1SANA 2STWA 3SMSA 4O3MA 5TRDA 4Z6YA 1A5JA 1IRGA 3EOCB 3PNVA 2E2HJ 4EM1A 1QZMA 4HA8A 2DXCB 1SXJD 4HLXA 3RKQA 1YQAA 2BPMB 1LTMA 3ZRGA 3BR2A 4ZYHA 3DTEA 4HV6A 2VT2A 4BBRJ 5FGMA 2BVLA 3KLNA 5EFQB 1WJFA 1ZR4A 3HGGA 3TGNA 4EOSB 5C4XJ 1VQOI 5DCFA 1UFMA 2DMUA 3GQ3A 4I99C 1MNMC 2LHGA 1YO5C 3F9KA 1FC3A 5AIQA 3F72A 1IQPA 4IBKA 1AIPC 3FD9A 3R0JA 4IQJA 4IMYB 3RJPA 2KRUA 1LQ1A 2HZTA 4A3CJ 1O9KB 1R9TJ 4E7HA 1VQPI 1J9IA 3OIPA 4CFWB 2GBYA 4ELJA 1AISB 3MKZA 1H0MA 4IO9F 1U78A 2VB6A 4ELLA 2KFDA 3CESA 3BLHB 2KPMA 3FKEA 3U1KA 4BYYA 1JI8A 3CMAI 4BCHB 1Y8QB 2JP7A 2R44A 1N77A 2IXSA 4JYKA 4S05A 2K9MA 5K7ZA 2WSEF 2DDBA 4MFDA 2JNHA 1MMAA 1D1AA 3ZQHA 1AU7A 3TOAA 4BNCA 3K9OA 2EFQA 4TV7A 5KPZA 2EV6A 3EUAA 2GOMA 1X37A 4ZPXA 5EZHA 4O6JA 5KAIC 5EDNA 3SXYA 2VKHA 3B7NA 1O7FA 3GPYA 2UXDM 2CHQA 5F1JA 3BPVA 2QA4I 3S3MA 4HF0A 4M74A 2VF8A 4CFUB 1KQ9A 2ZTDA 3KZIC 2KIFA 4KN4X 4IHVA 4BCMD 4CFXB 5IT9K 2D7EA 2XB0X 2XVCA 3HRSA 1PKDB 2O7OA 2L3DA 3PJRA 2FQ4A 2V9PA 1R5GA 2W85A 1Z5CA 2R7TA 1GHCA 1EA3A 4XLFA 3OS0A 5CPRB 3AL0B 2OO9A 2EH3A 3A8LB 1UCRA 2E5NA 1X4PA 2HAKA 3K1MA 1IXRC 4AI6A 2H8WA 2NOJB 2UUZA 1L0OC 2ID6A 2IPQX 3CP8A 4KUMA 3S8PA 5ITQA 4HF2A 3KP2A 2UZBB 2XV4S 2LHCA 4AYBA 1L2DA 1ZLJA 1TW2A 3QPHA 4DR1M 1XG1A 2HHHM 1TH4A 2LC2A 4L9TA 3IHPA 1RNLA 3ONQA 1VDLA 5B1AH 5J4YA 1XMOM 4AM3A 3MI9B 2HU9A 4XKVA 2JY5A 2L4EA 1R4GA 2X6OA 4Q48A 4ZZDA 1IF1A 1JR3E 4FVMA 2JA6J 1D0ZA 3HUGB 5FB2A 2HWVA 2WFYB 1YS6A 1UAAA 1G41A 2M34A 3MY5B 5DTDA 3FUVA 1B8IB 3V8JA 1LEBA 3O8HA 3BLQB 4WURA 5ERIA 3ZP5A 4RAYA 2HKOA 5E17F 2IEKA 3J7YJ 1KYWA 3VYSB 3PQJA 3BJAA 2R7UA 5F27A 3JTGA 2A6HF 3JSPA 5KVRA 1ZN2A 2BHYA 4U0YA 5BNJB 2L7MP 4NRWA 1IN5A 1QRYA 1V29B 1NNJA 4P9FA 2O5RA 2F5FA 1IXSB 4KN7X 4DNCA 2DCEA 5ED4A 2XGCA 3W67A 4G9YA 4BCGB 3WGIA 1TGUA 1RETA 1W4MA 1I3AA 5EP4A 3S14J 3WHCA 1R22A 1K78B 1OIYB 2Z4RA 1OCPA 1TH2A 4OX9M 1OCTC 4LJ9A 1WR1B 2AHMA 4I5SA 2CMPA 1YW7A 2HR3A 3FUWA 2R4GA 4EOOB 3UMMA 2WY8Q 2FOKA 2K9SA 3O3KA 3VPRA 2NVTJ 2RDPA 5FLXZ 2XASA 3Q8GA 1Q02A 2RAEA 2BXZA 1O7LA 1N34M 2F4MB 2QM3A 3PNTA 1GXQA 2CUZA 1LEAA 2ZPFB 1HNWM 4CFUD 1S3SA 5EQTA 3BR0A 2UXXA 3I0TA 3JRGA 3C7JA 5FKMA 2DBBA 3LSJA 3ZH9B 4I98B 4UY8I 1UNGD 2KZSA 4GITA 1E0EA 2RGHA 4E6KG 4S12A 3A4CA 3TWLA 3U6EA 3K4NA 4ENMA 2NS0A 5H37D 4FX3B 3U1DA 3I3LA 4C30A 3S2HJ 2BS4A 2PMUA 5HNFA 1OKVB 2E71A 2EO2A 2DPDA 5M5YJ 3JRDA 3DPLC 2XFTA 4XOPA 1E9HB 2K4BA 2ZXWH 3IAS2 3TO7A 4BQQA 5H2FC 2O61A 4E7ZA 1KYZA 4MGZE 4CYDA 1A5TA 5E20A 3PFIA 1YJ9I 5KPRA 2BWBA 2OF7A 3HEFA 1VEKA 3GTGJ 3A46A 5EEGA 5EP3A 1IBKM 1XSDA 2JRMA 3G3ZA 1GL6A 2YX4A 1XGSA 1H28B 1MH4A 2JUGA 2DMQA 3S1QJ 3K2LA 1ZGWA 3GQ5A 3KS4A 2JWTA 4DZJA 2XAHA 3SBJA 1MNDA 1SFOJ 2VQLA 3ML6A 3GLFB 2LSOA 5HOOA 4HQEA 5FLXS 4ZDLA 4K2EA 1JJ6C 2DMEA 3J80Z 3SC3A 1V5GA 2M9HA 1JOWA 1NJFA 2LOOA 2L0KA 2RQPA 1QZYA 2HVQA 2M0MA 2VC0A 1LVKA 4BCPB 1BOAA 4U0VA 2H1LA 2DDAA 4BY7X 3MY1B 3HO8A 2UU9M 2QBYB 1GO5A 3HUGA 1JHHA 4BGDA 1NO1A 2QBYA 5A2QK 4GHAA 2IS1A 2BOLA 1C0WA 1MW7A 2DT7B 4OB2B 3ZR8X 3WGGA 3ZPLA 2DA4A 1NHAA 3ERED 1TNSA 2YS9A 4C3JJ 4BKXA 2WA0A 4ROEA 1MSEC 1Y1WJ 2CW8A 4S04A 2ME0A 4IHSA 2BKZB 3C1DA 3AG4H 3ASOH 1R58A 4I0AA 2FJ1A 2CZ1B 4CXFA 4G4RA 4F91B 5LHGA 4XIDA 2BS3A 2PJQA 3K92A 2GA2A 4IOCF 2ISYA 2D0QB 2IA1A 4KMUX 4JX5A 4I02A 5HLHA 1W98B 2F2CA 3L2WA 3JAMZ 1OFCX 1FP1D 5HVQC 2PMZN 2W99A 5C44J 4P9UA 4YEJA 2C9OA 4DV3M 4XL9A 1NTCA 2UWMA 2CYYA 2GOXB 2V1XA 3HTSB 1TWFJ 2KISA 2JY7A 3GRRA 1R4MB 4UUSB 1E17A 2CUFA 3GLGA 3OIOA 1GDTA 3COAC 2E1CA 4AKGA 4FWHA 1Z3YA 3W0LB 3U6CA 1B4AA 1GUXB 3HHGA 1JXSA 3D5RC 2WY7Q 2DQLA 1JGSA 5M3FJ 1POGA 1MJGM 2E1OA 3CJTB 1UGRB 4UUTA 1ETOA 1LB2A 1EV7A 1WVRA 6PAXA 3BR6A 4A3MJ 2DA7A 3K2ZA 3KW6A 5D4RA 1D0LA 2R7QA 3SAUA 4HLYA 5BMZA 4A3KJ 1O3QA 1I94M 3WVDB 3X20B 1NY6A 2COMA
chains in the Genus database with same CATH topology
2XAUA 1UGSB 4BL0B 3QOEA 1AHJB 4N4NB 1D1CA 3DTKA 2DJIA 2MC4A 4ANJA 3HBLA 1T95A 3DL1A 2X6YA 2ZPGB 2QFZA 1N75A 1WJCA 3NWSA 1FMWA 1X1CA 3QYEA 4CZCA 3VSLA 3QODA 2QDJA 1G8XA 3K4CA 4OWRB 2LY2A 5HNHA 2CZ0B 3VYUB 4BDYA 2R7SA 3OS1A 4FASD 2VIXA 3QYHB 1UG0A 4XN3A 1SFKA 4XMYA 3TL4X 4E7JA 4IKFA 3HG9A 3BC8A 2VQCA 2HQAA 3H5AA 3OYBA 2PJRA 3VYGB 1HA8A 2VJJA 3H5RA 2MD0A 4CCMA 3UNGC 2ELJA 4II2A 2R7OA 3QYFA 3K4BA 4LIVA 3DEEA 4RLFA 3L2VA 3A8MB 2BVMA 3J7AY 4JX6A 4BQNA 4PSWA 2V7FA 3AL0C 2ZCFB 4MFEA 1BR1A 1KONA 1OLTA 1WJ5A 3LFUA 3L2QA 4PK4A 2DOAA 3OIQA 5FRMA 1PYVA 3X20B 3LL7A 4OB1B 3K4JA 4B3XA 3A2KA 3TW7A 1IREB 5FRNA 3EUKL 3CJRB 1WJAA 1NG6A 4ZYAA 4II3A 3QYBA 3RSNA 4P1WA 2F5VA 2DD5B 2OV7A 3HXLA 1V5FA 5LFAA 1TT0A 4XKBA 4E7LA 3SZGA 3G2BA 3OYHA 2R7RA 4ZGJB 4XN0A 3BG9A 4JOMA 3BLYA 3OYCA 4HEA2 3V42A 4IX7A 3HZJA 4ZC3A 3U21A 5KHDA 2V6EA 3OL4A 5CKTA 3W2WA 4F3QA 3L2RA 1Z7LA 4DGWB 2CV2A 3K70D 2I8DA 2KLOA 2X1CA 2WAEA 2E60A 1QHHD 2Z2SB 4XOTA 3RCOA 1UGPB 2W4SA 1IRXA 2LYCA 3H35A 2KZVA 2PMZA 2X85A 3LSMA 4B43A 3VSKA 3VWBA 2ZXIA 3HB9A 4G6TB 4ZGEB 2KQRA 1NG7A 4ZGDB 3S32A 2LBFA 4XNFA 4LG3A 2LBFB 4C2TA 2AHJB 3OY9A 2AQEA 2VJ5A 3OR2C 2OUMA 1Z21A 2A5WA 4GRIA 2CH0A 3LMMA 2CS3A 1ZELA 2F6CA 4F55A 2VJIA 3OYNA 3AKZA 2HZDA 4BEHB 3H9QA 4PFOA 4NC8A 2X1EA 3S93A 2P0WA 3K4LA 4QSHA 4OAZA 4KJZA 3DKXA 4XKWA 3PFYA 4HLQA 2L9SA 4OB0B 3OYGA 3HOSA 2IGOA 3X25B 3I9V2 3X24B 2Q2EB 3ZXSA 2K5CA 2LY1A 3DPUA 4BXFA 4XLEA 4D1QA 2Y0SA 3KX2A 4HNUA 2CW7A 3MMYB 3HOTA 2ZXHA 4E7SA 4DJAA 3A8HB 3E1SA 3VYTB 3OYFA 4BJ5C 2OC6A 2BS2A 1ERDA 4XLAA 3H9GA 4RMNA 4PJNA 3W2AA 1Y6IA 2VXDA 1FKMA 3OL3A 3VKHA 3LSIA 2WADA 4XM3A 1N78A 2JVHA 3QYGB 2VXZA 1D0YA 4P17A 2RREA 4PSXA 2LRDA 2ZZDB 2KRCA 2Z1DA 2DXBB 2HVRA 2F4IA 4N4OB 4BBSM 2RQQA 2FUG2 3H9JA 4LIUA 1BR4A 4E7KA 4QPOA 2CYZB 3X26B 3TBIA 1WJBA 3BG3A 1U0JA 2AQFA 4DBRA 2XC7A 5TGTA 4IQ4A 4PJLA 3M1CA 2CV1A 3HHTB 4OB3B 1LKXA 2R7XA 2ZPIB 2VJ4A 4PJMA 2HPMA 3OYAA 2LREA 2W82A 2Z16A 1T0FC 4EATA 4H4KC 4R79A 2MFZA 1G59A 3KEYA 2XF6A 1MMNA 4C2UA 2KDOA 3SEQA 1QU3A 1J09A 2CUJA 4BJTA 3EPZA 2VLAA 2KRHA 3OYLA 4HL4A 3OMYA 2E1MC 3LSHA 1D0XA 4NC7A 4NQWB 1BR2A 4BQOA 2KMUA 2G77A 3DKYA 2M4KA 4KT6A 3C2GA 3E0JB 3MD2A 3N05A 2BW3A 2X1DA 3OYEA 2M4GA 5KNLA 3A1YA 4OAYA 2V1NA 4RM2A 3H5NA 3K10A 4BJ6C 4NUBA 3VKGA 4ITVA 3BCAA 4BS9A 2QQ8A 3FBIB 2ZSHB 3M8JA 4KISA 2RNGA 4IZZA 2VKDA 2KHMA 3FBNB 4Z6YA 3PNVA 1Y56A 2DXCB 3OYJA 3ZRGA 4F92B 1UELB 2VL8A 2X51A 3DTEA 3K4KA 1MMGA 2CZ7B 2BVLA 2QKMB 1WJFA 3IP4B 4P5OA 4X0GA 1VZ0A 4BE0A 1V5EA 2VASA 2V9KA 1WFXA 3F9KA 1UGQB 4XONA 2WAQA 3DQVC 4IQJA 4E7HA 4ELJA 3OIPA 4U87A 4HPQA 1W36D 3MKZA 3BG7A 2JVGA 4PUSA 2VB6A 4CCJA 3CESA 3A8OB 4LOCA 2KPMA 3OYDA 4DBQA 1JI8A 4DIQA 3CP2A 2IXSA 1N77A 4CUGA 2K9MA 2WAFA 2LG4A 3DU5A 4Y3OA 3HL2A 3PSIA 2CZ6B 4MFDA 2CV0A 1AA7A 1MMAA 1D1AA 3S3NA 3EUHC 1FMVA 3EUAA 5CQEA 2GOMA 1X1DA 1D1BA 4MLOA 4RM3A 2VQGA 2KP6A 2VQHA 5JHFA 4HG2A 2VKHA 4ZJZA 1DGRM 4HNVA 5KCMA 2QF7A 3S3MA 2QKLB 3OYKA 4E7IA 2M3AA 3PNYA 4B47A 1QHGA 4ZTJA 3PJRA 2R7TA 4AKHA 3OYMA 1EA3A 4XLFA 1WJDA 5CPRB 3OS0A 3AL0B 4M6VA 2IGKA 3OYIA 4HSRA 2WBMA 3A8LB 1K6YA 2E5NA 1X4PA 3WVEB 2NOJB 2UUZA 4AVZA 3OOUA 4E4HA 1DGWY 3OWTA 3CP8A 3S8PA 4U7BA 2CZ1B 1OR7C 3KHIA 4LITA 2ZPBB 4AYBA 2JSPA 4XLHA 2W7NA 4D9JA 4NNJA 4CCLA 4F52A 3IUOA 5HLTA 3S3OA 1YX3A 2LC2A 3ONQA 3H0DA 2QDYB 3QWLA 3L2UA 2HU9A 4XKVA 3OR1C 2JA2A 1E7PA 2IS2A 2XF5A 1D0ZA 2ZPEB 3HUGB 2BW3B 3TMOA 1UAAA 1R6RA 4CCKA 3FKJA 2IGNA 3DLAA 3ZGKA 4AI6A 3ZCOA 4J00A 3NWTA 4BU2A 3TW6A 3ZQQA 3VYSB 1BOBA 3AFHA 2M7BA 2R7UA 3D5LA 4BUPA 1V29B 2O5RA 2V26A 1LDKB 2DPPB 3FDYA 2HPIA 4FETA 3CJQB 2DCEA 3CMMA 4B44A 4BACA 4FM4B 3BG5A 4YRVA 3VYRB 3BCBA 3QXEB 2Q1ZB 2CMPA 2R4GA 1S9HA 3A8GB 2L2OA 2WY8Q 2DT6A 3MKYB 2E5ZA 3SYTA 1QLBA 3OS2A 4PFPA 2HDWA 2MYSA 2K9LA 4XR6A 3DTIA 2DXIA 2CFOA 1LFPA 3W2VA 3PNTA 2VPLA 2CUZA 2ZPFB 1MMDA 1X1BA 3KYLA 4CCNA 3BG6A 3MKWB 3FHNA 4KITB 4NC6A 4BE1A 3SDBA 3QZ5B 4ZDPA 1E0EA 4E6KG 2KMGA 3A4CA 3HKZA 3K4NA 3UR3C 4MIMA 3I3LA 1YE9A 4C30A 3PSFA 1DQUA 2BS4A 5HNFA 3RPUD 2WJ9A 3RTRA 3H4CA 3DPLC 4XOPA 3IAS2 4ZTFA 5EJCA 4BQQA 3HPGA 4E7ZA 3X28B 1YX5A 2L7KA 2XF7A 2HNHA 4J01A 2W1OA 4XQFA 2PJRB 3CZ6A 1W36C 2ZSIB 2L9NA 3LSKA 2DD4B 4HRIA 4DOZA 4CH7A 2JUGA 2R7WA 1WJEA 3IAM2 4PJJA 4RLQA 1MNDA 4BEHA 2VQLA 5HOOA 2W00A 2XSJC 4ZDLA 4F93B 1X4OA 1GLNA 1V5GA 2LH9A 3K70C 4ZDOA 2LOOA 4BE2A 1P9QC 2X6XA 2HVQA 2M0MA 3LSGA 1LVKA 1TZLA 3SEZA 1MNEA 3DU6A 4JX4A 3RQ4A 3VDXA 3HO8A 2ZFUA 4CCOA 4BGDA 2E1MB 2MABA 4HSTA 4YELA 2BOLA 4Y33A 2IS1A 1MW7A 3QZ9B 4C9YA 2DT7B 4XLCA 4OB2B 3PL8A 3ZR8X 4AKIA 2WB1A 3DWLE 4BDZA 2M7AA 2WA0A 4HNTA 2CW8A 4JQFA 4CSWA 2V4JC 4Y4RA 3DPTA 2X6WA 2HVSA 4F91B 2R7VA 2BS3A 3PUBA 2IS4A 1X1AA 4CA0A 4BBRM 4B48A 2D0QB 3D5SC 4JX5A 2KR6A 3L2WA 3C2HA 5HVQC 2IS6A 3GBGA 4AU7A 3K4MA 4YEJA 1DP3A 4XL9A 2K3PA 2UWMA 2GOXB 4XKCA 2L5QA 3CF2A 5CQGA 3VYHB 1Z3YA 4AKGA 3W3CA 2XDVA 4QPQA 2UV1A 2KL4A 3D5RC 2WY7Q 2A6TA 4XORA 3K6GA 1UGRB 2ZPHB 5LD2C 1SAUA 1Z3XA 1X19A 3HPHA 2R7QA 3WVDB 1PJRA 3HC7A 5FROA 2IGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQ8 A;  3QWL A;  4HLQ A;  5EJC A;  3QYB A;  2QFZ A;  4HL4 A;  4Z6Y A;  2G77 A;  4NC6 A;  1FKM A;  4P17 A;  3QYE A;  3HZJ A; 
#chains in the Genus database with same CATH topology
 3DDP B;  2XAU A;  2EIN H;  2HOE A;  3HIF A;  3T8T A;  1UGS B;  2HQ5 A;  1D1C A;  4B8X A;  3H4J A;  2DJI A;  4ANJ A;  2UZK A;  4MQ9 F;  4DV1 M;  2FE8 A;  2JT1 A;  3DL1 A;  1P7J A;  5FFX A;  2VQE M;  1YG2 A;  2PK2 A;  1ODD A;  3ZMS A;  2ZPG B;  1VFC A;  1MIJ A;  1MBF A;  1N75 A;  2DI0 A;  3NWS A;  5K7H A;  3NWL A;  3TQS A;  3QYE A;  1FMW A;  2DYR H;  2JK3 A;  4CZC A;  1G8X A;  1XS9 A;  1VND A;  4W1U A;  2HYF A;  4BDY A;  2CZ0 B;  3CTW B;  2L4A A;  4L5E A;  1OIU B;  3OS1 A;  1JSU B;  4AWX B;  2VT3 A;  1BA5 A;  2L01 A;  4XN3 A;  1CF7 A;  1R2Y A;  4E7J A;  2ISZ A;  1YIO A;  2HS5 A;  4LF9 M;  2J7N A;  2IJL A;  3VB2 A;  2R7G A;  3FTF A;  3J2P B;  4U0W A;  2ZME A;  5E3O A;  1NV9 A;  1K79 A;  5FFZ A;  1N4M A;  1FLI A;  4BH9 A;  3V8K A;  3SZT A;  3GTJ J;  2B3T A;  4QNR A;  5JR3 A;  2MD5 A;  1IRF A;  1SD6 A;  2BY0 A;  3G4S I;  3W6V A;  4BQN A;  3J7A Y;  2EIJ H;  3S15 J;  2Z4S A;  2DU9 A;  3NAU A;  2PLY A;  4LK0 F;  1R7R A;  5A2Q S;  4MFE A;  4A3L J;  2ZCF B;  1XDU A;  1KON A;  2V1U A;  3LFU A;  1WJ5 A;  4L9V A;  2GIZ A;  2DZO B;  1V34 A;  3FTC A;  1PYV A;  5BNG A;  1GVN A;  2EFP A;  3ISP A;  4BXU A;  2Z3Y A;  2L54 A;  5DS9 A;  5D5V B;  1WJA A;  3RZO J;  1HT2 E;  4XIC A;  1WI9 A;  4JI0 M;  2V6C A;  3QYB A;  2WZJ A;  2OCC H;  3L00 A;  3RSN A;  4EOR B;  2CW0 F;  3TO9 A;  3D0S A;  4EJV A;  5LFA A;  3P9K A;  1TT0 A;  1ZV1 A;  5J6X A;  4QWQ A;  2KZU A;  2PBI A;  4AC0 A;  4EEF G;  2F4V M;  4ZGJ B;  1EKE A;  1LDD A;  2UXN A;  1BI2 A;  2VKE A;  2ZJQ F;  1I6X A;  4JOM A;  1Z1D A;  1VTN C;  2F5S A;  1E9R A;  2XPV A;  1DO0 A;  1TWG J;  3KP7 A;  1P4X A;  3R0A A;  3W2W A;  2GWR A;  2N8G A;  1VYW B;  3F92 A;  3L2R A;  4Q4Z F;  2L9V A;  3LQ5 B;  2CV2 A;  1TQP A;  3THG A;  2X1C A;  1ZLK A;  3J7A O;  1XC8 A;  2IW6 B;  3SHG B;  3TP0 A;  4JXJ A;  4V2G A;  2WV0 A;  3BXW A;  1GAB A;  2HOA A;  3I53 A;  3J81 K;  2W4S A;  1IN4 A;  1IRX A;  3L7W A;  4EV0 A;  3H35 A;  2E2J J;  3CCS I;  3P9C A;  1OYW A;  1SFU A;  1V55 H;  1SD7 A;  1Y39 A;  2UZD B;  3LSM A;  2R4J A;  1MJB A;  3B6A A;  4B43 A;  1QZZ A;  1XMA A;  3VSK A;  4CHU A;  3F8C A;  5DM7 F;  3S2D J;  4G6T B;  3I59 B;  4HYE A;  4P55 A;  5J3L A;  4P96 A;  4LF8 M;  5FKN A;  2LW4 A;  4PCZ A;  4UN2 B;  2DK5 A;  3HRT A;  4RF1 A;  2YSR A;  3VEP A;  4KMF A;  2QNJ A;  4XRS A;  1OR7 A;  2LTP A;  1TQI A;  3GLI E;  4LJ5 A;  3GLX A;  2JQ7 A;  1MX0 A;  2VJ5 A;  2O6G E;  2A5W A;  4PJ0 C;  1WWX A;  2CSO A;  1DPU A;  1ZEL A;  1OKR A;  2F6C A;  2QLZ A;  4F55 A;  2K86 A;  3CO7 C;  3TPZ A;  4DBG B;  2R0I A;  4XLP F;  4F6U B;  3GO5 A;  1D0M A;  1LV7 A;  1OIZ A;  3SDG A;  2QSH X;  1N25 A;  5BR8 M;  4Y52 J;  3S93 A;  2W25 A;  2XH9 A;  5JI3 E;  2RRU A;  3FYD A;  3A8H B;  4GC5 A;  2LH0 A;  4XKW A;  4CFN B;  5IYB J;  3FXR A;  1Y1V J;  1VQ4 I;  3M7G A;  2ZNY A;  2WB1 N;  3CCM I;  1R49 A;  3V7R A;  2CW7 A;  3HOT A;  4E7S A;  2CCI B;  4LJ8 A;  3K0L A;  4DJA A;  2LF7 A;  1PDN C;  2DLL A;  1UZC A;  2DA1 A;  5H6Q A;  1QDT A;  4BY7 J;  1LUJ B;  2F5Q A;  2HYJ A;  3FXO A;  4BJ5 C;  3B89 A;  3DXJ F;  4PJN A;  5ICG A;  3W2A A;  2VXD A;  3VKH A;  1E3P A;  1S72 I;  3I04 M;  2R46 A;  3U61 B;  1EE8 A;  4IHX A;  1RPW A;  3LAJ A;  2WIH B;  4PSX A;  2Y48 A;  2LRD A;  3A03 A;  1ZAO A;  3ZQF A;  2W9Z A;  3E46 A;  3JRC A;  2GZW A;  5F64 A;  2A68 F;  4N4O B;  1TFB A;  1X3Z B;  2CFX A;  2QVO A;  5L8R F;  3W6K B;  5DV5 A;  1LNW A;  4E7K A;  1WJB A;  1FZP B;  1LDJ A;  3PO3 J;  5K5R A;  1D2N A;  2VON A;  2OTJ I;  2WIP B;  5TGT A;  1IUY A;  2HWJ A;  1I1S A;  3RGP A;  1MMS A;  3HHT B;  3O6B B;  2EUF A;  1LKX A;  2R7X A;  2ZPI B;  5J4V A;  4IXA A;  4PJM A;  1PRB A;  2IT0 A;  1H1Q B;  4F2L A;  3RFW A;  1IZ1 A;  4G3O A;  3TNW B;  1L2C A;  1EF4 A;  4IVN A;  2A05 A;  3SYK A;  2MBF A;  4YIR X;  4BQA A;  2NOG A;  2MFZ A;  1N32 M;  2GAU A;  1IDZ A;  1XSV A;  3KFU G;  3CLQ A;  3PUF A;  2KDO A;  3A0B C;  1QU3 A;  3O0G D;  4BJT A;  2VLA A;  2DA5 A;  4ENJ A;  1PUF A;  3F3X A;  1I50 J;  1T08 B;  5EG0 A;  1R36 A;  4BCF B;  2DAG A;  3K8Z A;  1BR2 A;  1YRN B;  1JGG A;  4KHP M;  2EZK A;  4AIJ A;  4LJ6 A;  2EFW A;  3JR4 A;  2DO7 A;  3N05 A;  2YUS A;  1IXC A;  1HKT A;  3U6M A;  3FX3 A;  3IEC A;  1QMZ B;  5KNL A;  1H1P B;  4RM2 A;  3HHZ A;  3GLL A;  3TDU C;  4IBE A;  3K10 A;  1QUT A;  4BJ6 C;  4G94 A;  3BHT B;  4B7F A;  1ZAR A;  3MK6 A;  4WK8 F;  3KZZ A;  4G12 A;  3BCA A;  2ZSH B;  2OPT A;  4GKJ M;  2JJ7 A;  2RNG A;  4ZYE A;  3GTM J;  4IZZ A;  3D8L A;  4BHP A;  2VKD A;  2KHM A;  1IFY A;  1FOY A;  1BBY A;  3RE8 A;  3L29 A;  4CGY B;  4I01 A;  3S1R J;  3OYJ A;  1QYR A;  1VG5 A;  2LVO C;  3B7Q A;  4V19 K;  4LF4 M;  1XB4 A;  2E7W A;  2VL8 A;  1S7A A;  1MMG A;  2KIQ A;  2EK5 A;  2ZCW A;  1FYM A;  1ZRE A;  1W1W E;  1BW6 A;  2RVC A;  4LCB A;  1IBM M;  4P5O A;  2MH8 A;  4X0G A;  1SAX A;  4D0P A;  1F36 A;  3HU2 A;  2ZC2 A;  1WFX A;  4DQ2 A;  3BY6 A;  5J8C A;  4WX9 A;  5CVJ A;  5C18 A;  2WAQ A;  3FXL A;  4HV5 A;  2EQR A;  3JRE A;  2BNK A;  1GV5 A;  3ZQG A;  2ACJ A;  2KRF A;  1HKQ A;  4D5F A;  2FS1 A;  3HJQ A;  2DMN A;  3C2B A;  4NSR A;  2L6O A;  1IN8 A;  3HOW J;  4U87 A;  1JKQ C;  2Z33 A;  5HLG A;  2JVG A;  3TO6 A;  2IRF G;  4YOZ A;  3GEZ A;  3Q9S A;  2MH9 A;  2GA1 A;  1JR3 D;  2QUF A;  1R5I D;  4LOC A;  3OYD A;  3OSG A;  3T1Y M;  3F6O A;  3HJS A;  4CJ6 A;  1A6Q A;  2LG4 A;  4Y3O A;  3HL2 A;  2KRK A;  2CZ6 B;  3GTL J;  4A3G J;  1HW1 A;  4D81 A;  3EUH C;  4RGS A;  2EBI A;  2M87 A;  1BI1 A;  1GH6 B;  4XLN F;  1E32 A;  1D1B A;  4RM3 A;  5JHF A;  2VQH A;  3KOY E;  3NEU A;  4HG2 A;  3GPP A;  2DYS H;  3FXK A;  3HYI A;  4MNU A;  3WU2 C;  1FTT A;  2YPR A;  3KYC B;  1HXD A;  1DGR M;  3RKY A;  4HNV A;  4A93 J;  2QF7 A;  5TIS C;  1YLA A;  3MWM A;  3LA7 A;  3WTS C;  4N9I A;  4NBQ A;  1I6H J;  1R5L A;  1QHG A;  4OVZ A;  2LKP A;  3FM3 A;  5E79 C;  1HBX G;  4I4L A;  1ZRF A;  3OYM A;  1T43 A;  1R1V A;  3FXQ A;  5CJ9 A;  4M6V A;  3MKL A;  2R5Z A;  1K6Y A;  2B7E A;  1UHS A;  5K5O A;  1QPI A;  4LZJ A;  1H89 C;  2E2I J;  2YFQ A;  1IM2 A;  5ILS A;  4R3D A;  3W6J B;  1DGW Y;  3IWF A;  4E4H A;  3KHI A;  1OR7 C;  2EA2 A;  2X9D A;  2W84 A;  3KZY A;  5M5W J;  5FLV A;  5HDK A;  3O2P E;  1BI0 A;  1KU9 A;  3MHV C;  3HRU A;  4YG2 F;  4XLH A;  2GLO A;  2BEO A;  4CCL A;  5LRS A;  3IHU A;  4F52 A;  3GRU A;  3IUO A;  2XSZ D;  4G6Q A;  3S1M J;  4XGI A;  3H0D A;  1FSH A;  2QDY B;  2MH2 A;  2HOT A;  1B9N A;  4E70 A;  3A0H C;  3OR1 C;  2BY2 A;  1LE8 A;  4AW4 A;  1E7P A;  1ENW A;  3PVS A;  3DOA A;  2ZPE B;  2BW3 B;  3WTW C;  3F21 A;  3CCR I;  5F3W A;  3DV8 A;  2I53 A;  2MRO B;  4A3V B;  1H88 C;  3DLA A;  2VBY A;  3JTH A;  4FCW A;  2EKK A;  4OIQ F;  2D2W A;  1WI3 A;  3ZCO A;  3I4N J;  1XO2 A;  1RU3 A;  2IVM A;  4PDK A;  3LNQ A;  2DWN A;  3DEW A;  3ZQQ A;  1BOB A;  3K1J A;  5FTK A;  3AFH A;  3HU1 A;  3D5L A;  4Q7J A;  4TUW A;  4X1E A;  5IP7 J;  3FUT A;  2G7H A;  3SFI A;  2C6Y A;  1E2X A;  1G3S A;  1QVT A;  4X62 M;  1HOM A;  2DPP B;  2YQZ A;  4FE7 A;  4M9S A;  3A02 A;  2NVU B;  1DGB A;  4GC9 A;  1RI7 A;  1VQK I;  3S16 J;  1ETY A;  4NB5 A;  3ZN0 A;  4B44 A;  1MKM A;  2XKP A;  1DDN A;  4GEW A;  1IW7 F;  3FUX A;  5LBQ A;  4J19 A;  1H8A C;  3BG5 A;  2P6S A;  3FMR A;  3BCB A;  2MA3 A;  2EA4 A;  2JWS A;  3WTV C;  4KFC A;  2C5R A;  4EOI B;  3E21 A;  1FBQ A;  3KP3 A;  3N97 A;  2DT6 A;  3MEX A;  1GL7 A;  2E5Z A;  4PFP A;  5KPT A;  2K9L A;  3J80 S;  4XR6 A;  3DTI A;  4EC9 B;  2DXI A;  2EZI A;  5H20 A;  1G3N C;  1H24 B;  1KQ0 A;  1LFP A;  1T39 A;  2A6E F;  2RGV A;  2LKS A;  3U2R A;  1AUA A;  1NHG C;  4K0K M;  2E7X A;  2FBI A;  3T0Y A;  1MMD A;  1X1B A;  4AYB N;  4CCN A;  3BG6 A;  3MKW B;  4OIP F;  2F48 A;  1QZE A;  5EXS A;  2VF7 A;  2DMT A;  4OGR B;  2DA2 A;  3SDB A;  3QZ5 B;  1NJG A;  4ZDP A;  3IL2 A;  2H8R A;  1MGT A;  1ZMV A;  1U6G A;  2HXI A;  5DDG A;  3A42 A;  4B3M M;  2ZME C;  3BOS A;  2KDZ A;  5JLW A;  3MZ8 A;  3F0C A;  3GZN B;  4IRG A;  1YE9 A;  2DAE A;  3K9P A;  5HBE B;  1A31 A;  5B3S H;  3P5J A;  3CCJ I;  3RPU D;  1J75 A;  4CIC A;  4JI1 M;  4M3B A;  3RTR A;  1S6L A;  3CF0 A;  3GRV A;  1U3E M;  3JRI A;  1MDM A;  2QSF X;  3IG8 A;  1H26 B;  4ZTF A;  5KK1 A;  3X2Q H;  2M2E A;  1NH3 A;  2LTU A;  3QQA A;  4AZF A;  4MGH A;  3OTO M;  1U9O A;  3F5X B;  1CUK A;  3I01 M;  4XQF A;  4BCJ B;  3FIW A;  1W36 C;  3I56 I;  1IV6 A;  5FKO A;  4D80 A;  3EDP A;  2R3S A;  1W0U A;  1DGF A;  1UM8 A;  3KDS E;  4CH7 A;  1R5H A;  2D45 A;  2LVP C;  4LRT A;  1R23 A;  1WJE A;  3GTK J;  1DGG A;  4M0W A;  5LGT A;  5GP9 A;  2ELK A;  4BEH A;  1FPQ A;  5DD8 A;  2XSJ C;  2JUC A;  4F6W B;  1JUM A;  4F93 B;  2Y30 A;  3KP1 E;  1GLN A;  2LH9 A;  2H09 A;  4ZDO A;  5HVY B;  2IW9 B;  2VDB B;  4X64 M;  1MBE A;  1RC9 A;  3LSG A;  5C3E J;  4MGK E;  1IN6 A;  3DU6 A;  2EFN A;  3R6S A;  4L15 A;  2VBZ A;  3D8B A;  2ZB9 A;  2MAB A;  4HST A;  1OFH A;  2I5U A;  4EOP B;  1H6U A;  1SXJ E;  3C3E A;  3F6V A;  5EZG A;  4EOL B;  1G8P A;  5DFL A;  2W48 A;  4XLC A;  3PL8 A;  4FIS A;  4Y7N J;  3AJI B;  2KA6 B;  4BDZ A;  4OIN F;  1IRZ A;  2B9R A;  1YSY A;  4HNT A;  4F7Z A;  4JQF A;  5F08 A;  4YHH M;  2DOD A;  2D7G A;  3U6P A;  4Y4R A;  2FBH A;  1JHF A;  3ILK A;  5E18 F;  2R7V A;  1OI9 B;  4OR5 B;  2Z7J A;  3PUB A;  4CA0 A;  4B48 A;  1TW3 A;  1MBK A;  3U6S A;  2D7H A;  2KR6 A;  4IBB A;  1XX5 A;  3J80 K;  1A04 A;  2CHG A;  2P6T A;  3C2H A;  1H27 B;  1TT5 B;  4QHT A;  3IC7 A;  4AU7 A;  1UST A;  5ITU A;  2FSW A;  7CAT A;  1DP3 A;  3F8B A;  4HDV A;  1KSF X;  2K3P A;  3CUQ B;  2UZE B;  1TWA J;  2L5Q A;  3LOC A;  4II5 B;  4FCV A;  2MC3 A;  3GYH X;  2OZ6 A;  1UNL D;  3DFG A;  3MCZ A;  5FSW A;  2XDV A;  3ERM A;  2UV1 A;  1VQ6 I;  3HOU J;  2KDL A;  2ETH A;  2LD5 A;  2KL4 A;  1G2H A;  4RKU F;  1BC8 C;  5IZ7 D;  2L2D A;  5EP1 A;  2L02 A;  2C99 A;  1SAU A;  1Z3X A;  4BBA A;  1X19 A;  4GFB A;  4KNY A;  3UKG A;  1VIN A;  1WIV A;  1I3Q J;  3LVW A;  1TQM A;  4P1W A;  2BYV E;  5FRO A;  2G8L A;  4HEO A;  2GNO A;  3QPS A;  1W5C C;  1G71 A;  4OIR F;  3NBX X;  2RC4 A;  2DN0 A;  4N4N B;  1C7Y A;  1USS A;  4NDL A;  2QPA A;  4BL0 B;  1AHJ B;  2VOD A;  3BZ6 A;  2HEO A;  5LHH A;  5IT9 S;  1T2K A;  3FTD A;  4BY1 X;  2V22 B;  4UB6 C;  2YR0 A;  3KSJ A;  1VI0 A;  3VLF B;  3VK7 A;  1WJC A;  4PGH A;  2XGD A;  5L3C A;  4NQW A;  2QGS A;  4IJF A;  3HGI A;  2HQN A;  1I5Z A;  5K7F A;  5ICF A;  3VYU B;  4CDG A;  4QIW N;  3CCY A;  5LEK A;  3JSO A;  1HJP A;  4KOD A;  1XHB A;  2M5W A;  1DGH B;  2LLK A;  3KEO A;  3MZH A;  1UNH D;  1OPC A;  4FT8 A;  4L0Y B;  4IKF A;  4EVI A;  4PCQ A;  1F5T A;  3H5A A;  3BTJ A;  4MQV A;  2PJR A;  1EJ9 A;  1HA8 A;  3H5R A;  1Z5A A;  4WXD A;  1RUN A;  4CCM A;  4PDI A;  2ELJ A;  2L7F P;  2JSC A;  2HXO A;  5K1Y A;  4WWC A;  4A12 A;  1ZAE A;  3QYF A;  3K4B A;  4DR3 M;  3DEE A;  2IN3 A;  3FXM A;  4I0B A;  3HU3 A;  1FSE A;  1XXH E;  3EUH A;  4PSW A;  1T6O A;  3GLF A;  3U5Z B;  4ABZ A;  1BR1 A;  3T15 A;  2G5G X;  3ABK H;  5JVG F;  1K61 A;  2E19 A;  3OIQ A;  5FRM A;  3R4K A;  1XXH A;  1IAW A;  1DU6 A;  3EID B;  3WE3 A;  4HAM A;  3ZMV A;  3IRQ A;  2DA6 A;  4A69 C;  2JPB A;  1OCR H;  4B3X A;  1KU3 A;  1RR7 A;  1HQY E;  3TW7 A;  3EUK L;  5DYG A;  1FT9 A;  3TN8 B;  3GTM S;  4V2F A;  2ZNZ A;  3TWM A;  2X4A A;  1X3W B;  4II3 A;  2P8T A;  5HDG A;  2FE3 A;  4YFN F;  3TNH B;  1KFV A;  2Y75 A;  5CYI B;  1XMX A;  3QPT A;  1ORY B;  1TDZ A;  5B5E C;  3ELK A;  4A3B J;  3SZG A;  3L26 A;  3OYH A;  1VQM I;  2KIM A;  1HLV A;  3TP3 A;  1R71 A;  2ME6 A;  3AG2 H;  1UHM A;  1J0R A;  4ZZL A;  5HS8 A;  5D4S A;  4ETS A;  2A69 F;  4XSX F;  4IX7 A;  5IDP B;  2VBX A;  4M72 A;  3HZJ A;  3U21 A;  1HQC A;  5IT3 A;  1FY7 A;  1T33 A;  3ZC7 B;  1PJS A;  1P92 A;  3OL4 A;  5CKT A;  2FU4 A;  4CIS A;  1VQN I;  1Z7L A;  2CUE A;  2X48 A;  5FTL A;  2DW4 A;  1F4K A;  1WHC A;  2I8D A;  3P7N A;  1RIO H;  1JKW A;  2KLO A;  3ZMT A;  3JCU C;  1E94 E;  4GCV A;  2FQ3 A;  1OL1 B;  2O01 F;  1MDM B;  4DR5 M;  4UXN A;  4CFM B;  1UGP B;  3H3U A;  2XLJ A;  2JGZ B;  3ZN1 A;  2F2E A;  4LF6 M;  3VDP A;  3HJE A;  2X85 A;  4RS8 A;  2GIV A;  3WGH A;  2XRO A;  2C5V B;  1SEU A;  3GLI A;  3KP4 A;  1ENH A;  2X8A A;  4ZGE B;  2KQR A;  2XAQ A;  1NG7 A;  3T5X A;  3GLI B;  5A2Q Z;  3IKT A;  5L2W B;  5LMN M;  5EXX A;  4B08 A;  1J2X A;  1GXP A;  2NRA C;  3BLR B;  1J5Y A;  5KQ8 A;  3HOZ J;  3I55 I;  2FX0 A;  3OV8 A;  2LBF B;  2BXY A;  2R5Y A;  4C2T A;  2AHJ B;  2NS8 A;  1XMK A;  4XSZ F;  5F1R A;  1Q39 A;  2CS3 A;  1KQ8 A;  1FOX A;  1EFU B;  2JMW A;  3CDL A;  3DEU A;  1SC7 A;  3UZU A;  1BL0 A;  3SMP A;  1ETX A;  1V54 H;  2VJI A;  1IN7 A;  3FYC A;  4YFX F;  3OYN A;  3AKZ A;  1QGP A;  3BHU B;  4BEH B;  4NC8 A;  1TLH B;  4M3G A;  4LGY A;  2JXN A;  2X0L A;  3HSF A;  4QTR A;  4OAZ A;  4KJZ A;  3EYI A;  2OOB A;  3E5Q A;  1C1K A;  5GAE J;  4OB0 B;  4F1I A;  1ZGA A;  3OYG A;  3HOS A;  2IGO A;  5KAF C;  2PFB A;  3FWE A;  3GLH B;  4EGZ A;  2XPW A;  3GUD A;  3QRF F;  1X2M A;  2WMB B;  2DK8 A;  3FMS A;  4XLE A;  1Z91 A;  4D1Q A;  3KX2 A;  3MMY B;  1HDP A;  1D5V A;  5FLX K;  2Z8Y M;  1T38 A;  3CCQ I;  1FBS A;  2HFH A;  3E1S A;  3QU3 A;  3VYT B;  2OC6 A;  5JI6 A;  3HDD A;  5ITX E;  4RMN A;  3WU1 B;  3BTI A;  4L78 A;  1IBL M;  4MHG A;  1FKM A;  1SMT A;  2PMI B;  2LK2 A;  2KJC A;  1T0F A;  1IY2 A;  3FIS A;  4XM3 A;  2JVH A;  3QYG B;  2WSC F;  3U61 A;  4WW0 A;  2OJE D;  1JB0 F;  5ITX A;  3CC7 I;  4JI3 M;  1NSF A;  4UN0 A;  1YW9 A;  2ZZD B;  3SHF A;  3DOG B;  2QZ4 A;  2H94 A;  2FML A;  2HTJ A;  2RQQ A;  5E8I A;  2DOF A;  4ASN A;  1YTY A;  1DUX C;  1BR4 A;  2OAZ A;  1PJT A;  3C58 A;  4KO8 A;  3SAS A;  4LF7 M;  4QPO A;  4DUY M;  3BG3 A;  4O5V A;  1OKW B;  1Z77 A;  4G4Q A;  1LJ9 A;  2P81 A;  3ROU A;  3GFM A;  1B6A A;  3BWG A;  4PJL A;  5LLQ A;  1Q3B A;  2EKF A;  3HHY A;  1RR8 C;  1QUS A;  2BWE A;  2HPM A;  2HGC A;  2LP0 A;  3GVA A;  4MEY F;  4M6Y A;  1QNT A;  1DO2 A;  2ICW G;  1FIA A;  1FEX A;  5ICP B;  2Z16 A;  3TWK A;  4KIF A;  3ZQL A;  1F5Q B;  4H4K C;  4R79 A;  3RGF B;  1G59 A;  2OTL I;  1KXU A;  1W5T A;  1MMN A;  3KCC A;  3RZD J;  2BGC A;  1IG7 A;  2JZY A;  4I09 A;  1M1E B;  2GXG A;  2CJJ A;  4NRV A;  1I1G A;  3IWZ A;  2KRH A;  5F04 A;  4HL4 A;  1QO0 D;  2M30 A;  3ZQI A;  1D3U B;  1HDD C;  4PZJ A;  2ECB A;  3V4G A;  2DI3 A;  2KMU A;  4CYC B;  2VC1 A;  3KIO A;  5E6J A;  4GH9 A;  4QLC U;  3SAR A;  3C2G A;  3E0J B;  1MJ9 A;  5ILV A;  3G1L A;  4IBG A;  3LQR A;  4EOQ B;  2X1D A;  1LFU P;  2M4G A;  2C5X B;  1X3U A;  3FTE A;  3UJN A;  1XNQ M;  1OCZ H;  1R1U A;  1X58 A;  3E5X A;  3H5N A;  2H27 A;  4NUB A;  1PP8 F;  4H0E A;  3VKG A;  4L4U A;  5HS9 A;  4DR4 M;  2AO9 A;  4ITV A;  4G7Z F;  2DAK A;  3Q0U A;  4XRM A;  4EM2 A;  4KIS A;  4DYQ A;  1XGO A;  4I8O A;  1VEG A;  1BJA A;  1WCM J;  4GGG A;  3M07 A;  4Z8X A;  3FBN B;  1P3Q Q;  3CCE I;  2R5Y B;  4EJT A;  4I6Z A;  2R7D A;  1Y56 A;  5CVR A;  1JUS A;  3ZMD A;  3IRR A;  1UEL B;  2X51 A;  2MGQ A;  2QSG X;  4C3I J;  2K85 A;  2LKX A;  2FRH A;  4QHS A;  1VZ0 A;  4BE0 A;  1UHW A;  5CYV A;  1G4A E;  2VAS A;  1OTR A;  3KE2 A;  2V1D A;  4N0B A;  4EON B;  2QEX I;  1VQL I;  1UGQ B;  2CWB A;  2XZF A;  1P4A A;  2HI3 A;  4XON A;  3ASN H;  2W57 A;  1DPR A;  3E97 A;  3K7A J;  5D5W B;  1L8Q A;  4OOI A;  2W24 A;  1HW5 A;  4CO8 A;  3BG7 A;  1W36 D;  4PUS A;  4CCJ A;  3A8O B;  2R4E A;  1EIJ A;  4DBQ A;  4P16 A;  4DIQ A;  4ROC A;  4Y17 A;  3P9I A;  4HF1 A;  4AID A;  3IV5 A;  2Q8K A;  4DW6 A;  5HLI A;  4I81 A;  3T1H M;  3BZC A;  2XB5 A;  1OCO H;  3PSI A;  5L3B A;  3W0F A;  2VUM J;  1AA7 A;  1TBX A;  1XGM A;  3R8F A;  3M0E A;  1XN7 A;  3Q9V A;  2FMY A;  3AAF A;  1SXJ A;  5IP9 J;  2F5P A;  2KP6 A;  5GPC A;  2DZN B;  3CCU I;  1N33 M;  2ECC A;  3EET A;  3I58 A;  1H25 B;  4ZJZ A;  5KCM A;  1H1S B;  1WH7 A;  2K4J A;  3L9F A;  5FD5 A;  4A6D A;  3OYK A;  3HOY J;  1OYY A;  2H6B A;  4E7I A;  2M3A A;  3GLG B;  4BCK B;  1ZGJ A;  1J5E M;  3PNY A;  4B47 A;  2XRL A;  1W5S A;  3F8N A;  4RF0 A;  4HDU A;  4XK8 F;  2MGW A;  3VDU A;  1QPM A;  3ZQC A;  2DFH A;  3U60 A;  1WJD A;  4LLN A;  3G71 I;  3B57 A;  3KP6 A;  2IGK A;  3QP6 A;  3OYI A;  5FKL A;  1XWI A;  5IWA M;  4AVZ A;  2BHZ A;  4U7B A;  3OWT A;  4RB0 A;  1S5L C;  2E36 A;  5D6E A;  5J8F A;  2IW5 A;  1KU7 A;  3HHH A;  5IF1 B;  1W7P B;  2JSP A;  4XK4 A;  2X4H A;  2HTS A;  4JK1 X;  3POM A;  2DTZ A;  4DV4 M;  2KHH A;  5D6F A;  3KOZ E;  1J7K A;  3FMQ A;  4BCQ B;  5HLT A;  3S3O A;  1YX3 A;  2EIL H;  2OQR A;  1H4L D;  2HKX A;  2ADU A;  1CGP A;  1JQJ C;  3GPU A;  1PM5 A;  2FBK A;  3QPL A;  1Z05 A;  3R60 A;  1AHD P;  1RKW A;  1YIJ I;  1QVU A;  3MFK A;  1LE8 B;  2J5P A;  3KEQ A;  4RB1 A;  4DV5 M;  2R7Z J;  1FTZ A;  3MVP A;  3WTZ A;  4AIK A;  3TMO A;  2OQ4 A;  1B72 B;  3X25 B;  2HL7 A;  3RKW A;  2V1C A;  3GLH A;  4AVP A;  1WQ2 A;  1XB2 B;  2IGN A;  2Z99 A;  3FKJ A;  3ZGK A;  2ZBK B;  4L9N A;  1FIP A;  3LST A;  3QHR B;  3QU6 A;  4BU2 A;  5GTH C;  1F4I A;  4FE4 A;  4PGG A;  4KA4 A;  4IJE A;  1QQW A;  2VQF M;  2WAQ N;  3L2A A;  2G3Q A;  4F7N B;  1Z5B A;  4DUZ M;  2FA5 A;  4L5J A;  2CHV A;  1LDK B;  2EZL A;  2OU2 A;  4G4O A;  4FET A;  2PJP A;  1IXS A;  2QCU A;  2DFE A;  3CMM A;  5EGO A;  4R1H A;  1FP2 A;  2M45 A;  3A45 A;  2QQA A;  3M3Y J;  5ITR A;  5LEJ A;  4FM4 B;  3HOV J;  4M3E A;  1OIS A;  1ZG3 A;  3FKI J;  3QXE B;  2C9C A;  4JI8 M;  2Q1Z B;  2VE8 A;  2O25 A;  1ZR2 A;  3K1N A;  3ZCB B;  2L2O A;  2QQ9 A;  3SYT A;  5M3M J;  1QLB A;  2R18 A;  2LDU A;  2D5V A;  2EIM H;  2HDW A;  5DCM B;  5GAD J;  4L6V 6;  3K1P A;  1XPX A;  1BIB A;  1XGN A;  1PVE A;  1JJ8 C;  2L7I A;  4GMQ A;  3IG5 A;  2NAZ A;  1GY3 B;  2QCO A;  5HDN A;  2VPL A;  2Y0M A;  4HBL A;  3BTC A;  1TWC J;  3H92 A;  3PO2 J;  3FHN A;  3H3V K;  2JN6 A;  3TQN A;  4BE1 A;  1JE8 A;  1OJL A;  4NSO B;  3IH4 A;  5D5U B;  2UXB M;  2L7H A;  2KMG A;  2RN7 A;  3I64 A;  5IOZ A;  1A6I A;  4AQY M;  4G4N A;  2DQR A;  3UR3 C;  1XTA A;  4MIM A;  5IPA A;  4DV2 M;  3FHZ A;  1SXJ C;  1R1T A;  4C2M J;  1PUF B;  4LFB M;  1DQU A;  1ONV A;  3Q0V A;  3WHL A;  3HM5 A;  3T1B A;  5FTM A;  1K6O A;  2GQF A;  2MLG A;  3N4M A;  4IBD A;  3H4C A;  2X49 A;  3TED A;  3KSX A;  4Y72 B;  4BXX J;  4BLC A;  1BM9 A;  3L27 A;  1K3X A;  1P7I A;  5EJC A;  3HPG A;  2XSZ A;  3GQ4 A;  3AV0 A;  3S17 J;  4L5I A;  3F23 A;  1ZG1 A;  3I59 A;  1MH3 A;  3K69 A;  2AXT C;  2XF7 A;  2HNH A;  1O3S A;  4CRL B;  4J01 A;  5HOD A;  2PJR B;  3CZ6 A;  3GWZ A;  1YJN I;  2ZKZ A;  2P5K A;  4YIF A;  3JRB A;  1QAQ A;  3LSK A;  3GTQ J;  2B9S A;  2WPA B;  1RZ4 A;  4HRI A;  1NHW C;  4DOZ A;  2DFF A;  1WXQ A;  3HWS A;  2V9V A;  2O3F A;  1IJW C;  1KU2 A;  2EV0 A;  2QYO A;  5GAG J;  3ZMZ A;  2CEA A;  1S3J A;  5HNB B;  1ORK A;  2N35 A;  1H9G A;  2W00 A;  3KLO A;  1BN5 A;  2FH0 A;  3IH3 A;  1X4O A;  2R7F A;  3K70 C;  1E3O C;  3TE6 A;  2HQR A;  4Y28 F;  3L2C A;  3RGS A;  3BBZ A;  3BQY A;  2X6X A;  3FF5 A;  3GZ5 A;  4JP0 A;  3SEZ A;  1HC8 A;  5B1B H;  1MNE A;  3L09 A;  4JX4 A;  4QOS A;  3G1M A;  3RQ4 A;  2AS5 F;  4GDF A;  3A01 B;  4DYR A;  2ZFU A;  2WEV B;  4CCO A;  2YNM D;  3A01 A;  4YEL A;  4IEJ A;  3GTP J;  3BT9 A;  1Z0X A;  3KET A;  4IHW A;  2M1B A;  3QZ9 B;  2BZT A;  4OW0 A;  4AKI A;  2ZTC A;  3WU0 A;  2WB1 A;  3LCV B;  3DWL E;  1LVA A;  3U6Q A;  2M7A A;  3OOP A;  4L0Z B;  2DTR A;  4D7N A;  2V4J C;  1APL C;  2UUE B;  2FOI C;  4RGR A;  1GUU A;  3A98 B;  1T6S A;  2X6W A;  3DPT A;  2VE9 A;  2X1N B;  2Y20 A;  1WJ7 A;  1T3T A;  3CF6 E;  4LJA A;  2PEX A;  4D7M A;  3D5S C;  4RDU A;  2EFO A;  1CQT A;  2FNA A;  3DFZ A;  2OZU A;  1B59 A;  1QBJ A;  2DPU A;  2IS6 A;  5BPI A;  3GBG A;  1ZQ9 A;  2CU7 A;  3B73 A;  3K4M A;  1W0T A;  1P2F A;  3FM5 A;  2H5X A;  3RDI A;  1JT0 A;  1V3F A;  4XKC A;  5EEA A;  1FYK A;  3Q5F A;  2A5Y B;  3CF2 A;  3FZV A;  3HRM A;  5CQG A;  4KIB A;  1FNN A;  1I39 A;  2LR8 A;  2DWL A;  2KIU A;  4QPQ A;  2COB A;  4IIW A;  2CQN A;  2XIG A;  3W3C A;  1T8I A;  4XOR A;  5FLM J;  1N36 M;  3K6G A;  1H9T A;  4N9H A;  3MJ5 A;  5LD2 C;  4LFA M;  3L25 A;  1FJG M;  4F70 B;  3M6A A;  3HPH A;  4KLN A;  3HC7 A;  4CCK A;  2IGM A;  3W68 A;  1NVM A;  2DMP A;  4JI4 M;  1SD4 A;  4DV0 M;  4BHC A;  3HHX A;  3DTK A;  5L3F A;  1JKO C;  2MC4 A;  2J5Y A;  3GFJ A;  3S2W A;  2LWX A;  1DU0 A;  4Q5S F;  1SVO A;  4M9Z A;  5EYR A;  2KNV A;  1FWZ A;  4CXA B;  3GPX A;  4A0X A;  2QFZ A;  2EJS A;  2OA4 A;  2AXL A;  1X1C A;  1Z6T A;  3VSL A;  1A35 A;  3VFZ A;  3K4C A;  4OWR B;  2J5O A;  3HSE A;  1YJW I;  1E3H A;  1YS7 A;  4DR2 M;  1YOV B;  3GME A;  1QAM A;  4FWG A;  4LRS A;  1Y0U A;  2FD5 A;  3LA2 A;  4FAS D;  1REP C;  1RUO A;  1ZRD A;  1FOK A;  2XGN A;  1SFK A;  4XMY A;  1XSX A;  1JTX A;  9ANT A;  2ELH A;  1FVV B;  3BC8 A;  1EH7 A;  2P5T A;  2ZAO A;  1P4W A;  2HQA A;  3OYB A;  3DTO A;  4CHT B;  4AIH A;  3FRI A;  5LMU M;  3FK6 A;  4II2 A;  5LHI A;  3MMP A;  4RA2 A;  2ZME B;  2R7O A;  1YIT I;  2NVQ J;  1BW5 A;  3KXE C;  4LIV A;  2ZO4 A;  4RLF A;  2E35 A;  1Z7U A;  3A8M B;  1C9B A;  3CLO A;  2BVM A;  3GZ6 A;  1KA8 A;  4JX6 A;  1G3W A;  2V7F A;  1U9N A;  4BXF A;  2G9X B;  4M0D A;  5EXP A;  2KW0 A;  4MO7 A;  5EGO B;  1IV8 A;  2K6B A;  2EV5 A;  1JKR C;  1I4W A;  2DFI A;  2DJN A;  4PK4 A;  3V8L A;  3WE2 A;  4A3J J;  4FHT A;  1XMQ M;  3LA3 A;  4MGI E;  4GXO A;  5J47 A;  4DV6 M;  1G6N A;  4UVB A;  5J40 A;  2CQ7 A;  4OB1 B;  3KP5 A;  4RGX A;  5CLS A;  1Q1V A;  3E5U A;  5GAH J;  2Y9Z A;  3KPH A;  4EQQ A;  1JR3 A;  4JI7 M;  2DOE A;  2P7V B;  2XAJ A;  2TCT A;  3GCM A;  3H1C A;  4ZYA A;  3DLL F;  2O8K A;  2STT A;  1Z59 A;  1O9K A;  3LAP A;  2F5V A;  2DD5 B;  1Q1H A;  4OMZ A;  4FX4 A;  5KQD A;  3TNI B;  2OV7 A;  5IT9 Z;  4Q47 A;  1IXZ A;  4A2U A;  4LY6 A;  2C4G B;  2RKH A;  4E7L A;  4FCT A;  2XHK A;  3TOB A;  4NL4 H;  2MW8 A;  2BV6 A;  2R7R A;  3K9T A;  4XN0 A;  2FXA A;  5ILU A;  3BG9 A;  4MTD A;  1D5Y A;  3CD6 I;  4X6A J;  3BLY A;  5IOY A;  2PHG A;  3B02 A;  3MQ0 A;  1LPQ A;  5ITY A;  3OYC A;  2EB7 A;  3TKY A;  4IPA A;  2V6E A;  4ZC3 A;  1HT1 E;  5KHD A;  3JRF A;  2R92 J;  4F3Q A;  2JPC A;  4A3F J;  3ZMU A;  1R7J A;  5L3G A;  2AHQ A;  4RB3 C;  3LSR A;  4IBC A;  1SXJ B;  3K70 D;  4LGM A;  3BP8 A;  4PT5 A;  2WAE A;  3HKZ N;  4OIO F;  3CO6 C;  4RAG A;  2KT0 A;  1QHH D;  2Z2S B;  3RCO A;  4RAZ A;  4OVZ B;  4IF4 A;  2LYC A;  4EOJ B;  2JY6 B;  4AG5 A;  2KZV A;  4EIW A;  3V7S A;  4DV7 M;  5LRR A;  3Q8X A;  5LGU A;  3HB9 A;  3DCF A;  1YHQ I;  3S32 A;  4ESF A;  2LBF A;  1LFB A;  4XNF A;  4FX0 A;  3DDQ B;  1GVD A;  1WSU A;  1OMI A;  2VOP A;  2L7Z A;  2PI0 A;  2AQE A;  3L28 A;  2CP8 A;  4R7G A;  2F4O B;  2OUM A;  2FFJ A;  3K2A A;  3BTL A;  3JRH A;  5M5X J;  2P5L C;  5H6R A;  3SJM A;  2WMA B;  4BCQ D;  4IJA A;  2HZD A;  1SFE A;  3H9Q A;  2I7P A;  2MR9 A;  2ZAN A;  2M8E A;  4PFO A;  4UHT A;  1BVS A;  3CUQ C;  1NNU C;  4JBA A;  2FNP A;  2P0W A;  3JW4 A;  4YOS A;  4RGU A;  4LLG F;  4QOZ C;  5TJJ A;  4OMY A;  2ESN A;  1K82 A;  3I9V 2;  1PJQ A;  2CRU A;  1JTY A;  3X24 B;  4B3T M;  4NHJ A;  3ZXS A;  2K5C A;  2LY1 A;  3DPU A;  4JI2 M;  1HNX M;  4HW0 A;  5AON A;  2KXE A;  1QAN A;  2Y0S A;  4HNU A;  5JVT A;  4G7O F;  2NQ8 C;  2F5N A;  1IUF A;  2IBD A;  2ZXH A;  3J7B A;  1D3Y A;  5F6F A;  2XZU A;  3BJO A;  4D5C A;  2A61 A;  1HSJ A;  3ABT A;  3B74 A;  2Q0O A;  4EJO A;  2ESH A;  4KRD B;  4FQG A;  3ULQ B;  2A07 F;  2BS2 A;  1ERD A;  4XLA A;  4DR7 M;  2XF3 A;  2PG4 A;  3QP5 A;  2IP2 A;  2LNB A;  2F5O A;  4B4C A;  5IYD J;  4IBI A;  3OL3 A;  3LSI A;  2WAD A;  5E1X A;  3FE3 A;  4LB5 A;  4PDG A;  2DAO A;  2C5N B;  1XDS A;  4A0Z A;  2L4M A;  4Z2Y A;  3O8G A;  4P17 A;  1F1Z A;  2DNA A;  2P5V A;  2KRC A;  4F6S B;  2F4I A;  1HKS A;  5E3N A;  1XXH B;  4OU7 A;  4YC3 B;  1ACI A;  4BXX X;  2B63 J;  2LNH C;  3KP0 E;  2CYZ B;  2L9R A;  3M4O J;  1U0J A;  2AQF A;  4DBR A;  5IP6 A;  1Z9C A;  2MG4 A;  3MN2 A;  1BI3 A;  3CF5 F;  3KS8 A;  2UXC M;  2VJ4 A;  3HOX J;  4KDP A;  2XEP A;  5GTI C;  4B7G A;  4L9J A;  2W82 A;  4KT0 F;  5BOX A;  1T0F C;  4A5M A;  3E6D A;  4EAT A;  4F7J B;  3WTT C;  1YI2 I;  3RPU A;  3BOQ A;  4B3S M;  3DBH B;  1R2Z A;  4YII A;  3WG7 H;  3L1P A;  3GLF E;  2R65 A;  4A5N A;  2ZJR F;  3SEQ A;  4C2U A;  1SG9 A;  2K02 A;  5FGK B;  4BCN D;  2E1N A;  3EPZ A;  2FF4 A;  2D1V A;  1KYI A;  3LSH A;  1VQ1 A;  3ECO A;  1ULY A;  5FJ8 J;  5FO5 A;  1PGY A;  2EA0 A;  4BQO A;  3PQK A;  3DKY A;  2M4K A;  4C3H J;  1WGL A;  5D8L B;  1STZ A;  4KT6 A;  5IDN B;  8CAT A;  4LF5 M;  4KYW A;  3SAT A;  3OYE A;  1FJL A;  4OAY A;  2OBP A;  1WH5 A;  2NS7 A;  2V1N A;  2BE5 F;  5F0H A;  2Z9O A;  1UFZ A;  2W9F A;  4KRC B;  1XCV A;  2UUA M;  1VQ7 I;  1G3T A;  1VF9 A;  4HX7 A;  2J7O A;  3EQL F;  3KOX E;  3G33 B;  2LBC A;  4BS9 A;  2QQ8 A;  1GKI A;  3WG9 A;  2G0E A;  2QQB A;  3DA1 A;  1QDR A;  3U6D A;  2R45 A;  3LWF A;  3R61 A;  1YLF A;  4JV5 M;  1OAI A;  5E8G A;  5F0F A;  1Y8G A;  2JZ0 A;  2PX9 A;  1TH3 A;  5K5Q A;  4F92 B;  3U6O A;  2YU9 J;  4FTH A;  4BCM B;  3K4K A;  5CEI B;  2CZ7 B;  3J27 B;  2K7L A;  3DBL B;  2QKM B;  3IP4 B;  3U5Z A;  1VQ9 I;  1ZP2 A;  5B66 C;  4JI5 M;  4M6X A;  5DEQ A;  3GLG E;  5DUK A;  5L3E A;  1V5E A;  3GO8 A;  1QAO A;  2EWN A;  2V9K A;  4ENK A;  1SMY F;  5E1W A;  2RKO A;  3M9A A;  3J7Z I;  2YX7 A;  3DQV C;  1X2N A;  3NQO A;  2NYX A;  4MGY E;  4MB7 A;  2DT5 A;  4WCG A;  2H1K A;  4G6L B;  5HBH B;  3NBI A;  2RNJ A;  2VII A;  1XC5 A;  2JY8 A;  2DHR A;  4AG6 A;  1I27 A;  4GO1 A;  3DP7 A;  4QNM A;  4HPQ A;  2CG4 A;  1WGN A;  1OQY A;  3BDD A;  3CJN A;  2D1H A;  1TP4 A;  4A3D J;  4TTH A;  1S8N A;  1L1Z A;  1BIA A;  3CP2 A;  3EYY A;  5KO3 A;  4CUG A;  2WAF A;  3AG1 H;  1QA6 A;  2L09 A;  3DU5 A;  4IBF A;  3PXG A;  4M3F A;  4UB8 C;  2CV0 A;  4BY1 J;  3RYP A;  1D8J A;  3WHK A;  1ZYR F;  3GLH E;  3S3N A;  1YUB A;  1FMV A;  5E1Z B;  3JR5 A;  5CQE A;  1SVL A;  3SYL A;  1X1D A;  3T38 A;  2KNZ A;  3BQZ A;  1ETQ A;  2VQG A;  4MLO A;  4ZH4 F;  1T98 A;  2O9L A;  1VEJ A;  2WTE A;  1FIN B;  1SD5 A;  1U8R A;  3EJ1 B;  1WPK A;  3VFD A;  1NY5 A;  4OU0 A;  1AD6 A;  2QKL B;  1OCC H;  2OQG A;  2ZXJ A;  3VOD A;  1AOY A;  5DNY A;  1GJS A;  4ZTJ A;  4LJ7 A;  4AKH A;  2B0L A;  1TR8 A;  3HJ8 A;  2CQX A;  1K3W A;  5GPA A;  2DHY A;  4HSR A;  3U60 B;  2WBM A;  5HS7 A;  1TD6 A;  1URC B;  3WVE B;  2GQQ A;  4UNO A;  3OOU A;  1O4X A;  4LB6 B;  5IY5 H;  2EZH A;  2NVY J;  2BJV A;  1W7P A;  3JAM K;  2OPF A;  4LIT A;  2ZPB B;  2C98 A;  5LGN A;  4LG0 A;  1U5T C;  3U9G A;  4D9J A;  4NNJ A;  2K9N A;  2KJB A;  2DZL A;  2W7N A;  1BC7 C;  4G6D A;  1L2B A;  3BR5 A;  3EIE A;  2DWZ B;  1HNZ M;  1GJT A;  3QWL A;  4B09 A;  3L2U A;  1VOL A;  3U6L A;  1WKM A;  2JA2 A;  2KNA A;  2GM4 A;  2VKV A;  4UUV A;  2IS2 A;  1IY1 A;  1DGH A;  1UJ8 A;  2XF5 A;  3I4M J;  1ETV A;  3F8M A;  4I7H A;  2I40 B;  1R6R A;  2C6T B;  3NRV A;  5JLX A;  4XBO A;  2ID3 A;  2HDC A;  2QEN A;  1EH8 A;  1TF0 B;  2WWY A;  3ESW B;  3NWT A;  3TW6 A;  4J00 A;  3DBR B;  4EJW A;  2M7B A;  5J1R A;  2Y0T A;  2C5O B;  4BUP A;  4ITQ A;  4F7L B;  2V26 A;  1IO2 A;  4X65 M;  4X66 M;  3FDY A;  2HPI A;  3CJQ B;  4GHL A;  5L3D A;  3GRY A;  5IYC J;  1TDH A;  5ICE A;  3V76 A;  3H36 A;  2I7N A;  4NST B;  4BAC A;  4LZZ A;  1OKS A;  5GKN A;  4ROD A;  3I54 A;  3I71 A;  3CQZ J;  3ZQJ A;  1XNR M;  2ZJ2 A;  3VYR B;  5JHU A;  4YRV A;  1L3L A;  1SVM A;  4FD2 A;  1S9H A;  4UV9 A;  2XSD C;  3A8G B;  4EOK B;  1G3Y A;  1JST B;  1Y8R B;  4UUS A;  3MKY B;  2G7U A;  1G4D A;  3ECH A;  5I5Z B;  3OS2 A;  2DA3 A;  2MYS A;  1R4N B;  1O3T A;  2HKJ A;  4UVC A;  2CFO A;  5DCM A;  3HY5 A;  1VQ8 I;  3W2V A;  1ZK8 A;  3CC2 I;  1U8B A;  4BCI B;  3KYL A;  2WXV B;  1GT0 C;  1V4R A;  2P7C B;  1ZQ3 P;  4KIT B;  4NC6 A;  3RPQ A;  2CO5 A;  4G6Z A;  2HYG D;  4IL6 C;  4XRS G;  4DZP A;  5LMK B;  1D0K A;  2XPU A;  4EMS A;  3HKZ A;  1R6B X;  3M8F A;  3KYD B;  3CC4 I;  4UVA A;  4LD5 A;  4WF2 A;  3NDQ A;  3PO3 S;  3HX3 A;  4S0H B;  1YFH A;  2JA7 J;  1F9N A;  3Q0W A;  1MBJ A;  3PSF A;  3E7L A;  2WJ9 A;  1ZRC A;  2CJM B;  1L1T A;  1DV0 A;  2VI6 A;  2XKO A;  3CMY A;  3LSP A;  2VN2 A;  2R6F A;  5J1Y A;  2BBY A;  4MM3 B;  2QGU A;  2Y9Y A;  3DZD A;  1T56 A;  3PIO F;  3CCV I;  3JAM S;  2GXB A;  2EUC A;  2YR2 A;  1PJJ A;  2OCE A;  3T6P A;  3GF2 A;  3V7C A;  3X28 B;  2LVA A;  3HSR A;  4EGY A;  1YX5 A;  2L7K A;  2P4W A;  3S1N J;  3QHW B;  4REZ A;  5FTJ A;  2W1O A;  3T8R A;  2Z5U A;  2CGP A;  4NXN M;  1OAO C;  2L9N A;  4LJ4 A;  2ZSI B;  1WGX A;  2R5Z B;  3E9S A;  2DD4 B;  2JA5 J;  4KIG A;  3GFI A;  4ENN A;  4RNA A;  3C3D A;  2H6C A;  2R7W A;  1Y0N A;  5ACB A;  3IAM 2;  2IAI A;  4PJJ A;  3CTA A;  3VK8 A;  3WTX C;  3IH2 A;  4RLQ A;  1HW2 A;  2WC2 A;  4LG0 B;  3SAV A;  2O8X A;  2ZM6 M;  3BZK A;  4BE2 A;  3KFW X;  1P9Q C;  1TC3 C;  1TL8 A;  1Z67 A;  3ABL H;  2O03 A;  1H1R B;  1TZL A;  3E6B A;  5IHY A;  2QZ8 A;  2M8G X;  1FYL A;  2GXA A;  3VDX A;  2V6Z M;  4M73 A;  2OD5 A;  1NK2 P;  3GP1 A;  1EH6 A;  1JUP A;  2E1M B;  2L4F A;  4BCO B;  4CIZ A;  4Y33 A;  4DYC A;  2JUJ A;  1JKP C;  4ESB A;  4C9Y A;  3I4Y A;  5CVU A;  4XRF A;  2LVN C;  2CWE A;  3FRH A;  4RAF A;  4WXH A;  4EJU A;  1J59 A;  4WP2 A;  4IHT A;  4CSW A;  1FX7 A;  1OL2 B;  2K40 A;  4JYA M;  1HR0 M;  2Z3X A;  3UK6 A;  2E34 A;  3H4M A;  1E9S A;  2E5L M;  2HVS A;  3BHV B;  2IS4 A;  2LMD A;  5BPD A;  4MGR A;  1X1A A;  1BU2 A;  1K4T A;  4BBR M;  5JFR A;  1RRJ A;  4HX8 A;  5ICC A;  2DVW B;  2F5D A;  1D8K A;  4YFK F;  1DP7 P;  3J7A S;  1WHU A;  3RKX A;  3R9X B;  3E4R A;  3ABM H;  4LFC M;  1ON2 A;  5EP2 A;  3TDZ C;  2ZFW A;  4MEX F;  5E3M A;  2LVS A;  3VYH B;  5FKK A;  5F0C A;  4EOM B;  2A6T A;  1GUX A;  2K0B X;  2IA2 A;  2ZPH B;  4KIC A;  2M0C A;  5DYM A;  5BPV A;  1HF0 A;  1MN3 A;  2V79 A;  4G8X A;  1HCR A;  1PJR A;  1R00 A;  3MIA B;  1ETW A;  1RKT A;  2MSY A;  3QOE A;  4UV8 A;  2CCH B;  3C18 A;  1VDD A;  3M03 A;  2CQQ A;  3HBL A;  3FK7 A;  3G1O A;  1FBU A;  1W7P D;  4B3A A;  1T95 A;  2R0Q C;  2W2H A;  1U5T A;  4FW9 A;  3KVW A;  2X6Y A;  2M5Z A;  3AG3 H;  3SQN A;  2UUC M;  1U5T B;  5HQ0 B;  1IY0 A;  2EPF A;  3LCU A;  2KZG A;  5EG0 B;  2F5C A;  2QDJ A;  3QOD A;  1WZ2 A;  2MJ5 B;  3DKW A;  1YRN A;  2LY2 A;  3C3W A;  4JI6 M;  5HNH A;  1O3R A;  3LQQ A;  1GV2 A;  2DEN A;  3CME I;  2R7S A;  3REO A;  2BY1 A;  1CF7 B;  4M3D A;  2VIX A;  3I51 A;  4AD9 A;  3QYH B;  3Q3S A;  1G3I A;  3CGW A;  1UG0 A;  3TL4 X;  2ZBK A;  4B3R M;  2CQK A;  3HG9 A;  3I4P A;  2UZL B;  2LXE A;  4A3E J;  3WTU C;  2VQC A;  2Y0Q A;  3BR1 A;  4JN6 A;  1B9M A;  3AOE A;  2Y2Z A;  1A36 A;  1TTY A;  1MSF C;  1IDY A;  3VYG B;  1ZKG A;  1NV8 A;  1RES A;  1S7O A;  2VJJ A;  3QAH A;  2ZJP F;  4ON0 A;  2MD0 A;  1ZG5 A;  3UNG C;  2BY3 A;  4ESJ A;  4BBS J;  2VOO A;  2K9D A;  1GVJ A;  3L2V A;  4EC8 B;  1V33 A;  3AOG A;  5FTN A;  5HBJ B;  1UG2 A;  3AL0 C;  2VPR A;  3EIH A;  3SAW A;  2Y31 A;  4F7S B;  2Y69 H;  1JT6 A;  1OLT A;  2IA0 A;  4HOB A;  5J1U A;  1OFI A;  3L2Q A;  1U2W A;  3J81 S;  2DOA A;  2JTV A;  4PD2 A;  2XGX A;  3E6C C;  2RV8 A;  4LK1 F;  1V92 A;  5AIP A;  3HTU A;  3LL7 A;  4D82 A;  2UUB M;  2K3F A;  3K4J A;  4BAY A;  3A2K A;  3B6C A;  3J81 Z;  4R8H A;  5FRN A;  3CJR B;  1IRE B;  4I2O A;  3H3Z A;  1NG6 A;  2XAF A;  3BRO A;  3AOE C;  4HQM A;  5ITT A;  1IGN A;  4GKK M;  1K7A A;  1PJI A;  3HXL A;  1V5F A;  2C96 A;  3MZY A;  3BPX A;  4XKB A;  4HX4 A;  3G2B A;  3F22 A;  1NK3 P;  4ANR A;  2XFS A;  5CVI A;  2HOS A;  2QP9 X;  2W96 A;  1S7E A;  2DKL A;  1BJZ A;  4HEA 2;  1ITY A;  3C9P A;  3V42 A;  3CUO A;  4B7H A;  4L8R C;  4BB9 A;  3ZQ7 A;  3QOP A;  5E3L A;  3LFK A;  4AUX A;  4DGW B;  1OGU B;  3DF8 A;  4CYC A;  2WV1 A;  3CCL I;  1WRJ A;  2EIK H;  1MU5 A;  1XCB A;  2E60 A;  2G9W A;  2KKO A;  5FD6 A;  4XOT A;  1ETK A;  4LMY A;  4ZYD A;  2PK9 B;  4RBO A;  1F43 A;  4XBF A;  4I3Z B;  5CVV A;  2PMZ A;  4A0Y A;  4M71 A;  1VQ5 I;  3FXJ A;  3ZOB A;  4U7D A;  5DUI A;  2M60 A;  3SFZ A;  3GX4 X;  3VWB A;  3GTO J;  1S29 A;  1TTE A;  2MLK A;  2OOA A;  2ZXI A;  5E26 A;  2EJR A;  1YYV A;  1B1B A;  3F8F A;  3WHB A;  1OIP A;  3SZP A;  4IOA F;  4ZGD B;  4LJZ F;  2CRG A;  4LG3 A;  1MZB A;  2JZ1 A;  1PP7 U;  3OY9 A;  3OR2 C;  2Y21 A;  2LY9 A;  2H1R A;  1Z21 A;  4GRI A;  2PN6 A;  2CH0 A;  3LMM A;  5C4J J;  4YY3 M;  4Y13 A;  3OSF A;  1UMQ A;  4LGW A;  4LLL A;  3QAU A;  5IRE B;  1MJA A;  2TRT A;  1YW8 A;  2WSF F;  4CFV B;  4NXM M;  2X1E A;  2RGO A;  2QHO B;  3E6M A;  3RQI A;  3VOE A;  4G7H F;  4QSH A;  3K4L A;  1KGS A;  1UB9 A;  4A3I J;  3DKX A;  3KOW E;  2NNN A;  4L18 B;  4HLQ A;  3PFY A;  2L9S A;  2JA8 J;  2Q2E A;  2QWW A;  4R71 A;  5C1B A;  2NXN B;  4M9X A;  3BJ6 A;  1B8I A;  2XRN A;  2Q2E B;  3I4V A;  2IW8 B;  3HGY A;  5DQV A;  2CE7 A;  2R62 A;  1X1P A;  2PQ8 A;  5EXT A;  2K9Q A;  4HZF A;  3H0G J;  3OYF A;  3GXO A;  3PIP F;  4MH0 E;  1K83 J;  3B9P A;  3LW5 F;  2R93 J;  3H9G A;  3M1E A;  4Y15 A;  1Y6I A;  3WTY C;  4EM0 B;  4W5W A;  1IC8 A;  4NOO B;  2PMH A;  3B7Z A;  1N78 A;  1K4S A;  1ZHF A;  1ZMU A;  4A6E A;  2Y0S N;  2VXZ A;  2BJW A;  1K78 A;  2XGE A;  1D0Y A;  2RRE A;  4IRI A;  1O57 A;  2ZAM A;  5EEH A;  2A3S A;  2Z1D A;  1Z6R A;  1PUE E;  2HVR A;  2LFB A;  2DXB B;  3CUQ A;  4BBS M;  4YOO A;  2FUG 2;  3H9J A;  4GYG A;  2LVQ D;  3LVV A;  4LIU A;  4LFU A;  2HDD A;  3K7A M;  3X26 B;  1MBG A;  3TBI A;  4BHB A;  5DD4 A;  4RB2 C;  4GYI A;  1KZH A;  2DAM A;  2DAI A;  3CDI A;  3RYR A;  5JI2 E;  3RIR A;  2XC7 A;  3RI4 A;  2O0Y A;  4IHY A;  4IQ4 A;  4CGZ A;  3M1C A;  2CV1 A;  3MAJ A;  4ZYG A;  4OB3 B;  1ZTR A;  2APL A;  2K47 A;  4DR6 M;  3G6E I;  5DM6 F;  1FOW A;  2FEZ A;  5D8K B;  3PM1 A;  5BQT A;  2IVX A;  1TWH J;  1HST A;  2YU3 A;  3OYA A;  2LRE A;  2F5E A;  2HCB A;  1ON1 A;  1QQI A;  3I5U A;  3GW2 A;  5DYI A;  4U88 A;  3CDH A;  3HHW A;  5LQF B;  4II7 A;  1P6R A;  4BCN B;  3G73 A;  2WHB B;  4IRH A;  3NAR A;  4FWD A;  3KEY A;  2XF6 A;  4B1R A;  1J09 A;  1TNT A;  2CUJ A;  3E3V A;  1XD7 A;  3OYL A;  2XUB A;  3OMY A;  2E1M C;  1MBH A;  4MTE A;  3IKV A;  2I10 A;  1D0X A;  1SFX A;  4NC7 A;  4NQW B;  1AKH B;  3DJB A;  1AWC A;  2XAG A;  2KEB A;  2JRT A;  4KT5 C;  2G77 A;  2DWM A;  2ERC A;  1Q3C A;  3FUU A;  4IBJ A;  3D1N I;  1AKH A;  3JR9 A;  3MD2 A;  3JRA A;  4L16 A;  4W97 A;  2BW3 A;  4FCY A;  1OYI A;  1QVR A;  1B72 A;  2FOW A;  4I76 A;  5BS6 A;  3A1Y A;  3WOD F;  2NNY A;  2NVX J;  1P5E B;  2K27 A;  2LF8 A;  4WXC A;  5EF6 A;  1MD0 A;  3UGJ A;  5DQW A;  2TDX A;  3M8E A;  4GIP A;  2VBW A;  5D5X B;  3ABU A;  4CZZ A;  3FBI B;  3M8J A;  4LG2 A;  1ZMW A;  3HKP A;  3GFL A;  3FXU A;  3BR3 A;  1ZH5 A;  1SAN A;  2STW A;  3SMS A;  4O3M A;  5TRD A;  4Z6Y A;  1A5J A;  1IRG A;  3EOC B;  3PNV A;  2E2H J;  4EM1 A;  1QZM A;  4HA8 A;  2DXC B;  1SXJ D;  4HLX A;  3RKQ A;  1YQA A;  2BPM B;  1LTM A;  3ZRG A;  3BR2 A;  4ZYH A;  3DTE A;  4HV6 A;  2VT2 A;  4BBR J;  5FGM A;  2BVL A;  3KLN A;  5EFQ B;  1WJF A;  1ZR4 A;  3HGG A;  3TGN A;  4EOS B;  5C4X J;  1VQO I;  5DCF A;  1UFM A;  2DMU A;  3GQ3 A;  4I99 C;  1MNM C;  2LHG A;  1YO5 C;  3F9K A;  1FC3 A;  5AIQ A;  3F72 A;  1IQP A;  4IBK A;  1AIP C;  3FD9 A;  3R0J A;  4IQJ A;  4IMY B;  3RJP A;  2KRU A;  1LQ1 A;  2HZT A;  4A3C J;  1O9K B;  1R9T J;  4E7H A;  1VQP I;  1J9I A;  3OIP A;  4CFW B;  2GBY A;  4ELJ A;  1AIS B;  3MKZ A;  1H0M A;  4IO9 F;  1U78 A;  2VB6 A;  4ELL A;  2KFD A;  3CES A;  3BLH B;  2KPM A;  3FKE A;  3U1K A;  4BYY A;  1JI8 A;  3CMA I;  4BCH B;  1Y8Q B;  2JP7 A;  2R44 A;  1N77 A;  2IXS A;  4JYK A;  4S05 A;  2K9M A;  5K7Z A;  2WSE F;  2DDB A;  4MFD A;  2JNH A;  1MMA A;  1D1A A;  3ZQH A;  1AU7 A;  3TOA A;  4BNC A;  3K9O A;  2EFQ A;  4TV7 A;  5KPZ A;  2EV6 A;  3EUA A;  2GOM A;  1X37 A;  4ZPX A;  5EZH A;  4O6J A;  5KAI C;  5EDN A;  3SXY A;  2VKH A;  3B7N A;  1O7F A;  3GPY A;  2UXD M;  2CHQ A;  5F1J A;  3BPV A;  2QA4 I;  3S3M A;  4HF0 A;  4M74 A;  2VF8 A;  4CFU B;  1KQ9 A;  2ZTD A;  3KZI C;  2KIF A;  4KN4 X;  4IHV A;  4BCM D;  4CFX B;  5IT9 K;  2D7E A;  2XB0 X;  2XVC A;  3HRS A;  1PKD B;  2O7O A;  2L3D A;  3PJR A;  2FQ4 A;  2V9P A;  1R5G A;  2W85 A;  1Z5C A;  2R7T A;  1GHC A;  1EA3 A;  4XLF A;  3OS0 A;  5CPR B;  3AL0 B;  2OO9 A;  2EH3 A;  3A8L B;  1UCR A;  2E5N A;  1X4P A;  2HAK A;  3K1M A;  1IXR C;  4AI6 A;  2H8W A;  2NOJ B;  2UUZ A;  1L0O C;  2ID6 A;  2IPQ X;  3CP8 A;  4KUM A;  3S8P A;  5ITQ A;  4HF2 A;  3KP2 A;  2UZB B;  2XV4 S;  2LHC A;  4AYB A;  1L2D A;  1ZLJ A;  1TW2 A;  3QPH A;  4DR1 M;  1XG1 A;  2HHH M;  1TH4 A;  2LC2 A;  4L9T A;  3IHP A;  1RNL A;  3ONQ A;  1VDL A;  5B1A H;  5J4Y A;  1XMO M;  4AM3 A;  3MI9 B;  2HU9 A;  4XKV A;  2JY5 A;  2L4E A;  1R4G A;  2X6O A;  4Q48 A;  4ZZD A;  1IF1 A;  1JR3 E;  4FVM A;  2JA6 J;  1D0Z A;  3HUG B;  5FB2 A;  2HWV A;  2WFY B;  1YS6 A;  1UAA A;  1G41 A;  2M34 A;  3MY5 B;  5DTD A;  3FUV A;  1B8I B;  3V8J A;  1LEB A;  3O8H A;  3BLQ B;  4WUR A;  5ERI A;  3ZP5 A;  4RAY A;  2HKO A;  5E17 F;  2IEK A;  3J7Y J;  1KYW A;  3VYS B;  3PQJ A;  3BJA A;  2R7U A;  5F27 A;  3JTG A;  2A6H F;  3JSP A;  5KVR A;  1ZN2 A;  2BHY A;  4U0Y A;  5BNJ B;  2L7M P;  4NRW A;  1IN5 A;  1QRY A;  1V29 B;  1NNJ A;  4P9F A;  2O5R A;  2F5F A;  1IXS B;  4KN7 X;  4DNC A;  2DCE A;  5ED4 A;  2XGC A;  3W67 A;  4G9Y A;  4BCG B;  3WGI A;  1TGU A;  1RET A;  1W4M A;  1I3A A;  5EP4 A;  3S14 J;  3WHC A;  1R22 A;  1K78 B;  1OIY B;  2Z4R A;  1OCP A;  1TH2 A;  4OX9 M;  1OCT C;  4LJ9 A;  1WR1 B;  2AHM A;  4I5S A;  2CMP A;  1YW7 A;  2HR3 A;  3FUW A;  2R4G A;  4EOO B;  3UMM A;  2WY8 Q;  2FOK A;  2K9S A;  3O3K A;  3VPR A;  2NVT J;  2RDP A;  5FLX Z;  2XAS A;  3Q8G A;  1Q02 A;  2RAE A;  2BXZ A;  1O7L A;  1N34 M;  2F4M B;  2QM3 A;  3PNT A;  1GXQ A;  2CUZ A;  1LEA A;  2ZPF B;  1HNW M;  4CFU D;  1S3S A;  5EQT A;  3BR0 A;  2UXX A;  3I0T A;  3JRG A;  3C7J A;  5FKM A;  2DBB A;  3LSJ A;  3ZH9 B;  4I98 B;  4UY8 I;  1UNG D;  2KZS A;  4GIT A;  1E0E A;  2RGH A;  4E6K G;  4S12 A;  3A4C A;  3TWL A;  3U6E A;  3K4N A;  4ENM A;  2NS0 A;  5H37 D;  4FX3 B;  3U1D A;  3I3L A;  4C30 A;  3S2H J;  2BS4 A;  2PMU A;  5HNF A;  1OKV B;  2E71 A;  2EO2 A;  2DPD A;  5M5Y J;  3JRD A;  3DPL C;  2XFT A;  4XOP A;  1E9H B;  2K4B A;  2ZXW H;  3IAS 2;  3TO7 A;  4BQQ A;  5H2F C;  2O61 A;  4E7Z A;  1KYZ A;  4MGZ E;  4CYD A;  1A5T A;  5E20 A;  3PFI A;  1YJ9 I;  5KPR A;  2BWB A;  2OF7 A;  3HEF A;  1VEK A;  3GTG J;  3A46 A;  5EEG A;  5EP3 A;  1IBK M;  1XSD A;  2JRM A;  3G3Z A;  1GL6 A;  2YX4 A;  1XGS A;  1H28 B;  1MH4 A;  2JUG A;  2DMQ A;  3S1Q J;  3K2L A;  1ZGW A;  3GQ5 A;  3KS4 A;  2JWT A;  4DZJ A;  2XAH A;  3SBJ A;  1MND A;  1SFO J;  2VQL A;  3ML6 A;  3GLF B;  2LSO A;  5HOO A;  4HQE A;  5FLX S;  4ZDL A;  4K2E A;  1JJ6 C;  2DME A;  3J80 Z;  3SC3 A;  1V5G A;  2M9H A;  1JOW A;  1NJF A;  2LOO A;  2L0K A;  2RQP A;  1QZY A;  2HVQ A;  2M0M A;  2VC0 A;  1LVK A;  4BCP B;  1BOA A;  4U0V A;  2H1L A;  2DDA A;  4BY7 X;  3MY1 B;  3HO8 A;  2UU9 M;  2QBY B;  1GO5 A;  3HUG A;  1JHH A;  4BGD A;  1NO1 A;  2QBY A;  5A2Q K;  4GHA A;  2IS1 A;  2BOL A;  1C0W A;  1MW7 A;  2DT7 B;  4OB2 B;  3ZR8 X;  3WGG A;  3ZPL A;  2DA4 A;  1NHA A;  3ERE D;  1TNS A;  2YS9 A;  4C3J J;  4BKX A;  2WA0 A;  4ROE A;  1MSE C;  1Y1W J;  2CW8 A;  4S04 A;  2ME0 A;  4IHS A;  2BKZ B;  3C1D A;  3AG4 H;  3ASO H;  1R58 A;  4I0A A;  2FJ1 A;  2CZ1 B;  4CXF A;  4G4R A;  4F91 B;  5LHG A;  4XID A;  2BS3 A;  2PJQ A;  3K92 A;  2GA2 A;  4IOC F;  2ISY A;  2D0Q B;  2IA1 A;  4KMU X;  4JX5 A;  4I02 A;  5HLH A;  1W98 B;  2F2C A;  3L2W A;  3JAM Z;  1OFC X;  1FP1 D;  5HVQ C;  2PMZ N;  2W99 A;  5C44 J;  4P9U A;  4YEJ A;  2C9O A;  4DV3 M;  4XL9 A;  1NTC A;  2UWM A;  2CYY A;  2GOX B;  2V1X A;  3HTS B;  1TWF J;  2KIS A;  2JY7 A;  3GRR A;  1R4M B;  4UUS B;  1E17 A;  2CUF A;  3GLG A;  3OIO A;  1GDT A;  3COA C;  2E1C A;  4AKG A;  4FWH A;  1Z3Y A;  3W0L B;  3U6C A;  1B4A A;  1GUX B;  3HHG A;  1JXS A;  3D5R C;  2WY7 Q;  2DQL A;  1JGS A;  5M3F J;  1POG A;  1MJG M;  2E1O A;  3CJT B;  1UGR B;  4UUT A;  1ETO A;  1LB2 A;  1EV7 A;  1WVR A;  6PAX A;  3BR6 A;  4A3M J;  2DA7 A;  3K2Z A;  3KW6 A;  5D4R A;  1D0L A;  2R7Q A;  3SAU A;  4HLY A;  5BMZ A;  4A3K J;  1O3Q A;  1I94 M;  3WVD B;  3X20 B;  1NY6 A;  2COM A; 
#chains in the Genus database with same CATH homology
 2XAU A;  1UGS B;  4BL0 B;  3QOE A;  1AHJ B;  4N4N B;  1D1C A;  3DTK A;  2DJI A;  2MC4 A;  4ANJ A;  3HBL A;  1T95 A;  3DL1 A;  2X6Y A;  2ZPG B;  2QFZ A;  1N75 A;  1WJC A;  3NWS A;  1FMW A;  1X1C A;  3QYE A;  4CZC A;  3VSL A;  3QOD A;  2QDJ A;  1G8X A;  3K4C A;  4OWR B;  2LY2 A;  5HNH A;  2CZ0 B;  3VYU B;  4BDY A;  2R7S A;  3OS1 A;  4FAS D;  2VIX A;  3QYH B;  1UG0 A;  4XN3 A;  1SFK A;  4XMY A;  3TL4 X;  4E7J A;  4IKF A;  3HG9 A;  3BC8 A;  2VQC A;  2HQA A;  3H5A A;  3OYB A;  2PJR A;  3VYG B;  1HA8 A;  2VJJ A;  3H5R A;  2MD0 A;  4CCM A;  3UNG C;  2ELJ A;  4II2 A;  2R7O A;  3QYF A;  3K4B A;  4LIV A;  3DEE A;  4RLF A;  3L2V A;  3A8M B;  2BVM A;  3J7A Y;  4JX6 A;  4BQN A;  4PSW A;  2V7F A;  3AL0 C;  2ZCF B;  4MFE A;  1BR1 A;  1KON A;  1OLT A;  1WJ5 A;  3LFU A;  3L2Q A;  4PK4 A;  2DOA A;  3OIQ A;  5FRM A;  1PYV A;  3X20 B;  3LL7 A;  4OB1 B;  3K4J A;  4B3X A;  3A2K A;  3TW7 A;  1IRE B;  5FRN A;  3EUK L;  3CJR B;  1WJA A;  1NG6 A;  4ZYA A;  4II3 A;  3QYB A;  3RSN A;  4P1W A;  2F5V A;  2DD5 B;  2OV7 A;  3HXL A;  1V5F A;  5LFA A;  1TT0 A;  4XKB A;  4E7L A;  3SZG A;  3G2B A;  3OYH A;  2R7R A;  4ZGJ B;  4XN0 A;  3BG9 A;  4JOM A;  3BLY A;  3OYC A;  4HEA 2;  3V42 A;  4IX7 A;  3HZJ A;  4ZC3 A;  3U21 A;  5KHD A;  2V6E A;  3OL4 A;  5CKT A;  3W2W A;  4F3Q A;  3L2R A;  1Z7L A;  4DGW B;  2CV2 A;  3K70 D;  2I8D A;  2KLO A;  2X1C A;  2WAE A;  2E60 A;  1QHH D;  2Z2S B;  4XOT A;  3RCO A;  1UGP B;  2W4S A;  1IRX A;  2LYC A;  3H35 A;  2KZV A;  2PMZ A;  2X85 A;  3LSM A;  4B43 A;  3VSK A;  3VWB A;  2ZXI A;  3HB9 A;  4G6T B;  4ZGE B;  2KQR A;  1NG7 A;  4ZGD B;  3S32 A;  2LBF A;  4XNF A;  4LG3 A;  2LBF B;  4C2T A;  2AHJ B;  3OY9 A;  2AQE A;  2VJ5 A;  3OR2 C;  2OUM A;  1Z21 A;  2A5W A;  4GRI A;  2CH0 A;  3LMM A;  2CS3 A;  1ZEL A;  2F6C A;  4F55 A;  2VJI A;  3OYN A;  3AKZ A;  2HZD A;  4BEH B;  3H9Q A;  4PFO A;  4NC8 A;  2X1E A;  3S93 A;  2P0W A;  3K4L A;  4QSH A;  4OAZ A;  4KJZ A;  3DKX A;  4XKW A;  3PFY A;  4HLQ A;  2L9S A;  4OB0 B;  3OYG A;  3HOS A;  2IGO A;  3X25 B;  3I9V 2;  3X24 B;  2Q2E B;  3ZXS A;  2K5C A;  2LY1 A;  3DPU A;  4BXF A;  4XLE A;  4D1Q A;  2Y0S A;  3KX2 A;  4HNU A;  2CW7 A;  3MMY B;  3HOT A;  2ZXH A;  4E7S A;  4DJA A;  3A8H B;  3E1S A;  3VYT B;  3OYF A;  4BJ5 C;  2OC6 A;  2BS2 A;  1ERD A;  4XLA A;  3H9G A;  4RMN A;  4PJN A;  3W2A A;  1Y6I A;  2VXD A;  1FKM A;  3OL3 A;  3VKH A;  3LSI A;  2WAD A;  4XM3 A;  1N78 A;  2JVH A;  3QYG B;  2VXZ A;  1D0Y A;  4P17 A;  2RRE A;  4PSX A;  2LRD A;  2ZZD B;  2KRC A;  2Z1D A;  2DXB B;  2HVR A;  2F4I A;  4N4O B;  4BBS M;  2RQQ A;  2FUG 2;  3H9J A;  4LIU A;  1BR4 A;  4E7K A;  4QPO A;  2CYZ B;  3X26 B;  3TBI A;  1WJB A;  3BG3 A;  1U0J A;  2AQF A;  4DBR A;  2XC7 A;  5TGT A;  4IQ4 A;  4PJL A;  3M1C A;  2CV1 A;  3HHT B;  4OB3 B;  1LKX A;  2R7X A;  2ZPI B;  2VJ4 A;  4PJM A;  2HPM A;  3OYA A;  2LRE A;  2W82 A;  2Z16 A;  1T0F C;  4EAT A;  4H4K C;  4R79 A;  2MFZ A;  1G59 A;  3KEY A;  2XF6 A;  1MMN A;  4C2U A;  2KDO A;  3SEQ A;  1QU3 A;  1J09 A;  2CUJ A;  4BJT A;  3EPZ A;  2VLA A;  2KRH A;  3OYL A;  4HL4 A;  3OMY A;  2E1M C;  3LSH A;  1D0X A;  4NC7 A;  4NQW B;  1BR2 A;  4BQO A;  2KMU A;  2G77 A;  3DKY A;  2M4K A;  4KT6 A;  3C2G A;  3E0J B;  3MD2 A;  3N05 A;  2BW3 A;  2X1D A;  3OYE A;  2M4G A;  5KNL A;  3A1Y A;  4OAY A;  2V1N A;  4RM2 A;  3H5N A;  3K10 A;  4BJ6 C;  4NUB A;  3VKG A;  4ITV A;  3BCA A;  4BS9 A;  2QQ8 A;  3FBI B;  2ZSH B;  3M8J A;  4KIS A;  2RNG A;  4IZZ A;  2VKD A;  2KHM A;  3FBN B;  4Z6Y A;  3PNV A;  1Y56 A;  2DXC B;  3OYJ A;  3ZRG A;  4F92 B;  1UEL B;  2VL8 A;  2X51 A;  3DTE A;  3K4K A;  1MMG A;  2CZ7 B;  2BVL A;  2QKM B;  1WJF A;  3IP4 B;  4P5O A;  4X0G A;  1VZ0 A;  4BE0 A;  1V5E A;  2VAS A;  2V9K A;  1WFX A;  3F9K A;  1UGQ B;  4XON A;  2WAQ A;  3DQV C;  4IQJ A;  4E7H A;  4ELJ A;  3OIP A;  4U87 A;  4HPQ A;  1W36 D;  3MKZ A;  3BG7 A;  2JVG A;  4PUS A;  2VB6 A;  4CCJ A;  3CES A;  3A8O B;  4LOC A;  2KPM A;  3OYD A;  4DBQ A;  1JI8 A;  4DIQ A;  3CP2 A;  2IXS A;  1N77 A;  4CUG A;  2K9M A;  2WAF A;  2LG4 A;  3DU5 A;  4Y3O A;  3HL2 A;  3PSI A;  2CZ6 B;  4MFD A;  2CV0 A;  1AA7 A;  1MMA A;  1D1A A;  3S3N A;  3EUH C;  1FMV A;  3EUA A;  5CQE A;  2GOM A;  1X1D A;  1D1B A;  4MLO A;  4RM3 A;  2VQG A;  2KP6 A;  2VQH A;  5JHF A;  4HG2 A;  2VKH A;  4ZJZ A;  1DGR M;  4HNV A;  5KCM A;  2QF7 A;  3S3M A;  2QKL B;  3OYK A;  4E7I A;  2M3A A;  3PNY A;  4B47 A;  1QHG A;  4ZTJ A;  3PJR A;  2R7T A;  4AKH A;  3OYM A;  1EA3 A;  4XLF A;  1WJD A;  5CPR B;  3OS0 A;  3AL0 B;  4M6V A;  2IGK A;  3OYI A;  4HSR A;  2WBM A;  3A8L B;  1K6Y A;  2E5N A;  1X4P A;  3WVE B;  2NOJ B;  2UUZ A;  4AVZ A;  3OOU A;  4E4H A;  1DGW Y;  3OWT A;  3CP8 A;  3S8P A;  4U7B A;  2CZ1 B;  1OR7 C;  3KHI A;  4LIT A;  2ZPB B;  4AYB A;  2JSP A;  4XLH A;  2W7N A;  4D9J A;  4NNJ A;  4CCL A;  4F52 A;  3IUO A;  5HLT A;  3S3O A;  1YX3 A;  2LC2 A;  3ONQ A;  3H0D A;  2QDY B;  3QWL A;  3L2U A;  2HU9 A;  4XKV A;  3OR1 C;  2JA2 A;  1E7P A;  2IS2 A;  2XF5 A;  1D0Z A;  2ZPE B;  3HUG B;  2BW3 B;  3TMO A;  1UAA A;  1R6R A;  4CCK A;  3FKJ A;  2IGN A;  3DLA A;  3ZGK A;  4AI6 A;  3ZCO A;  4J00 A;  3NWT A;  4BU2 A;  3TW6 A;  3ZQQ A;  3VYS B;  1BOB A;  3AFH A;  2M7B A;  2R7U A;  3D5L A;  4BUP A;  1V29 B;  2O5R A;  2V26 A;  1LDK B;  2DPP B;  3FDY A;  2HPI A;  4FET A;  3CJQ B;  2DCE A;  3CMM A;  4B44 A;  4BAC A;  4FM4 B;  3BG5 A;  4YRV A;  3VYR B;  3BCB A;  3QXE B;  2Q1Z B;  2CMP A;  2R4G A;  1S9H A;  3A8G B;  2L2O A;  2WY8 Q;  2DT6 A;  3MKY B;  2E5Z A;  3SYT A;  1QLB A;  3OS2 A;  4PFP A;  2HDW A;  2MYS A;  2K9L A;  4XR6 A;  3DTI A;  2DXI A;  2CFO A;  1LFP A;  3W2V A;  3PNT A;  2VPL A;  2CUZ A;  2ZPF B;  1MMD A;  1X1B A;  3KYL A;  4CCN A;  3BG6 A;  3MKW B;  3FHN A;  4KIT B;  4NC6 A;  4BE1 A;  3SDB A;  3QZ5 B;  4ZDP A;  1E0E A;  4E6K G;  2KMG A;  3A4C A;  3HKZ A;  3K4N A;  3UR3 C;  4MIM A;  3I3L A;  1YE9 A;  4C30 A;  3PSF A;  1DQU A;  2BS4 A;  5HNF A;  3RPU D;  2WJ9 A;  3RTR A;  3H4C A;  3DPL C;  4XOP A;  3IAS 2;  4ZTF A;  5EJC A;  4BQQ A;  3HPG A;  4E7Z A;  3X28 B;  1YX5 A;  2L7K A;  2XF7 A;  2HNH A;  4J01 A;  2W1O A;  4XQF A;  2PJR B;  3CZ6 A;  1W36 C;  2ZSI B;  2L9N A;  3LSK A;  2DD4 B;  4HRI A;  4DOZ A;  4CH7 A;  2JUG A;  2R7W A;  1WJE A;  3IAM 2;  4PJJ A;  4RLQ A;  1MND A;  4BEH A;  2VQL A;  5HOO A;  2W00 A;  2XSJ C;  4ZDL A;  4F93 B;  1X4O A;  1GLN A;  1V5G A;  2LH9 A;  3K70 C;  4ZDO A;  2LOO A;  4BE2 A;  1P9Q C;  2X6X A;  2HVQ A;  2M0M A;  3LSG A;  1LVK A;  1TZL A;  3SEZ A;  1MNE A;  3DU6 A;  4JX4 A;  3RQ4 A;  3VDX A;  3HO8 A;  2ZFU A;  4CCO A;  4BGD A;  2E1M B;  2MAB A;  4HST A;  4YEL A;  2BOL A;  4Y33 A;  2IS1 A;  1MW7 A;  3QZ9 B;  4C9Y A;  2DT7 B;  4XLC A;  4OB2 B;  3PL8 A;  3ZR8 X;  4AKI A;  2WB1 A;  3DWL E;  4BDZ A;  2M7A A;  2WA0 A;  4HNT A;  2CW8 A;  4JQF A;  4CSW A;  2V4J C;  4Y4R A;  3DPT A;  2X6W A;  2HVS A;  4F91 B;  2R7V A;  2BS3 A;  3PUB A;  2IS4 A;  1X1A A;  4CA0 A;  4BBR M;  4B48 A;  2D0Q B;  3D5S C;  4JX5 A;  2KR6 A;  3L2W A;  3C2H A;  5HVQ C;  2IS6 A;  3GBG A;  4AU7 A;  3K4M A;  4YEJ A;  1DP3 A;  4XL9 A;  2K3P A;  2UWM A;  2GOX B;  4XKC A;  2L5Q A;  3CF2 A;  5CQG A;  3VYH B;  1Z3Y A;  4AKG A;  3W3C A;  2XDV A;  4QPQ A;  2UV1 A;  2KL4 A;  3D5R C;  2WY7 Q;  2A6T A;  4XOR A;  3K6G A;  1UGR B;  2ZPH B;  5LD2 C;  1SAU A;  1Z3X A;  1X19 A;  3HPH A;  2R7Q A;  3WVD B;  1PJR A;  3HC7 A;  5FRO A;  2IGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...