3QYBA

X-ray crystal structure of human tbc1d4 (as160) rabgap domain
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
297
structure length
297
Chain Sequence
HMKVKLDYEEVGACQKEVLITWDKKLLNCRAKIRCDMEDIHTLLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKELLKQLTAQQHAILVDLGRTFPTHPYFSVQLGPGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLHMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEISPSLYAAPWFLTLFASQFSLGFVARVFDIIFLQGTEVIFKVALSLLSSQETLIMECESFENIVEFLKNTLPDMNTSEMEKIITQVFEMDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TBC1 domain family member 4
publication title Crystal structures of human TBC1D1 and TBC1D4 (AS160) RabGTPase-activating protein (RabGAP) domains reveal critical elements for GLUT4 translocation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
total genus 91
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2011-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 3qybA02
1.10.10.2750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3qybA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3qybA03
3QWLA 3QYBA 4P17A 4NC6A 3QYEA 4HL4A 1FKMA 2QFZA 2QQ8A 5EJCA 2G77A 4Z6YA 4HLQA 3HZJA
chains in the Genus database with same CATH superfamily
4A2UA 2VB6A 2E5NA 1J5EM 1D8KA 4HX4A 5ITXA 5F3WA 2ESNA 1DGBA 2EPFA 2DZNB 3CF5F 2Y30A 3GPPA 4PGGA 4M3DA 1W4MA 2JMWA 3H9QA 4K2EA 2IS6A 1V55H 2RVCA 4C30A 1TD6A 3SARA 4J01A 3I4NJ 3MHVC 3GLGE 4ASNA 1RC9A 4JV5M 2JVHA 2XKPA 1OTRA 2C9CA 1I5ZA 3EUHC 3G33B 5K5QA 5EXXA 3V8LA 4G6LB 1IBMM 4LLLA 3FIWA 4LG2A 1R5HA 2Y9ZA 1XGOA 3IKTA 3FX3A 1X3UA 3H3UA 3ULQB 2R7ZJ 2DZLA 4DYCA 1ZV1A 2CHQA 4ZZLA 1FPQA 2LKXA 3PO3S 2CU7A 3VWBA 4X62M 5A2QK 2R4GA 1XDUA 3DBLB 2HU9A 3NDQA 4HQMA 1ZELA 2GIVA 2F48A 2LG4A 2VDBB 4A3IJ 3IP4B 1G3IA 5TRDA 3GP1A 1FJLA 5CVUA 1TC3C 2UUBM 2RN7A 4RF0A 5L3BA 1FBSA 1LDKB 1LDDA 2ZPEB 5FKLA 2Z99A 1DP3A 3QYFA 4ZH4F 2BWBA 1RU3A 2ZXWH 2KDZA 5EP2A 1UHSA 3RI4A 4B7HA 3CGWA 1NY5A 3KEYA 5DNYA 1DP7P 3HL2A 3Q0UA 3RYPA 4WXHA 3FTEA 3WE3A 1MJ9A 1PYVA 3TMOA 2FMLA 3GZ6A 1ZAOA 2Y0SA 4AU7A 1Y1WJ 5E1WA 2CSOA 4G7ZF 2A69F 1V4RA 1R2ZA 5C3EJ 3ZXSA 2KZSA 2IJLA 5C44J 3K1MA 3IRQA 2UZKA 1HLVA 2ELKA 3J2PB 1FBQA 6PAXA 3K7AJ 4V2GA 2Q8KA 4O5VA 1WWXA 4E7SA 1EJ9A 2GXAA 2KMGA 3C3DA 1IUYA 3C18A 2JUGA 4HRIA 2ICWG 2AXLA 1NJFA 3GRUA 5IY5H 4PJJA 4A3EJ 3IUOA 5FTMA 2Z1DA 1R1VA 3H0GJ 3VYTB 5D5XB 4BL0B 3CDLA 1R9TJ 4CFXB 2GNOA 5JI3E 4XRSG 1IRXA 3ZR8X 3MVPA 2ZPFB 1WGNA 1RUOA 2HR3A 3X25B 1T33A 1UG0A 1WJ5A 3LSRA 4ITVA 1BR2A 2P8TA 3OY9A 1XB2B 4I01A 4M74A 2LLKA 3NWSA 2EFWA 2DLLA 2QSGX 2DOAA 5ICEA 3IH3A 3ROUA 3VPRA 3A8LB 1BJZA 2JA6J 3P7NA 5D5VB 4BCMB 3GQ3A 2XPVA 4ZGEB 4AVZA 4A3CJ 5FSWA 4UXNA 4BE1A 2ZZDB 4L4UA 2CH0A 2DA2A 3I71A 1HW2A 4FWGA 1H9GA 1V92A 3JAMS 1FOWA 2XASA 3BR3A 1ORYB 2EA4A 4L9JA 3RE8A 2V6ZM 3U6CA 2EIKH 2WAFA 1PJTA 3D8BA 4LJ8A 1DGHB 1A6IA 3K4LA 5LLQA 2M8EA 3QU6A 4C9YA 1TL8A 3HJQA 3KS8A 2BHYA 3GTJJ 4P5OA 2LY9A 3JRAA 1TT5B 4PDGA 5TISC 1U8RA 1JGGA 2EJSA 4NB5A 2L7MP 3QPHA 2D45A 1QA6A 1LB2A 3HKZA 4D0PA 2ZPGB 1VQ9I 4II3A 2MA3A 3SAUA 5DFLA 4S04A 5ICCA 1MBGA 1YYVA 5CKTA 2LNHC 3GF2A 3SAWA 4CFWB 3MZ8A 1Q3CA 5LHGA 1CUKA 1LV7A 1RRJA 1Z21A 4LG3A 1F1ZA 2YX7A 4CCKA 1I94M 4FWHA 5IREB 1SXJE 4E7IA 1FJGM 2OUMA 3MN2A 2FOWA 2G7HA 3WU2C 2NQ8C 3OYEA 2E36A 4Q47A 5BPIA 4DBGB 1P7JA 2KISA 1MH3A 4C2TA 4RA2A 1UNGD 5FLVA 5CVVA 3LAJA 3GZNB 4G8XA 3J80K 2ID6A 2FE8A 2VBWA 3C9PA 5J3LA 4PFPA 5GPAA 2BXYA 2CE7A 3R9XB 2JRTA 2NS8A 3M07A 2DXBB 3H35A 4HQEA 2YX4A 4RNAA 4PD2A 4EQQA 4JI8M 1ZLKA 3ASOH 4BY7J 2DA5A 5FLXZ 4U0WA 5J40A 4LGWA 2KJBA 3LAPA 2L6OA 3GBGA 2KZGA 2EA0A 1G71A 2DAOA 1ZGWA 3ZMZA 2VUMJ 4AIJA 1EH6A 3HRMA 1PJRA 2BY2A 3G2BA 1STZA 4C3IJ 4XQFA 1HA8A 3IHUA 3KXEC 1VQNI 2RQPA 1G59A 4G12A 3HPGA 3RPUA 4RB3C 3IH2A 2NVUB 3F23A 2HVSA 1ZH5A 3LSHA 1I1SA 3RDIA 2NNYA 4V19K 1NO1A 4EOMB 3L25A 3DPTA 1T0FC 1B9NA 2WSEF 3E9SA 3HM5A 1WHUA 3QAHA 4BACA 1F5TA 2F5EA 2G7UA 4Y15A 3HU2A 4DR1M 4OMZA 3S15J 8CATA 4JQFA 4XLCA 5DQVA 5LHHA 4BQAA 4CXAB 1PM5A 1V5FA 2PMUA 3SDBA 1B72A 2XC7A 2L4AA 1MJGM 1EIJA 3F6VA 4OR5B 2QFZA 4ZGDB 3W67A 2PMHA 4DR4M 3CJRB 3E6BA 4UVAA 4BHPA 4BBSM 5IT3A 3LCVB 5L3CA 1S3SA 3WTWC 3H36A 1GH6B 2LVNC 2M7AA 3J7AY 3SBJA 3GW2A 4HNTA 2W57A 3S8PA 2ZAMA 2V1XA 5KK1A 4OIRF 3W2AA 1N4MA 1T6OA 3C7JA 3EIEA 2V1NA 1HKSA 4XKWA 2LVQD 2WA0A 1U5TC 3BDDA 3BC8A 3SEQA 4IOCF 4E7JA 2XGNA 1LEBA 2W1OA 2VONA 2Z5UA 3W0LB 1GVNA 4EGYA 3K4BA 2R93J 4OB0B 2KRHA 2KP6A 1OFCX 3HSEA 2ZSHB 1H88C 2M3AA 3DPLC 3GXOA 4NC6A 3IAS2 3GYHX 4HSTA 3CCLI 1H24B 4B3MM 3GVAA 1R1TA 1WJEA 3L26A 5EQTA 3E5UA 5LMNM 2UXDM 3QOEA 4Y72B 1J75A 1Z3YA 4KRDB 2QLZA 2XAGA 3NWTA 2DK8A 1LPQA 3GTQJ 4QHTA 3GTLJ 4MLOA 4B09A 3W6KB 1MMDA 1OL2B 1N77A 1MNDA 5CQGA 2CMPA 3MCZA 3HY5A 2DOFA 1UGSB 4WXDA 3B89A 2OQGA 3FKIJ 1VTNC 2RGOA 4QNRA 1TWHJ 3FTDA 2EFNA 2XGXA 3F72A 3OR2C 3B7NA 1XHBA 2CW0F 2KIFA 2RV8A 3E1SA 2IXSA 3HOVJ 3QZ5B 5D5WB 3P5JA 2FEZA 4D7NA 4DBRA 4G6DA 5FFZA 3L00A 2DMEA 4LLNA 5J8FA 1VQOI 4LFUA 3X24B 4LF7M 1M1EB 4L18B 3FISA 1E32A 2CUZA 1Q39A 5DV5A 2KR6A 5KO3A 3A8HB 4YOSA 4WF2A 3ZN1A 4AUXA 1BI3A 4QTRA 1LQ1A 5HBHB 5F6FA 1ZQ3P 2EJRA 3T15A 2VQGA 3IRRA 3W6VA 2W00A 5A2QZ 1SD7A 4KJZA 2I7PA 4MGRA 2P4WA 3H4MA 2EZKA 1SMTA 3I59A 1ZHFA 2UXXA 2EKKA 2YSRA 2CO5A 3S1RJ 3GLIA 5DUKA 2DPUA 4QLCU 2CCHB 2OQRA 3GQ4A 3PL8A 1H1SB 1V29B 3U61B 2P0WA 1VFCA 2YNMD 2JZ0A 2A61A 3K4CA 3V8JA 3VLFB 4CISA 3L2AA 4BCHB 3DF8A 3C3WA 1JB0F 1ZMWA 4IQ4A 3SC3A 2IA0A 1R2YA 2DZOB 3GTMJ 2EUFA 2RRUA 5JHUA 1XGMA 4JI2M 3NEUA 3KP1E 3T38A 4YHHM 3PQJA 4A0ZA 3I55I 5AIPA 2HOAA 3JTGA 2CEAA 2V1DA 4EGZA 1WI3A 2HDWA 4I0AA 1SAXA 3F8FA 4BQNA 3ECOA 1WZ2A 1AD6A 2W96A 5E79C 3HGGA 5FGMA 4RBOA 4IQJA 4L0YB 3DJBA 5JLWA 1AHDP 4J19A 4YEJA 3DTOA 1EF4A 3DKXA 2BW3A 3V8KA 2JNHA 3QWLA 3CCJI 3HOWJ 3CCEI 3CMMA 3JW4A 4P17A 2VBYA 3D5RC 2OTJI 1SFKA 1PUEE 3BHVB 1ENHA 2O9LA 1IN5A 4KICA 2WMBB 3UZUA 3SAVA 2IVMA 4RAFA 2QDYB 4XK4A 2K4JA 4JP0A 4F7ZA 1B1BA 4GMQA 2RC4A 2G9XB 2W24A 1ZGJA 4MIMA 3BJ6A 2HXOA 4E7HA 3K1NA 3GRYA 2V4JC 1JHHA 1IXZA 2ELJA 4L9NA 4MHGA 1LFUP 5EP4A 1FKMA 1X3WB 4NL4H 5ACBA 2MBFA 4CSWA 4E4HA 2KQRA 2V79A 4PSXA 4EOIB 3BQZA 3A2KA 5DM7F 1UNLD 2XF7A 2PN6A 4CICA 2BNKA 2UU9M 3B9PA 1URCB 1VYWB 2ACJA 4F6WB 4UVCA 2IPQX 2N35A 1N25A 1P6RA 2LK2A 3U6SA 1SMYF 2EZIA 3TOAA 3WG7H 1R7JA 2CUEA 1HSJA 3FTCA 2UUAM 3M8EA 1I3AA 4M3FA 4B4CA 4B08A 2NOJB 1QBJA 2A3SA 2VE8A 3A46A 3LSPA 2LNBA 5GADJ 4XRFA 5BOXA 3JREA 3LMMA 2Y21A 2HS5A 4YFNF 1R71A 4IF4A 3DEEA 4I98B 1XO2A 1E3HA 1WR1B 1Z9CA 1IF1A 3TNWB 1YIJI 5KQ8A 5FROA 4OIPF 1ZR4A 3G71I 3BHUB 4XL9A 4A12A 2KA6B 4PK4A 5DCMA 3DEWA 5EGOB 2R18A 1B9MA 4DV2M 1XXHA 1OR7C 1QVUA 2G0EA 2Y0TA 4BLCA 5E6JA 2DOEA 3WTSC 3HPHA 3BR1A 2M60A 2XIGA 4FX0A 2DDBA 3J7BA 3QPSA 2CYZB 3D1NI 4XKCA 1FSEA 2VQHA 4EM2A 2DODA 3A01B 4G4QA 5FTNA 1JHFA 3TWLA 3HOYJ 1P3QQ 4JYAM 2NRAC 2PQ8A 4CCLA 1VEKA 4UV9A 2HOTA 1ERDA 2F5VA 3IWZA 3KCCA 4AKHA 2L9VA 5K7FA 4UHTA 2K86A 3RGPA 3H92A 5L3DA 4AYBA 3GCMA 2XH9A 2JZYA 3J80Z 3JRBA 4LJ5A 4M72A 3HO8A 5CVIA 4I76A 3BLQB 3VYGB 3C1DA 2WV1A 5HLTA 3WU1B 2LMDA 1YO5C 2BEOA 3RPQA 3ZMSA 2DFIA 3LA7A 1HJPA 2DMNA 1MNMC 5KPZA 1FMWA 2YR0A 3D8LA 2NAZA 3M1EA 3I04M 3KSXA 1SAUA 4CO8A 5EG0B 3PIOF 2BYVE 2FBKA 3HOZJ 4RGRA 3M8JA 4NXMM 3FWEA 3PNVA 2GWRA 1N75A 3BZ6A 3JRFA 1CQTA 3DBHB 4Q7JA 3BTIA 3FXLA 4XORA 4RB1A 2XAFA 4LIUA 4LCBA 1WH7A 3V42A 4BCPB 1D0ZA 2DBBA 2MC4A 5AIQA 3EIHA 3A8OB 5BNJB 1TTYA 3PVSA 4OW0A 1IBKM 1LFPA 2JWSA 4A5NA 1L1ZA 4KFCA 1T43A 5EEGA 1U0JA 3OS2A 2BS4A 2XB5A 2MD0A 2ZPIB 1YOVB 1CGPA 1RZ4A 5FTJA 3H3VK 1O3TA 1UNHD 4HF1A 2LW4A 3WVDB 3ZQ7A 4Y7NJ 2FH0A 2R6FA 3FHNA 2A6TA 4XLHA 5HVQC 1R6BX 4Y28F 5TGTA 2R7FA 2JP7A 2V6EA 4BY1J 1Q3BA 4ZYEA 4IOAF 2IGKA 2FQ4A 4BDYA 4GYIA 4F52A 4A3LJ 5CQEA 2VXZA 2C6TB 4MM3B 1YE9A 3GZ5A 4MNUA 4OINF 2ADUA 3JSOA 1NNUC 2R65A 3IWFA 1ZQ9A 1D2NA 3KYLA 1V3FA 1DGFA 1XPXA 2UUEB 3U6DA 1F4IA 4LF4M 3RYRA 4ON0A 3SXYA 3CUOA 1IO2A 4M0DA 2R5ZA 4BE2A 2H8RA 3VYHB 5F0FA 2WC2A 2MLKA 1JUMA 3QOPA 2OBPA 1YW9A 4B3RM 2XGEA 2PJPA 2XVCA 2Z3YA 2EKFA 3F5XB 1UFMA 2IW5A 1V5GA 4W5WA 2WADA 3HHGA 1ENWA 4U87A 1YW8A 4BCIB 4EOLB 2DMUA 3W68A 2GA1A 4M9XA 3HX3A 2HTJA 2VASA 2XF3A 2ZO4A 1W36C 3D5LA 2VOOA 2R7GA 3FK7A 5HQ0B 3GX4X 2ZB9A 4MH0E 4F92B 1H4LD 3BG7A 2Z9OA 1IXRC 3MKZA 1KGSA 5DD4A 1IN8A 1C7YA 2PEXA 4GCVA 3OSGA 1VINA 3B57A 1IV8A 5H6QA 1CF7A 4GRIA 2Y31A 4BCMD 3J7ZI 1QZZA 1O7LA 4Y13A 5HDNA 3OMYA 5L3EA 2F4IA 2R7SA 1JR3E 3C2GA 3M4OJ 1OL1B 5JI6A 4EEFG 3J27B 3ZQLA 1K4TA 1JJ8C 2JVGA 3HTUA 3QQAA 1FYMA 3BZKA 4UY8I 4BNCA 2A6EF 2K7LA 1MGTA 4HAMA 3BG5A 1JKWA 3KS4A 2V9VA 3K70D 2Q2EA 3TBIA 1K6YA 1YJWI 4RKUF 2QCUA 4LF9M 3W2WA 1IAWA 4GDFA 5FKOA 4IHXA 1FT9A 5EXSA 2XGDA 3CCUI 1OCPA 1X3ZB 2PMZN 3LFUA 2Y9YA 2CJMB 3S2DJ 2F4OB 4II2A 3U60A 1WHCA 2J7NA 4OAZA 3ABUA 1G6NA 1UHMA 4RB0A 4BEHA 4MFEA 2HI3A 4AG5A 3BCAA 5ICGA 3OYKA 1L8QA 5KAFC 1TQIA 3EUKL 2ZBKB 1XN7A 4IO9F 3K92A 4HEOA 3JSPA 4ENJA 1NSFA 3ZMUA 2J7OA 5IYBJ 3P9CA 4FT8A 4LMYA 4AWXB 4DZJA 1OIPA 2G3QA 1TW3A 2H09A 1IRFA 4RMNA 4EV0A 2UV1A 3K2ZA 4JOMA 2HQNA 2BJWA 1JGSA 3HG9A 1R1UA 1JUPA 5LGUA 2VJJA 2WTEA 3QAUA 3FF5A 1OI9B 4YIRX 3WE2A 4XBFA 5KNLA 2WHBB 1NJGA 4A6EA 1RIOH 3AV0A 2D1VA 5LRSA 4IBCA 1Y8RB 4FETA 5EYRA 3ABKH 4CHUA 1YQAA 1QAMA 2OCEA 3B7ZA 2DTRA 3EUAA 3HHHA 2DYSH 1QQWA 2DFEA 2MGQA 2P5VA 5DDGA 2MD5A 3TEDA 3FD9A 1B8IB 2WFYB 3ZQHA 4XGIA 1ETWA 1UELB 4CXFA 4KUMA 2M0MA 5HLIA 4FTHA 2R7RA 4ZYAA 1Z7UA 1TWFJ 3VOEA 1Z3XA 1QDTA 5DS9A 2IVXA 1NY6A 2KRCA 5E20A 4XLPF 2JQ7A 2XGCA 2RKOA 2RKHA 2G5GX 3U6MA 3AG2H 1ZK8A 3J81S 4EJOA 4I3ZB 2UZBB 3GLHA 3ABLH 4XLNF 1IC8A 3BR2A 2CRGA 2JN6A 3H9GA 1L2CA 4UN2B 1USSA 1NV8A 5IZ7D 2VQCA 3ISPA 1GT0C 3LVVA 2DWMA 3ZQCA 1QU3A 2L2OA 4CRLB 3X28B 4PFOA 4F7JB 5IYDJ 2JJ7A 2CQQA 3QHRB 2C9OA 3S1QJ 2L9SA 3TDZC 4WX9A 3LSKA 4BB9A 2CW8A 2P7VB 2BJVA 3GFMA 3DTEA 4JX6A 4ELJA 2VN2A 1X1CA 1RPWA 3I58A 5F1JA 5IP6A 2H1KA 2COBA 1ZMVA 2LF7A 2KIQA 4CCMA 1AU7A 2QWWA 2VBXA 2BY3A 1SVMA 2L9NA 3D0SA 1TH3A 3HHTB 4E6KG 3B02A 5IOZA 1NG6A 4J00A 1OIYB 4AIHA 1JSTB 3WGGA 1SD6A 1ZTRA 4FW9A 3OYHA 3L2VA 3AJIB 2DW4A 4BQOA 2PK9B 4A3GJ 1OCRH 5GTHC 3SQNA 2QP9X 4LK1F 2EH3A 3VB2A 3S3MA 2IGNA 4AQYM 1TT0A 1T98A 2ZXIA 5FKKA 2BVLA 2P81A 4O6JA 3CQZJ 5KVRA 5IT9Z 1DPUA 2PBIA 1XMOM 4CIZA 4EJWA 2DT5A 4DZPA 3OYFA 1BA5A 1W7PA 1ETYA 4RM2A 4X65M 2YU3A 4DJAA 2F5PA 2QQ9A 3CJQB 2CP8A 1R22A 2X48A 3GRRA 4HDVA 3MEXA 2DU9A 3SJMA 4BCJB 1TWGJ 1R5GA 5GKNA 5JI2E 3HRTA 4FE7A 4BQQA 4JX4A 4BS9A 1V34A 4MGYE 2HXIA 3R0JA 2V7FA 2LVPC 1VG5A 1Z91A 3FXRA 1OIUB 2B9SA 2OQ4A 4RGUA 3M0EA 3T5XA 2CG4A 2QBYA 3ONQA 3HKZN 4KNYA 1HNZM 3TNIB 5HOOA 1HKQA 3PM1A 4K0KM 2E7XA 2L02A 5J4YA 5FFXA 1U8BA 1IJWC 2I5UA 4IIWA 5FD6A 1E3PA 1FSHA 1R4GA 4OB2B 3HRUA 2XPUA 2YFQA 2XRLA 1QAOA 2CYYA 2JY8A 3E6DA 1H89C 2L2DA 3E6CC 1ON1A 4IPAA 4L9TA 3HU1A 5ITRA 2LF8A 2V6CA 3OSFA 1W5CC 4XOTA 3O3KA 1IRGA 3EJ1B 3Q3SA 1FOYA 3FUTA 3AFHA 2VPRA 1D5VA 1N34M 1NHAA 2K4BA 1N36M 2ZC2A 3RSNA 3MFKA 2IW9B 1ZMUA 1UMQA 5M3MJ 2ZPBB 3J81K 3CESA 4MQVA 4KIFA 3CF6E 1ACIA 4UUSA 1BR4A 2WBMA 1XTAA 3Q9VA 1YI2I 1HDDC 3KZYA 2R7UA 1V5EA 3KYDB 2QEXI 2LFBA 1MBJA 1P4WA 1K79A 1IREB 4LGMA 1TGUA 1MMAA 3TO7A 3U6LA 3JTHA 3CF2A 4NXNM 5ILSA 3HUGA 3JRDA 2PLYA 1OQYA 3BR0A 2F4VM 3LSTA 4ESFA 5DCFA 3ABTA 1Q1HA 1DUXC 5GTIC 2EWNA 5K1YA 3HHWA 1SFUA 2HZTA 2W2HA 4NUBA 4C3JJ 2E5LM 4RODA 1QHGA 1QZYA 4YRVA 2DJIA 2TCTA 1OFIA 2F5CA 2GOXB 2L0KA 3FM5A 5DD8A 5LBQA 3OS1A 2O61A 2L7KA 2E2JJ 4DIQA 3CDHA 4MTDA 3VFZA 3BWGA 1W36D 1PVEA 2O25A 1LVAA 3L27A 1SFEA 3CLQA 4B3AA 1MIJA 2JRMA 3KP2A 3GTOJ 4HV6A 2ZFUA 2KRKA 3UGJA 4KT5C 2HKXA 1T08B 2PMIB 3I59B 2LY1A 4ZGJB 3CF0A 1ETKA 1ZAEA 3I4YA 3E5QA 3FYCA 1WSUA 1H8AC 2P6TA 3LSJA 5EDNA 4A0YA 4PCQA 1W98B 3GLIB 1LKXA 1NNJA 1A04A 3OL3A 2FA5A 4XMYA 5FKNA 3RTRA 2HYFA 9ANTA 1BI2A 1IXCA 2DMQA 3W0FA 2VIXA 5CEIB 1H0MA 2CV0A 1J09A 1TNSA 2Y2ZA 2EILH 2CHVA 2XEPA 1GUUA 3OYIA 5FO5A 4EMSA 3I01M 5FTKA 2VKDA 3ZOBA 1S5LC 5C1BA 5BMZA 2LTUA 2RGHA 3SHFA 4AI6A 1A36A 2HCBA 4DOZA 1KYZA 3SMPA 4OOIA 4DBQA 3FE3A 2E1NA 3U5ZA 3OYNA 3L2CA 1JI8A 2WWYA 1R4MB 4I5SA 2A07F 2QDJA 4U88A 2NYXA 2HEOA 1XGNA 1K7AA 4BXUA 2XFSA 1X19A 1TDHA 4HLYA 4AM3A 1EA3A 2BW3B 3SATA 2P5KA 2FNPA 2XKOA 2BZTA 1L3LA 1KU9A 2W82A 2M45A 2VL8A 1IGNA 1FOKA 3GLFA 1P4AA 1AISB 1T8IA 1HNWM 1D0YA 1ZRCA 4YOOA 2CWEA 2O5RA 5JHFA 3WODF 2LVAA 2KIUA 3U9GA 3KOXE 1D0XA 2ZFWA 4R7GA 4PDKA 4MFDA 3HZJA 3PIPF 5HVYB 3V7CA 4XM3A 4LG0A 3K0LA 4IBGA 4P96A 1YJNI 1KU7A 2QYOA 2ZXHA 1X58A 1KFVA 2DI3A 2WAQN 2ZNYA 3RKXA 4KT0F 4ZZDA 3BPXA 1PP7U 4IBEA 3FZVA 3HGYA 3OOUA 4XKBA 1WFXA 4CJ6A 2C96A 2DFHA 2V1CA 4A3JJ 3AG3H 4HEA2 3QRFF 1QO0D 3PSIA 4OWRB 5JVTA 2VKHA 2KLOA 4OVZA 4HYEA 4RB2C 4BXXX 2PG4A 3FXMA 5E8GA 3OYMA 3DU5A 3S93A 1YTYA 4OB1B 4IBIA 3VDUA 3U6QA 1D0LA 1OYWA 1HQCA 3K1JA 1WGXA 1I27A 1IW7F 2KHMA 3WTTC 3I51A 2MH8A 5EP3A 1XMKA 2L54A 1S6LA 5FRMA 4XN0A 2H1LA 5EFQB 3ML6A 3GO5A 5HDGA 1QNTA 3VFDA 2DN0A 3A03A 2HTSA 1YS7A 4NQWA 3HB9A 3FHZA 1F5QB 4YIFA 1OGUB 5DCMB 1MBEA 2OTLI 3K9PA 1XXHB 5EP1A 4L0ZB 3GLXA 5E18F 2KNZA 2CW7A 3EQLF 3ASNH 3JAMK 3O8GA 1G3NC 5LMKB 4CCOA 1J5YA 3F8BA 3O8HA 3KYCB 2WZJA 1D1BA 2ZPHB 1QUSA 5F64A 3OYGA 2PJRA 3C58A 3U21A 4UNOA 4KIBA 1JOWA 4KN7X 3F8MA 3HRSA 3QU3A 2VKEA 2UUCM 4FASD 3COAC 1SFOJ 3A45A 5HS8A 2PI0A 3MMYB 2KHHA 1OLTA 3WTXC 3I3LA 4I09A 3BOSA 4G4RA 2M1BA 1GUXA 5ITYA 3A98B 2VI6A 1GVJA 1D3UB 1ZP2A 1OYIA 3OWTA 1EH7A 2KMUA 3E5XA 4KDPA 1E9SA 2NVTJ 4GGGA 4HZFA 4KRCB 3QYHB 4RGXA 1WJ7A 3Q9SA 3VDXA 3HWSA 4CYCA 3RKQA 4HX7A 1F9NA 4JK1X 2ESHA 1JTXA 1VQLI 2O7OA 1FINB 1IY0A 3ZH9B 5IP9J 3L2UA 2XZFA 2FBHA 4ENNA 3GRVA 2P7CB 1I39A 4XBOA 1DGWY 1Z7LA 2F5SA 1VNDA 2HZDA 4EM1A 4JN6A 4HF2A 2B0LA 1K61A 3BG9A 3NQOA 4LLGF 3HEFA 5HNHA 1TH2A 1S7AA 4M9ZA 2JUCA 5D4RA 3E7LA 2JA5J 2QQ8A 1LTMA 3GLHE 2FSWA 1PKDB 1UHWA 2KKOA 5DYIA 3AOEA 5D8LB 4JI5M 4FHTA 4HW0A 2IGOA 1SEUA 2VOPA 5HODA 1HSTA 2UXBM 2AQFA 1QAQA 4WW0A 2WAEA 3BLHB 2ID3A 4CFUD 2E5ZA 3MQ0A 1UZCA 5D6FA 4ELLA 2CZ1B 1BVSA 2B9RA 5KQDA 4MEYF 3IECA 4E7KA 2LYCA 2QQAA 3K70C 2KDOA 4AIKA 2DA1A 5ICPB 3K69A 4KITB 4LZJA 3T1BA 1VDLA 4DV4M 2JWTA 2EFPA 4JI6M 2XSZA 3GFIA 2CZ0B 3VK7A 2DT7B 3E46A 3ZPLA 4B44A 5LGNA 5ITXE 2X6XA 3H1CA 5BPDA 4NSTB 4R3DA 2FF4A 2Q0OA 4XIDA 1QGPA 3GTGJ 4M6VA 1OMIA 4IHWA 4F70B 1BJAA 5LRRA 5IDPB 2R5ZB 2G77A 3ZMVA 3F3XA 2M7BA 4RDUA 3QHWB 4EC9B 2H27A 3CO6C 2DXIA 2KEBA 1XS9A 2R5YA 2KNVA 4CZZA 2NOGA 4C2MJ 4NOOB 3L9FA 3DOAA 1APLC 3DOGB 3SASA 2BY1A 3LSGA 1AKHA 1P5EB 1GLNA 3I56I 1H1QB 3AL0B 1S7OA 1AIPC 5BPVA 2DHYA 4X66M 1IBLM 1FTZA 5L3FA 2I53A 4AYBN 2OA4A 5L3GA 2XPWA 2IP2A 1VQPI 3ESWB 1RI7A 4A69C 1F43A 3WHBA 4IBBA 1FBUA 3ZCOA 4BUPA 3UJNA 2K47A 3QPTA 4TUWA 1BW5A 1LUJB 1QPMA 2AXTC 4DV3M 2CQNA 1WKMA 1BI0A 4KLNA 1A35A 2IS4A 4LF6M 2C5XB 3LFKA 3PO2J 1WJFA 1P4XA 2EV6A 1CF7B 4GHLA 4ZJZA 1X37A 4IRHA 1X1AA 2EZHA 4D5FA 4DR6M 2FS1A 3DLLF 4HNVA 3F21A 3CDIA 1OCTC 5KCMA 1R49A 1AHJB 1TWCJ 2JXNA 1E7PA 3L7WA 5CJ9A 4DYRA 2AHJB 3JRCA 1ZG1A 1GXPA 2UXNA 1JT0A 3OYLA 4JI4M 2MH9A 2M4GA 1MNEA 3A4CA 4F91B 2JA7J 3F8CA 4PUSA 2UUZA 3MWMA 4G7OF 2Q2EB 1HDPA 1R58A 1EH8A 4Z6YA 3NARA 3M8FA 4ESJA 3THGA 2QZ4A 1UGPB 4L15A 3BG3A 3S1MJ 1XD7A 2X1NB 3I0TA 4GKJM 3GLGA 3U60B 1QRYA 2VXDA 4X1EA 2E1CA 4GFBA 4UUVA 1OISA 2VIIA 4ZDPA 4XN3A 4AG6A 4BEHB 5LFAA 1Z1DA 1ZR2A 3GO8A 2IGMA 4NBQA 4D7MA 1DDNA 2BXZA 3KEQA 3J7AO 4BCOB 4LK0F 1Z05A 2VKVA 2XRNA 1U9OA 4XK8F 2LD5A 3Q8GA 4M0WA 4A0XA 1UJ8A 3DA1A 1YX3A 3RGFB 1JTYA 3VSLA 2K40A 2VJIA 3BP8A 4A5MA 4PT5A 4GC9A 1RKWA 4QPOA 3MKYB 1SVLA 3TNHB 3AKZA 3X26B 2OZ6A 5ED4A 4E7ZA 2ZJQF 4AW4A 1AA7A 1LE8A 4KIGA 3SEZA 3WGHA 1K3XA 3L09A 4XICA 4ZDOA 1XGSA 1RUNA 3R0AA 4BU2A 1DPRA 4M71A 2CZ6B 4IVNA 2MH2A 2ZJRF 2EQRA 5DYGA 3PJRA 1QQIA 1QMZB 1O57A 3WU0A 5IP7J 2WY7Q 4EJVA 4F7LB 3ZQGA 1OCCH 1TDZA 1FTTA 4HV5A 1IM2A 1Y0UA 4I8OA 3E3VA 3X2QH 4R79A 2NVQJ 1QZMA 1OYYA 2M0CA 1B59A 3F22A 2LVOC 3A1YA 4XSXF 3W3CA 1XCBA 2JK3A 3R4KA 3LWFA 4NDLA 1SG9A 3ZGKA 2YUSA 2H5XA 3KX2A 1W0UA 3GLHB 2BY0A 3MZHA 4JI0M 3DKWA 4B47A 4BBSJ 5EXPA 5ITTA 2Z3XA 1G3TA 4HX8A 1J59A 1Y1VJ 4RGSA 1TR8A 2QSFX 1JE8A 4Y3OA 5C4JJ 2F5OA 5FLMJ 1QYRA 5BQTA 4R71A 3CUQB 4YG2F 2JPCA 5K7ZA 3T6PA 1PP8F 3GTKJ 5KAIC 4QHSA 2LBFA 1JKPC 4ITQA 3KP4A 2L4FA 1PJIA 2QF7A 1G4DA 1JUSA 1L0OC 1VQKI 4Q5SF 2ME0A 3RQIA 1MU5A 2DNAA 2DPDA 3H4JA 3OV8A 3JRHA 3TP3A 4HBLA 1DGRM 5E1XA 3T0YA 1VI0A 4B3XA 3EETA 3KP3A 5E8IA 3L29A 3GTMS 2LHGA 1IDZA 3W6JB 3OYBA 2QM3A 2Y75A 5FLXS 1ZLJA 1K6OA 2EFQA 1YUBA 5HNFA 1YJ9I 2GA2A 3I54A 4LY6A 4DQ2A 2VT2A 3IL2A 1S72I 1LFBA 4XLEA 1O3RA 4U7DA 3GPXA 2FOIC 3VK8A 3CC2I 1V54H 5HBEB 4B1RA 1WQ2A 1T56A 4GITA 3MKWB 1S29A 3JAMZ 4G6QA 1W7PB 2OPFA 2L5QA 2WJ9A 5AONA 3L2RA 1I3QJ 3SZTA 2UZEB 3CCYA 4GEWA 1FMVA 3FUUA 1ZG5A 2DMPA 1E2XA 3Q8XA 2MGWA 4LD5A 3WG9A 1YIOA 3KP7A 2I7NA 2F5QA 4AD9A 5GAGJ 3K9OA 4XRSA 2STTA 1XC8A 2B63J 3REOA 3P9KA 1UCRA 3E0JB 4QOSA 2M9HA 2K6BA 4Y52J 1IXSA 2ZMEA 3IAM2 4JI1M 5K7HA 4II7A 1FLIA 2DAIA 4L6V6 4A93J 3DZDA 1SXJA 3OTOM 3K9TA 5EEAA 3MY5B 4LF5M 1RESA 1BN5A 2QBYB 2M34A 2V26A 4BYYA 2QGSA 3JCUC 3S3OA 2IRFG 4LFAM 3RGSA 4G9YA 2HVRA 1UFZA 4BCKB 3F0CA 1D0MA 1IN4A 2R62A 1BM9A 2CUJA 4CFVB 5B1AH 5E17F 1HC8A 3H4CA 2GIZA 2ZM6M 2BGCA 4MB7A 3BCBA 3LSIA 5F04A 5GAEJ 1IN7A 3EUHA 1TQMA 5JVGF 1A6QA 3Q0WA 3P9IA 2WSCF 3ZC7B 1IN6A 3VEPA 2KT0A 2CWBA 2HYJA 3FTFA 5M5WJ 2HYGD 3GWZA 4I0BA 2PFBA 1KZHA 4A6DA 5LEJA 4HLQA 3FMSA 1YFHA 3FKEA 2APLA 2XB0X 2M4KA 4DUYM 3HOTA 1MW7A 2X9DA 2VODA 4KA4A 4N4NB 4BAYA 4UUSB 2YPRA 2EIJH 2A5WA 3K4MA 3OYJA 4H0EA 1YRNA 4ZTFA 1ZREA 3DTIA 3MAJA 1VQMI 2HPIA 4DR3M 2O03A 4IHSA 3QZ9B 3PO3J 2FMYA 3HTSB 2QZ8A 5BNGA 1GKIA 2K0BX 2Z33A 2C4GB 2BVMA 3TDUC 2OF7A 1PJQA 5L8RF 2OD5A 3HUGB 4JX5A 3OYAA 1IFYA 2K02A 1DU0A 3BG6A 5EF6A 1KSFX 5F1RA 3PSFA 2P5LC 3HSFA 1GL6A 2LOOA 1V33A 2W84A 1YX5A 4LB6B 1FP1D 2D7HA 2BE5F 2Z7JA 3FXJA 3RJPA 1IG7A 3DV8A 4NRVA 3OR1C 1X4OA 4G94A 4D5CA 2EB7A 2LBCA 4HSRA 1FY7A 1YG2A 3ZQIA 3QXEB 3LCUA 4LJ6A 3ABMH 4ZYHA 2R0QC 3POMA 3AG1H 1SVOA 1R4NB 1XCVA 4PCZA 4Z2YA 2DO7A 3C2BA 3DFGA 1ZN2A 3TW7A 2DCEA 2JY5A 2KZVA 4BBRM 3B7QA 1SANA 3F6OA 3M7GA 4AVPA 1TTEA 4S12A 3GPYA 2WY8Q 1PJSA 3RPUD 4Y4RA 1NK3P 4U7BA 5A2QS 4KMFA 4YIIA 3F9KA 2HDCA 2VT3A 3BJAA 2R7TA 2X6YA 4R8HA 3CCVI 1HR0M 3TPZA 4TTHA 1WJBA 2ZKZA 4Q48A 2V9PA 4M3EA 2QNJA 2MC3A 1OAIA 4CUGA 2UZLB 4FCVA 1UG2A 3PFYA 4IZZA 1OKVB 4FX3B 3CJNA 4M73A 3IG8A 3VSKA 4ROEA 2LDUA 3R61A 4W1UA 4G6TB 2BBYA 3GLIE 1O3SA 3U5ZB 1FYKA 1GO5A 3GFLA 1Z0XA 1G2HA 5ERIA 4F2LA 4RF1A 1YW7A 2FD5A 4AIDA 1MDMA 1O9KA 2Y0SN 4YC3B 2RNGA 2CS3A 1EE8A 2DA3A 2ZCWA 3K4NA 1TZLA 1N32M 4JBAA 1S9HA 3H3ZA 4N9IA 4EOOB 3KP6A 4A3FJ 4V2FA 2Y0MA 2X8AA 2DHRA 3GLFB 3BLRB 2XZUA 3FMRA 1K4SA 2B3TA 3H9JA 2X4HA 2HGCA 1DO2A 5J1RA 4YELA 2WB1A 5DUIA 2NVXJ 4ZDLA 4LJ4A 2KPMA 2BS3A 4LG0B 3HHYA 1Z6RA 5FD5A 4GKKM 3G1LA 4ENKA 1D3YA 2KJCA 2O6GE 4OB3B 3DU6A 1BIAA 3OL4A 2OU2A 3DDQB 4M6XA 2BOLA 2R0IA 3BROA 3K4KA 4CCJA 4O3MA 2L7ZA 2V1UA 3I64A 2OC6A 3ELKA 2K3FA 3LA2A 3IH4A 1SC7A 2BHZA 4KN4X 2G8LA 1OPCA 4OVZB 3CCQI 1DO0A 1MH4A 2VJ5A 4B43A 2Z4SA 2JTVA 3CP2A 2YS9A 3TOBA 3Q0VA 4D80A 5HS7A 3OS0A 3AL0C 4EOPB 4ABZA 2LWXA 1PUFA 3KPHA 1L2BA 2F6CA 2JA2A 4UVBA 4CCNA 4IHVA 3QP5A 1JSUB 4LRSA 4NRWA 3DBRB 4NHJA 4LFBM 5IOYA 3KOYE 3SZGA 3G73A 1TW2A 5F27A 1H26B 4KMUX 4Z8XA 5JR3A 1JKQC 3DL1A 1WJAA 4LJ7A 1GDTA 1B72B 4NQWB 1ZGAA 2ISYA 5IF1B 1E0EA 3HYIA 4A3MJ 4NSOB 1IY1A 1GHCA 2DAGA 1XSVA 4F93B 2L7IA 1OCOH 1E94E 2EA2A 3ZN0A 3R8FA 4LJAA 2IBDA 4UV8A 1YHQI 1OKRA 4CDGA 4IX7A 3CTAA 3VYSB 3JR4A 2DA4A 5HS9A 2JY7A 3EPZA 2PJRB 2DD5B 2IN3A 4G4NA 2D7EA 1WVRA 4XRMA 3OYCA 4JI7M 2WIHB 2FX0A 4FE4A 1KQ8A 5DQWA 2EUCA 4OMYA 5K5RA 1QUTA 2X6OA 1XXHE 2V9KA 3FBIB 4L9VA 1BC7C 1UAAA 1H27B 3R60A 2W9FA 2UXCM 1GUXB 2A5YB 3CD6I 1K78A 5B66C 3R6SA 1OIZA 1T0FA 3TL4X 2XSZD 3TO9A 4OU7A 4I6ZA 4HG2A 4P9FA 2JGZB 2OOAA 2HQ5A 3WGIA 2YR2A 2W25A 4XLFA 4A3VB 1F4KA 4NSRA 2GAUA 3BOQA 3GQ5A 2EO2A 4WURA 4LF8M 3PUBA 5EZGA 3DWLE 2COMA 3J80S 2CJJA 4CYCB 3HOUJ 3TQSA 3KETA 1I6XA 3UMMA 2FJ1A 1TF0B 1TBXA 1MBHA 1O4XA 1X2NA 5CLSA 4RS8A 5J8CA 1Z77A 2I8DA 4KHPM 3SMSA 1T2KA 3BTJA 3WTYC 2DQRA 2EV0A 1BR1A 2LREA 1R7RA 1ZKGA 3SFZA 4FISA 3MI9B 1FNNA 2JUJA 4N9HA 3CJTB 4XR6A 3M9AA 1SD4A 2CRUA 4EJUA 4L8RC 1HF0A 2GM4A 1F36A 1S3JA 1Y0NA 3LQRA 3SZPA 1YLFA 4S0HB 2PK2A 2DAEA 3B73A 3HSRA 2CUFA 3SYLA 4I99C 5LMUM 1RR7A 3BZCA 4KISA 2HKJA 3FXOA 2HAKA 1XNRM 3BR5A 1U5TA 4RAGA 4MTEA 2QSHX 3HDDA 2R7VA 1WXQA 3VYUB 1PGYA 2LXEA 3KSJA 1ETXA 2HOEA 1RKTA 3TWMA 1WRJA 2HWVA 1DU6A 4IKFA 5EJCA 2DTZA 2K3PA 3QP6A 4IJFA 3PUFA 4B8XA 2X1DA 3G1MA 5FTLA 3KIOA 1LEAA 1KONA 5J1UA 2X6WA 2R3SA 3B6AA 2Z2SB 1OKWB 2HQAA 1P2FA 4MGKE 3DPUA 4G7HF 5CYVA 4PZJA 2F2CA 2ZBKA 3BY6A 4OU0A 4IBJA 2ECCA 2ETHA 2DXCB 4TV7A 4A3DJ 2D1HA 2HNHA 1UGRB 2W4SA 4LIVA 3GMEA 3TP0A 1R6RA 5C4XJ 2C5RA 4P9UA 1Z59A 2DT6A 3QPLA 5B5EC 3U6OA 3VKGA 1UGQB 1ETOA 2VC0A 1C1KA 2H8WA 2MYSA 3A0HC 3CUQC 1FEXA 1R36A 1W0TA 3M1CA 2R5YB 1AWCA 2DDAA 2KRUA 2E34A 1HNXM 1MZBA 3WTVC 3RZOJ 4IBKA 1AKHB 4XKVA 4BY7X 3FUVA 3H5AA 4EATA 3RZDJ 1Z5BA 1IQPA 3B74A 2JY6B 2L4MA 3HC7A 1B8IA 3A0BC 4I02A 4WWCA 1MSEC 3EOCB 4QPQA 4BBRJ 4IMYB 4BCFB 4X6AJ 3FUWA 5DM6F 4P1WA 4XSZF 4I2OA 2L09A 2XROA 2W99A 1GV2A 1A5TA 1VQ1A 1Y8GA 4IBDA 4D81A 2RGVA 1EV7A 4HDUA 1LNWA 3FMQA 2ZJ2A 3K6GA 4RLFA 2JSPA 5FGKB 1VQ5I 2K85A 3HHXA 2J5OA 2FU4A 1WI9A 1G41A 1G3WA 4HPQA 4C3HJ 2IS1A 1GJTA 4JXJA 4FD2A 4EC8B 2R4JA 2K9DA 1SD5A 2E1MB 2WV0A 3H5NA 4XNFA 3LQQA 1K82A 3EIDB 3M03A 4EOKB 3MIAB 4M3BA 4H4KC 3FK6A 4ZYGA 2OCCH 3IHPA 2NXNB 2PHGA 3CMEI 2A05A 2O3FA 1NHGC 1MSFC 5FKMA 1BW6A 1ODDA 4DV7M 1U6GA 4KODA 3HIFA 3GPUA 2OO9A 2K27A 1OCZH 5H6RA 5BS6A 1MMGA 4MO7A 4GH9A 3MMPA 3BBZA 2QVOA 3JR9A 1BC8C 5JLXA 2HHHM 2D7GA 2M30A 2RAEA 5E26A 2XHKA 1T3TA 2R45A 1NG7A 3AOGA 3GLGB 1IZ1A 2L01A 1VDDA 3CO7C 2F5FA 2MLGA 2DD4B 1KU3A 2DAMA 3NBIA 5I5ZB 4FM4B 5H37D 1H9TA 4IHTA 1N33M 3CP8A 2WSFF 2GXGA 1NV9A 1G8PA 2F5NA 1XNQM 1ULYA 1H28B 3JR5A 4DYQA 4DV0M 3IV5A 2DI0A 2M8GX 3HXLA 2JZ1A 3HGIA 2E7WA 1I6HJ 2LY2A 1E3OC 5EEHA 2CFOA 4BE0A 2Z16A 4D9JA 1XMQM 3VODA 2HKOA 1LE8B 3KVWA 4GXOA 3BHTB 3C3EA 1G3YA 4EVIA 1AUAA 2EFOA 2P5TA 5F08A 3K4JA 1H1PB 1BIBA 1J0RA 3FKJA 2X4AA 4BCND 2XF6A 2EIMH 1JQJC 2CGPA 5JFRA 3PXGA 4L5EA 3FM3A 2Y20A 4PJLA 4BXXJ 1IY2A 1YS6A 2TRTA 1OAOC 3RQ4A 2IA2A 2CCIB 4A3BJ 5E3MA 4GIPA 4G4OA 4OGRB 3UKGA 4ZTJA 3ECHA 2R44A 3H0DA 2DPPB 2HL7A 5IYCJ 2FQ3A 3L28A 4F6UB 1X1PA 5EZHA 3I9V2 2XFTA 2LP0A 4EM0B 3G6EI 4ROCA 3TWKA 1USTA 1WIVA 1JR3A 4REZA 4DR5M 4B3TM 1KQ0A 3F92A 2DA6A 2JT1A 3S32A 1WJCA 2EV5A 3BR6A 2OJED 2KL4A 1WH5A 3C2HA 2HOSA 2OPTA 1SFXA 1L1TA 2C99A 3PFIA 2DQLA 1EFUB 3RCOA 4BH9A 1OR7A 2XLJA 3HJEA 1ZARA 4QSHA 1SXJD 3BQYA 3D5SC 1TP4A 4Y17A 2ZCFB 4DW6A 4RAZA 1Q1VA 1HW5A 4IL6C 2DJNA 2DENA 3E97A 5ICFA 2IT0A 2PX9A 4IBFA 2LBFB 3G4SI 3KP0E 1D5YA 5CYIB 2DVWB 3N05A 4F7SB 2ZTCA 3U1DA 3S16J 1MMNA 2X1CA 3MK6A 1FP2A 1ETVA 1HT1E 2EZLA 1TQPA 3KLNA 2Y0QA 3FBNB 3LL7A 1W5TA 1VEGA 3J7YJ 5L2WB 1BBYA 1GXQA 2WAQA 3T1YM 2O01F 4I81A 2LTPA 4F1IA 1K83J 3DQVC 1D1CA 1UB9A 2EK5A 1Y6IA 2FE3A 2MABA 4HLXA 3WHLA 4AC0A 5M5XJ 5D5UB 3K8ZA 2BPMB 3ZQJA 3NBXX 1R23A 4M6YA 4HNUA 1T38A 2FXAA 4BCNB 1J7KA 3M6AA 3QYGB 3A42A 1REPC 2E35A 3U6PA 4B7FA 1B6AA 2HVQA 2J5PA 3L1PA 1BI1A 3TKYA 1C9BA 2J5YA 2WIPB 2W9ZA 2LR8A 2ZSIB 3TO6A 1T95A 4UN0A 3T8RA 3ZQQA 3S2HJ 2QKLB 3BTCA 2ME6A 2TDXA 3KLOA 3V76A 2XDVA 2VQFM 2H94A 2XSJC 4YOZA 2E19A 1XMAA 5E3LA 4HL4A 5IT9S 5D4SA 3KFWX 4KT6A 3DXJF 2R46A 3TW6A 2O8XA 2L9RA 3UK6A 2ZTDA 4WP2A 3F8NA 3MZYA 1R5ID 3IKVA 4AKGA 3RKYA 3WHKA 1DGHA 3HKPA 3CCMI 1S8NA 2I40B 1IXSB 2ZMEB 3O2PE 4JI3M 4B7GA 2RNJA 2VE9A 2I10A 2K9SA 4EONB 1SXJB 2Y48A 2B7EA 3TGNA 1TNTA 3W2VA 1N78A 3CCRI 1MBFA 1ZRDA 3SYTA 3K10A 2NVYJ 1UM8A 1NVMA 2RREA 5M3FJ 2WEVB 4I7HA 4FQGA 4FCWA 1E9RA 3DP7A 5CVJA 3SYKA 3KEOA 2WXVB 3J81Z 3EYIA 2QPAA 1XG1A 2DWZB 4CGZA 4Q4ZF 2Q1ZB 2E2IJ 2E60A 3ERMA 4PSWA 3ZMDA 3VDPA 2BKZB 4MGZE 1HXDA 1X1DA 3A8GB 4CFNB 1IUFA 4C2UA 1FVVB 1MN3A 1LJ9A 4LRTA 4FCYA 3BT9A 2X51A 1GV5A 3I5UA 1U78A 1VQ8I 5E3OA 4BBAA 3RKWA 3JRIA 4LFCM 2ZJPF 1YLAA 3SDGA 5J1YA 2E2HJ 3LSMA 4FWDA 2CV2A 3BJOA 4BHCA 5GAHJ 2DK5A 1FIAA 2MFZA 3MJ5A 2QGUA 2L4EA 2KIMA 2QCOA 4PJ0C 1IDYA 4UB6C 4CFUB 1RR8C 1JJ6C 2QA4I 1VQ6I 2IS2A 3RFWA 4QWQA 3KE2A 4IXAA 4EOSB 2VQLA 3N97A 4NC7A 4IRGA 1GL7A 4BDZA 2IAIA 1ZYRF 2D2WA 1X1BA 1YRNB 2L3DA 4EJTA 3QODA 1VZ0A 3ZCBB 3LW5F 2RQQA 3KOZE 4ZC3A 2DKLA 5LHIA 4IHYA 5B1BH 5F0CA 1VQ7I 2XUBA 2ISZA 4GHAA 1H25B 2QUFA 2CQKA 2WMAB 3PNYA 1BOBA 2A68F 2JA8J 3HU3A 1BL0A 3OIOA 1KYWA 4M3GA 3FDYA 4BJ6C 1GABA 3ZQFA 4ESBA 3LNQA 2LKPA 3JRGA 2XV4S 4EIWA 3DTKA 3DLAA 1RETA 3Q5FA 1Z5AA 5GP9A 3CC4I 4NC8A 3OOPA 4N4OB 4BHBA 1NH3A 4ZYDA 1QDRA 4QOZC 3K2LA 4DV1M 2MJ5B 5KHDA 3MD2A 4A3KJ 1T39A 2IA1A 1MJBA 3AAFA 1XSXA 1FC3A 4RLQA 4ENMA 1QZEA 4I4LA 2KRFA 2Z4RA 3TE6A 2F5DA 1C0WA 3VYRB 1I1GA 2M2EA 2CZ7B 4HA8A 1U3EM 1ETQA 1H6UA 2L7HA 4M9SA 1J2XA 1WCMJ 2XAHA 4MGIE 4GO1A 1MKMA 3CMAI 1TLHB 3LOCA 1XB4A 2X1EA 5LGTA 2XSDC 2E1OA 1X2MA 3PNTA 1KYIA 5IT9K 1W7PD 4XLAA 1XMXA 1U2WA 2WPAB 4QNMA 3GUDA 3ILKA 2KZUA 1LVKA 3L2WA 2X85A 3I4MJ 3FYDA 2DWLA 1XC5A 3V4GA 2AHQA 1MBKA 1LDJA 3EYYA 3FRIA 2LSOA 5K5OA 4EOQB 5C18A 1NTCA 3N4MA 4II5B 2Z8YM 5ITUA 2CV1A 1JXSA 1FWZA 1WPKA 3NRVA 2M87A 2GZWA 3UR3C 2QKMB 3A8MB 2K9NA 3AOEC 4W97A 3HBLA 3OIQA 3DCFA 4BCQD 2ZNZA 4YFXF 4YY3M 5HLGA 2R7QA 1MDMB 3ZP5A 4G3OA 2MR9A 4B3SM 4BGDA 2AO9A 1O9KB 2OZUA 1BOAA 4WXCA 3BXWA 3M3YJ 2X0LA 3DFZA 2QQBA 4MQ9F 5TJJA 3WTZA 4BY1X 2K5CA 2VPLA 5HBJB 2ECBA 4F3QA 3PQKA 1OJLA 3QYEA 4X64M 4QIWN 2GQFA 2CQ7A 2JPBA 4BJ5C 2OV7A 3K2AA 4WCGA 5LD2C 4ZPXA 1TWAJ 1GVDA 2LKSA 3ZMTA 1VEJA 3T1HM 1MD0A 1KQ9A 2HFHA 3E21A 1J9IA 2Y69H 2EBIA 4JYKA 3FXUA 5D8KB 1I50J 2CFXA 1G4AE 2LH9A 4BKXA 3HOSA 3OYDA 5KPRA 3GLFE 1HKTA 4S05A 1YITI 1Z6TA 1P7IA 4Y33A 2LH0A 1XSDA 5H20A 1A5JA 7CATA 2GQQA 4PJMA 4CA0A 2CHGA 3BTLA 2AHMA 2G9WA 1I4WA 1ORKA 2KNAA 3GFJA 3I4PA 3MKLA 4LITA 3T8TA 2VF7A 4P16A 2W7NA 1W1WE 4IEJA 5DTDA 5B3SH 1RNLA 1VQ4I 3MY1B 2K9LA 3U2RA 1ZG3A 3FRHA 5EXTA 2H6CA 4LB5A 4DV5M 5IWAM 2CQXA 3OIPA 4HOBA 4CZCA 1PUFB 1IV6A 2LVSA 1DV0A 4KYWA 1P92A 5CPRB 1WGLA 3V7RA 2D5VA 2H1RA 5M5YJ 3SHGB 5KPTA 2NNNA 3HHZA 5HLHA 3V7SA 3KHIA 1FYLA 3KDSE 4G6ZA 4XOPA 1O3QA 4CH7A 4N0BA 4F55A 5J47A 2LC2A 1PRBA 2C98A 2P6SA 2IEKA 4BCQB 3KP5A 3LQ5B 3SFIA 1O7FA 3CMYA 3KZZA 1GY3B 3U61A 1QANA 2E1MC 2F2EA 1WJDA 3WTUC 3KW6A 4MGHA 3VKHA 4ANRA 1S7EA 2FUG2 1OFHA 1U9NA 2BV6A 2ZXJA 2MSYA 4F6SB 1GJSA 1JT6A 3GLLA 3HOXJ 2R4EA 1JKRC 1P9QC 3O6BB 2YU9J 2IW8B 1XX5A 1MX0A 1XWIA 4UUTA 4DUZM 5ILUA 3TN8B 1BU2A 2HPMA 2DMTA 2C5VB 3K7AM 5E3NA 3EDPA 2X49A 3CZ6A 3RIRA 3BPVA 1K78B 2AS5F 3CLOA 2YQZA 3E4RA 1ITYA 1K3WA 4OIOF 3CTWB 4YFKF 5IPAA 2HDDA 5IDNB 4OAYA 4NNJA 2NS0A 2XAJA 1NK2P 2DA7A 3B6CA 2VBZA 1ZRFA 4LZZA 4GYGA 2JSCA 2R7DA 1PDNC 5GPCA 4GC5A 1TH4A 2FNAA 3GTPJ 5E1ZB 3CC7I 2MW8A 2GBYA 3DDPB 5D6EA 3QYBA 2VJ4A 5FJ8J 4ETSA 4HF0A 2C5OB 2UWMA 3U6EA 2L7FP 1R5LA 2DYRH 2VLAA 4D1QA 1ON2A 4UB8C 4DGWB 2WB1N 3H5RA 5LQFB 4CYDA 2R92J 2PJQA 2W48A 4E70A 3UNGC 3L2QA 3G3ZA 4FX4A 1KXUA 1FZPB 1Z5CA 1QHHD 5LEKA 2VQEM 2FOKA 1POGA 2STWA 1U5TB 1ONVA 2VC1A 1IRZA 4L5IA 4B48A 2D0QB 5F0HA 1YSYA 4AKIA 2IW6B 1QPIA 3A02A 2FFJA 2ELHA 2FRHA 2OOBA 1HQYE 1Y8QB 1FIPA 1DQUA 4LJ9A 3NAUA 1E9HB 4L78A 5FLXK 2KW0A 2R7OA 2ERCA 5ITQA 2XF5A 2DWNA 1OKSA 2HWJA 1Z67A 3BLYA 1QVRA 5DYMA 1FX7A 1HBXG 1FOXA 3X20B 4PJNA 2DAKA 1G3SA 2HQRA 5DEQA 3U1KA 4X0GA 2FBIA 1VF9A 3K1PA 2H6BA 1QLBA 4FVMA 4BCGB 4KO8A 2F4MB 1G8XA 4D82A 4L5JA 5EGOA 2M5WA 1Q02A 4DR7M 3TQNA 2KXEA 4DNCA 1XDSA 5HDKA 4XONA 3WVEB 2A6HF 4LOCA 4ANJA 1T6SA 5CVRA 2O8KA 2UZDB 4CFMB 3WHCA 2K9MA 3S2WA 4OIQF 2XAQA 3A01A 1JKOC 1Y56A 2MROB 3HJSA 2W85A 4U0YA 1EKEA 1KA8A 1NHWC 2V22B 1D1AA 3NWLA 5HNBB 2C5NB 4OX9M 3HJ8A 4IJAA 4U0VA 2BS2A 1H1RB 1HCRA 1DGGA 1B4AA 2VF8A 1Y39A 2ZAOA 3DKYA 4P55A 4CGYB 2GLOA 3O0GD 2K9QA 2O0YA 4RAYA 1E17A 3KOWE 2QHOB 3I53A 5ILVA 2EINH 3J7AS 2N8GA 3G1OA 3KZIC 3DEUA 4LGYA 5EG0A 4PDIA 3S14J 1MJAA 1MMSA 1HT2E 1X4PA 1HW1A 4F7NB 4AZFA 1D8JA 5FB2A 4CHTB 1R00A 3FXQA 2MG4A 3IC7A 5J6XA 1HOMA 4RM3A 1D0KA 3KFUG 3E6MA 2QENA 1W5SA 3IG5A 2LRDA 5H2FC 2E71A 2OAZA 2RDPA 3LA3A 1PJJA 4WK8F 1AOYA 1TFBA 4L16A 2C6YA 2ZANA 3GEZA 1L2DA 3CUQA 4BJTA 3ERED 4DV6M 2BWEA 2GOMA 1JR3D 3S17J 2R7XA 1VOLA 4EORB 1A31A 2KFDA 5FRNA 4FCTA 4LJZF 4R1HA 3I4VA 2NS7A 2AQEA 3CCSI 2KDLA 2PMZA 4PGHA 2LHCA 2M5ZA 5J4VA 4E7LA 3S1NJ 2GXBA 2ZMEC 4DR2M 1KU2A 3AG4H 4BXFA 4EOJB 2XAUA 2R7WA 3FUXA 4MEXF 3FXKA 3LVWA 5BR8M 4IJEA 5IHYA 3ZRGA 3S3NA 1SXJC 2DFFA 4IRIA 1QVTA
chains in the Genus database with same CATH topology
2VB6A 2E5NA 3KYLA 4H4KC 3ZCOA 4BUPA 4BE2A 3VYHB 3H9QA 2IS4A 2IS6A 4C30A 1WJFA 4J01A 1MMGA 1V5GA 4ZJZA 2WADA 2JVHA 1X1AA 3EUHC 4U87A 1NG7A 4HNVA 5KCMA 1AHJB 1E7PA 2DD4B 2VASA 2AHJB 1W36C 4FM4B 3D5LA 3OYLA 4F92B 2M4GA 1MNEA 3CP8A 3A4CA 3BG7A 4F91B 3MKZA 4PUSA 2UUZA 2Q2EB 3VWBA 2R4GA 4Z6YA 3HXLA 4GRIA 1UGPB 2HU9A 2LY2A 3OMYA 1ZELA 4BE0A 2CFOA 2F4IA 2LG4A 2Z16A 4D9JA 2VXDA 3C2GA 2R7SA 3IP4B 4ZDPA 4XN3A 4BEHB 5LFAA 2ZPEB 2JVGA 1LDKB 2IGMA 3K4JA 1DP3A 3FKJA 3QYFA 2XF6A 3BG5A 3K70D 3TBIA 1K6YA 3W2WA 1YX3A 3KEYA 4PJLA 3VSLA 3HL2A 3RQ4A 2VJIA 3MKYB 3LFUA 4QPOA 3AKZA 4ZTJA 3X26B 1PYVA 3TMOA 4E7ZA 3H0DA 2DPPB 2Y0SA 4AU7A 4II2A 4OAZA 1AA7A 3I9V2 3SEZA 4BEHA 4ZDOA 3ZXSA 4MFEA 3OYKA 3BCAA 3S32A 1WJCA 3EUKL 4E7SA 4BU2A 2KMGA 2KL4A 2CZ6B 3C2HA 2JUGA 4HRIA 3PJRA 4PJJA 3RCOA 2WY7Q 3IUOA 2Z1DA 4BL0B 3VYTB 4QSHA 4RMNA 2UV1A 4JOMA 3D5SC 4R79A 2ZCFB 3HG9A 1IRXA 3ZR8X 2VJJA 2ZPFB 3A1YA 2LBFB 3X25B 3W3CA 5KNLA 1UG0A 1WJ5A 3ZGKA 4ITVA 1BR2A 3N05A 3KX2A 3OY9A 4FETA 1MMNA 2X1CA 3EUAA 3NWSA 3LL7A 4B47A 3FBNB 2DOAA 3A8LB 1UELB 3A8HB 2WAQA 4Y3OA 2M0MA 4ZGEB 4AVZA 3DQVC 4BE1A 3L2WA 1D1CA 2R7RA 2ZZDB 1Y6IA 2CH0A 2MABA 4ZYAA 2LBFA 4HNUA 1Z3XA 2QF7A 3QYGB 2KRCA 2WAFA 2HVQA 3K4LA 2ZSIB 1T95A 3ZQQA 4C9YA 2QKLB 3H9GA 1DGRM 4P5OA 2VQCA 1QU3A 2XDVA 4B3XA 2L2OA 3HKZA 2XSJC 3X28B 2ZPGB 4PFOA 4HL4A 3OYBA 4II3A 4KT6A 3TW6A 5CKTA 5HNFA 2L9SA 3LSKA 2CW8A 1Z21A 4LG3A 4AKGA 4XLEA 3DTEA 4JX6A 4CCKA 4ELJA 1X1CA 4E7IA 2OUMA 4CCMA 3OYEA 2L9NA 3MKWB 3W2VA 3HHTB 1N78A 4E6KG 2L5QA 1NG6A 3SYTA 3K10A 4J00A 4C2TA 3L2RA 2WJ9A 2RREA 1FMVA 3OYHA 3L2VA 4BQOA 4PFPA 2Q1ZB 2E60A 4PSWA 3E0JB 1X1DA 3S3MA 3H35A 2DXBB 3A8GB 4C2UA 2IGNA 3IAM2 1TT0A 2ZXIA 2BVLA 2X51A 3OYFA 3GBGA 3LSMA 4RM2A 2V26A 2CV2A 2CZ1B 2MFZA 4DJAA 3CJQB 1PJRA 2HVRA 3G2BA 2IS2A 4XQFA 1HA8A 2CUJA 2VQLA 4BQQA 4JX4A 4NC7A 4BS9A 4BDZA 3H4CA 1G59A 3HPGA 2HVSA 3BCBA 1X1BA 2V7FA 3LSIA 3LSHA 1VZ0A 3QODA 2RQQA 4ZC3A 3DPTA 1T0FC 4BACA 3ONQA 1BOBA 3PNYA 5HOOA 4HLQA 3FDYA 4BJ6C 4OB2B 2M4KA 4JQFA 4XLCA 3HOTA 1MW7A 1V5FA 4N4NB 3DTKA 3K4MA 3DLAA 2A5WA 3SDBA 3OYJA 2XC7A 4NC8A 4N4OB 4ZTFA 3DTIA 2QFZA 4ZGDB 2HPIA 3CJRB 4XOTA 3QZ9B 5KHDA 3MD2A 3AFHA 4BBSM 2BVMA 4RLQA 3HUGB 4JX5A 3OYAA 3RSNA 3BG6A 3PSFA 2M7AA 3VYRB 3J7AY 4HNTA 2ZPBB 2LOOA 3S8PA 3CESA 2CZ7B 1YX5A 3W2AA 1BR4A 2V1NA 2WBMA 4XKWA 3BC8A 2WA0A 2R7UA 3SEQA 4E7JA 1V5EA 2X1EA 2W1OA 3PNTA 1IREB 4OB0B 3OR1C 1X4OA 3K4BA 4XLAA 1MMAA 4HSRA 3QXEB 2KRHA 2KP6A 2ZSHB 3CF2A 1LVKA 2M3AA 2X85A 3DPLC 4NC6A 3IAS2 4HSTA 3TW7A 1WJEA 2DCEA 2KZVA 3QOEA 4BBRM 1Z3YA 2CV1A 4NUBA 2WY8Q 3NWTA 3RPUD 3UR3C 2QKMB 1QHGA 4Y4RA 3A8MB 4YRVA 2DJIA 4U7BA 3HBLA 3OIQA 2GOXB 3F9KA 4MLOA 3OS1A 2R7TA 1MMDA 1N77A 1MNDA 2L7KA 2R7QA 5CQGA 2X6YA 2CMPA 4DIQA 4BGDA 1W36D 1WJBA 1UGSB 4CUGA 2K5CA 3OR2C 2VPLA 3PFYA 2ZFUA 3E1SA 4F3QA 2IXSA 4IZZA 3QZ5B 3VSKA 3QYEA 4ZGJB 2LY1A 4G6TB 4BJ5C 4DBRA 5LD2C 2OV7A 3X24B 1LKXA 2CUZA 3RTRA 3OL3A 4XMYA 2KR6A 2VIXA 2LH9A 2RNGA 2CS3A 3HOSA 2CV0A 1J09A 3K4NA 1TZLA 3OYDA 1S9HA 3OYIA 4Y33A 2VKDA 2VQGA 2W00A 4KJZA 4PJMA 4CA0A 4AI6A 3BG3A 4DOZA 3H9JA 4DBQA 4LITA 2W7NA 3OYNA 1JI8A 4YELA 2WB1A 2K9LA 4ZDLA 2QDJA 2KPMA 2BS3A 3PL8A 4CZCA 1V29B 3OIPA 1X19A 2P0WA 3K4CA 1EA3A 2BW3B 5CPRB 4OB3B 3DU6A 3OL4A 4IQ4A 2W82A 2BOLA 2VL8A 3K4KA 4CCJA 1D0YA 2OC6A 3KHIA 2O5RA 5JHFA 4XOPA 4CH7A 4F55A 2LC2A 1D0XA 2VJ5A 4B43A 3CP2A 4MFDA 3HZJA 2HDWA 4BQNA 4XM3A 4IQJA 3OS0A 3AL0C 2ZXHA 4YEJA 2E1MC 2F6CA 2BW3A 1WJDA 2JA2A 3DKXA 4CCNA 3QWLA 3VKHA 3CMMA 4P17A 2FUG2 3D5RC 3OOUA 1SFKA 1WFXA 4XKBA 3SZGA 3DL1A 1P9QC 4HEA2 1WJAA 3PSIA 4OWRB 3H5NA 2VKHA 2QDYB 2KLOA 4NQWB 2HPMA 3OYMA 3DU5A 3S93A 4MIMA 4OB1B 1E0EA 3CZ6A 4E7HA 2V4JC 4F93B 2ELJA 2KHMA 4OAYA 1FKMA 4NNJA 4CSWA 4E4HA 2KQRA 4PSXA 5FRMA 4XN0A 4IX7A 3A2KA 2XF7A 3VYSB 3EPZA 2PJRB 2DD5B 3OYCA 3FBIB 3QYBA 2V9KA 2VJ4A 3HB9A 1UAAA 2UWMA 3TL4X 2VLAA 4D1QA 2NOJB 4DGWB 2CW7A 4HG2A 3H5RA 4CCOA 3LMMA 4XLFA 3UNGC 3L2QA 3DEEA 3HO8A 1D1BA 3S3OA 3PUBA 2ZPHB 3DWLE 3OYGA 1QHHD 2PJRA 3U21A 5FROA 4XL9A 4FASD 3MMYB 4PK4A 4B48A 2D0QB 4AKIA 1OLTA 3I3LA 2I8DA 1OR7C 1DQUA 1BR1A 2LREA 3HPHA 3OWTA 2KMUA 2R7OA 4XR6A 2CYZB 2XF5A 4XKCA 3X20B 3BLYA 3QYHB 2VQHA 4PJNA 4XNFA 3VDXA 4X0GA 1QLBA 4KISA 4CCLA 1G8XA 2R7VA 3VYUB 2F5VA 3L2UA 1ERDA 4AKHA 4IKFA 3WVEB 4XONA 5EJCA 4AYBA 1DGWY 1Z7LA 2K3PA 4LOCA 2HZDA 2X1DA 4ANJA 3BG9A 2K9MA 3VYGB 5HLTA 1KONA 2X6WA 5HNHA 2Z2SB 1Y56A 2HQAA 3DPUA 1FMWA 2QQ8A 1SAUA 1D1AA 2DXCB 3M8JA 2HNHA 1UGRB 2BS2A 2W4SA 4LIVA 2IGOA 3PNVA 1R6RA 1N75A 2AQFA 2WAEA 2DT6A 3DKYA 4XORA 2E5ZA 4LIUA 3VKGA 1UGQB 2MYSA 3V42A 1D0ZA 2MC4A 3M1CA 3A8OB 4E7KA 2LYCA 3K70C 2KDOA 1LFPA 1X4PA 4KITB 1U0JA 4XKVA 3OS2A 2BS4A 2MD0A 3H5AA 4RM3A 2ZPIB 4EATA 2CZ0B 2LRDA 2DT7B 3HC7A 4B44A 3WVDB 2X6XA 3FHNA 4QPQA 4M6VA 2A6TA 4XLHA 5HVQC 4BJTA 5TGTA 2GOMA 4P1WA 2R7XA 2G77A 2M7BA 2V6EA 5FRNA 2DXIA 2IGKA 4BDYA 2AQEA 3K6GA 2PMZA 2JSPA 4RLFA 4F52A 4E7LA 5CQEA 2VXZA 3LSGA 1YE9A 1GLNA 4BXFA 4HPQA 2XAUA 2R7WA 2IS1A 3AL0B 3ZRGA 3S3NA 2E1MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWL A;  3QYB A;  4P17 A;  4NC6 A;  3QYE A;  4HL4 A;  1FKM A;  2QFZ A;  2QQ8 A;  5EJC A;  2G77 A;  4Z6Y A;  4HLQ A;  3HZJ A; 
#chains in the Genus database with same CATH topology
 4A2U A;  2VB6 A;  2E5N A;  1J5E M;  1D8K A;  4HX4 A;  5ITX A;  5F3W A;  2ESN A;  1DGB A;  2EPF A;  2DZN B;  3CF5 F;  2Y30 A;  3GPP A;  4PGG A;  4M3D A;  1W4M A;  2JMW A;  3H9Q A;  4K2E A;  2IS6 A;  1V55 H;  2RVC A;  4C30 A;  1TD6 A;  3SAR A;  4J01 A;  3I4N J;  3MHV C;  3GLG E;  4ASN A;  1RC9 A;  4JV5 M;  2JVH A;  2XKP A;  1OTR A;  2C9C A;  1I5Z A;  3EUH C;  3G33 B;  5K5Q A;  5EXX A;  3V8L A;  4G6L B;  1IBM M;  4LLL A;  3FIW A;  4LG2 A;  1R5H A;  2Y9Z A;  1XGO A;  3IKT A;  3FX3 A;  1X3U A;  3H3U A;  3ULQ B;  2R7Z J;  2DZL A;  4DYC A;  1ZV1 A;  2CHQ A;  4ZZL A;  1FPQ A;  2LKX A;  3PO3 S;  2CU7 A;  3VWB A;  4X62 M;  5A2Q K;  2R4G A;  1XDU A;  3DBL B;  2HU9 A;  3NDQ A;  4HQM A;  1ZEL A;  2GIV A;  2F48 A;  2LG4 A;  2VDB B;  4A3I J;  3IP4 B;  1G3I A;  5TRD A;  3GP1 A;  1FJL A;  5CVU A;  1TC3 C;  2UUB M;  2RN7 A;  4RF0 A;  5L3B A;  1FBS A;  1LDK B;  1LDD A;  2ZPE B;  5FKL A;  2Z99 A;  1DP3 A;  3QYF A;  4ZH4 F;  2BWB A;  1RU3 A;  2ZXW H;  2KDZ A;  5EP2 A;  1UHS A;  3RI4 A;  4B7H A;  3CGW A;  1NY5 A;  3KEY A;  5DNY A;  1DP7 P;  3HL2 A;  3Q0U A;  3RYP A;  4WXH A;  3FTE A;  3WE3 A;  1MJ9 A;  1PYV A;  3TMO A;  2FML A;  3GZ6 A;  1ZAO A;  2Y0S A;  4AU7 A;  1Y1W J;  5E1W A;  2CSO A;  4G7Z F;  2A69 F;  1V4R A;  1R2Z A;  5C3E J;  3ZXS A;  2KZS A;  2IJL A;  5C44 J;  3K1M A;  3IRQ A;  2UZK A;  1HLV A;  2ELK A;  3J2P B;  1FBQ A;  6PAX A;  3K7A J;  4V2G A;  2Q8K A;  4O5V A;  1WWX A;  4E7S A;  1EJ9 A;  2GXA A;  2KMG A;  3C3D A;  1IUY A;  3C18 A;  2JUG A;  4HRI A;  2ICW G;  2AXL A;  1NJF A;  3GRU A;  5IY5 H;  4PJJ A;  4A3E J;  3IUO A;  5FTM A;  2Z1D A;  1R1V A;  3H0G J;  3VYT B;  5D5X B;  4BL0 B;  3CDL A;  1R9T J;  4CFX B;  2GNO A;  5JI3 E;  4XRS G;  1IRX A;  3ZR8 X;  3MVP A;  2ZPF B;  1WGN A;  1RUO A;  2HR3 A;  3X25 B;  1T33 A;  1UG0 A;  1WJ5 A;  3LSR A;  4ITV A;  1BR2 A;  2P8T A;  3OY9 A;  1XB2 B;  4I01 A;  4M74 A;  2LLK A;  3NWS A;  2EFW A;  2DLL A;  2QSG X;  2DOA A;  5ICE A;  3IH3 A;  3ROU A;  3VPR A;  3A8L B;  1BJZ A;  2JA6 J;  3P7N A;  5D5V B;  4BCM B;  3GQ3 A;  2XPV A;  4ZGE B;  4AVZ A;  4A3C J;  5FSW A;  4UXN A;  4BE1 A;  2ZZD B;  4L4U A;  2CH0 A;  2DA2 A;  3I71 A;  1HW2 A;  4FWG A;  1H9G A;  1V92 A;  3JAM S;  1FOW A;  2XAS A;  3BR3 A;  1ORY B;  2EA4 A;  4L9J A;  3RE8 A;  2V6Z M;  3U6C A;  2EIK H;  2WAF A;  1PJT A;  3D8B A;  4LJ8 A;  1DGH B;  1A6I A;  3K4L A;  5LLQ A;  2M8E A;  3QU6 A;  4C9Y A;  1TL8 A;  3HJQ A;  3KS8 A;  2BHY A;  3GTJ J;  4P5O A;  2LY9 A;  3JRA A;  1TT5 B;  4PDG A;  5TIS C;  1U8R A;  1JGG A;  2EJS A;  4NB5 A;  2L7M P;  3QPH A;  2D45 A;  1QA6 A;  1LB2 A;  3HKZ A;  4D0P A;  2ZPG B;  1VQ9 I;  4II3 A;  2MA3 A;  3SAU A;  5DFL A;  4S04 A;  5ICC A;  1MBG A;  1YYV A;  5CKT A;  2LNH C;  3GF2 A;  3SAW A;  4CFW B;  3MZ8 A;  1Q3C A;  5LHG A;  1CUK A;  1LV7 A;  1RRJ A;  1Z21 A;  4LG3 A;  1F1Z A;  2YX7 A;  4CCK A;  1I94 M;  4FWH A;  5IRE B;  1SXJ E;  4E7I A;  1FJG M;  2OUM A;  3MN2 A;  2FOW A;  2G7H A;  3WU2 C;  2NQ8 C;  3OYE A;  2E36 A;  4Q47 A;  5BPI A;  4DBG B;  1P7J A;  2KIS A;  1MH3 A;  4C2T A;  4RA2 A;  1UNG D;  5FLV A;  5CVV A;  3LAJ A;  3GZN B;  4G8X A;  3J80 K;  2ID6 A;  2FE8 A;  2VBW A;  3C9P A;  5J3L A;  4PFP A;  5GPA A;  2BXY A;  2CE7 A;  3R9X B;  2JRT A;  2NS8 A;  3M07 A;  2DXB B;  3H35 A;  4HQE A;  2YX4 A;  4RNA A;  4PD2 A;  4EQQ A;  4JI8 M;  1ZLK A;  3ASO H;  4BY7 J;  2DA5 A;  5FLX Z;  4U0W A;  5J40 A;  4LGW A;  2KJB A;  3LAP A;  2L6O A;  3GBG A;  2KZG A;  2EA0 A;  1G71 A;  2DAO A;  1ZGW A;  3ZMZ A;  2VUM J;  4AIJ A;  1EH6 A;  3HRM A;  1PJR A;  2BY2 A;  3G2B A;  1STZ A;  4C3I J;  4XQF A;  1HA8 A;  3IHU A;  3KXE C;  1VQN I;  2RQP A;  1G59 A;  4G12 A;  3HPG A;  3RPU A;  4RB3 C;  3IH2 A;  2NVU B;  3F23 A;  2HVS A;  1ZH5 A;  3LSH A;  1I1S A;  3RDI A;  2NNY A;  4V19 K;  1NO1 A;  4EOM B;  3L25 A;  3DPT A;  1T0F C;  1B9N A;  2WSE F;  3E9S A;  3HM5 A;  1WHU A;  3QAH A;  4BAC A;  1F5T A;  2F5E A;  2G7U A;  4Y15 A;  3HU2 A;  4DR1 M;  4OMZ A;  3S15 J;  8CAT A;  4JQF A;  4XLC A;  5DQV A;  5LHH A;  4BQA A;  4CXA B;  1PM5 A;  1V5F A;  2PMU A;  3SDB A;  1B72 A;  2XC7 A;  2L4A A;  1MJG M;  1EIJ A;  3F6V A;  4OR5 B;  2QFZ A;  4ZGD B;  3W67 A;  2PMH A;  4DR4 M;  3CJR B;  3E6B A;  4UVA A;  4BHP A;  4BBS M;  5IT3 A;  3LCV B;  5L3C A;  1S3S A;  3WTW C;  3H36 A;  1GH6 B;  2LVN C;  2M7A A;  3J7A Y;  3SBJ A;  3GW2 A;  4HNT A;  2W57 A;  3S8P A;  2ZAM A;  2V1X A;  5KK1 A;  4OIR F;  3W2A A;  1N4M A;  1T6O A;  3C7J A;  3EIE A;  2V1N A;  1HKS A;  4XKW A;  2LVQ D;  2WA0 A;  1U5T C;  3BDD A;  3BC8 A;  3SEQ A;  4IOC F;  4E7J A;  2XGN A;  1LEB A;  2W1O A;  2VON A;  2Z5U A;  3W0L B;  1GVN A;  4EGY A;  3K4B A;  2R93 J;  4OB0 B;  2KRH A;  2KP6 A;  1OFC X;  3HSE A;  2ZSH B;  1H88 C;  2M3A A;  3DPL C;  3GXO A;  4NC6 A;  3IAS 2;  3GYH X;  4HST A;  3CCL I;  1H24 B;  4B3M M;  3GVA A;  1R1T A;  1WJE A;  3L26 A;  5EQT A;  3E5U A;  5LMN M;  2UXD M;  3QOE A;  4Y72 B;  1J75 A;  1Z3Y A;  4KRD B;  2QLZ A;  2XAG A;  3NWT A;  2DK8 A;  1LPQ A;  3GTQ J;  4QHT A;  3GTL J;  4MLO A;  4B09 A;  3W6K B;  1MMD A;  1OL2 B;  1N77 A;  1MND A;  5CQG A;  2CMP A;  3MCZ A;  3HY5 A;  2DOF A;  1UGS B;  4WXD A;  3B89 A;  2OQG A;  3FKI J;  1VTN C;  2RGO A;  4QNR A;  1TWH J;  3FTD A;  2EFN A;  2XGX A;  3F72 A;  3OR2 C;  3B7N A;  1XHB A;  2CW0 F;  2KIF A;  2RV8 A;  3E1S A;  2IXS A;  3HOV J;  3QZ5 B;  5D5W B;  3P5J A;  2FEZ A;  4D7N A;  4DBR A;  4G6D A;  5FFZ A;  3L00 A;  2DME A;  4LLN A;  5J8F A;  1VQO I;  4LFU A;  3X24 B;  4LF7 M;  1M1E B;  4L18 B;  3FIS A;  1E32 A;  2CUZ A;  1Q39 A;  5DV5 A;  2KR6 A;  5KO3 A;  3A8H B;  4YOS A;  4WF2 A;  3ZN1 A;  4AUX A;  1BI3 A;  4QTR A;  1LQ1 A;  5HBH B;  5F6F A;  1ZQ3 P;  2EJR A;  3T15 A;  2VQG A;  3IRR A;  3W6V A;  2W00 A;  5A2Q Z;  1SD7 A;  4KJZ A;  2I7P A;  4MGR A;  2P4W A;  3H4M A;  2EZK A;  1SMT A;  3I59 A;  1ZHF A;  2UXX A;  2EKK A;  2YSR A;  2CO5 A;  3S1R J;  3GLI A;  5DUK A;  2DPU A;  4QLC U;  2CCH B;  2OQR A;  3GQ4 A;  3PL8 A;  1H1S B;  1V29 B;  3U61 B;  2P0W A;  1VFC A;  2YNM D;  2JZ0 A;  2A61 A;  3K4C A;  3V8J A;  3VLF B;  4CIS A;  3L2A A;  4BCH B;  3DF8 A;  3C3W A;  1JB0 F;  1ZMW A;  4IQ4 A;  3SC3 A;  2IA0 A;  1R2Y A;  2DZO B;  3GTM J;  2EUF A;  2RRU A;  5JHU A;  1XGM A;  4JI2 M;  3NEU A;  3KP1 E;  3T38 A;  4YHH M;  3PQJ A;  4A0Z A;  3I55 I;  5AIP A;  2HOA A;  3JTG A;  2CEA A;  2V1D A;  4EGZ A;  1WI3 A;  2HDW A;  4I0A A;  1SAX A;  3F8F A;  4BQN A;  3ECO A;  1WZ2 A;  1AD6 A;  2W96 A;  5E79 C;  3HGG A;  5FGM A;  4RBO A;  4IQJ A;  4L0Y B;  3DJB A;  5JLW A;  1AHD P;  4J19 A;  4YEJ A;  3DTO A;  1EF4 A;  3DKX A;  2BW3 A;  3V8K A;  2JNH A;  3QWL A;  3CCJ I;  3HOW J;  3CCE I;  3CMM A;  3JW4 A;  4P17 A;  2VBY A;  3D5R C;  2OTJ I;  1SFK A;  1PUE E;  3BHV B;  1ENH A;  2O9L A;  1IN5 A;  4KIC A;  2WMB B;  3UZU A;  3SAV A;  2IVM A;  4RAF A;  2QDY B;  4XK4 A;  2K4J A;  4JP0 A;  4F7Z A;  1B1B A;  4GMQ A;  2RC4 A;  2G9X B;  2W24 A;  1ZGJ A;  4MIM A;  3BJ6 A;  2HXO A;  4E7H A;  3K1N A;  3GRY A;  2V4J C;  1JHH A;  1IXZ A;  2ELJ A;  4L9N A;  4MHG A;  1LFU P;  5EP4 A;  1FKM A;  1X3W B;  4NL4 H;  5ACB A;  2MBF A;  4CSW A;  4E4H A;  2KQR A;  2V79 A;  4PSX A;  4EOI B;  3BQZ A;  3A2K A;  5DM7 F;  1UNL D;  2XF7 A;  2PN6 A;  4CIC A;  2BNK A;  2UU9 M;  3B9P A;  1URC B;  1VYW B;  2ACJ A;  4F6W B;  4UVC A;  2IPQ X;  2N35 A;  1N25 A;  1P6R A;  2LK2 A;  3U6S A;  1SMY F;  2EZI A;  3TOA A;  3WG7 H;  1R7J A;  2CUE A;  1HSJ A;  3FTC A;  2UUA M;  3M8E A;  1I3A A;  4M3F A;  4B4C A;  4B08 A;  2NOJ B;  1QBJ A;  2A3S A;  2VE8 A;  3A46 A;  3LSP A;  2LNB A;  5GAD J;  4XRF A;  5BOX A;  3JRE A;  3LMM A;  2Y21 A;  2HS5 A;  4YFN F;  1R71 A;  4IF4 A;  3DEE A;  4I98 B;  1XO2 A;  1E3H A;  1WR1 B;  1Z9C A;  1IF1 A;  3TNW B;  1YIJ I;  5KQ8 A;  5FRO A;  4OIP F;  1ZR4 A;  3G71 I;  3BHU B;  4XL9 A;  4A12 A;  2KA6 B;  4PK4 A;  5DCM A;  3DEW A;  5EGO B;  2R18 A;  1B9M A;  4DV2 M;  1XXH A;  1OR7 C;  1QVU A;  2G0E A;  2Y0T A;  4BLC A;  5E6J A;  2DOE A;  3WTS C;  3HPH A;  3BR1 A;  2M60 A;  2XIG A;  4FX0 A;  2DDB A;  3J7B A;  3QPS A;  2CYZ B;  3D1N I;  4XKC A;  1FSE A;  2VQH A;  4EM2 A;  2DOD A;  3A01 B;  4G4Q A;  5FTN A;  1JHF A;  3TWL A;  3HOY J;  1P3Q Q;  4JYA M;  2NRA C;  2PQ8 A;  4CCL A;  1VEK A;  4UV9 A;  2HOT A;  1ERD A;  2F5V A;  3IWZ A;  3KCC A;  4AKH A;  2L9V A;  5K7F A;  4UHT A;  2K86 A;  3RGP A;  3H92 A;  5L3D A;  4AYB A;  3GCM A;  2XH9 A;  2JZY A;  3J80 Z;  3JRB A;  4LJ5 A;  4M72 A;  3HO8 A;  5CVI A;  4I76 A;  3BLQ B;  3VYG B;  3C1D A;  2WV1 A;  5HLT A;  3WU1 B;  2LMD A;  1YO5 C;  2BEO A;  3RPQ A;  3ZMS A;  2DFI A;  3LA7 A;  1HJP A;  2DMN A;  1MNM C;  5KPZ A;  1FMW A;  2YR0 A;  3D8L A;  2NAZ A;  3M1E A;  3I04 M;  3KSX A;  1SAU A;  4CO8 A;  5EG0 B;  3PIO F;  2BYV E;  2FBK A;  3HOZ J;  4RGR A;  3M8J A;  4NXM M;  3FWE A;  3PNV A;  2GWR A;  1N75 A;  3BZ6 A;  3JRF A;  1CQT A;  3DBH B;  4Q7J A;  3BTI A;  3FXL A;  4XOR A;  4RB1 A;  2XAF A;  4LIU A;  4LCB A;  1WH7 A;  3V42 A;  4BCP B;  1D0Z A;  2DBB A;  2MC4 A;  5AIQ A;  3EIH A;  3A8O B;  5BNJ B;  1TTY A;  3PVS A;  4OW0 A;  1IBK M;  1LFP A;  2JWS A;  4A5N A;  1L1Z A;  4KFC A;  1T43 A;  5EEG A;  1U0J A;  3OS2 A;  2BS4 A;  2XB5 A;  2MD0 A;  2ZPI B;  1YOV B;  1CGP A;  1RZ4 A;  5FTJ A;  3H3V K;  1O3T A;  1UNH D;  4HF1 A;  2LW4 A;  3WVD B;  3ZQ7 A;  4Y7N J;  2FH0 A;  2R6F A;  3FHN A;  2A6T A;  4XLH A;  5HVQ C;  1R6B X;  4Y28 F;  5TGT A;  2R7F A;  2JP7 A;  2V6E A;  4BY1 J;  1Q3B A;  4ZYE A;  4IOA F;  2IGK A;  2FQ4 A;  4BDY A;  4GYI A;  4F52 A;  4A3L J;  5CQE A;  2VXZ A;  2C6T B;  4MM3 B;  1YE9 A;  3GZ5 A;  4MNU A;  4OIN F;  2ADU A;  3JSO A;  1NNU C;  2R65 A;  3IWF A;  1ZQ9 A;  1D2N A;  3KYL A;  1V3F A;  1DGF A;  1XPX A;  2UUE B;  3U6D A;  1F4I A;  4LF4 M;  3RYR A;  4ON0 A;  3SXY A;  3CUO A;  1IO2 A;  4M0D A;  2R5Z A;  4BE2 A;  2H8R A;  3VYH B;  5F0F A;  2WC2 A;  2MLK A;  1JUM A;  3QOP A;  2OBP A;  1YW9 A;  4B3R M;  2XGE A;  2PJP A;  2XVC A;  2Z3Y A;  2EKF A;  3F5X B;  1UFM A;  2IW5 A;  1V5G A;  4W5W A;  2WAD A;  3HHG A;  1ENW A;  4U87 A;  1YW8 A;  4BCI B;  4EOL B;  2DMU A;  3W68 A;  2GA1 A;  4M9X A;  3HX3 A;  2HTJ A;  2VAS A;  2XF3 A;  2ZO4 A;  1W36 C;  3D5L A;  2VOO A;  2R7G A;  3FK7 A;  5HQ0 B;  3GX4 X;  2ZB9 A;  4MH0 E;  4F92 B;  1H4L D;  3BG7 A;  2Z9O A;  1IXR C;  3MKZ A;  1KGS A;  5DD4 A;  1IN8 A;  1C7Y A;  2PEX A;  4GCV A;  3OSG A;  1VIN A;  3B57 A;  1IV8 A;  5H6Q A;  1CF7 A;  4GRI A;  2Y31 A;  4BCM D;  3J7Z I;  1QZZ A;  1O7L A;  4Y13 A;  5HDN A;  3OMY A;  5L3E A;  2F4I A;  2R7S A;  1JR3 E;  3C2G A;  3M4O J;  1OL1 B;  5JI6 A;  4EEF G;  3J27 B;  3ZQL A;  1K4T A;  1JJ8 C;  2JVG A;  3HTU A;  3QQA A;  1FYM A;  3BZK A;  4UY8 I;  4BNC A;  2A6E F;  2K7L A;  1MGT A;  4HAM A;  3BG5 A;  1JKW A;  3KS4 A;  2V9V A;  3K70 D;  2Q2E A;  3TBI A;  1K6Y A;  1YJW I;  4RKU F;  2QCU A;  4LF9 M;  3W2W A;  1IAW A;  4GDF A;  5FKO A;  4IHX A;  1FT9 A;  5EXS A;  2XGD A;  3CCU I;  1OCP A;  1X3Z B;  2PMZ N;  3LFU A;  2Y9Y A;  2CJM B;  3S2D J;  2F4O B;  4II2 A;  3U60 A;  1WHC A;  2J7N A;  4OAZ A;  3ABU A;  1G6N A;  1UHM A;  4RB0 A;  4BEH A;  4MFE A;  2HI3 A;  4AG5 A;  3BCA A;  5ICG A;  3OYK A;  1L8Q A;  5KAF C;  1TQI A;  3EUK L;  2ZBK B;  1XN7 A;  4IO9 F;  3K92 A;  4HEO A;  3JSP A;  4ENJ A;  1NSF A;  3ZMU A;  2J7O A;  5IYB J;  3P9C A;  4FT8 A;  4LMY A;  4AWX B;  4DZJ A;  1OIP A;  2G3Q A;  1TW3 A;  2H09 A;  1IRF A;  4RMN A;  4EV0 A;  2UV1 A;  3K2Z A;  4JOM A;  2HQN A;  2BJW A;  1JGS A;  3HG9 A;  1R1U A;  1JUP A;  5LGU A;  2VJJ A;  2WTE A;  3QAU A;  3FF5 A;  1OI9 B;  4YIR X;  3WE2 A;  4XBF A;  5KNL A;  2WHB B;  1NJG A;  4A6E A;  1RIO H;  3AV0 A;  2D1V A;  5LRS A;  4IBC A;  1Y8R B;  4FET A;  5EYR A;  3ABK H;  4CHU A;  1YQA A;  1QAM A;  2OCE A;  3B7Z A;  2DTR A;  3EUA A;  3HHH A;  2DYS H;  1QQW A;  2DFE A;  2MGQ A;  2P5V A;  5DDG A;  2MD5 A;  3TED A;  3FD9 A;  1B8I B;  2WFY B;  3ZQH A;  4XGI A;  1ETW A;  1UEL B;  4CXF A;  4KUM A;  2M0M A;  5HLI A;  4FTH A;  2R7R A;  4ZYA A;  1Z7U A;  1TWF J;  3VOE A;  1Z3X A;  1QDT A;  5DS9 A;  2IVX A;  1NY6 A;  2KRC A;  5E20 A;  4XLP F;  2JQ7 A;  2XGC A;  2RKO A;  2RKH A;  2G5G X;  3U6M A;  3AG2 H;  1ZK8 A;  3J81 S;  4EJO A;  4I3Z B;  2UZB B;  3GLH A;  3ABL H;  4XLN F;  1IC8 A;  3BR2 A;  2CRG A;  2JN6 A;  3H9G A;  1L2C A;  4UN2 B;  1USS A;  1NV8 A;  5IZ7 D;  2VQC A;  3ISP A;  1GT0 C;  3LVV A;  2DWM A;  3ZQC A;  1QU3 A;  2L2O A;  4CRL B;  3X28 B;  4PFO A;  4F7J B;  5IYD J;  2JJ7 A;  2CQQ A;  3QHR B;  2C9O A;  3S1Q J;  2L9S A;  3TDZ C;  4WX9 A;  3LSK A;  4BB9 A;  2CW8 A;  2P7V B;  2BJV A;  3GFM A;  3DTE A;  4JX6 A;  4ELJ A;  2VN2 A;  1X1C A;  1RPW A;  3I58 A;  5F1J A;  5IP6 A;  2H1K A;  2COB A;  1ZMV A;  2LF7 A;  2KIQ A;  4CCM A;  1AU7 A;  2QWW A;  2VBX A;  2BY3 A;  1SVM A;  2L9N A;  3D0S A;  1TH3 A;  3HHT B;  4E6K G;  3B02 A;  5IOZ A;  1NG6 A;  4J00 A;  1OIY B;  4AIH A;  1JST B;  3WGG A;  1SD6 A;  1ZTR A;  4FW9 A;  3OYH A;  3L2V A;  3AJI B;  2DW4 A;  4BQO A;  2PK9 B;  4A3G J;  1OCR H;  5GTH C;  3SQN A;  2QP9 X;  4LK1 F;  2EH3 A;  3VB2 A;  3S3M A;  2IGN A;  4AQY M;  1TT0 A;  1T98 A;  2ZXI A;  5FKK A;  2BVL A;  2P81 A;  4O6J A;  3CQZ J;  5KVR A;  5IT9 Z;  1DPU A;  2PBI A;  1XMO M;  4CIZ A;  4EJW A;  2DT5 A;  4DZP A;  3OYF A;  1BA5 A;  1W7P A;  1ETY A;  4RM2 A;  4X65 M;  2YU3 A;  4DJA A;  2F5P A;  2QQ9 A;  3CJQ B;  2CP8 A;  1R22 A;  2X48 A;  3GRR A;  4HDV A;  3MEX A;  2DU9 A;  3SJM A;  4BCJ B;  1TWG J;  1R5G A;  5GKN A;  5JI2 E;  3HRT A;  4FE7 A;  4BQQ A;  4JX4 A;  4BS9 A;  1V34 A;  4MGY E;  2HXI A;  3R0J A;  2V7F A;  2LVP C;  1VG5 A;  1Z91 A;  3FXR A;  1OIU B;  2B9S A;  2OQ4 A;  4RGU A;  3M0E A;  3T5X A;  2CG4 A;  2QBY A;  3ONQ A;  3HKZ N;  4KNY A;  1HNZ M;  3TNI B;  5HOO A;  1HKQ A;  3PM1 A;  4K0K M;  2E7X A;  2L02 A;  5J4Y A;  5FFX A;  1U8B A;  1IJW C;  2I5U A;  4IIW A;  5FD6 A;  1E3P A;  1FSH A;  1R4G A;  4OB2 B;  3HRU A;  2XPU A;  2YFQ A;  2XRL A;  1QAO A;  2CYY A;  2JY8 A;  3E6D A;  1H89 C;  2L2D A;  3E6C C;  1ON1 A;  4IPA A;  4L9T A;  3HU1 A;  5ITR A;  2LF8 A;  2V6C A;  3OSF A;  1W5C C;  4XOT A;  3O3K A;  1IRG A;  3EJ1 B;  3Q3S A;  1FOY A;  3FUT A;  3AFH A;  2VPR A;  1D5V A;  1N34 M;  1NHA A;  2K4B A;  1N36 M;  2ZC2 A;  3RSN A;  3MFK A;  2IW9 B;  1ZMU A;  1UMQ A;  5M3M J;  2ZPB B;  3J81 K;  3CES A;  4MQV A;  4KIF A;  3CF6 E;  1ACI A;  4UUS A;  1BR4 A;  2WBM A;  1XTA A;  3Q9V A;  1YI2 I;  1HDD C;  3KZY A;  2R7U A;  1V5E A;  3KYD B;  2QEX I;  2LFB A;  1MBJ A;  1P4W A;  1K79 A;  1IRE B;  4LGM A;  1TGU A;  1MMA A;  3TO7 A;  3U6L A;  3JTH A;  3CF2 A;  4NXN M;  5ILS A;  3HUG A;  3JRD A;  2PLY A;  1OQY A;  3BR0 A;  2F4V M;  3LST A;  4ESF A;  5DCF A;  3ABT A;  1Q1H A;  1DUX C;  5GTI C;  2EWN A;  5K1Y A;  3HHW A;  1SFU A;  2HZT A;  2W2H A;  4NUB A;  4C3J J;  2E5L M;  4ROD A;  1QHG A;  1QZY A;  4YRV A;  2DJI A;  2TCT A;  1OFI A;  2F5C A;  2GOX B;  2L0K A;  3FM5 A;  5DD8 A;  5LBQ A;  3OS1 A;  2O61 A;  2L7K A;  2E2J J;  4DIQ A;  3CDH A;  4MTD A;  3VFZ A;  3BWG A;  1W36 D;  1PVE A;  2O25 A;  1LVA A;  3L27 A;  1SFE A;  3CLQ A;  4B3A A;  1MIJ A;  2JRM A;  3KP2 A;  3GTO J;  4HV6 A;  2ZFU A;  2KRK A;  3UGJ A;  4KT5 C;  2HKX A;  1T08 B;  2PMI B;  3I59 B;  2LY1 A;  4ZGJ B;  3CF0 A;  1ETK A;  1ZAE A;  3I4Y A;  3E5Q A;  3FYC A;  1WSU A;  1H8A C;  2P6T A;  3LSJ A;  5EDN A;  4A0Y A;  4PCQ A;  1W98 B;  3GLI B;  1LKX A;  1NNJ A;  1A04 A;  3OL3 A;  2FA5 A;  4XMY A;  5FKN A;  3RTR A;  2HYF A;  9ANT A;  1BI2 A;  1IXC A;  2DMQ A;  3W0F A;  2VIX A;  5CEI B;  1H0M A;  2CV0 A;  1J09 A;  1TNS A;  2Y2Z A;  2EIL H;  2CHV A;  2XEP A;  1GUU A;  3OYI A;  5FO5 A;  4EMS A;  3I01 M;  5FTK A;  2VKD A;  3ZOB A;  1S5L C;  5C1B A;  5BMZ A;  2LTU A;  2RGH A;  3SHF A;  4AI6 A;  1A36 A;  2HCB A;  4DOZ A;  1KYZ A;  3SMP A;  4OOI A;  4DBQ A;  3FE3 A;  2E1N A;  3U5Z A;  3OYN A;  3L2C A;  1JI8 A;  2WWY A;  1R4M B;  4I5S A;  2A07 F;  2QDJ A;  4U88 A;  2NYX A;  2HEO A;  1XGN A;  1K7A A;  4BXU A;  2XFS A;  1X19 A;  1TDH A;  4HLY A;  4AM3 A;  1EA3 A;  2BW3 B;  3SAT A;  2P5K A;  2FNP A;  2XKO A;  2BZT A;  1L3L A;  1KU9 A;  2W82 A;  2M45 A;  2VL8 A;  1IGN A;  1FOK A;  3GLF A;  1P4A A;  1AIS B;  1T8I A;  1HNW M;  1D0Y A;  1ZRC A;  4YOO A;  2CWE A;  2O5R A;  5JHF A;  3WOD F;  2LVA A;  2KIU A;  3U9G A;  3KOX E;  1D0X A;  2ZFW A;  4R7G A;  4PDK A;  4MFD A;  3HZJ A;  3PIP F;  5HVY B;  3V7C A;  4XM3 A;  4LG0 A;  3K0L A;  4IBG A;  4P96 A;  1YJN I;  1KU7 A;  2QYO A;  2ZXH A;  1X58 A;  1KFV A;  2DI3 A;  2WAQ N;  2ZNY A;  3RKX A;  4KT0 F;  4ZZD A;  3BPX A;  1PP7 U;  4IBE A;  3FZV A;  3HGY A;  3OOU A;  4XKB A;  1WFX A;  4CJ6 A;  2C96 A;  2DFH A;  2V1C A;  4A3J J;  3AG3 H;  4HEA 2;  3QRF F;  1QO0 D;  3PSI A;  4OWR B;  5JVT A;  2VKH A;  2KLO A;  4OVZ A;  4HYE A;  4RB2 C;  4BXX X;  2PG4 A;  3FXM A;  5E8G A;  3OYM A;  3DU5 A;  3S93 A;  1YTY A;  4OB1 B;  4IBI A;  3VDU A;  3U6Q A;  1D0L A;  1OYW A;  1HQC A;  3K1J A;  1WGX A;  1I27 A;  1IW7 F;  2KHM A;  3WTT C;  3I51 A;  2MH8 A;  5EP3 A;  1XMK A;  2L54 A;  1S6L A;  5FRM A;  4XN0 A;  2H1L A;  5EFQ B;  3ML6 A;  3GO5 A;  5HDG A;  1QNT A;  3VFD A;  2DN0 A;  3A03 A;  2HTS A;  1YS7 A;  4NQW A;  3HB9 A;  3FHZ A;  1F5Q B;  4YIF A;  1OGU B;  5DCM B;  1MBE A;  2OTL I;  3K9P A;  1XXH B;  5EP1 A;  4L0Z B;  3GLX A;  5E18 F;  2KNZ A;  2CW7 A;  3EQL F;  3ASN H;  3JAM K;  3O8G A;  1G3N C;  5LMK B;  4CCO A;  1J5Y A;  3F8B A;  3O8H A;  3KYC B;  2WZJ A;  1D1B A;  2ZPH B;  1QUS A;  5F64 A;  3OYG A;  2PJR A;  3C58 A;  3U21 A;  4UNO A;  4KIB A;  1JOW A;  4KN7 X;  3F8M A;  3HRS A;  3QU3 A;  2VKE A;  2UUC M;  4FAS D;  3COA C;  1SFO J;  3A45 A;  5HS8 A;  2PI0 A;  3MMY B;  2KHH A;  1OLT A;  3WTX C;  3I3L A;  4I09 A;  3BOS A;  4G4R A;  2M1B A;  1GUX A;  5ITY A;  3A98 B;  2VI6 A;  1GVJ A;  1D3U B;  1ZP2 A;  1OYI A;  3OWT A;  1EH7 A;  2KMU A;  3E5X A;  4KDP A;  1E9S A;  2NVT J;  4GGG A;  4HZF A;  4KRC B;  3QYH B;  4RGX A;  1WJ7 A;  3Q9S A;  3VDX A;  3HWS A;  4CYC A;  3RKQ A;  4HX7 A;  1F9N A;  4JK1 X;  2ESH A;  1JTX A;  1VQL I;  2O7O A;  1FIN B;  1IY0 A;  3ZH9 B;  5IP9 J;  3L2U A;  2XZF A;  2FBH A;  4ENN A;  3GRV A;  2P7C B;  1I39 A;  4XBO A;  1DGW Y;  1Z7L A;  2F5S A;  1VND A;  2HZD A;  4EM1 A;  4JN6 A;  4HF2 A;  2B0L A;  1K61 A;  3BG9 A;  3NQO A;  4LLG F;  3HEF A;  5HNH A;  1TH2 A;  1S7A A;  4M9Z A;  2JUC A;  5D4R A;  3E7L A;  2JA5 J;  2QQ8 A;  1LTM A;  3GLH E;  2FSW A;  1PKD B;  1UHW A;  2KKO A;  5DYI A;  3AOE A;  5D8L B;  4JI5 M;  4FHT A;  4HW0 A;  2IGO A;  1SEU A;  2VOP A;  5HOD A;  1HST A;  2UXB M;  2AQF A;  1QAQ A;  4WW0 A;  2WAE A;  3BLH B;  2ID3 A;  4CFU D;  2E5Z A;  3MQ0 A;  1UZC A;  5D6F A;  4ELL A;  2CZ1 B;  1BVS A;  2B9R A;  5KQD A;  4MEY F;  3IEC A;  4E7K A;  2LYC A;  2QQA A;  3K70 C;  2KDO A;  4AIK A;  2DA1 A;  5ICP B;  3K69 A;  4KIT B;  4LZJ A;  3T1B A;  1VDL A;  4DV4 M;  2JWT A;  2EFP A;  4JI6 M;  2XSZ A;  3GFI A;  2CZ0 B;  3VK7 A;  2DT7 B;  3E46 A;  3ZPL A;  4B44 A;  5LGN A;  5ITX E;  2X6X A;  3H1C A;  5BPD A;  4NST B;  4R3D A;  2FF4 A;  2Q0O A;  4XID A;  1QGP A;  3GTG J;  4M6V A;  1OMI A;  4IHW A;  4F70 B;  1BJA A;  5LRR A;  5IDP B;  2R5Z B;  2G77 A;  3ZMV A;  3F3X A;  2M7B A;  4RDU A;  3QHW B;  4EC9 B;  2H27 A;  3CO6 C;  2DXI A;  2KEB A;  1XS9 A;  2R5Y A;  2KNV A;  4CZZ A;  2NOG A;  4C2M J;  4NOO B;  3L9F A;  3DOA A;  1APL C;  3DOG B;  3SAS A;  2BY1 A;  3LSG A;  1AKH A;  1P5E B;  1GLN A;  3I56 I;  1H1Q B;  3AL0 B;  1S7O A;  1AIP C;  5BPV A;  2DHY A;  4X66 M;  1IBL M;  1FTZ A;  5L3F A;  2I53 A;  4AYB N;  2OA4 A;  5L3G A;  2XPW A;  2IP2 A;  1VQP I;  3ESW B;  1RI7 A;  4A69 C;  1F43 A;  3WHB A;  4IBB A;  1FBU A;  3ZCO A;  4BUP A;  3UJN A;  2K47 A;  3QPT A;  4TUW A;  1BW5 A;  1LUJ B;  1QPM A;  2AXT C;  4DV3 M;  2CQN A;  1WKM A;  1BI0 A;  4KLN A;  1A35 A;  2IS4 A;  4LF6 M;  2C5X B;  3LFK A;  3PO2 J;  1WJF A;  1P4X A;  2EV6 A;  1CF7 B;  4GHL A;  4ZJZ A;  1X37 A;  4IRH A;  1X1A A;  2EZH A;  4D5F A;  4DR6 M;  2FS1 A;  3DLL F;  4HNV A;  3F21 A;  3CDI A;  1OCT C;  5KCM A;  1R49 A;  1AHJ B;  1TWC J;  2JXN A;  1E7P A;  3L7W A;  5CJ9 A;  4DYR A;  2AHJ B;  3JRC A;  1ZG1 A;  1GXP A;  2UXN A;  1JT0 A;  3OYL A;  4JI4 M;  2MH9 A;  2M4G A;  1MNE A;  3A4C A;  4F91 B;  2JA7 J;  3F8C A;  4PUS A;  2UUZ A;  3MWM A;  4G7O F;  2Q2E B;  1HDP A;  1R58 A;  1EH8 A;  4Z6Y A;  3NAR A;  3M8F A;  4ESJ A;  3THG A;  2QZ4 A;  1UGP B;  4L15 A;  3BG3 A;  3S1M J;  1XD7 A;  2X1N B;  3I0T A;  4GKJ M;  3GLG A;  3U60 B;  1QRY A;  2VXD A;  4X1E A;  2E1C A;  4GFB A;  4UUV A;  1OIS A;  2VII A;  4ZDP A;  4XN3 A;  4AG6 A;  4BEH B;  5LFA A;  1Z1D A;  1ZR2 A;  3GO8 A;  2IGM A;  4NBQ A;  4D7M A;  1DDN A;  2BXZ A;  3KEQ A;  3J7A O;  4BCO B;  4LK0 F;  1Z05 A;  2VKV A;  2XRN A;  1U9O A;  4XK8 F;  2LD5 A;  3Q8G A;  4M0W A;  4A0X A;  1UJ8 A;  3DA1 A;  1YX3 A;  3RGF B;  1JTY A;  3VSL A;  2K40 A;  2VJI A;  3BP8 A;  4A5M A;  4PT5 A;  4GC9 A;  1RKW A;  4QPO A;  3MKY B;  1SVL A;  3TNH B;  3AKZ A;  3X26 B;  2OZ6 A;  5ED4 A;  4E7Z A;  2ZJQ F;  4AW4 A;  1AA7 A;  1LE8 A;  4KIG A;  3SEZ A;  3WGH A;  1K3X A;  3L09 A;  4XIC A;  4ZDO A;  1XGS A;  1RUN A;  3R0A A;  4BU2 A;  1DPR A;  4M71 A;  2CZ6 B;  4IVN A;  2MH2 A;  2ZJR F;  2EQR A;  5DYG A;  3PJR A;  1QQI A;  1QMZ B;  1O57 A;  3WU0 A;  5IP7 J;  2WY7 Q;  4EJV A;  4F7L B;  3ZQG A;  1OCC H;  1TDZ A;  1FTT A;  4HV5 A;  1IM2 A;  1Y0U A;  4I8O A;  3E3V A;  3X2Q H;  4R79 A;  2NVQ J;  1QZM A;  1OYY A;  2M0C A;  1B59 A;  3F22 A;  2LVO C;  3A1Y A;  4XSX F;  3W3C A;  1XCB A;  2JK3 A;  3R4K A;  3LWF A;  4NDL A;  1SG9 A;  3ZGK A;  2YUS A;  2H5X A;  3KX2 A;  1W0U A;  3GLH B;  2BY0 A;  3MZH A;  4JI0 M;  3DKW A;  4B47 A;  4BBS J;  5EXP A;  5ITT A;  2Z3X A;  1G3T A;  4HX8 A;  1J59 A;  1Y1V J;  4RGS A;  1TR8 A;  2QSF X;  1JE8 A;  4Y3O A;  5C4J J;  2F5O A;  5FLM J;  1QYR A;  5BQT A;  4R71 A;  3CUQ B;  4YG2 F;  2JPC A;  5K7Z A;  3T6P A;  1PP8 F;  3GTK J;  5KAI C;  4QHS A;  2LBF A;  1JKP C;  4ITQ A;  3KP4 A;  2L4F A;  1PJI A;  2QF7 A;  1G4D A;  1JUS A;  1L0O C;  1VQK I;  4Q5S F;  2ME0 A;  3RQI A;  1MU5 A;  2DNA A;  2DPD A;  3H4J A;  3OV8 A;  3JRH A;  3TP3 A;  4HBL A;  1DGR M;  5E1X A;  3T0Y A;  1VI0 A;  4B3X A;  3EET A;  3KP3 A;  5E8I A;  3L29 A;  3GTM S;  2LHG A;  1IDZ A;  3W6J B;  3OYB A;  2QM3 A;  2Y75 A;  5FLX S;  1ZLJ A;  1K6O A;  2EFQ A;  1YUB A;  5HNF A;  1YJ9 I;  2GA2 A;  3I54 A;  4LY6 A;  4DQ2 A;  2VT2 A;  3IL2 A;  1S72 I;  1LFB A;  4XLE A;  1O3R A;  4U7D A;  3GPX A;  2FOI C;  3VK8 A;  3CC2 I;  1V54 H;  5HBE B;  4B1R A;  1WQ2 A;  1T56 A;  4GIT A;  3MKW B;  1S29 A;  3JAM Z;  4G6Q A;  1W7P B;  2OPF A;  2L5Q A;  2WJ9 A;  5AON A;  3L2R A;  1I3Q J;  3SZT A;  2UZE B;  3CCY A;  4GEW A;  1FMV A;  3FUU A;  1ZG5 A;  2DMP A;  1E2X A;  3Q8X A;  2MGW A;  4LD5 A;  3WG9 A;  1YIO A;  3KP7 A;  2I7N A;  2F5Q A;  4AD9 A;  5GAG J;  3K9O A;  4XRS A;  2STT A;  1XC8 A;  2B63 J;  3REO A;  3P9K A;  1UCR A;  3E0J B;  4QOS A;  2M9H A;  2K6B A;  4Y52 J;  1IXS A;  2ZME A;  3IAM 2;  4JI1 M;  5K7H A;  4II7 A;  1FLI A;  2DAI A;  4L6V 6;  4A93 J;  3DZD A;  1SXJ A;  3OTO M;  3K9T A;  5EEA A;  3MY5 B;  4LF5 M;  1RES A;  1BN5 A;  2QBY B;  2M34 A;  2V26 A;  4BYY A;  2QGS A;  3JCU C;  3S3O A;  2IRF G;  4LFA M;  3RGS A;  4G9Y A;  2HVR A;  1UFZ A;  4BCK B;  3F0C A;  1D0M A;  1IN4 A;  2R62 A;  1BM9 A;  2CUJ A;  4CFV B;  5B1A H;  5E17 F;  1HC8 A;  3H4C A;  2GIZ A;  2ZM6 M;  2BGC A;  4MB7 A;  3BCB A;  3LSI A;  5F04 A;  5GAE J;  1IN7 A;  3EUH A;  1TQM A;  5JVG F;  1A6Q A;  3Q0W A;  3P9I A;  2WSC F;  3ZC7 B;  1IN6 A;  3VEP A;  2KT0 A;  2CWB A;  2HYJ A;  3FTF A;  5M5W J;  2HYG D;  3GWZ A;  4I0B A;  2PFB A;  1KZH A;  4A6D A;  5LEJ A;  4HLQ A;  3FMS A;  1YFH A;  3FKE A;  2APL A;  2XB0 X;  2M4K A;  4DUY M;  3HOT A;  1MW7 A;  2X9D A;  2VOD A;  4KA4 A;  4N4N B;  4BAY A;  4UUS B;  2YPR A;  2EIJ H;  2A5W A;  3K4M A;  3OYJ A;  4H0E A;  1YRN A;  4ZTF A;  1ZRE A;  3DTI A;  3MAJ A;  1VQM I;  2HPI A;  4DR3 M;  2O03 A;  4IHS A;  3QZ9 B;  3PO3 J;  2FMY A;  3HTS B;  2QZ8 A;  5BNG A;  1GKI A;  2K0B X;  2Z33 A;  2C4G B;  2BVM A;  3TDU C;  2OF7 A;  1PJQ A;  5L8R F;  2OD5 A;  3HUG B;  4JX5 A;  3OYA A;  1IFY A;  2K02 A;  1DU0 A;  3BG6 A;  5EF6 A;  1KSF X;  5F1R A;  3PSF A;  2P5L C;  3HSF A;  1GL6 A;  2LOO A;  1V33 A;  2W84 A;  1YX5 A;  4LB6 B;  1FP1 D;  2D7H A;  2BE5 F;  2Z7J A;  3FXJ A;  3RJP A;  1IG7 A;  3DV8 A;  4NRV A;  3OR1 C;  1X4O A;  4G94 A;  4D5C A;  2EB7 A;  2LBC A;  4HSR A;  1FY7 A;  1YG2 A;  3ZQI A;  3QXE B;  3LCU A;  4LJ6 A;  3ABM H;  4ZYH A;  2R0Q C;  3POM A;  3AG1 H;  1SVO A;  1R4N B;  1XCV A;  4PCZ A;  4Z2Y A;  2DO7 A;  3C2B A;  3DFG A;  1ZN2 A;  3TW7 A;  2DCE A;  2JY5 A;  2KZV A;  4BBR M;  3B7Q A;  1SAN A;  3F6O A;  3M7G A;  4AVP A;  1TTE A;  4S12 A;  3GPY A;  2WY8 Q;  1PJS A;  3RPU D;  4Y4R A;  1NK3 P;  4U7B A;  5A2Q S;  4KMF A;  4YII A;  3F9K A;  2HDC A;  2VT3 A;  3BJA A;  2R7T A;  2X6Y A;  4R8H A;  3CCV I;  1HR0 M;  3TPZ A;  4TTH A;  1WJB A;  2ZKZ A;  4Q48 A;  2V9P A;  4M3E A;  2QNJ A;  2MC3 A;  1OAI A;  4CUG A;  2UZL B;  4FCV A;  1UG2 A;  3PFY A;  4IZZ A;  1OKV B;  4FX3 B;  3CJN A;  4M73 A;  3IG8 A;  3VSK A;  4ROE A;  2LDU A;  3R61 A;  4W1U A;  4G6T B;  2BBY A;  3GLI E;  1O3S A;  3U5Z B;  1FYK A;  1GO5 A;  3GFL A;  1Z0X A;  1G2H A;  5ERI A;  4F2L A;  4RF1 A;  1YW7 A;  2FD5 A;  4AID A;  1MDM A;  1O9K A;  2Y0S N;  4YC3 B;  2RNG A;  2CS3 A;  1EE8 A;  2DA3 A;  2ZCW A;  3K4N A;  1TZL A;  1N32 M;  4JBA A;  1S9H A;  3H3Z A;  4N9I A;  4EOO B;  3KP6 A;  4A3F J;  4V2F A;  2Y0M A;  2X8A A;  2DHR A;  3GLF B;  3BLR B;  2XZU A;  3FMR A;  1K4S A;  2B3T A;  3H9J A;  2X4H A;  2HGC A;  1DO2 A;  5J1R A;  4YEL A;  2WB1 A;  5DUI A;  2NVX J;  4ZDL A;  4LJ4 A;  2KPM A;  2BS3 A;  4LG0 B;  3HHY A;  1Z6R A;  5FD5 A;  4GKK M;  3G1L A;  4ENK A;  1D3Y A;  2KJC A;  2O6G E;  4OB3 B;  3DU6 A;  1BIA A;  3OL4 A;  2OU2 A;  3DDQ B;  4M6X A;  2BOL A;  2R0I A;  3BRO A;  3K4K A;  4CCJ A;  4O3M A;  2L7Z A;  2V1U A;  3I64 A;  2OC6 A;  3ELK A;  2K3F A;  3LA2 A;  3IH4 A;  1SC7 A;  2BHZ A;  4KN4 X;  2G8L A;  1OPC A;  4OVZ B;  3CCQ I;  1DO0 A;  1MH4 A;  2VJ5 A;  4B43 A;  2Z4S A;  2JTV A;  3CP2 A;  2YS9 A;  3TOB A;  3Q0V A;  4D80 A;  5HS7 A;  3OS0 A;  3AL0 C;  4EOP B;  4ABZ A;  2LWX A;  1PUF A;  3KPH A;  1L2B A;  2F6C A;  2JA2 A;  4UVB A;  4CCN A;  4IHV A;  3QP5 A;  1JSU B;  4LRS A;  4NRW A;  3DBR B;  4NHJ A;  4LFB M;  5IOY A;  3KOY E;  3SZG A;  3G73 A;  1TW2 A;  5F27 A;  1H26 B;  4KMU X;  4Z8X A;  5JR3 A;  1JKQ C;  3DL1 A;  1WJA A;  4LJ7 A;  1GDT A;  1B72 B;  4NQW B;  1ZGA A;  2ISY A;  5IF1 B;  1E0E A;  3HYI A;  4A3M J;  4NSO B;  1IY1 A;  1GHC A;  2DAG A;  1XSV A;  4F93 B;  2L7I A;  1OCO H;  1E94 E;  2EA2 A;  3ZN0 A;  3R8F A;  4LJA A;  2IBD A;  4UV8 A;  1YHQ I;  1OKR A;  4CDG A;  4IX7 A;  3CTA A;  3VYS B;  3JR4 A;  2DA4 A;  5HS9 A;  2JY7 A;  3EPZ A;  2PJR B;  2DD5 B;  2IN3 A;  4G4N A;  2D7E A;  1WVR A;  4XRM A;  3OYC A;  4JI7 M;  2WIH B;  2FX0 A;  4FE4 A;  1KQ8 A;  5DQW A;  2EUC A;  4OMY A;  5K5R A;  1QUT A;  2X6O A;  1XXH E;  2V9K A;  3FBI B;  4L9V A;  1BC7 C;  1UAA A;  1H27 B;  3R60 A;  2W9F A;  2UXC M;  1GUX B;  2A5Y B;  3CD6 I;  1K78 A;  5B66 C;  3R6S A;  1OIZ A;  1T0F A;  3TL4 X;  2XSZ D;  3TO9 A;  4OU7 A;  4I6Z A;  4HG2 A;  4P9F A;  2JGZ B;  2OOA A;  2HQ5 A;  3WGI A;  2YR2 A;  2W25 A;  4XLF A;  4A3V B;  1F4K A;  4NSR A;  2GAU A;  3BOQ A;  3GQ5 A;  2EO2 A;  4WUR A;  4LF8 M;  3PUB A;  5EZG A;  3DWL E;  2COM A;  3J80 S;  2CJJ A;  4CYC B;  3HOU J;  3TQS A;  3KET A;  1I6X A;  3UMM A;  2FJ1 A;  1TF0 B;  1TBX A;  1MBH A;  1O4X A;  1X2N A;  5CLS A;  4RS8 A;  5J8C A;  1Z77 A;  2I8D A;  4KHP M;  3SMS A;  1T2K A;  3BTJ A;  3WTY C;  2DQR A;  2EV0 A;  1BR1 A;  2LRE A;  1R7R A;  1ZKG A;  3SFZ A;  4FIS A;  3MI9 B;  1FNN A;  2JUJ A;  4N9H A;  3CJT B;  4XR6 A;  3M9A A;  1SD4 A;  2CRU A;  4EJU A;  4L8R C;  1HF0 A;  2GM4 A;  1F36 A;  1S3J A;  1Y0N A;  3LQR A;  3SZP A;  1YLF A;  4S0H B;  2PK2 A;  2DAE A;  3B73 A;  3HSR A;  2CUF A;  3SYL A;  4I99 C;  5LMU M;  1RR7 A;  3BZC A;  4KIS A;  2HKJ A;  3FXO A;  2HAK A;  1XNR M;  3BR5 A;  1U5T A;  4RAG A;  4MTE A;  2QSH X;  3HDD A;  2R7V A;  1WXQ A;  3VYU B;  1PGY A;  2LXE A;  3KSJ A;  1ETX A;  2HOE A;  1RKT A;  3TWM A;  1WRJ A;  2HWV A;  1DU6 A;  4IKF A;  5EJC A;  2DTZ A;  2K3P A;  3QP6 A;  4IJF A;  3PUF A;  4B8X A;  2X1D A;  3G1M A;  5FTL A;  3KIO A;  1LEA A;  1KON A;  5J1U A;  2X6W A;  2R3S A;  3B6A A;  2Z2S B;  1OKW B;  2HQA A;  1P2F A;  4MGK E;  3DPU A;  4G7H F;  5CYV A;  4PZJ A;  2F2C A;  2ZBK A;  3BY6 A;  4OU0 A;  4IBJ A;  2ECC A;  2ETH A;  2DXC B;  4TV7 A;  4A3D J;  2D1H A;  2HNH A;  1UGR B;  2W4S A;  4LIV A;  3GME A;  3TP0 A;  1R6R A;  5C4X J;  2C5R A;  4P9U A;  1Z59 A;  2DT6 A;  3QPL A;  5B5E C;  3U6O A;  3VKG A;  1UGQ B;  1ETO A;  2VC0 A;  1C1K A;  2H8W A;  2MYS A;  3A0H C;  3CUQ C;  1FEX A;  1R36 A;  1W0T A;  3M1C A;  2R5Y B;  1AWC A;  2DDA A;  2KRU A;  2E34 A;  1HNX M;  1MZB A;  3WTV C;  3RZO J;  4IBK A;  1AKH B;  4XKV A;  4BY7 X;  3FUV A;  3H5A A;  4EAT A;  3RZD J;  1Z5B A;  1IQP A;  3B74 A;  2JY6 B;  2L4M A;  3HC7 A;  1B8I A;  3A0B C;  4I02 A;  4WWC A;  1MSE C;  3EOC B;  4QPQ A;  4BBR J;  4IMY B;  4BCF B;  4X6A J;  3FUW A;  5DM6 F;  4P1W A;  4XSZ F;  4I2O A;  2L09 A;  2XRO A;  2W99 A;  1GV2 A;  1A5T A;  1VQ1 A;  1Y8G A;  4IBD A;  4D81 A;  2RGV A;  1EV7 A;  4HDU A;  1LNW A;  3FMQ A;  2ZJ2 A;  3K6G A;  4RLF A;  2JSP A;  5FGK B;  1VQ5 I;  2K85 A;  3HHX A;  2J5O A;  2FU4 A;  1WI9 A;  1G41 A;  1G3W A;  4HPQ A;  4C3H J;  2IS1 A;  1GJT A;  4JXJ A;  4FD2 A;  4EC8 B;  2R4J A;  2K9D A;  1SD5 A;  2E1M B;  2WV0 A;  3H5N A;  4XNF A;  3LQQ A;  1K82 A;  3EID B;  3M03 A;  4EOK B;  3MIA B;  4M3B A;  4H4K C;  3FK6 A;  4ZYG A;  2OCC H;  3IHP A;  2NXN B;  2PHG A;  3CME I;  2A05 A;  2O3F A;  1NHG C;  1MSF C;  5FKM A;  1BW6 A;  1ODD A;  4DV7 M;  1U6G A;  4KOD A;  3HIF A;  3GPU A;  2OO9 A;  2K27 A;  1OCZ H;  5H6R A;  5BS6 A;  1MMG A;  4MO7 A;  4GH9 A;  3MMP A;  3BBZ A;  2QVO A;  3JR9 A;  1BC8 C;  5JLX A;  2HHH M;  2D7G A;  2M30 A;  2RAE A;  5E26 A;  2XHK A;  1T3T A;  2R45 A;  1NG7 A;  3AOG A;  3GLG B;  1IZ1 A;  2L01 A;  1VDD A;  3CO7 C;  2F5F A;  2MLG A;  2DD4 B;  1KU3 A;  2DAM A;  3NBI A;  5I5Z B;  4FM4 B;  5H37 D;  1H9T A;  4IHT A;  1N33 M;  3CP8 A;  2WSF F;  2GXG A;  1NV9 A;  1G8P A;  2F5N A;  1XNQ M;  1ULY A;  1H28 B;  3JR5 A;  4DYQ A;  4DV0 M;  3IV5 A;  2DI0 A;  2M8G X;  3HXL A;  2JZ1 A;  3HGI A;  2E7W A;  1I6H J;  2LY2 A;  1E3O C;  5EEH A;  2CFO A;  4BE0 A;  2Z16 A;  4D9J A;  1XMQ M;  3VOD A;  2HKO A;  1LE8 B;  3KVW A;  4GXO A;  3BHT B;  3C3E A;  1G3Y A;  4EVI A;  1AUA A;  2EFO A;  2P5T A;  5F08 A;  3K4J A;  1H1P B;  1BIB A;  1J0R A;  3FKJ A;  2X4A A;  4BCN D;  2XF6 A;  2EIM H;  1JQJ C;  2CGP A;  5JFR A;  3PXG A;  4L5E A;  3FM3 A;  2Y20 A;  4PJL A;  4BXX J;  1IY2 A;  1YS6 A;  2TRT A;  1OAO C;  3RQ4 A;  2IA2 A;  2CCI B;  4A3B J;  5E3M A;  4GIP A;  4G4O A;  4OGR B;  3UKG A;  4ZTJ A;  3ECH A;  2R44 A;  3H0D A;  2DPP B;  2HL7 A;  5IYC J;  2FQ3 A;  3L28 A;  4F6U B;  1X1P A;  5EZH A;  3I9V 2;  2XFT A;  2LP0 A;  4EM0 B;  3G6E I;  4ROC A;  3TWK A;  1UST A;  1WIV A;  1JR3 A;  4REZ A;  4DR5 M;  4B3T M;  1KQ0 A;  3F92 A;  2DA6 A;  2JT1 A;  3S32 A;  1WJC A;  2EV5 A;  3BR6 A;  2OJE D;  2KL4 A;  1WH5 A;  3C2H A;  2HOS A;  2OPT A;  1SFX A;  1L1T A;  2C99 A;  3PFI A;  2DQL A;  1EFU B;  3RCO A;  4BH9 A;  1OR7 A;  2XLJ A;  3HJE A;  1ZAR A;  4QSH A;  1SXJ D;  3BQY A;  3D5S C;  1TP4 A;  4Y17 A;  2ZCF B;  4DW6 A;  4RAZ A;  1Q1V A;  1HW5 A;  4IL6 C;  2DJN A;  2DEN A;  3E97 A;  5ICF A;  2IT0 A;  2PX9 A;  4IBF A;  2LBF B;  3G4S I;  3KP0 E;  1D5Y A;  5CYI B;  2DVW B;  3N05 A;  4F7S B;  2ZTC A;  3U1D A;  3S16 J;  1MMN A;  2X1C A;  3MK6 A;  1FP2 A;  1ETV A;  1HT1 E;  2EZL A;  1TQP A;  3KLN A;  2Y0Q A;  3FBN B;  3LL7 A;  1W5T A;  1VEG A;  3J7Y J;  5L2W B;  1BBY A;  1GXQ A;  2WAQ A;  3T1Y M;  2O01 F;  4I81 A;  2LTP A;  4F1I A;  1K83 J;  3DQV C;  1D1C A;  1UB9 A;  2EK5 A;  1Y6I A;  2FE3 A;  2MAB A;  4HLX A;  3WHL A;  4AC0 A;  5M5X J;  5D5U B;  3K8Z A;  2BPM B;  3ZQJ A;  3NBX X;  1R23 A;  4M6Y A;  4HNU A;  1T38 A;  2FXA A;  4BCN B;  1J7K A;  3M6A A;  3QYG B;  3A42 A;  1REP C;  2E35 A;  3U6P A;  4B7F A;  1B6A A;  2HVQ A;  2J5P A;  3L1P A;  1BI1 A;  3TKY A;  1C9B A;  2J5Y A;  2WIP B;  2W9Z A;  2LR8 A;  2ZSI B;  3TO6 A;  1T95 A;  4UN0 A;  3T8R A;  3ZQQ A;  3S2H J;  2QKL B;  3BTC A;  2ME6 A;  2TDX A;  3KLO A;  3V76 A;  2XDV A;  2VQF M;  2H94 A;  2XSJ C;  4YOZ A;  2E19 A;  1XMA A;  5E3L A;  4HL4 A;  5IT9 S;  5D4S A;  3KFW X;  4KT6 A;  3DXJ F;  2R46 A;  3TW6 A;  2O8X A;  2L9R A;  3UK6 A;  2ZTD A;  4WP2 A;  3F8N A;  3MZY A;  1R5I D;  3IKV A;  4AKG A;  3RKY A;  3WHK A;  1DGH A;  3HKP A;  3CCM I;  1S8N A;  2I40 B;  1IXS B;  2ZME B;  3O2P E;  4JI3 M;  4B7G A;  2RNJ A;  2VE9 A;  2I10 A;  2K9S A;  4EON B;  1SXJ B;  2Y48 A;  2B7E A;  3TGN A;  1TNT A;  3W2V A;  1N78 A;  3CCR I;  1MBF A;  1ZRD A;  3SYT A;  3K10 A;  2NVY J;  1UM8 A;  1NVM A;  2RRE A;  5M3F J;  2WEV B;  4I7H A;  4FQG A;  4FCW A;  1E9R A;  3DP7 A;  5CVJ A;  3SYK A;  3KEO A;  2WXV B;  3J81 Z;  3EYI A;  2QPA A;  1XG1 A;  2DWZ B;  4CGZ A;  4Q4Z F;  2Q1Z B;  2E2I J;  2E60 A;  3ERM A;  4PSW A;  3ZMD A;  3VDP A;  2BKZ B;  4MGZ E;  1HXD A;  1X1D A;  3A8G B;  4CFN B;  1IUF A;  4C2U A;  1FVV B;  1MN3 A;  1LJ9 A;  4LRT A;  4FCY A;  3BT9 A;  2X51 A;  1GV5 A;  3I5U A;  1U78 A;  1VQ8 I;  5E3O A;  4BBA A;  3RKW A;  3JRI A;  4LFC M;  2ZJP F;  1YLA A;  3SDG A;  5J1Y A;  2E2H J;  3LSM A;  4FWD A;  2CV2 A;  3BJO A;  4BHC A;  5GAH J;  2DK5 A;  1FIA A;  2MFZ A;  3MJ5 A;  2QGU A;  2L4E A;  2KIM A;  2QCO A;  4PJ0 C;  1IDY A;  4UB6 C;  4CFU B;  1RR8 C;  1JJ6 C;  2QA4 I;  1VQ6 I;  2IS2 A;  3RFW A;  4QWQ A;  3KE2 A;  4IXA A;  4EOS B;  2VQL A;  3N97 A;  4NC7 A;  4IRG A;  1GL7 A;  4BDZ A;  2IAI A;  1ZYR F;  2D2W A;  1X1B A;  1YRN B;  2L3D A;  4EJT A;  3QOD A;  1VZ0 A;  3ZCB B;  3LW5 F;  2RQQ A;  3KOZ E;  4ZC3 A;  2DKL A;  5LHI A;  4IHY A;  5B1B H;  5F0C A;  1VQ7 I;  2XUB A;  2ISZ A;  4GHA A;  1H25 B;  2QUF A;  2CQK A;  2WMA B;  3PNY A;  1BOB A;  2A68 F;  2JA8 J;  3HU3 A;  1BL0 A;  3OIO A;  1KYW A;  4M3G A;  3FDY A;  4BJ6 C;  1GAB A;  3ZQF A;  4ESB A;  3LNQ A;  2LKP A;  3JRG A;  2XV4 S;  4EIW A;  3DTK A;  3DLA A;  1RET A;  3Q5F A;  1Z5A A;  5GP9 A;  3CC4 I;  4NC8 A;  3OOP A;  4N4O B;  4BHB A;  1NH3 A;  4ZYD A;  1QDR A;  4QOZ C;  3K2L A;  4DV1 M;  2MJ5 B;  5KHD A;  3MD2 A;  4A3K J;  1T39 A;  2IA1 A;  1MJB A;  3AAF A;  1XSX A;  1FC3 A;  4RLQ A;  4ENM A;  1QZE A;  4I4L A;  2KRF A;  2Z4R A;  3TE6 A;  2F5D A;  1C0W A;  3VYR B;  1I1G A;  2M2E A;  2CZ7 B;  4HA8 A;  1U3E M;  1ETQ A;  1H6U A;  2L7H A;  4M9S A;  1J2X A;  1WCM J;  2XAH A;  4MGI E;  4GO1 A;  1MKM A;  3CMA I;  1TLH B;  3LOC A;  1XB4 A;  2X1E A;  5LGT A;  2XSD C;  2E1O A;  1X2M A;  3PNT A;  1KYI A;  5IT9 K;  1W7P D;  4XLA A;  1XMX A;  1U2W A;  2WPA B;  4QNM A;  3GUD A;  3ILK A;  2KZU A;  1LVK A;  3L2W A;  2X85 A;  3I4M J;  3FYD A;  2DWL A;  1XC5 A;  3V4G A;  2AHQ A;  1MBK A;  1LDJ A;  3EYY A;  3FRI A;  2LSO A;  5K5O A;  4EOQ B;  5C18 A;  1NTC A;  3N4M A;  4II5 B;  2Z8Y M;  5ITU A;  2CV1 A;  1JXS A;  1FWZ A;  1WPK A;  3NRV A;  2M87 A;  2GZW A;  3UR3 C;  2QKM B;  3A8M B;  2K9N A;  3AOE C;  4W97 A;  3HBL A;  3OIQ A;  3DCF A;  4BCQ D;  2ZNZ A;  4YFX F;  4YY3 M;  5HLG A;  2R7Q A;  1MDM B;  3ZP5 A;  4G3O A;  2MR9 A;  4B3S M;  4BGD A;  2AO9 A;  1O9K B;  2OZU A;  1BOA A;  4WXC A;  3BXW A;  3M3Y J;  2X0L A;  3DFZ A;  2QQB A;  4MQ9 F;  5TJJ A;  3WTZ A;  4BY1 X;  2K5C A;  2VPL A;  5HBJ B;  2ECB A;  4F3Q A;  3PQK A;  1OJL A;  3QYE A;  4X64 M;  4QIW N;  2GQF A;  2CQ7 A;  2JPB A;  4BJ5 C;  2OV7 A;  3K2A A;  4WCG A;  5LD2 C;  4ZPX A;  1TWA J;  1GVD A;  2LKS A;  3ZMT A;  1VEJ A;  3T1H M;  1MD0 A;  1KQ9 A;  2HFH A;  3E21 A;  1J9I A;  2Y69 H;  2EBI A;  4JYK A;  3FXU A;  5D8K B;  1I50 J;  2CFX A;  1G4A E;  2LH9 A;  4BKX A;  3HOS A;  3OYD A;  5KPR A;  3GLF E;  1HKT A;  4S05 A;  1YIT I;  1Z6T A;  1P7I A;  4Y33 A;  2LH0 A;  1XSD A;  5H20 A;  1A5J A;  7CAT A;  2GQQ A;  4PJM A;  4CA0 A;  2CHG A;  3BTL A;  2AHM A;  2G9W A;  1I4W A;  1ORK A;  2KNA A;  3GFJ A;  3I4P A;  3MKL A;  4LIT A;  3T8T A;  2VF7 A;  4P16 A;  2W7N A;  1W1W E;  4IEJ A;  5DTD A;  5B3S H;  1RNL A;  1VQ4 I;  3MY1 B;  2K9L A;  3U2R A;  1ZG3 A;  3FRH A;  5EXT A;  2H6C A;  4LB5 A;  4DV5 M;  5IWA M;  2CQX A;  3OIP A;  4HOB A;  4CZC A;  1PUF B;  1IV6 A;  2LVS A;  1DV0 A;  4KYW A;  1P92 A;  5CPR B;  1WGL A;  3V7R A;  2D5V A;  2H1R A;  5M5Y J;  3SHG B;  5KPT A;  2NNN A;  3HHZ A;  5HLH A;  3V7S A;  3KHI A;  1FYL A;  3KDS E;  4G6Z A;  4XOP A;  1O3Q A;  4CH7 A;  4N0B A;  4F55 A;  5J47 A;  2LC2 A;  1PRB A;  2C98 A;  2P6S A;  2IEK A;  4BCQ B;  3KP5 A;  3LQ5 B;  3SFI A;  1O7F A;  3CMY A;  3KZZ A;  1GY3 B;  3U61 A;  1QAN A;  2E1M C;  2F2E A;  1WJD A;  3WTU C;  3KW6 A;  4MGH A;  3VKH A;  4ANR A;  1S7E A;  2FUG 2;  1OFH A;  1U9N A;  2BV6 A;  2ZXJ A;  2MSY A;  4F6S B;  1GJS A;  1JT6 A;  3GLL A;  3HOX J;  2R4E A;  1JKR C;  1P9Q C;  3O6B B;  2YU9 J;  2IW8 B;  1XX5 A;  1MX0 A;  1XWI A;  4UUT A;  4DUZ M;  5ILU A;  3TN8 B;  1BU2 A;  2HPM A;  2DMT A;  2C5V B;  3K7A M;  5E3N A;  3EDP A;  2X49 A;  3CZ6 A;  3RIR A;  3BPV A;  1K78 B;  2AS5 F;  3CLO A;  2YQZ A;  3E4R A;  1ITY A;  1K3W A;  4OIO F;  3CTW B;  4YFK F;  5IPA A;  2HDD A;  5IDN B;  4OAY A;  4NNJ A;  2NS0 A;  2XAJ A;  1NK2 P;  2DA7 A;  3B6C A;  2VBZ A;  1ZRF A;  4LZZ A;  4GYG A;  2JSC A;  2R7D A;  1PDN C;  5GPC A;  4GC5 A;  1TH4 A;  2FNA A;  3GTP J;  5E1Z B;  3CC7 I;  2MW8 A;  2GBY A;  3DDP B;  5D6E A;  3QYB A;  2VJ4 A;  5FJ8 J;  4ETS A;  4HF0 A;  2C5O B;  2UWM A;  3U6E A;  2L7F P;  1R5L A;  2DYR H;  2VLA A;  4D1Q A;  1ON2 A;  4UB8 C;  4DGW B;  2WB1 N;  3H5R A;  5LQF B;  4CYD A;  2R92 J;  2PJQ A;  2W48 A;  4E70 A;  3UNG C;  3L2Q A;  3G3Z A;  4FX4 A;  1KXU A;  1FZP B;  1Z5C A;  1QHH D;  5LEK A;  2VQE M;  2FOK A;  1POG A;  2STW A;  1U5T B;  1ONV A;  2VC1 A;  1IRZ A;  4L5I A;  4B48 A;  2D0Q B;  5F0H A;  1YSY A;  4AKI A;  2IW6 B;  1QPI A;  3A02 A;  2FFJ A;  2ELH A;  2FRH A;  2OOB A;  1HQY E;  1Y8Q B;  1FIP A;  1DQU A;  4LJ9 A;  3NAU A;  1E9H B;  4L78 A;  5FLX K;  2KW0 A;  2R7O A;  2ERC A;  5ITQ A;  2XF5 A;  2DWN A;  1OKS A;  2HWJ A;  1Z67 A;  3BLY A;  1QVR A;  5DYM A;  1FX7 A;  1HBX G;  1FOX A;  3X20 B;  4PJN A;  2DAK A;  1G3S A;  2HQR A;  5DEQ A;  3U1K A;  4X0G A;  2FBI A;  1VF9 A;  3K1P A;  2H6B A;  1QLB A;  4FVM A;  4BCG B;  4KO8 A;  2F4M B;  1G8X A;  4D82 A;  4L5J A;  5EGO A;  2M5W A;  1Q02 A;  4DR7 M;  3TQN A;  2KXE A;  4DNC A;  1XDS A;  5HDK A;  4XON A;  3WVE B;  2A6H F;  4LOC A;  4ANJ A;  1T6S A;  5CVR A;  2O8K A;  2UZD B;  4CFM B;  3WHC A;  2K9M A;  3S2W A;  4OIQ F;  2XAQ A;  3A01 A;  1JKO C;  1Y56 A;  2MRO B;  3HJS A;  2W85 A;  4U0Y A;  1EKE A;  1KA8 A;  1NHW C;  2V22 B;  1D1A A;  3NWL A;  5HNB B;  2C5N B;  4OX9 M;  3HJ8 A;  4IJA A;  4U0V A;  2BS2 A;  1H1R B;  1HCR A;  1DGG A;  1B4A A;  2VF8 A;  1Y39 A;  2ZAO A;  3DKY A;  4P55 A;  4CGY B;  2GLO A;  3O0G D;  2K9Q A;  2O0Y A;  4RAY A;  1E17 A;  3KOW E;  2QHO B;  3I53 A;  5ILV A;  2EIN H;  3J7A S;  2N8G A;  3G1O A;  3KZI C;  3DEU A;  4LGY A;  5EG0 A;  4PDI A;  3S14 J;  1MJA A;  1MMS A;  1HT2 E;  1X4P A;  1HW1 A;  4F7N B;  4AZF A;  1D8J A;  5FB2 A;  4CHT B;  1R00 A;  3FXQ A;  2MG4 A;  3IC7 A;  5J6X A;  1HOM A;  4RM3 A;  1D0K A;  3KFU G;  3E6M A;  2QEN A;  1W5S A;  3IG5 A;  2LRD A;  5H2F C;  2E71 A;  2OAZ A;  2RDP A;  3LA3 A;  1PJJ A;  4WK8 F;  1AOY A;  1TFB A;  4L16 A;  2C6Y A;  2ZAN A;  3GEZ A;  1L2D A;  3CUQ A;  4BJT A;  3ERE D;  4DV6 M;  2BWE A;  2GOM A;  1JR3 D;  3S17 J;  2R7X A;  1VOL A;  4EOR B;  1A31 A;  2KFD A;  5FRN A;  4FCT A;  4LJZ F;  4R1H A;  3I4V A;  2NS7 A;  2AQE A;  3CCS I;  2KDL A;  2PMZ A;  4PGH A;  2LHC A;  2M5Z A;  5J4V A;  4E7L A;  3S1N J;  2GXB A;  2ZME C;  4DR2 M;  1KU2 A;  3AG4 H;  4BXF A;  4EOJ B;  2XAU A;  2R7W A;  3FUX A;  4MEX F;  3FXK A;  3LVW A;  5BR8 M;  4IJE A;  5IHY A;  3ZRG A;  3S3N A;  1SXJ C;  2DFF A;  4IRI A;  1QVT A; 
#chains in the Genus database with same CATH homology
 2VB6 A;  2E5N A;  3KYL A;  4H4K C;  3ZCO A;  4BUP A;  4BE2 A;  3VYH B;  3H9Q A;  2IS4 A;  2IS6 A;  4C30 A;  1WJF A;  4J01 A;  1MMG A;  1V5G A;  4ZJZ A;  2WAD A;  2JVH A;  1X1A A;  3EUH C;  4U87 A;  1NG7 A;  4HNV A;  5KCM A;  1AHJ B;  1E7P A;  2DD4 B;  2VAS A;  2AHJ B;  1W36 C;  4FM4 B;  3D5L A;  3OYL A;  4F92 B;  2M4G A;  1MNE A;  3CP8 A;  3A4C A;  3BG7 A;  4F91 B;  3MKZ A;  4PUS A;  2UUZ A;  2Q2E B;  3VWB A;  2R4G A;  4Z6Y A;  3HXL A;  4GRI A;  1UGP B;  2HU9 A;  2LY2 A;  3OMY A;  1ZEL A;  4BE0 A;  2CFO A;  2F4I A;  2LG4 A;  2Z16 A;  4D9J A;  2VXD A;  3C2G A;  2R7S A;  3IP4 B;  4ZDP A;  4XN3 A;  4BEH B;  5LFA A;  2ZPE B;  2JVG A;  1LDK B;  2IGM A;  3K4J A;  1DP3 A;  3FKJ A;  3QYF A;  2XF6 A;  3BG5 A;  3K70 D;  3TBI A;  1K6Y A;  3W2W A;  1YX3 A;  3KEY A;  4PJL A;  3VSL A;  3HL2 A;  3RQ4 A;  2VJI A;  3MKY B;  3LFU A;  4QPO A;  3AKZ A;  4ZTJ A;  3X26 B;  1PYV A;  3TMO A;  4E7Z A;  3H0D A;  2DPP B;  2Y0S A;  4AU7 A;  4II2 A;  4OAZ A;  1AA7 A;  3I9V 2;  3SEZ A;  4BEH A;  4ZDO A;  3ZXS A;  4MFE A;  3OYK A;  3BCA A;  3S32 A;  1WJC A;  3EUK L;  4E7S A;  4BU2 A;  2KMG A;  2KL4 A;  2CZ6 B;  3C2H A;  2JUG A;  4HRI A;  3PJR A;  4PJJ A;  3RCO A;  2WY7 Q;  3IUO A;  2Z1D A;  4BL0 B;  3VYT B;  4QSH A;  4RMN A;  2UV1 A;  4JOM A;  3D5S C;  4R79 A;  2ZCF B;  3HG9 A;  1IRX A;  3ZR8 X;  2VJJ A;  2ZPF B;  3A1Y A;  2LBF B;  3X25 B;  3W3C A;  5KNL A;  1UG0 A;  1WJ5 A;  3ZGK A;  4ITV A;  1BR2 A;  3N05 A;  3KX2 A;  3OY9 A;  4FET A;  1MMN A;  2X1C A;  3EUA A;  3NWS A;  3LL7 A;  4B47 A;  3FBN B;  2DOA A;  3A8L B;  1UEL B;  3A8H B;  2WAQ A;  4Y3O A;  2M0M A;  4ZGE B;  4AVZ A;  3DQV C;  4BE1 A;  3L2W A;  1D1C A;  2R7R A;  2ZZD B;  1Y6I A;  2CH0 A;  2MAB A;  4ZYA A;  2LBF A;  4HNU A;  1Z3X A;  2QF7 A;  3QYG B;  2KRC A;  2WAF A;  2HVQ A;  3K4L A;  2ZSI B;  1T95 A;  3ZQQ A;  4C9Y A;  2QKL B;  3H9G A;  1DGR M;  4P5O A;  2VQC A;  1QU3 A;  2XDV A;  4B3X A;  2L2O A;  3HKZ A;  2XSJ C;  3X28 B;  2ZPG B;  4PFO A;  4HL4 A;  3OYB A;  4II3 A;  4KT6 A;  3TW6 A;  5CKT A;  5HNF A;  2L9S A;  3LSK A;  2CW8 A;  1Z21 A;  4LG3 A;  4AKG A;  4XLE A;  3DTE A;  4JX6 A;  4CCK A;  4ELJ A;  1X1C A;  4E7I A;  2OUM A;  4CCM A;  3OYE A;  2L9N A;  3MKW B;  3W2V A;  3HHT B;  1N78 A;  4E6K G;  2L5Q A;  1NG6 A;  3SYT A;  3K10 A;  4J00 A;  4C2T A;  3L2R A;  2WJ9 A;  2RRE A;  1FMV A;  3OYH A;  3L2V A;  4BQO A;  4PFP A;  2Q1Z B;  2E60 A;  4PSW A;  3E0J B;  1X1D A;  3S3M A;  3H35 A;  2DXB B;  3A8G B;  4C2U A;  2IGN A;  3IAM 2;  1TT0 A;  2ZXI A;  2BVL A;  2X51 A;  3OYF A;  3GBG A;  3LSM A;  4RM2 A;  2V26 A;  2CV2 A;  2CZ1 B;  2MFZ A;  4DJA A;  3CJQ B;  1PJR A;  2HVR A;  3G2B A;  2IS2 A;  4XQF A;  1HA8 A;  2CUJ A;  2VQL A;  4BQQ A;  4JX4 A;  4NC7 A;  4BS9 A;  4BDZ A;  3H4C A;  1G59 A;  3HPG A;  2HVS A;  3BCB A;  1X1B A;  2V7F A;  3LSI A;  3LSH A;  1VZ0 A;  3QOD A;  2RQQ A;  4ZC3 A;  3DPT A;  1T0F C;  4BAC A;  3ONQ A;  1BOB A;  3PNY A;  5HOO A;  4HLQ A;  3FDY A;  4BJ6 C;  4OB2 B;  2M4K A;  4JQF A;  4XLC A;  3HOT A;  1MW7 A;  1V5F A;  4N4N B;  3DTK A;  3K4M A;  3DLA A;  2A5W A;  3SDB A;  3OYJ A;  2XC7 A;  4NC8 A;  4N4O B;  4ZTF A;  3DTI A;  2QFZ A;  4ZGD B;  2HPI A;  3CJR B;  4XOT A;  3QZ9 B;  5KHD A;  3MD2 A;  3AFH A;  4BBS M;  2BVM A;  4RLQ A;  3HUG B;  4JX5 A;  3OYA A;  3RSN A;  3BG6 A;  3PSF A;  2M7A A;  3VYR B;  3J7A Y;  4HNT A;  2ZPB B;  2LOO A;  3S8P A;  3CES A;  2CZ7 B;  1YX5 A;  3W2A A;  1BR4 A;  2V1N A;  2WBM A;  4XKW A;  3BC8 A;  2WA0 A;  2R7U A;  3SEQ A;  4E7J A;  1V5E A;  2X1E A;  2W1O A;  3PNT A;  1IRE B;  4OB0 B;  3OR1 C;  1X4O A;  3K4B A;  4XLA A;  1MMA A;  4HSR A;  3QXE B;  2KRH A;  2KP6 A;  2ZSH B;  3CF2 A;  1LVK A;  2M3A A;  2X85 A;  3DPL C;  4NC6 A;  3IAS 2;  4HST A;  3TW7 A;  1WJE A;  2DCE A;  2KZV A;  3QOE A;  4BBR M;  1Z3Y A;  2CV1 A;  4NUB A;  2WY8 Q;  3NWT A;  3RPU D;  3UR3 C;  2QKM B;  1QHG A;  4Y4R A;  3A8M B;  4YRV A;  2DJI A;  4U7B A;  3HBL A;  3OIQ A;  2GOX B;  3F9K A;  4MLO A;  3OS1 A;  2R7T A;  1MMD A;  1N77 A;  1MND A;  2L7K A;  2R7Q A;  5CQG A;  2X6Y A;  2CMP A;  4DIQ A;  4BGD A;  1W36 D;  1WJB A;  1UGS B;  4CUG A;  2K5C A;  3OR2 C;  2VPL A;  3PFY A;  2ZFU A;  3E1S A;  4F3Q A;  2IXS A;  4IZZ A;  3QZ5 B;  3VSK A;  3QYE A;  4ZGJ B;  2LY1 A;  4G6T B;  4BJ5 C;  4DBR A;  5LD2 C;  2OV7 A;  3X24 B;  1LKX A;  2CUZ A;  3RTR A;  3OL3 A;  4XMY A;  2KR6 A;  2VIX A;  2LH9 A;  2RNG A;  2CS3 A;  3HOS A;  2CV0 A;  1J09 A;  3K4N A;  1TZL A;  3OYD A;  1S9H A;  3OYI A;  4Y33 A;  2VKD A;  2VQG A;  2W00 A;  4KJZ A;  4PJM A;  4CA0 A;  4AI6 A;  3BG3 A;  4DOZ A;  3H9J A;  4DBQ A;  4LIT A;  2W7N A;  3OYN A;  1JI8 A;  4YEL A;  2WB1 A;  2K9L A;  4ZDL A;  2QDJ A;  2KPM A;  2BS3 A;  3PL8 A;  4CZC A;  1V29 B;  3OIP A;  1X19 A;  2P0W A;  3K4C A;  1EA3 A;  2BW3 B;  5CPR B;  4OB3 B;  3DU6 A;  3OL4 A;  4IQ4 A;  2W82 A;  2BOL A;  2VL8 A;  3K4K A;  4CCJ A;  1D0Y A;  2OC6 A;  3KHI A;  2O5R A;  5JHF A;  4XOP A;  4CH7 A;  4F55 A;  2LC2 A;  1D0X A;  2VJ5 A;  4B43 A;  3CP2 A;  4MFD A;  3HZJ A;  2HDW A;  4BQN A;  4XM3 A;  4IQJ A;  3OS0 A;  3AL0 C;  2ZXH A;  4YEJ A;  2E1M C;  2F6C A;  2BW3 A;  1WJD A;  2JA2 A;  3DKX A;  4CCN A;  3QWL A;  3VKH A;  3CMM A;  4P17 A;  2FUG 2;  3D5R C;  3OOU A;  1SFK A;  1WFX A;  4XKB A;  3SZG A;  3DL1 A;  1P9Q C;  4HEA 2;  1WJA A;  3PSI A;  4OWR B;  3H5N A;  2VKH A;  2QDY B;  2KLO A;  4NQW B;  2HPM A;  3OYM A;  3DU5 A;  3S93 A;  4MIM A;  4OB1 B;  1E0E A;  3CZ6 A;  4E7H A;  2V4J C;  4F93 B;  2ELJ A;  2KHM A;  4OAY A;  1FKM A;  4NNJ A;  4CSW A;  4E4H A;  2KQR A;  4PSX A;  5FRM A;  4XN0 A;  4IX7 A;  3A2K A;  2XF7 A;  3VYS B;  3EPZ A;  2PJR B;  2DD5 B;  3OYC A;  3FBI B;  3QYB A;  2V9K A;  2VJ4 A;  3HB9 A;  1UAA A;  2UWM A;  3TL4 X;  2VLA A;  4D1Q A;  2NOJ B;  4DGW B;  2CW7 A;  4HG2 A;  3H5R A;  4CCO A;  3LMM A;  4XLF A;  3UNG C;  3L2Q A;  3DEE A;  3HO8 A;  1D1B A;  3S3O A;  3PUB A;  2ZPH B;  3DWL E;  3OYG A;  1QHH D;  2PJR A;  3U21 A;  5FRO A;  4XL9 A;  4FAS D;  3MMY B;  4PK4 A;  4B48 A;  2D0Q B;  4AKI A;  1OLT A;  3I3L A;  2I8D A;  1OR7 C;  1DQU A;  1BR1 A;  2LRE A;  3HPH A;  3OWT A;  2KMU A;  2R7O A;  4XR6 A;  2CYZ B;  2XF5 A;  4XKC A;  3X20 B;  3BLY A;  3QYH B;  2VQH A;  4PJN A;  4XNF A;  3VDX A;  4X0G A;  1QLB A;  4KIS A;  4CCL A;  1G8X A;  2R7V A;  3VYU B;  2F5V A;  3L2U A;  1ERD A;  4AKH A;  4IKF A;  3WVE B;  4XON A;  5EJC A;  4AYB A;  1DGW Y;  1Z7L A;  2K3P A;  4LOC A;  2HZD A;  2X1D A;  4ANJ A;  3BG9 A;  2K9M A;  3VYG B;  5HLT A;  1KON A;  2X6W A;  5HNH A;  2Z2S B;  1Y56 A;  2HQA A;  3DPU A;  1FMW A;  2QQ8 A;  1SAU A;  1D1A A;  2DXC B;  3M8J A;  2HNH A;  1UGR B;  2BS2 A;  2W4S A;  4LIV A;  2IGO A;  3PNV A;  1R6R A;  1N75 A;  2AQF A;  2WAE A;  2DT6 A;  3DKY A;  4XOR A;  2E5Z A;  4LIU A;  3VKG A;  1UGQ B;  2MYS A;  3V42 A;  1D0Z A;  2MC4 A;  3M1C A;  3A8O B;  4E7K A;  2LYC A;  3K70 C;  2KDO A;  1LFP A;  1X4P A;  4KIT B;  1U0J A;  4XKV A;  3OS2 A;  2BS4 A;  2MD0 A;  3H5A A;  4RM3 A;  2ZPI B;  4EAT A;  2CZ0 B;  2LRD A;  2DT7 B;  3HC7 A;  4B44 A;  3WVD B;  2X6X A;  3FHN A;  4QPQ A;  4M6V A;  2A6T A;  4XLH A;  5HVQ C;  4BJT A;  5TGT A;  2GOM A;  4P1W A;  2R7X A;  2G77 A;  2M7B A;  2V6E A;  5FRN A;  2DXI A;  2IGK A;  4BDY A;  2AQE A;  3K6G A;  2PMZ A;  2JSP A;  4RLF A;  4F52 A;  4E7L A;  5CQE A;  2VXZ A;  3LSG A;  1YE9 A;  1GLN A;  4BXF A;  4HPQ A;  2XAU A;  2R7W A;  2IS1 A;  3AL0 B;  3ZRG A;  3S3N A;  2E1M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...