3QYBA

X-ray crystal structure of human tbc1d4 (as160) rabgap domain
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
297
structure length
297
Chain Sequence
b'HMKVKLDYEEVGACQKEVLITWDKKLLNCRAKIRCDMEDIHTLLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKELLKQLTAQQHAILVDLGRTFPTHPYFSVQLGPGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLHMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEISPSLYAAPWFLTLFASQFSLGFVARVFDIIFLQGTEVIFKVALSLLSSQETLIMECESFENIVEFLKNTLPDMNTSEMEKIITQVFEMDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TBC1 domain family member 4
publication title Crystal structures of human TBC1D1 and TBC1D4 (AS160) RabGTPase-activating protein (RabGAP) domains reveal critical elements for GLUT4 translocation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
total genus 91
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2011-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 3qybA02
1.10.10.2750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3qybA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3qybA03
4Z6YA 2QQ8A 3QYEA 2QFZA 3HZJA 4P17A 5EJCA 4HL4A 1FKMA 4NC6A 3QYBA 3QWLA 4HLQA 2G77A
chains in the Genus database with same CATH superfamily
3OS2A 4Z6YA 4ESBA 2DYSH 4EJWA 2ID6A 3HWSA 2KJCA 4A3CJ 3HHGA 4MFEA 4ROCA 1ZMWA 1SXJB 2ZPIB 4UB8C 3K4BA 1BW6A 2DMTA 2UZBB 3JRGA 1TW3A 1BI2A 4XOTA 3TW6A 3M03A 3K9TA 2MH2A 5FKKA 4YELA 4ON0A 2FA5A 3CO7C 1GH6B 3C3DA 3FRHA 2ID3A 3U6PA 4Y15A 3OYHA 4JP0A 2L0KA 3A8OB 2M45A 3ZH9B 2XKOA 1WJBA 2A5WA 4I76A 2DNAA 2WSFF 4OOIA 4FCTA 1Y0UA 4KIGA 3TWKA 3T38A 1ETVA 1HKSA 1Z91A 1WI3A 3A4CA 5DYGA 1BR2A 3E6CC 1SD4A 5FRMA 3SYKA 5KQ8A 2EZIA 2Z3XA 3D5SC 3MWMA 2VUMJ 4Y28F 3GTPJ 3DEEA 1H1RB 2R7GA 3G71I 4FE4A 5HNFA 3GXOA 5DTDA 4DUYM 4FWHA 4MM3B 4PK4A 3BG9A 1V34A 1FINB 3M3YJ 2VE9A 3FHZA 3PSFA 4G4OA 2DOFA 1OFIA 1H26B 2JTVA 2QCOA 3ZN1A 2PX9A 3SHFA 4AC0A 4KN7X 1FY7A 5EGOA 1G4AE 2GQQA 4AM3A 1LTMA 1J09A 3TWMA 4EIWA 2GXGA 3BG3A 2BY3A 5IT3A 4OB3B 2YX7A 1MBGA 1T98A 3RGSA 2Y0MA 4I09A 3DXJF 4AG6A 1Z59A 3L29A 4CYCB 1UHMA 3GEZA 2OPTA 3DBHB 4BS9A 2Q2EB 3LSMA 4FASD 2DI0A 1RI7A 3OYBA 1ZQ9A 4EOMB 2NOJB 1D1CA 2DA3A 3K7AM 1SVMA 2GZWA 1RIOH 2CUJA 5IT9S 3R0AA 2L4AA 2ZC2A 4LK1F 4MLOA 1F5TA 2X0LA 3G4SI 3I04M 2PN6A 4DV6M 3LMMA 3QYEA 1DGRM 1TQMA 4F7JB 3AOGA 2RNGA 5AONA 3SDGA 2G5GX 4M9XA 1IXRC 3KEQA 2QQ9A 1W1WE 4JK1X 1WVRA 2VOOA 5EZHA 4A93J 1S7EA 1K6OA 4NSTB 2I7NA 1MDMB 1X37A 2D45A 3L9FA 2AXLA 4AG5A 5DM7F 1JB0F 1IDZA 1QLBA 4BCNB 1R7JA 1F43A 3IRRA 4BACA 2DXIA 3HHYA 2KISA 4B7GA 5J6XA 1HBXG 3IWFA 2DVWB 4DYQA 4F93B 4N0BA 2W85A 4BY1X 5HBJB 2CRGA 1L2BA 2PK2A 3PSIA 1C9BA 1VQ1A 2BVMA 4I5SA 2D7EA 4RB1A 1XGMA 5L3EA 2X49A 3GLGA 3GPUA 4A3BJ 4D7MA 4LG0B 1S3SA 2VN2A 4RB3C 1OPCA 2R4JA 3EUAA 1K82A 1JGSA 1TTYA 2FQ3A 3T15A 5IDPB 5ILVA 5JVTA 2C9OA 3SEZA 1UGRB 1TWCJ 2GBYA 2Z2SB 1W7PB 5F64A 4UUSB 4HAMA 1T2KA 1N25A 3CCLI 1IM2A 1W5CC 2YR0A 1TWGJ 3E6MA 4B09A 5M5WJ 1CF7A 1K4TA 4O6JA 4YIRX 2OQ4A 4FX4A 3THGA 5ITRA 2ZXJA 4BUPA 2HS5A 2I5UA 4DZPA 5EDNA 4G7HF 1ZV1A 4AKGA 3LAPA 1S9HA 2KDZA 1SAXA 1UMQA 2R5YA 1MBJA 2DMUA 1LDKB 1DUXC 4A3LJ 2BZTA 2JGZB 5EP2A 4DR2M 2LKXA 1HCRA 4XSZF 1J7KA 3NBXX 4IJEA 2DKLA 4LZZA 3CJQB 1A6IA 3ZXSA 3ZOBA 2OTJI 3QXEB 5JLXA 3GLHE 1MD0A 4AW4A 3LA2A 4LJAA 4M3DA 5HS8A 3HUGB 2BY0A 3P9KA 4BLCA 1EKEA 5CKTA 1T3TA 3FXMA 2XZUA 1HNXM 3QPHA 1L3LA 1I27A 2Z9OA 3JR9A 4S12A 3SHGB 2PMHA 3I0TA 1ENWA 1OLTA 2J5OA 3I51A 3NWLA 4CFUB 1K3WA 2R7OA 3BJOA 3IAS2 1XXHE 2C98A 3GVAA 1G3SA 2PHGA 2X6WA 4OMZA 3ZMZA 3U9GA 1I1GA 2F5EA 1ZHFA 3KEYA 5EEAA 5KAIC 3WGIA 1NH3A 1FYMA 2O3FA 4HW0A 3RQIA 4O3MA 1LEBA 4WXHA 3A8GB 3OS1A 3SAVA 5L2WB 2LHGA 4ETSA 2QA4I 3JW4A 4RA2A 1ZRDA 1LB2A 1N78A 2NRAC 1J59A 3UMMA 1OJLA 1PJJA 4Y13A 3VYUB 4FTHA 5EP1A 1L1ZA 4FHTA 4U0WA 3NQOA 4HV5A 2GIVA 2R18A 1S5LC 1G8XA 1R4GA 2W7NA 5FLXS 2EFQA 3KXEC 3H5RA 4JX5A 2R5ZA 2JJ7A 3FK6A 3JAMZ 3D5LA 5K7ZA 5LMKB 1H0MA 1G41A 2M0CA 1Z21A 2BV6A 5J4VA 2Z4SA 3FD9A 1OFHA 4G12A 1BI1A 4E7HA 1H88C 1WIVA 1VI0A 2DFEA 5LQFB 4B7FA 1JJ6C 4G4NA 1U8BA 1H25B 2ZCWA 2YSRA 3DJBA 1NG7A 2JT1A 2QZ8A 4HF2A 1FVVB 4E7IA 3LFUA 4LG3A 4DR7M 4A69C 3BTJA 3OYGA 1O9KA 5E1ZB 2FNPA 3HHHA 4ZJZA 3E6DA 3I55I 3MHVC 2Y48A 1ZAEA 2DAKA 5F0CA 3ZCOA 4AVPA 3CO6C 3BBZA 3SXYA 3QHWB 1P5EB 3SYTA 3H9JA 2C96A 3FM3A 1JTXA 5IP7J 2WIPB 4E7KA 4A3MJ 4CHUA 1Q3CA 2GA1A 4XLHA 4C2UA 4NSRA 4WW0A 2DO7A 2ZXWH 3IWZA 2LWXA 3L7WA 2Y31A 5E1XA 1JR3D 2HQ5A 3P5JA 4BEHA 4BBSM 4Q5SF 4ANJA 3EOCB 2FMYA 3QYBA 5HDGA 5HOOA 3H4MA 2NNYA 1XG1A 1NHGC 3QZ9B 3DKXA 4W97A 2ZCFB 3H0GJ 3K4LA 4ZYGA 1MJGM 2K9SA 3L2WA 4BXXJ 1HKQA 1LE8B 3M7GA 3G1LA 2QVOA 3LOCA 3OOPA 4BBRJ 4ZYEA 5IP6A 3Q5FA 1JI8A 2C5OB 1L2DA 2L7KA 3BWGA 2AS5F 2OCCH 1YTYA 4BQQA 4CCJA 4Y17A 4DQ2A 4YFXF 4OIOF 3G33B 2EV5A 3GZ6A 2FBKA 3U6CA 1T95A 3OR1C 5CYVA 3HL2A 4PFOA 2E2HJ 1N77A 3L25A 2DZLA 5TISC 2O9LA 1MMNA 4ZH4F 4EOLB 1NK2P 3HHZA 5C3EJ 2H1LA 2V1UA 1T0FA 3ECHA 1JUPA 4BJTA 3RJPA 5EGOB 4NUBA 4FX3B 3ZMDA 1YO5C 2RC4A 3LNQA 2RKHA 3BTLA 3J81Z 3MKWB 5LHIA 2X6OA 2KZUA 5JLWA 5BPDA 3HX3A 1KU7A 2LVSA 3B57A 1Q39A 2F5OA 2DPDA 4ZC3A 3J80Z 1XMXA 4TTHA 4HNVA 1QMZB 1F4KA 4XRFA 3RYRA 2R7DA 4IL6C 5JR3A 3HGIA 3L2AA 1FOYA 4BL0B 4PJJA 2EIMH 1T0FC 2ZBKA 3OWTA 3T0YA 3OSFA 2XFTA 3KZIC 3GLHA 2F4VM 2HTJA 1VDDA 1TWFJ 4JI8M 5EJCA 1X3WB 4MIMA 5CVJA 3WTUC 2ELHA 3I4PA 3ZN0A 4II7A 2LK2A 4HNTA 4KLNA 1RKWA 3WHCA 3L28A 2A3SA 2N35A 1XTAA 2QNJA 2JVGA 2UZKA 3GZ5A 4IIWA 4YG2F 3RKXA 2UV1A 2UXNA 4B47A 1DQUA 1XXHA 4IOCF 1UNHD 4GFBA 5HLTA 3AOEA 3C1DA 3S14J 4ENMA 3CCSI 2D0QB 2CE7A 3HJEA 1R00A 3KYLA 3ZQIA 2R0QC 1VQNI 2UZDB 1OQYA 1MNMC 3K69A 1F36A 3IKTA 2O01F 3FXRA 2FFJA 4GKJM 1HW1A 2XUBA 1VQ4I 3V8LA 2OD5A 3GFMA 3HOVJ 4A6EA 3IH4A 2F5NA 1SFOJ 1VEGA 5J1RA 4II3A 1IRXA 1Z7UA 1DPUA 3AOEC 1E3OC 1MX0A 2ADUA 3WHBA 1ACIA 2LC2A 3WU2C 4ZDOA 2MG4A 1Y0NA 2CYYA 3S2HJ 4LF8M 2ECCA 2JUCA 1BC7C 2CGPA 1PVEA 4GEWA 4GGGA 4O5VA 4NHJA 3BHTB 4K0KM 1SFUA 3SQNA 2C5NB 4BKXA 3A1YA 5FJ8J 6PAXA 5KPRA 2GAUA 2X1EA 1FMVA 1QZMA 2CUEA 4CO8A 1U78A 1CF7B 3HSRA 1FYKA 2UZEB 3A8LB 2K47A 2L09A 1H1QB 1OI9B 3OIPA 1W0TA 1BU2A 2PFBA 1USSA 3C18A 2IA0A 4L16A 1TWHJ 4J19A 2R5YB 3B02A 1IBLM 4QOZC 1BN5A 5B1AH 1QPMA 2P81A 3OYCA 3UKGA 3MK6A 1WWXA 4CRLB 3AAFA 4EOKB 3MD2A 5H6RA 4XRSG 3J81K 4P96A 4OB0B 4A0YA 4BJ6C 5HQ0B 2ZANA 2EJRA 1H9GA 5LHHA 4DYCA 2K9NA 3J80K 1MBKA 3K7AJ 1ZP2A 4A3GJ 4L78A 3QAUA 1DGGA 2FRHA 3L2UA 3A01B 1V33A 1T08B 2E60A 2ZJPF 4AUXA 2CUZA 2F4MB 1BA5A 4DV3M 2QUFA 5AIQA 5HBHB 5C4JJ 2XSJC 5TJJA 4L5IA 3HOTA 1WI9A 3OYLA 5K7FA 4BDZA 5IDNB 4F91B 1J5EM 5IT9Z 2VQEM 3S2DJ 4DV5M 4EV0A 1J0RA 4PJLA 4X0GA 3VYHB 3GQ5A 3S15J 2CJMB 2X1CA 1WJFA 4HF0A 3V7CA 2DPUA 1TLHB 3T5XA 4KMFA 3PO3S 3RPUA 2HAKA 5FGKB 2RKOA 3WTYC 1JKOC 1AOYA 3PIOF 2R3SA 5GPAA 1R4NB 3MCZA 1LVKA 1GT0C 1SMTA 2LDUA 3OMYA 4S0HB 2R5ZB 2FBHA 1GJSA 2Z5UA 1HSJA 5TGTA 1O7FA 4R1HA 1I4WA 3BZCA 1K4SA 3POMA 4G7OF 4EONB 1WZ2A 1Z77A 2AQFA 3ASOH 2A68F 4XIDA 2HDCA 3SBJA 2HGCA 2C5VB 3I64A 3SDBA 2IXSA 3QHRB 4LGMA 1YIOA 4NDLA 3G2BA 1X2NA 4WWCA 4GMQA 3L1PA 4F92B 4EGYA 2BHZA 3LSHA 5FFXA 2EUFA 4CDGA 2XF6A 4XKVA 1O9KB 1X1PA 3HJQA 3ZQLA 5IREB 2ZXIA 4XK4A 3CF5F 2WAFA 4F1IA 1OKWB 4F6UB 2E34A 1BR1A 3GLFE 1WGXA 5JFRA 2ZO4A 1B6AA 2IEKA 4P1WA 3BC8A 2IN3A 4FETA 2Y2ZA 3FF5A 5IOZA 4UN0A 2E5ZA 2PBIA 3JREA 3K9PA 4DR3M 1FBSA 4CFWB 1YIJI 1FBUA 4DBQA 2Y0SA 1KU3A 4XBOA 2A05A 2DFIA 5F27A 1Y1VJ 5DM6F 3LWFA 3BPVA 2XGEA 3D0SA 1DGFA 4B3AA 4CFUD 1A5TA 1T56A 3VKGA 1R6RA 4F55A 4NXNM 3PM1A 3ZGKA 4XBFA 5FLVA 4IJFA 3OY9A 3BDDA 3FXKA 2HKOA 1K78A 2W57A 4NSOB 3K6GA 2DENA 4DBGB 4DV7M 3GO5A 2FJ1A 2XGNA 4ESJA 2DLLA 3KEOA 2X85A 3CCVI 5CYIB 4AKHA 2KIFA 1OTRA 3ZMUA 2HEOA 2AHMA 4UVBA 3TBIA 3LA7A 1ETXA 5FKNA 3AG1H 4D0PA 2OQGA 2JMWA 3BR0A 3FUXA 4HQEA 3CUQA 3IP4B 4OWRB 4NXMM 3KP6A 3WTTC 1HSTA 2CV0A 5DUKA 3MAJA 5ILSA 4L9VA 2LVPC 4F3QA 3MKZA 2D1HA 5F6FA 3RKQA 5IT9K 4A2UA 4UXNA 3RGPA 3K1PA 3V8JA 2XB5A 4I4LA 1JT6A 4NL4H 4BHPA 3B6CA 5DD4A 4M3GA 2JZYA 1O3SA 2E36A 5E26A 3OS0A 4XRMA 3V42A 4FISA 3CGWA 2CS3A 3HC7A 5FKOA 3CUQC 5IPAA 1BW5A 3COAC 5FROA 1FTTA 3BR6A 3FUTA 2PMZA 3O3KA 4MGRA 5FLXZ 2IGMA 4IMYB 2ZBKB 8CATA 2F5SA 3LCVB 3T1YM 1X3ZB 2CG4A 2JN6A 2WA0A 3GFJA 3GLHB 2LHCA 3MN2A 2OBPA 2LH0A 3BR3A 2ACJA 2H8WA 2LFBA 4DR4M 2BWEA 1OCPA 3HRSA 3WTZA 2TRTA 1P92A 2K02A 4AQYM 2Z16A 4F7NB 2C5XB 2UXCM 2JWSA 5H20A 4ZYAA 5KO3A 2XLJA 1I3QJ 2KHMA 5LGNA 4G7ZF 2UXDM 3T8TA 2ELKA 3DWLE 1NG6A 5GAHJ 3DOAA 1Z0XA 4I98B 4XLPF 2EO2A 4M9SA 3I54A 3RI4A 1XXHB 4HSTA 4JX4A 2Q2EA 4XN3A 1K7AA 2JA5J 1U9OA 2VT3A 3TOAA 1T8IA 1VF9A 1YW8A 3V7RA 3GPYA 3EQLF 3MEXA 1ZKGA 1AA7A 1WH7A 1YS6A 4V2GA 4UV8A 5HLIA 2A5YB 2DK8A 2FOWA 2IP2A 4MQVA 4D5CA 4ZYDA 1YI2I 4FVMA 3HHXA 3F8CA 3QYFA 2UXBM 2V7FA 3CJNA 4M73A 4I81A 2WAQA 5LMNM 3KS8A 5FTMA 2CFOA 4RB2C 4EM2A 3K1NA 3KDSE 3QP5A 3H3ZA 4A5NA 1UGSB 5FGMA 2FX0A 1JJ8C 2K0BX 5LMUM 1X2MA 4LFAM 2J7NA 2M5WA 4NNJA 4Q48A 2R7SA 3VEPA 4C3HJ 4CCLA 3QPLA 4YIIA 1F4IA 4XKWA 1RNLA 4YIFA 3I4MJ 2M8GX 1OCZH 1TQPA 4RS8A 2XHKA 3HO8A 4LF9M 1FSEA 1WSUA 4FWGA 2EA2A 2R7RA 3ELKA 3U1DA 1IC8A 1R1TA 3BR2A 5LLQA 3PO2J 1E32A 2KXEA 4MO7A 1E9HB 4M0DA 3GLFA 2WZJA 4A3FJ 1B8IA 1YITI 1N32M 3FTDA 1SEUA 1FIAA 5BPIA 2M60A 2HQNA 3IAM2 4BE0A 4HLQA 1WQ2A 1EIJA 1IFYA 2LVOC 4FCVA 1U0JA 1W7PA 2KZSA 2HXOA 2L02A 1R7RA 3DKYA 3ZQJA 3GUDA 4XLNF 1O7LA 1AKHA 1QRYA 2XH9A 1JOWA 3ABUA 5J4YA 1O4XA 2R46A 1R58A 4F2LA 1NHWC 3F8FA 1N33M 1F9NA 3ESWB 1FX7A 4S04A 1I5ZA 3QYGB 4HZFA 5ILUA 3GBGA 2XEPA 3LSRA 3A2KA 5FLXK 1YX5A 3CF2A 2DXBB 3ML6A 3CTWB 4II2A 1R6BX 3FUWA 3KW6A 1E0EA 3J7BA 4DZJA 2IJLA 4F52A 3GW2A 4QOSA 2VF8A 2ME0A 1IUYA 3TDUC 3KPHA 2XF3A 2V26A 3DBRB 4ITVA 2WY8Q 4NQWB 4Z8XA 1IAWA 2HVQA 2RREA 2CQ7A 5BNGA 5E17F 4RLQA 1W4MA 2WAEA 1XCVA 3DKWA 1P4AA 1JKRC 1V3FA 3K9OA 1FMWA 3V8KA 4A3JJ 2PMZN 1KGSA 1GXPA 4ZGDB 2XC7A 4BHBA 2F5PA 3U6SA 4P16A 1CGPA 2CCHB 4FWDA 5ICEA 2H1KA 1B9NA 5CLSA 1ZGWA 2FBIA 2FSWA 1HQCA 1ERDA 2K3FA 2R45A 3W0LB 3SASA 1VQ9I 4GH9A 2JXNA 1NVMA 4AIDA 2EPFA 2L3DA 1IN7A 3KHIA 1H28B 3P9IA 2PMUA 3JCUC 1ZG3A 3PUFA 4C9YA 1ZR2A 3R9XB 3KP1E 3L2QA 4HDUA 1PJTA 2DU9A 1Z6RA 5C18A 2KNZA 2VC1A 1ZLJA 2GOXB 3QAHA 9ANTA 2L2DA 4S05A 4RODA 4LOCA 2HQRA 3AG3H 3LAJA 2L9NA 1J5YA 3F8BA 5F3WA 4XLAA 3TEDA 1GUXA 2GM4A 1QDRA 1IJWC 2LREA 3H9QA 4EJOA 1DV0A 2JRMA 1WCMJ 3R6SA 3IECA 1MJBA 2EFNA 2BW3A 2I8DA 3BLYA 4NC6A 1QGPA 3M0EA 2XGDA 3HGYA 4I99C 1I39A 1Y8QB 3QOEA 2C99A 3GRRA 4AU7A 4WX9A 2EZLA 2VBXA 1LFUP 2XRNA 1XGNA 4XRSA 1U3EM 2IW8B 1ORKA 1IRZA 1QUSA 1L2CA 4E7JA 1U5TA 4YHHM 2XAGA 2Y9YA 3FRIA 4MGYE 1OCCH 5LD2C 2I53A 4CISA 4LK0F 1OCTC 1K78B 2VE8A 4EM1A 4BYYA 1QHHD 4N4NB 2WMBB 3HRUA 4KO8A 3SAUA 3GF2A 1FYLA 1L0OC 4I3ZB 4G4RA 1D8KA 1X3UA 3CUQB 4Y52J 3R4KA 5F0FA 5DS9A 5K1YA 2CQNA 5ERIA 1GHCA 3MIAB 3SAWA 1AUAA 5B3SH 1LE8A 2KRCA 1R5LA 3E1SA 3CDIA 4E7LA 1ONVA 1P9QC 2QEXI 3EYIA 1H4LD 3SZGA 1S6LA 2OA4A 2XPUA 4DV0M 1NNJA 5E79C 1FOKA 1Z67A 3TOBA 1ZTRA 4FE7A 3SFIA 3C3EA 3FTCA 2FE3A 3GTOJ 4ZTJA 2L6OA 3C58A 3U6MA 2XF5A 3VDXA 4IQJA 1IN5A 5FKMA 1WJAA 3HJSA 2KHHA 1GDTA 4BCJB 3AL0C 3J7AY 3B89A 2OU2A 4G3OA 1BI3A 4WXDA 2Y9ZA 1YHQI 2H6CA 2A6EF 2J5YA 4IVNA 1PGYA 1OKVB 1APLC 4QNRA 4DJAA 1Z7LA 4XLEA 3BHUB 1E3PA 2CHQA 2OPFA 2CMPA 3W67A 3HKPA 4M9ZA 1D1BA 1ZAOA 3OIOA 3RKWA 3AKZA 3CC4I 3RKYA 1UJ8A 4ELLA 5DYMA 4RKUF 3E0JB 4CCOA 2RDPA 3KP7A 5E8IA 3ECOA 4II5B 4RF0A 4X62M 4MTEA 1Y1WJ 1MIJA 2RRUA 2VXZA 3ZQHA 1P4WA 1UNGD 2WIHB 4I01A 3IG5A 3LSKA 4DV2M 1PM5A 1TQIA 5DYIA 5DDGA 3VSLA 2ZPHB 2R65A 4HOBA 3S3MA 1QANA 2Y30A 2QBYA 5HLGA 2K4BA 2DI3A 2M2EA 2CV1A 2OJED 4IBFA 4BCQD 2ZAMA 3EIHA 1VQ6I 2NNNA 1IY0A 3OYMA 2LY1A 2VQLA 2ZSHB 1L1TA 3FKIJ 3EIDB 5JHUA 3LW5F 2DZOB 3K2AA 1VQ8I 2L7HA 1V54H 4IHSA 2M0MA 3S1RJ 2HDWA 1IDYA 1MNEA 4PD2A 2PG4A 3L2CA 2JA6J 2DHYA 3BLQB 4HEOA 2B9RA 2LG4A 2DFFA 1TTEA 1K79A 3Q0UA 2O03A 5DFLA 3TQNA 4QNMA 3GLFB 1WJ7A 1B8IB 2CFXA 2VJJA 2KEBA 4LRSA 5IYCJ 2VBZA 4NRVA 2AQEA 4DYRA 4CIZA 2GLOA 1I6XA 5CVIA 5E3OA 2XB0X 2EH3A 3R61A 4F7SB 5KQDA 1AKHB 4V2FA 3W6KB 3CCUI 5FD6A 5LGTA 3F6OA 2IS4A 1YS7A 2G3QA 1JTYA 4LFBM 3BXWA 3LQQA 5F0HA 5K7HA 2UU9M 4RLFA 1YJWI 1ZG5A 2V9PA 2BXYA 5ICCA 3K70C 4L18B 1R36A 2EIJH 4L8RC 1IY2A 2AO9A 3ABMH 3HYIA 3QPTA 2STWA 3LA3A 3BT9A 2WV0A 5EXTA 3CD6I 3HPGA 3LVWA 2M87A 1TW2A 4IX7A 1VQ5I 1QQWA 4HQMA 5FTJA 4I7HA 3PXGA 4LMYA 4LJZF 1S29A 3A01A 2GWRA 3SZPA 3JTGA 3KFWX 5F08A 4EGZA 4YOOA 3H3UA 1N4MA 1K6YA 3RDIA 4IBEA 2DD5B 3DTEA 2V79A 1XHBA 1ON2A 4KIFA 1ZK8A 2RQQA 1T38A 1EH8A 4KRDB 1DGBA 1OCRH 2CZ0B 2HWVA 1BJAA 1IW7F 4BAYA 4UY8I 3UR3C 1VQLI 4HG2A 4E7ZA 1VEJA 4MGZE 4BCIB 2VC0A 3TL4X 3NDQA 1TL8A 1WPKA 3I53A 4L5EA 2L7ZA 2OAZA 1DU6A 4XK8F 1TF0B 3PJRA 2LKPA 1QVTA 7CATA 3VOEA 4ROEA 1KYIA 3KP3A 1QDTA 2DHRA 3BCBA 4XSXF 3U6LA 4KUMA 3WTVC 3NAUA 2C9CA 2M3AA 5LGUA 2Z4RA 4IBDA 3EETA 1GUXB 3BLRB 4F70B 1TFBA 1UHWA 5GAGJ 1EE8A 2QQBA 2F5QA 3WVDB 1GO5A 4C2MJ 1HJPA 3KOWE 2ZXHA 2RGVA 2BW3B 3CQZJ 1I1SA 3DQVC 3F6VA 3FDYA 3KZYA 4IHYA 1GLNA 3LSIA 1FP2A 3HTUA 3OYNA 3KETA 3ROUA 4R71A 2ZMEA 3W3CA 3I56I 3S1QJ 3LSGA 4JXJA 3LQ5B 2HOAA 4A12A 4FW9A 1Z9CA 2QSFX 1U5TB 1V5GA 3X28B 2VJ5A 1W0UA 3FTFA 1YJNI 2YFQA 4LG2A 2EILH 1HDDC 2VPLA 2JNHA 2VXDA 4BQAA 3G1OA 2L4MA 3HDDA 1SAUA 2M34A 2V9VA 3I4VA 2DMQA 4EOSB 4F6WB 3RPUD 4YRVA 3F8MA 1MH4A 3S8PA 1RUNA 1G3TA 4ENKA 3A42A 4IHTA 1SANA 3OIQA 2ZMEC 4ENJA 1H6UA 3J2PB 2COMA 4RGRA 4IOAF 2C6TB 2CSOA 4Q47A 2NYXA 2DYRH 5ITUA 2DA4A 3IRQA 2LYCA 2W25A 1X4PA 2JSPA 4P9UA 1OMIA 4D9JA 5IHYA 1WJ5A 2CWBA 1SD7A 5ICGA 1LFPA 1VZ0A 2JY7A 4LF4M 4KJZA 4DOZA 3AL0B 1D8JA 4Q7JA 4MGHA 2IA2A 4NOOB 4B3RM 4U87A 4QTRA 3RZOJ 2H1RA 3ZRGA 4ZTFA 2Z99A 4A3EJ 3EIEA 1GXQA 3GP1A 2K9LA 5K5OA 4FCWA 3GLIB 2XPWA 4MTDA 3GTKJ 2BS3A 3QU3A 2M7AA 2K85A 2DT6A 4R79A 4BE1A 4BNCA 2QYOA 3Q8XA 1DPRA 2P5KA 4L4UA 4I0AA 5BNJB 3RGFB 4ESFA 3LCUA 3KYDB 3K2ZA 5JVGF 3ZQQA 2G9XB 1IBMM 1QU3A 1V55H 2Z3YA 4YC3B 5FO5A 4GHAA 3R0JA 2ZZDB 3O2PE 3W6VA 4XKCA 2ISYA 3C2HA 3KVWA 4PJNA 4J01A 4OGRB 3FBNB 2O25A 2QQ8A 1XSDA 4JV5M 4PSWA 1GVNA 2VT2A 4Y72B 1WRJA 2BBYA 2BOLA 3A8MB 3P9CA 3HHWA 1GV2A 2WV1A 1RR8C 2MR9A 2EV0A 2DWLA 2BXZA 2LLKA 2H09A 1SXJD 5C1BA 4YOZA 2KRFA 2VONA 4BCKB 3KYCB 2QF7A 3FUUA 3BG5A 1XDUA 1ZARA 3LQRA 3MMYB 4BHCA 4IBKA 3FISA 3OV8A 4B1RA 3GFLA 1G2HA 2WY7Q 2EA0A 2W84A 4XNFA 2ISZA 1ZELA 4X66M 3J7YJ 1MSFC 5FRNA 3KOZE 2WFYB 2QBYB 1ZRFA 2QP9X 3C3WA 1KSFX 2FEZA 2CV2A 2YU3A 3FMQA 1PP8F 2XRLA 1FLIA 2UUAM 2L4EA 5B66C 1XWIA 1HW5A 2VODA 2QGUA 2LKSA 5F1RA 3QPSA 3Q0VA 2PQ8A 2V1NA 1RRJA 2HNHA 5L3CA 5KNLA 1EJ9A 2Y69H 2APLA 2WEVB 5A2QS 1HC8A 2DZNB 2R0IA 4PSXA 2QLZA 4C3IJ 4I6ZA 2JA2A 5EQTA 1TP4A 2X48A 5EXSA 1QZYA 1WH5A 3I58A 4LJ4A 4LJ5A 1WXQA 3HRTA 3OYFA 4IKFA 2VKHA 1O3RA 3L09A 3F5XB 3D1NI 1LPQA 3R8FA 3FMSA 2CZ1B 2DFHA 5FSWA 2W99A 3WGHA 1W5SA 1F1ZA 4PDKA 4LFUA 3E9SA 4BU2A 1TC3C 2OUMA 3DV8A 4IZZA 2ZPGB 1LDJA 1HNZM 3CMMA 5D5UB 1XDSA 2XROA 3WGGA 4OU7A 4AI6A 2HVRA 2ZJQF 2CQXA 5IYBJ 4EOPB 1W5TA 2BS2A 3H5NA 4QPOA 3A02A 1NJFA 1YLFA 2JVHA 2R7UA 4GYIA 1OAIA 2HYGD 2XGXA 2DA5A 3CDHA 3HOXJ 1S3JA 1IN6A 3O8HA 2E5NA 2LNBA 1T33A 1XN7A 1Y8RB 4CSWA 2JA8J 1IY1A 4DV1M 2MJ5B 3M4OJ 1QVUA 1TDZA 4JI3M 3B7NA 3KS4A 4IBJA 4D80A 4GHLA 1C1KA 2CQQA 5BR8M 2VKEA 1HLVA 2KZVA 4D1QA 2XSZA 1LUJB 2Y0QA 1MJAA 1U6GA 4L6V6 4F7ZA 4YY3M 3HEFA 5BPVA 4P55A 2CZ7B 1YE9A 1FT9A 3ZP5A 1H9TA 1ULYA 4NRWA 3T1BA 4IO9F 4BCND 2HYFA 1GJTA 3U61A 4JX6A 4DW6A 3PNVA 1YUBA 3GFIA 4BCMB 2CUFA 4LJ8A 4QHTA 1NY5A 4XGIA 1RPWA 5M3MJ 3OYIA 1J75A 2IS1A 4BY7X 4NQWA 4ZPXA 1IZ1A 2DAOA 2JY5A 2VQFM 2QKMB 3MVPA 2PK9B 3CCRI 5BMZA 3OOUA 3QZ5B 2OOBA 3G73A 2WTEA 5KPTA 2O8XA 2ZFUA 3TW7A 2MW8A 5GPCA 3A45A 2COBA 1G3IA 3GTQJ 2IRFG 1HT1E 1PJRA 4X64M 1W7PD 1ETYA 1R5HA 2DDAA 4NC7A 3RYPA 2EFWA 5BS6A 1PJIA 4KICA 3GRVA 2DCEA 2ZFWA 5FKLA 5D8KB 3OYDA 3HZJA 1QA6A 5F04A 3DZDA 1PDNC 2QWWA 2E1MB 4HX8A 2D5VA 1OIYB 5CEIB 4AIHA 2WHBB 4C3JJ 1Z1DA 4Y33A 1D2NA 1ZMUA 1TT0A 2P6SA 1KU2A 2ZMEB 5M5XJ 2FS1A 5GKNA 1XNQM 2GIZA 4GITA 2EZKA 2VQGA 4HA8A 5D4SA 1K61A 1UGQB 4N9IA 2X1DA 2CRUA 3CCJI 3WU1B 3M6AA 2TCTA 2CEAA 3ABTA 4HX7A 5J1UA 3CF0A 3FE3A 4HBLA 4IEJA 4LD5A 1EH7A 5IY5H 2B3TA 3CMEI 1EH6A 1ODDA 4IPAA 1MU5A 2YU9J 3DL1A 2Z33A 5J40A 2MD0A 4CA0A 1NV8A 1TBXA 3H3VK 2IW9B 2M9HA 2F6CA 3JRFA 1AHDP 3WTSC 4KHPM 1NTCA 3M8FA 4Z2YA 2IT0A 3S32A 2E19A 2IPQX 4E4HA 1VTNC 2WSCF 2FOKA 1TH3A 4RGXA 4XLCA 1K83J 3F21A 3GLLA 2ZTCA 4BE2A 2EUCA 2PJPA 2ZPBB 2IS6A 3MY5B 4KMUX 2BVLA 2HKJA 2F5DA 1V92A 5GADJ 5C4XJ 3U21A 1GVJA 3B7ZA 3KE2A 4GKKM 5IYDJ 3DU6A 2QGSA 3QP6A 3X2QH 1I3AA 4XL9A 1G6NA 1UCRA 2K27A 3HIFA 4CUGA 4RDUA 3BR5A 4OAYA 3N4MA 3QWLA 3HY5A 1VINA 3FMRA 1BM9A 4KIBA 4YFKF 4EATA 3GPPA 1VOLA 4IRHA 3B7QA 2UZLB 2QFZA 2DWMA 3VKHA 4CZZA 4WCGA 1VEKA 4LFCM 2C5RA 4IQ4A 1G3WA 4JI0M 2VBWA 2JY8A 2IGNA 2E2JJ 3PNTA 1E9SA 4J00A 1ORYB 1TDHA 1T6SA 3FYCA 1Y8GA 2W00A 4Y7NJ 4CXFA 3VYGB 4B43A 4L0ZB 1MSEC 2UUZA 1TNSA 2JUGA 2QZ4A 1BJZA 3V76A 2L7FP 2XV4S 1N75A 1TNTA 4B3XA 1FWZA 1MBEA 2MH9A 3DF8A 4LB6B 5LRSA 4XLFA 4KA4A 3CP8A 1SC7A 1TWAJ 4M3FA 3GQ4A 4IRIA 4G6QA 3H36A 2A61A 3VYTB 1NK3P 3CJRB 4ITQA 5LFAA 4BBSJ 2DK5A 1D0ZA 3BROA 2DA7A 1H27B 4LF5M 4XMYA 5D6EA 2O6GE 1ETWA 2L54A 4FT8A 2M30A 2R4GA 4KYWA 4EM0B 3R60A 2HOEA 2DN0A 1R4MB 2HFHA 2CW8A 1U2WA 4HL4A 2AXTC 4RMNA 2XZFA 2LMDA 5J8CA 1JKQC 4XM3A 5H37D 1VQ7I 2L9SA 4HF1A 5EZGA 1JKWA 3Q3SA 3X20B 3IL2A 2X9DA 2FNAA 4HSRA 1D3YA 2H6BA 4M6VA 5LHGA 4KFCA 4B48A 2IGOA 3HHTB 3JRIA 2EINH 3PQJA 3VPRA 5HVYB 1I94M 2RVCA 4HRIA 4DIQA 1H1PB 1S8NA 3HGGA 3BR1A 2JZ1A 2A07F 2G7UA 4CHTB 3S1MJ 3WTWC 5ICPB 3HJ8A 1IQPA 2GXAA 3GLIE 3I59A 2XAUA 1XMOM 2VPRA 2YS9A 2RQPA 4PT5A 3NRVA 4JI2M 4RAGA 2E1OA 3C2GA 2HU9A 5D5VB 1VQMI 4IHWA 1G3NC 3TNIB 2BJWA 3GRUA 5CVUA 1HW2A 1REPC 3E6BA 2WMAB 1I50J 2W96A 4ZZLA 3W0FA 2WADA 5FFZA 4GO1A 5E3LA 3GTMS 4WK8F 4RM3A 1ZRCA 1HQYE 3TP3A 3F23A 2L01A 2LOOA 1RETA 2N8GA 5DD8A 2KJBA 3FKEA 4CCMA 3OYJA 2P5TA 3DPTA 3JRCA 3L2VA 2MABA 5J8FA 1ZQ3P 3U61B 1UHSA 3VK8A 1GY3B 2UUCM 1UB9A 3BG6A 4RAYA 3KSJA 3LSPA 3FXJA 2B9SA 1OL2B 4N4OB 3U1KA 1K3XA 1B72A 1LFBA 2DMEA 1ZR4A 2KA6B 1WKMA 3K4KA 4WXCA 3GLXA 1RKTA 3AV0A 5J3LA 3J7AO 2CHVA 2LRDA 4AIKA 3B73A 2MH8A 1EA3A 3DEUA 5C44J 1IN8A 1TH2A 3K70D 1KQ8A 2CZ6B 2OC6A 4GDFA 1AD6A 2VIIA 3MMPA 3DCFA 3E5QA 1IXCA 3DPLC 1P3QQ 4L9NA 1LKXA 3ONQA 3WG9A 4ZGJB 5FLMJ 4TV7A 5JI2E 1SD6A 2DPPB 4R7GA 5A2QZ 2JY6B 4XORA 3T1HM 2V6EA 4P5OA 2LR8A 2OF7A 1USTA 3N97A 3FZVA 5LBQA 3HOYJ 2DJNA 1DP3A 1QZZA 3QU6A 2JPCA 3QODA 4M72A 5JI6A 2O7OA 2F5CA 3IC7A 4I02A 1BIAA 4YEJA 1IXSA 3B74A 1XO2A 3DBLB 2I40B 4BBRM 4RAZA 4W1UA 1Z05A 1JHHA 4HX4A 3VFDA 1G71A 4D5FA 3DLAA 3LVVA 3IHPA 1WHCA 1QAOA 3LSJA 2H94A 3TNHB 2R7FA 3ZMSA 2X1NB 4BJ5C 2Q0OA 2Z1DA 4D82A 4MNUA 2X4HA 1YQAA 4LLLA 2KRKA 3P7NA 2MYSA 1ZG1A 1E7PA 1PUEE 4CCNA 3FX3A 4GC9A 3B9PA 3WE2A 5IP9J 2FOIC 1ZYRF 4JI7M 2IVXA 1XMAA 3TP0A 1BL0A 4OMYA 5E3NA 3TPZA 3HSEA 4AD9A 4UB6C 3Q9SA 2XIGA 3I3LA 1Y6IA 2VLAA 4N9HA 4BH9A 4FQGA 4P9FA 4EC9B 4AYBA 5E1WA 2VOPA 1MN3A 2IBDA 1MMAA 2HPIA 1Z6TA 1C7YA 4JYAM 3EJ1B 3TO7A 5M5YJ 1U8RA 2HPMA 3HOWJ 1N34M 4DBRA 1H89C 2K9QA 2DAMA 5KAFC 2WPAB 1MW7A 1NV9A 1U5TC 2ZM6M 3CJTB 3ZCBB 3EUKL 3CZ6A 4MEXF 4RF1A 2W24A 3C9PA 3CMYA 4UUVA 1TT5B 2F4OB 2HWJA 4A5MA 4MEYF 5L3DA 1HT2E 4MFDA 2E7XA 2LXEA 4E70A 4BY7J 3J7AS 2DTZA 2FU4A 5CVRA 3ERED 1R1VA 2NQ8C 1LQ1A 3ZQ7A 1A31A 1PRBA 1IF1A 3CP2A 1D1AA 4ELJA 1IV8A 3GLIA 3ZR8X 2ELJA 3PFIA 3F22A 1XMQM 3EUHA 1LNWA 2QSHX 2ZPEB 2WB1A 3NARA 4G4QA 4OAZA 4PFPA 3WVEB 1FZPB 3H9GA 3BJAA 3M07A 5DV5A 3CTAA 1E2XA 3GTJJ 4U7DA 1DO2A 3SEQA 4GRIA 4BXFA 2VDBB 4BCHB 2NVXJ 2NVTJ 3S93A 2E7WA 1A04A 5A2QK 2NS7A 3C7JA 3MJ5A 4L5JA 5K5QA 2CJJA 3EUHC 1MBFA 2EA4A 2XAFA 5JI3E 5EYRA 4KT0F 1Z5CA 4OVZA 3CDLA 3T6PA 5EEGA 2HOTA 2VI6A 3KLOA 4HDVA 1CQTA 2YPRA 3ZQGA 3AG4H 3H5AA 1WJEA 3M8EA 2MLKA 3CCYA 5EG0A 1YSYA 1T39A 2ETHA 5EF6A 1MH3A 3ILKA 2K6BA 2K3PA 3KCCA 1XX5A 2R92J 3RSNA 3FXLA 5HLHA 3A46A 1HNWM 1D0KA 4EOIB 4BBAA 3JR5A 4M74A 3TQSA 1R71A 2VF7A 1YW9A 3SFZA 2RV8A 4D81A 3FXOA 3DTKA 4ZGEB 5D5XB 4MB7A 5BOXA 1V4RA 1UG0A 1HF0A 5I5ZB 1H8AC 4QPQA 1IG7A 1JE8A 1X1CA 2EKFA 1SFKA 2JK3A 1OAOC 3HU2A 5ITXE 2LBFA 2IW6B 3G3ZA 3D8LA 1J2XA 1QQIA 2CW0F 2Y20A 2MLGA 4PUSA 3QOPA 1QBJA 1X19A 2NS0A 2DWNA 1FJGM 1EF4A 2W82A 2HQAA 3U6DA 2W9ZA 2EB7A 3GWZA 3HU1A 4CICA 4KODA 3QYHB 5EP4A 1F5QB 5BQTA 3IHUA 2YQZA 4OX9M 3CMAI 3FYDA 1PYVA 2FXAA 2JA7J 3I59B 2ZJ2A 3HU3A 2R7WA 3OSGA 3FBIB 3VK7A 4AYBN 3MQ0A 1X4OA 1VFCA 3V4GA 5D6FA 4L9JA 1B59A 1FBQA 3H92A 1D0MA 2VBYA 4ZYHA 5CVVA 1QPIA 4PJ0C 1GV5A 1NJGA 1D5YA 4DR6M 3BY6A 3I71A 2FH0A 1YLAA 5IWAM 5ACBA 1KQ9A 3N05A 3W2WA 3RCOA 1R22A 2OZ6A 4OIRF 2KIUA 3KIOA 2FE8A 5TRDA 4A3KJ 3WTXC 4JI4M 1YJ9I 4E6KG 3CF6E 3CESA 1IREB 3K4CA 1G8PA 2Y21A 1X1BA 2E71A 3OYEA 2STTA 2DAEA 4EJVA 3JRBA 4EOQB 4MQ9F 1WGLA 2VKDA 2X51A 2FF4A 1AHJB 3DDPB 2LVNC 3I9V2 4JYKA 4M6YA 4U88A 4HLYA 4FCYA 3HOUJ 2R7TA 2CO5A 1B72B 2UXXA 3LSTA 1XC5A 3DU5A 3NWTA 1JSTB 2WXVB 1XD7A 3X26B 2RGHA 3NBIA 4KT5C 2LH9A 3E7LA 3V7SA 4DR5M 1XSVA 4CZCA 4HLXA 3A03A 2WB1N 3SARA 4G6TB 2H27A 3FM5A 2V6CA 4R8HA 2EWNA 4ENNA 3IH2A 4KISA 1JGGA 3U60A 2KRUA 1JUSA 2EV6A 3G6EI 1YFHA 2KFDA 1MNDA 3GPXA 5D8LB 3S16J 1W98B 2CP8A 2EQRA 4G94A 1ETOA 1PUFA 5J47A 1BOAA 4RB0A 2BKZB 2L9VA 2R44A 2MSYA 3EPZA 3IUOA 1AISB 2OOAA 1E9RA 4RGUA 5DCMA 1WJDA 3A0HC 4XICA 2XVCA 3F9KA 1D0LA 1N36M 2PJRA 2YUSA 2DMPA 2IGKA 3PVSA 4KRCB 1UGPB 1DGHA 1RC9A 1YW7A 3S3OA 5L3BA 2HL7A 1W36C 1D0XA 3HKZA 4OU0A 2P7CB 1IXSB 2HTSA 1R9TJ 1A36A 5J1YA 5ICFA 4OIQF 3FXQA 4B08A 5B5EC 3S3NA 2M7BA 5GTIC 2VIXA 2F48A 2Y75A 4OIPF 5GP9A 2P8TA 4X6AJ 4BQOA 1FC3A 2XSZD 2OCEA 3AG2H 3K1MA 4B3SM 3BG7A 1NO1A 2HXIA 4BDYA 3W68A 1DP7P 2KRHA 3KZZA 3JR4A 2W1OA 3PQKA 1NHAA 5KK1A 3ZMTA 2PEXA 4LRTA 5JHFA 2L7MP 4NC8A 1P7IA 3GRYA 3BZKA 4GYGA 4EMSA 1L8QA 3GYHX 4B7HA 1OKSA 5E6JA 4DR1M 1KA8A 4MGIE 4IBGA 1XCBA 3X25B 2ICWG 2E35A 1MMGA 3CCMI 4AKIA 2V4JC 4RNAA 2VJ4A 2E1MC 2QCUA 1FIPA 5ED4A 3BTCA 2O8KA 4LLNA 3LL7A 4RM2A 3WODF 4RBOA 1I6HJ 1TD6A 4M71A 2WSEF 5L3FA 3K1JA 3HTSB 1Z5AA 1FKMA 2OO9A 2B0LA 4U7BA 4PZJA 5ITXA 2P0WA 1LEAA 2VL8A 5IOYA 4C30A 1Z5BA 3MZHA 3NWSA 2LVAA 2HOSA 3F72A 3CCEI 1GABA 3F92A 5HS7A 2BJVA 2MFZA 4EOOB 3KLNA 4AZFA 4R3DA 3D8BA 4BGDA 1IV6A 3U6OA 4M3BA 3FWEA 3A0BC 3GX4X 3GQ3A 1X58A 2RN7A 4IBIA 5B1BH 4JI5M 4HPQA 2L9RA 4PGHA 3IG8A 4Q4ZF 4REZA 2G8LA 2VASA 1H1SB 1A5JA 2QHOB 2V6ZM 4ABZA 5GAEJ 2M4KA 4XQFA 1D5VA 1QZEA 1HDPA 4IBCA 3DTIA 3BLHB 3MKLA 5F1JA 1E94E 3H1CA 1SG9A 1SVLA 5HNBB 1QVRA 3E3VA 1DO0A 1LVAA 1RR7A 3RE8A 2MC3A 3JRHA 1TGUA 2BWBA 2XAHA 2C4GB 4OB1B 2ZNZA 3IKVA 4B44A 3PUBA 2L2OA 1STZA 2KP6A 1UFZA 4IJAA 4I8OA 3K0LA 4JBAA 4Y3OA 5LEJA 3KSXA 2JP7A 1BIBA 3W2VA 3JSOA 2KQRA 3QQAA 3JTHA 4AWXB 4OVZB 5DQVA 2KMGA 1PP7U 1KYWA 2QQAA 3K2LA 5CPRB 2JWTA 2QSGX 1SFEA 3S2WA 3WE3A 4LLGF 2YX4A 1MMDA 3RFWA 3H4JA 5EG0B 1QNTA 4ASNA 1JR3E 3HG9A 2BYVE 3MKYB 4UVAA 1IRFA 3I4NJ 1A35A 1XS9A 4JOMA 1O3TA 3FUVA 4TUWA 1GUUA 3K4MA 4XONA 4V19K 1TZLA 2AHQA 2M1BA 4CJ6A 1EV7A 1MGTA 2PMIB 4UVCA 2V1CA 1WR1B 2K40A 4B3MM 3KX2A 1XGSA 4CH7A 1UFMA 4KT6A 3HKZN 2JRTA 5DCFA 1ENHA 4YFNF 1GKIA 2H5XA 1T43A 2MD5A 2LY2A 4JQFA 5H2FC 2G0EA 3TMOA 2EFOA 2LBFB 1MZBA 1OISA 2KIMA 4OR5B 4LF7M 1T6OA 2WBMA 1IXZA 4FM4B 2L4FA 2NOGA 2V1XA 3OL3A 4C2TA 1OYWA 1UZCA 2ZJRF 2X4AA 3BJ6A 3X24B 1E3HA 3ZC7B 3HXLA 4BCOB 5HDNA 3JRDA 1IO2A 2NXNB 3Q8GA 2KNVA 2BNKA 2EK5A 2VQHA 3RTRA 2DTRA 2KR6A 5DQWA 2LF7A 3H35A 4KNYA 3BOQA 4A0XA 3QRFF 2W2HA 1HXDA 1HR0M 5FTKA 2P5LC 1S72I 4ANRA 2J5PA 3L2RA 2X6XA 2Y0TA 4QIWN 2DT5A 4LB5A 1S7OA 3PFYA 5FD5A 4EC8B 2G7HA 2LY9A 4PCQA 1SXJE 2K5CA 2V22B 4L9TA 2W4SA 4A0ZA 2JZ0A 1GVDA 2IW5A 4LGWA 2Q1ZB 4KN4X 2DT7B 1J9IA 3IV5A 1OCOH 1FOWA 3WHLA 2HI3A 3W6JB 1OR7A 2O5RA 3GLGB 1QAQA 2CQKA 4CFNB 4X65M 3PIPF 3PL8A 2KKOA 5AIPA 1JT0A 2E1CA 1OIPA 3CLQA 3RQ4A 4B4CA 4EVIA 3FTEA 5DUIA 3I01M 4FD2A 4XKBA 2QDYB 3BTIA 1IN4A 1BI0A 1ZGAA 3BPXA 3F8NA 1OYYA 3VDPA 2R7ZJ 3DDQB 1S7AA 4GXOA 4DUZM 1O57A 2QENA 1YOVB 4XN0A 2P6TA 4IBBA 2L5QA 4H4KC 2G9WA 3WU0A 1O3QA 2DA6A 1OR7C 4FX0A 5M3FJ 2UUEB 3U60B 3TGNA 2DAGA 3SJMA 4BCFB 2R6FA 1R23A 2DOAA 2VB6A 3J27B 1KQ0A 2O61A 3CC7I 2MGQA 2B63J 1PUFB 1FOXA 3JSPA 1LDDA 2P4WA 2VKVA 4OW0A 1Y56A 2IAIA 3ABLH 1YRNA 2V1DA 2KDOA 5D4RA 3FXUA 4LITA 4I2OA 1JXSA 2L7IA 5DCMB 2E5LM 2OZUA 2HHHM 2E2IJ 4CFXB 1R5GA 1RZ4A 3DFGA 4EJUA 2LBCA 4QLCU 1R1UA 3SZTA 2PJRB 5LRRA 4BCGB 3A98B 2P5VA 2KDLA 1DGHB 3U5ZA 3NEUA 1FJLA 2ESHA 3H4CA 2CWEA 5HODA 2ZPFB 4YOSA 2MA3A 3OYAA 1H24B 3RPQA 1WFXA 3S1NJ 4JI1M 2NVUB 3E4RA 1IUFA 4LY6A 2YR2A 1XPXA 1QO0D 3UZUA 1V5FA 4NBQA 5CQGA 1M1EB 2DW4A 4QWQA 3CC2I 5E18F 2NVQJ 4CGZA 1VYWB 1P7JA 4IXAA 2G77A 1KXUA 3TO9A 4XOPA 1XB2B 1ZH5A 4M3EA 5E8GA 1MJ9A 2DDBA 3HPHA 3L27A 2EKKA 3JAMK 2LW4A 1YG2A 5EP3A 2R7VA 3HOSA 5FTNA 4EOJB 1DGWY 1POGA 2F2EA 1JR3A 1RU3A 2CHGA 1VNDA 4I0BA 3DP7A 1PJQA 5ITYA 2BGCA 4AVZA 1G4DA 1GL7A 1FEXA 1AIPC 3PNYA 1JHFA 1VG5A 2BHYA 3LFKA 2FD5A 3PO3J 1P4XA 4BXUA 3OTOM 3ASNH 2IVMA 4GC5A 3BQYA 3EYYA 2D1VA 1KZHA 2XFSA 1P2FA 2LF8A 2D7HA 5LEKA 2WJ9A 2XPVA 1WJCA 2F2CA 1KYZA 2ME6A 3SC3A 1SFXA 2GOMA 3FK7A 1YX3A 3K10A 3OYKA 1R5ID 2IA1A 4G8XA 1Z3YA 2TDXA 3VYSB 3BQZA 4H0EA 1ZREA 1D0YA 1R49A 4B3TM 3HBLA 4HV6A 1X1AA 1RUOA 3FHNA 2JQ7A 1R2YA 3BP8A 1HOMA 4GCVA 4MGKE 2JPBA 2NVYJ 3ZQFA 2ZAOA 3VSKA 1BVSA 3ZMVA 2BY2A 4BEHB 2B7EA 2A69F 2W9FA 3D5RC 5L3GA 4EJTA 4DV4M 1MKMA 4IHXA 2QPAA 1UM8A 3CUOA 1G59A 1XSXA 3Q9VA 4LZJA 2KW0A 3U6QA 2KLOA 4B8XA 2R4EA 4HYEA 2WWYA 1LV7A 3O0GD 1SXJA 3ABKH 4OB2B 3L00A 2R7QA 1OL1B 1D3UB 3BCAA 5D5WB 3B6AA 2HVSA 3F3XA 5IZ7D 2EJSA 4P17A 4L0YB 3TN8B 3I5UA 2HZDA 1C0WA 1DU0A 2MROB 2VQCA 2HCBA 4OINF 1AU7A 2HR3A 2K7LA 3FIWA 2KNAA 3K4JA 3A8HB 3G1MA 1VQKI 4M6XA 2XGCA 3UK6A 1QYRA 2H8RA 2KZGA 4BCQB 1NY6A 2LP0A 1V5EA 2XAJA 2R7XA 2LVQD 2XF7A 1SXJC 3M1CA 3UNGC 3VODA 2A6TA 2KL4A 1FTZA 1OYIA 3HRMA 2DWZB 1FPQA 2Q8KA 4A3IJ 4D7NA 4EORB 2FUG2 4WF2A 1DDNA 1Q3BA 3OL4A 2KPMA 3VYRB 3KP0E 1JQJC 4G6DA 2GXBA 3HM5A 2XDVA 2ZNYA 4AIJA 2DXCB 2ECBA 4QSHA 2KIQA 4ZDLA 1Q1HA 3MFKA 1E17A 3U6EA 2E1NA 3ULQB 1VQPI 4UN2B 4JN6A 1PJSA 3M8JA 4KDPA 5KPZA 4IHVA 1SD5A 2A6HF 1IGNA 1UNLD 2BS4A 4BY1J 5E3MA 4MH0E 2HZTA 1RESA 5FB2A 2K86A 2GQFA 2JUJA 5L8RF 2HDDA 4E7SA 3SMPA 4PCZA 3FKJA 4MHGA 3VFZA 4U0VA 3KP4A 4IRGA 4LIVA 3ISPA 1PKDB 1BR4A 2K9MA 4XR6A 2ERCA 1B9MA 2CYZB 3HOZJ 5FTLA 5HS9A 3DOGB 3O8GA 2PJQA 3KP5A 4EQQA 4CYCA 2EFPA 1OIUB 3E5XA 2P7VB 3SYLA 2XSDC 1JSUB 2X6YA 1HKTA 4LGYA 3BOSA 4DNCA 2DA1A 4CXAB 1FSHA 5HDKA 1QAMA 4RGSA 2YNMD 5EXPA 3HSFA 3TE6A 1Y39A 1KU9A 4HEA2 2RAEA 1OKRA 3SMSA 1SMYF 3KOYE 3E5UA 4F6SB 2PI0A 1A6QA 2PLYA 2Z7JA 1ETKA 2BY1A 1SVOA 4LJ6A 2EIKH 3WG7H 1R2ZA 3RZDJ 1XC8A 2J7OA 4QHSA 2ZSIB 4PDIA 2MBFA 1VQOI 3O6BB 3GO8A 2WC2A 2XAQA 1MDMA 3TKYA 3EDPA 5E20A 1IBKM 3VDUA 2O0YA 1WHUA 3F0CA 3W2AA 3UJNA 3Q0WA 3U2RA 2UWMA 1ZMVA 3TDZC 5ITQA 3JAMS 2DD4B 1U9NA 2CU7A 1WGNA 2FMLA 3DFZA 2NS8A 4UV9A 3VLFB 1ZN2A 2HYJA 2MC4A 5CQEA 3S17J 3VB2A 4CFVB 1GL6A 4ZZDA 4CGYB 2Y0SN 1XB4A 3C2BA 5KHDA 2R93J 2DMNA 2DBBA 4HNUA 3TO6A 4UUTA 2QDJA 1IRGA 2I10A 3I4YA 5K5RA 2KT0A 5KCMA 2R62A 1VDLA 2F5FA 2CW7A 2K4JA 2M8EA 4LG0A 5KVRA 2BPMB 1B1BA 3MZ8A 1XGOA 4W5WA 1BBYA 3KP2A 4BB9A 4KITB 3AJIB 3HB9A 3JRAA 2OTLI 3TWLA 4JI6M 3K8ZA 1YYVA 4ZDPA 3DTOA 4UUSA 4M0WA 4NB5A 1UAAA 1YRNB 3KOXE 3BZ6A 2DA2A 4WP2A 4DGWB 3GCMA 5EFQB 4EEFG 2IS2A 4CFMB 3E21A 2DQLA 3REOA 1BC8C 4WURA 2GA2A 4UHTA 3T8RA 4LJ7A 2GNOA 3U5ZB 2CCIB 3UGJA 2LSOA 3WHKA 1QHGA 2OQRA 4PGGA 4BXXX 2LTPA 1MBHA 1HA8A 3H0DA 3CCQI 1ON1A 3AFHA 1P6RA 1X1DA 1CUKA 2ESNA 2ZKZA 1B4AA 5HBEB 3GTMJ 1AWCA 2I7PA 4L15A 1Z3XA 4BQNA 1UG2A 3HUGA 2UUBM 3ZPLA 1QUTA 3SATA 4LF6M 3K92A 1XNRM 2D2WA 4RAFA 2K9DA 1OIZA 2ZB9A 2RGOA 3DLLF 4A6DA 2NAZA 5ITTA 1NNUC 2EBIA 1URCB 2DQRA 3BHVB 1NSFA 1V29B 2QKLB 4G9YA 4LIUA 2M4GA 2AHJB 4G6LB 1BOBA 2BE5F 1TH4A 5HVQC 4BCPB 2XASA 4GIPA 2DAIA 1JKPC 3GTGJ 1KFVA 4IF4A 2F4IA 5GTHC 1FNNA 3MZYA 3E46A 2KMUA 4Y4RA 2DOEA 3MY1B 3J81S 2QM3A 3M9AA 2HKXA 5HNHA 1MMSA 4LJ9A 4LCBA 5DNYA 1LJ9A 2VJIA 3M1EA 2X8AA 1Q02A 3J80S 3KFUG 1UELB 2OV7A 3CLOA 1Q1VA 2LD5A 5IF1B 1JUMA 2RNJA 1W36D 4BCMD 1ZLKA 2FQ4A 3MI9B 3IH3A 3DA1A 5CJ9A 3GTLJ 3DEWA 4G6ZA 5H6QA 1TR8A 3ZQCA 1ITYA 2W48A 4CYDA 4F7LB 2D7GA 5DEQA 3J7ZI 3VWBA 1G3YA 2ZTDA 1ZGJA 4PDGA 1EFUB 2CH0A 3ERMA 3GZNB 3GLGE 4PJMA 5EEHA 1OFCX 3RIRA 2C6YA 2JSCA 3DPUA 4K2EA 3GMEA 1OGUB 2DODA 3TNWB 3E97A 2DJIA 1XMKA 2WAQN 3OR2C 4X1EA 3K4NA 2EZHA 4A3VB 1KONA 2F5VA 5EXXA 2M5ZA 2Z8YM 4U0YA 4UNOA 3L26A 2BEOA 2V9KA 2XKPA 2LNHC 4CCKA 2MGWA 2LTUA 4A3DJ 1FP1D 1ETQA
chains in the Genus database with same CATH topology
2Z16A 3OS2A 3S3OA 1W36C 4Z6YA 4AI6A 4ZYAA 1D0XA 3HKZA 2KHMA 4MFEA 2BS2A 3S3NA 2M7BA 3DWLE 2VIXA 1NG6A 3H5NA 4QPOA 3K4BA 2JVHA 2R7UA 2ZPIB 4XOTA 4BQOA 3TW6A 4HSTA 4JX4A 4XN3A 2E5NA 4YELA 3BG7A 4BDYA 4CSWA 2KRHA 2W1OA 1AA7A 3OYHA 2KZVA 5JHFA 4D1QA 4NC8A 3A8OB 1WJBA 2A5WA 3QYFA 2V7FA 2CZ7B 3X25B 2WAQA 1YE9A 1MMGA 3A4CA 1BR2A 2V4JC 4AKIA 5FRMA 2CFOA 2VJ4A 2E1MC 3D5SC 4JX6A 1UGSB 3PNVA 3DEEA 3LL7A 4RM2A 5HNFA 4NNJA 4PK4A 3OYIA 2IS1A 2R7SA 3BG9A 4CCLA 3PSFA 1FKMA 4XKWA 4U7BA 2QKMB 2P0WA 2VL8A 3OOUA 3QZ5B 4C30A 3HO8A 2ZFUA 1J09A 3NWSA 2R7RA 3TW7A 3BG3A 4OB3B 2MFZA 1PJRA 4BGDA 4NC7A 2DCEA 4HPQA 3OYDA 3HZJA 2VASA 2E1MB 3IAM2 4BE0A 4BS9A 4HLQA 2Q2EB 3LSMA 1U0JA 2M4KA 3DKYA 4Y33A 4FASD 4XQFA 1TT0A 3OYBA 3DTIA 2NOJB 1D1CA 2CUJA 4MLOA 3LMMA 3QYEA 1DGRM 2VQGA 1UGQB 2RNGA 3QYGB 4OB1B 3GBGA 3A2KA 4B44A 3PUBA 1YX5A 2L2OA 2X1DA 3CF2A 4II2A 2DXBB 2KP6A 4Y3OA 1E0EA 4F52A 3W2VA 2KQRA 3DL1A 1QLBA 2KMGA 2V26A 4ITVA 2MD0A 2WY8Q 4NQWB 5CPRB 4CA0A 2HVQA 2RREA 4BACA 4RLQA 2DXIA 2WAEA 2F6CA 1MMDA 4F93B 1FMWA 3HG9A 3MKYB 3S32A 3PSIA 4JOMA 4E4HA 4XONA 4ZGDB 3K4MA 2XC7A 2BVMA 4XLCA 1TZLA 4BE2A 3KX2A 1ERDA 2ZPBB 2IS6A 4CH7A 4KT6A 3EUAA 2BVLA 3KHIA 3U21A 3SEZA 4C9YA 1UGRB 2Z2SB 2LY2A 4JQFA 3L2QA 3TMOA 2LBFB 3DU6A 2GOXB 2WBMA 4XL9A 4BUPA 4CUGA 4LOCA 2L9NA 4XLAA 4OAYA 4FM4B 4AKGA 1S9HA 3QWLA 3OL3A 4C2TA 1LDKB 2LREA 3H9QA 3X24B 4EATA 3HXLA 2BW3A 2I8DA 3BLYA 4NC6A 3CJQB 3ZXSA 4AU7A 3VKHA 2HVRA 3QOEA 3QXEB 2VQHA 3RTRA 2KR6A 4IQ4A 3H35A 3HUGB 2IGNA 3PNTA 5CKTA 4J00A 4E7JA 3L2RA 2X6XA 2W00A 3PFYA 4B43A 3VYGB 5LD2C 1OLTA 2UUZA 2JUGA 2K5CA 2W4SA 2R7OA 2Q1ZB 2DT7B 3IAS2 1QHHD 4N4NB 1N75A 2X6WA 4B3XA 2O5RA 3KEYA 4XLFA 3CP8A 3A8GB 3PL8A 3OS1A 3RQ4A 3VYTB 3CJRB 1N78A 5LFAA 4XKBA 1D0ZA 3VYUB 2QDYB 1G8XA 4XMYA 2KRCA 2W7NA 4JX5A 2R4GA 3E1SA 3H5RA 4E7LA 4XN0A 2L5QA 4H4KC 3D5LA 1P9QC 1OR7C 2CW8A 4HL4A 4RMNA 3SZGA 1Z21A 2DOAA 2VB6A 4XM3A 2L9SA 4E7HA 1JI8A 1Y56A 4ZTJA 2XF5A 3X20B 3VDXA 2KDOA 4IQJA 1NG7A 4HSRA 4LITA 4M6VA 1WJAA 4B48A 2IGOA 3HHTB 4E7IA 3LFUA 3AL0C 4LG3A 3J7AY 2PJRB 3OYGA 4HRIA 4DIQA 4ZJZA 3H4CA 3ZCOA 4DJAA 2ZPFB 1Z7LA 4XLEA 3SYTA 3OYAA 3H9JA 1WFXA 2CMPA 1D1BA 4E7KA 2XAUA 3AKZA 4XLHA 1V5FA 5CQGA 3C2GA 2HU9A 4C2UA 3E0JB 4CCOA 2G77A 4XOPA 4BEHA 4BBSM 4ANJA 3HPHA 3QYBA 5HOOA 2R7VA 2VXZA 3QZ9B 3HOSA 3DKXA 2ZCFB 2WADA 3K4LA 3L2WA 1DGWY 4RM3A 3LSKA 2LOOA 3VSLA 2ZPHB 3S3MA 4AVZA 4CCMA 3OYJA 3PNYA 3DPTA 3L2VA 2L7KA 2MABA 2CV1A 4BQQA 4CCJA 3OYMA 2LY1A 2VQLA 2ZSHB 3BG6A 3OR1C 3HL2A 1T95A 2WJ9A 4N4OB 1WJCA 4PFOA 1N77A 1MMNA 3K4KA 2GOMA 2M0MA 1YX3A 3K10A 3OYKA 2HDWA 1MNEA 4BJTA 2LRDA 1Z3YA 4NUBA 1EA3A 3VYSB 3K70D 3MKWB 2CZ6B 1D0YA 2OC6A 2LG4A 3DPLC 3HBLA 4ZC3A 1X1AA 1LKXA 4HNVA 3ONQA 3FHNA 4ZGJB 2VJJA 2DPPB 4BL0B 4XORA 2V6EA 4PJJA 1T0FC 4P5OA 3OWTA 2AQEA 3VSKA 5EJCA 4BEHB 1DP3A 4MIMA 3D5RC 4HNTA 3QODA 2IS4A 1G59A 4YEJA 2KLOA 4BBRM 2JVGA 4RLFA 4OB2B 2R7QA 3K70C 3DLAA 2UV1A 3BCAA 4B47A 1DQUA 2HVSA 4P17A 2HZDA 5HLTA 2VQCA 4BJ5C 3HPGA 2Z1DA 3K4JA 3A8HB 4IX7A 2D0QB 3KYLA 2MYSA 1E7PA 4CCNA 1V5EA 2R7XA 2XF7A 1K6YA 3M1CA 3UNGC 2A6TA 3I3LA 2DD5B 2KL4A 3DTEA 1Y6IA 2VLAA 2FUG2 2RQQA 4AYBA 3OL4A 4II3A 1IRXA 2KPMA 3VYRB 2CZ0B 2DXCB 2XDVA 1MMAA 2LC2A 2HPIA 3UR3C 4ZDOA 4QSHA 4ZDLA 4HG2A 2HPMA 2QFZA 4E7ZA 3M8JA 4DBRA 2BS4A 3TL4X 1MW7A 1HA8A 4E7SA 3A1YA 3PJRA 3FKJA 3EUKL 3CZ6A 4LIVA 1BR4A 2X1EA 1FMVA 2K9MA 4XR6A 4MFDA 2CYZB 3A8LB 3BCBA 2M3AA 3OIPA 3CP2A 1D1AA 4ELJA 3ZR8X 2ELJA 2X6YA 3OYCA 3WVDB 2ZPEB 2ZXHA 2WB1A 2BW3B 3MD2A 4OB0B 3DQVC 3FDYA 4OAZA 4PFPA 4BJ6C 3WVEB 1GLNA 3H9GA 3LSIA 4HEA2 3OYNA 3W3CA 3LSGA 3SEQA 4BXFA 4GRIA 3L2UA 2E60A 1V5GA 2CUZA 3X28B 2VJ5A 3S93A 2XSJC 2ZSIB 2VPLA 2VXDA 3HOTA 3OYLA 4BDZA 1SAUA 4F91B 3EUHC 3W2AA 3RPUD 4YRVA 3S8PA 2UWMA 4PJLA 4X0GA 3VYHB 2DD4B 3OIQA 2X1CA 1WJFA 3H5AA 1WJEA 2MC4A 5CQEA 2K3PA 2LYCA 1X4PA 2JSPA 5KHDA 4D9JA 1LVKA 1WJ5A 3RSNA 4HNUA 2QDJA 1LFPA 1VZ0A 4KJZA 4DOZA 3AL0B 3OMYA 5KCMA 2CW7A 5TGTA 3DTKA 4U87A 4ZGEB 3ZRGA 4ZTFA 2K9LA 2AQFA 2BS3A 1UG0A 4KITB 3HB9A 4ZDPA 3SDBA 4QPQA 2M7AA 1X1CA 1SFKA 2IXSA 1UAAA 2LBFA 2DT6A 3G2BA 4R79A 4BE1A 4F92B 4PUSA 3LSHA 4DGWB 1X19A 2IS2A 2XF6A 4XKVA 3ZQQA 2HQAA 2W82A 2ZXIA 1QU3A 2WAFA 3QYHB 1BR1A 1QHGA 2ZZDB 4P1WA 3BC8A 3C2HA 4FETA 4PJNA 4XKCA 3H0DA 4J01A 2E5ZA 2QQ8A 1PYVA 1X1DA 3AFHA 3FBNB 4PSWA 2R7WA 2BOLA 4DBQA 3A8MB 2Y0SA 3FBIB 1X4OA 1Z3XA 4BQNA 3VKGA 1R6RA 4F55A 3ZGKA 2QF7A 3OY9A 3N05A 3W2WA 3BG5A 3MMYB 3K6GA 3RCOA 1V29B 2QKLB 4LIUA 2AHJB 2M4GA 1BOBA 2WY7Q 4XNFA 5FRNA 5HVQC 1ZELA 4E6KG 3CESA 2X85A 2F4IA 1IREB 3K4CA 4AKHA 2KMUA 1X1BA 4Y4RA 3OYEA 2CV2A 3TBIA 2VKDA 2X51A 5HNHA 1AHJB 2ZPGB 2VJIA 3I9V2 3IP4B 4OWRB 2R7TA 1UELB 2OV7A 3NWTA 3DU5A 3X26B 2V1NA 2CV0A 1W36D 2HNHA 2LH9A 4F3QA 4CZCA 5KNLA 3MKZA 4G6TB 4PSXA 4KISA 2JA2A 3VWBA 4PJMA 2CH0A 1MNDA 3OYFA 4IKFA 3DPUA 3OS0A 3V42A 2VKHA 2DJIA 2CS3A 3HC7A 3OR2C 3EPZA 3IUOA 3K4NA 5FROA 1KONA 2F5VA 2CZ1B 2PMZA 2IGMA 1WJDA 2WA0A 3F9KA 2PJRA 2V9KA 4BU2A 2IGKA 4CCKA 2OUMA 1UGPB 4IZZA 3CMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z6Y A;  2QQ8 A;  3QYE A;  2QFZ A;  3HZJ A;  4P17 A;  5EJC A;  4HL4 A;  1FKM A;  4NC6 A;  3QYB A;  3QWL A;  4HLQ A;  2G77 A; 
#chains in the Genus database with same CATH topology
 3OS2 A;  4Z6Y A;  4ESB A;  2DYS H;  4EJW A;  2ID6 A;  3HWS A;  2KJC A;  4A3C J;  3HHG A;  4MFE A;  4ROC A;  1ZMW A;  1SXJ B;  2ZPI B;  4UB8 C;  3K4B A;  1BW6 A;  2DMT A;  2UZB B;  3JRG A;  1TW3 A;  1BI2 A;  4XOT A;  3TW6 A;  3M03 A;  3K9T A;  2MH2 A;  5FKK A;  4YEL A;  4ON0 A;  2FA5 A;  3CO7 C;  1GH6 B;  3C3D A;  3FRH A;  2ID3 A;  3U6P A;  4Y15 A;  3OYH A;  4JP0 A;  2L0K A;  3A8O B;  2M45 A;  3ZH9 B;  2XKO A;  1WJB A;  2A5W A;  4I76 A;  2DNA A;  2WSF F;  4OOI A;  4FCT A;  1Y0U A;  4KIG A;  3TWK A;  3T38 A;  1ETV A;  1HKS A;  1Z91 A;  1WI3 A;  3A4C A;  5DYG A;  1BR2 A;  3E6C C;  1SD4 A;  5FRM A;  3SYK A;  5KQ8 A;  2EZI A;  2Z3X A;  3D5S C;  3MWM A;  2VUM J;  4Y28 F;  3GTP J;  3DEE A;  1H1R B;  2R7G A;  3G71 I;  4FE4 A;  5HNF A;  3GXO A;  5DTD A;  4DUY M;  4FWH A;  4MM3 B;  4PK4 A;  3BG9 A;  1V34 A;  1FIN B;  3M3Y J;  2VE9 A;  3FHZ A;  3PSF A;  4G4O A;  2DOF A;  1OFI A;  1H26 B;  2JTV A;  2QCO A;  3ZN1 A;  2PX9 A;  3SHF A;  4AC0 A;  4KN7 X;  1FY7 A;  5EGO A;  1G4A E;  2GQQ A;  4AM3 A;  1LTM A;  1J09 A;  3TWM A;  4EIW A;  2GXG A;  3BG3 A;  2BY3 A;  5IT3 A;  4OB3 B;  2YX7 A;  1MBG A;  1T98 A;  3RGS A;  2Y0M A;  4I09 A;  3DXJ F;  4AG6 A;  1Z59 A;  3L29 A;  4CYC B;  1UHM A;  3GEZ A;  2OPT A;  3DBH B;  4BS9 A;  2Q2E B;  3LSM A;  4FAS D;  2DI0 A;  1RI7 A;  3OYB A;  1ZQ9 A;  4EOM B;  2NOJ B;  1D1C A;  2DA3 A;  3K7A M;  1SVM A;  2GZW A;  1RIO H;  2CUJ A;  5IT9 S;  3R0A A;  2L4A A;  2ZC2 A;  4LK1 F;  4MLO A;  1F5T A;  2X0L A;  3G4S I;  3I04 M;  2PN6 A;  4DV6 M;  3LMM A;  3QYE A;  1DGR M;  1TQM A;  4F7J B;  3AOG A;  2RNG A;  5AON A;  3SDG A;  2G5G X;  4M9X A;  1IXR C;  3KEQ A;  2QQ9 A;  1W1W E;  4JK1 X;  1WVR A;  2VOO A;  5EZH A;  4A93 J;  1S7E A;  1K6O A;  4NST B;  2I7N A;  1MDM B;  1X37 A;  2D45 A;  3L9F A;  2AXL A;  4AG5 A;  5DM7 F;  1JB0 F;  1IDZ A;  1QLB A;  4BCN B;  1R7J A;  1F43 A;  3IRR A;  4BAC A;  2DXI A;  3HHY A;  2KIS A;  4B7G A;  5J6X A;  1HBX G;  3IWF A;  2DVW B;  4DYQ A;  4F93 B;  4N0B A;  2W85 A;  4BY1 X;  5HBJ B;  2CRG A;  1L2B A;  2PK2 A;  3PSI A;  1C9B A;  1VQ1 A;  2BVM A;  4I5S A;  2D7E A;  4RB1 A;  1XGM A;  5L3E A;  2X49 A;  3GLG A;  3GPU A;  4A3B J;  4D7M A;  4LG0 B;  1S3S A;  2VN2 A;  4RB3 C;  1OPC A;  2R4J A;  3EUA A;  1K82 A;  1JGS A;  1TTY A;  2FQ3 A;  3T15 A;  5IDP B;  5ILV A;  5JVT A;  2C9O A;  3SEZ A;  1UGR B;  1TWC J;  2GBY A;  2Z2S B;  1W7P B;  5F64 A;  4UUS B;  4HAM A;  1T2K A;  1N25 A;  3CCL I;  1IM2 A;  1W5C C;  2YR0 A;  1TWG J;  3E6M A;  4B09 A;  5M5W J;  1CF7 A;  1K4T A;  4O6J A;  4YIR X;  2OQ4 A;  4FX4 A;  3THG A;  5ITR A;  2ZXJ A;  4BUP A;  2HS5 A;  2I5U A;  4DZP A;  5EDN A;  4G7H F;  1ZV1 A;  4AKG A;  3LAP A;  1S9H A;  2KDZ A;  1SAX A;  1UMQ A;  2R5Y A;  1MBJ A;  2DMU A;  1LDK B;  1DUX C;  4A3L J;  2BZT A;  2JGZ B;  5EP2 A;  4DR2 M;  2LKX A;  1HCR A;  4XSZ F;  1J7K A;  3NBX X;  4IJE A;  2DKL A;  4LZZ A;  3CJQ B;  1A6I A;  3ZXS A;  3ZOB A;  2OTJ I;  3QXE B;  5JLX A;  3GLH E;  1MD0 A;  4AW4 A;  3LA2 A;  4LJA A;  4M3D A;  5HS8 A;  3HUG B;  2BY0 A;  3P9K A;  4BLC A;  1EKE A;  5CKT A;  1T3T A;  3FXM A;  2XZU A;  1HNX M;  3QPH A;  1L3L A;  1I27 A;  2Z9O A;  3JR9 A;  4S12 A;  3SHG B;  2PMH A;  3I0T A;  1ENW A;  1OLT A;  2J5O A;  3I51 A;  3NWL A;  4CFU B;  1K3W A;  2R7O A;  3BJO A;  3IAS 2;  1XXH E;  2C98 A;  3GVA A;  1G3S A;  2PHG A;  2X6W A;  4OMZ A;  3ZMZ A;  3U9G A;  1I1G A;  2F5E A;  1ZHF A;  3KEY A;  5EEA A;  5KAI C;  3WGI A;  1NH3 A;  1FYM A;  2O3F A;  4HW0 A;  3RQI A;  4O3M A;  1LEB A;  4WXH A;  3A8G B;  3OS1 A;  3SAV A;  5L2W B;  2LHG A;  4ETS A;  2QA4 I;  3JW4 A;  4RA2 A;  1ZRD A;  1LB2 A;  1N78 A;  2NRA C;  1J59 A;  3UMM A;  1OJL A;  1PJJ A;  4Y13 A;  3VYU B;  4FTH A;  5EP1 A;  1L1Z A;  4FHT A;  4U0W A;  3NQO A;  4HV5 A;  2GIV A;  2R18 A;  1S5L C;  1G8X A;  1R4G A;  2W7N A;  5FLX S;  2EFQ A;  3KXE C;  3H5R A;  4JX5 A;  2R5Z A;  2JJ7 A;  3FK6 A;  3JAM Z;  3D5L A;  5K7Z A;  5LMK B;  1H0M A;  1G41 A;  2M0C A;  1Z21 A;  2BV6 A;  5J4V A;  2Z4S A;  3FD9 A;  1OFH A;  4G12 A;  1BI1 A;  4E7H A;  1H88 C;  1WIV A;  1VI0 A;  2DFE A;  5LQF B;  4B7F A;  1JJ6 C;  4G4N A;  1U8B A;  1H25 B;  2ZCW A;  2YSR A;  3DJB A;  1NG7 A;  2JT1 A;  2QZ8 A;  4HF2 A;  1FVV B;  4E7I A;  3LFU A;  4LG3 A;  4DR7 M;  4A69 C;  3BTJ A;  3OYG A;  1O9K A;  5E1Z B;  2FNP A;  3HHH A;  4ZJZ A;  3E6D A;  3I55 I;  3MHV C;  2Y48 A;  1ZAE A;  2DAK A;  5F0C A;  3ZCO A;  4AVP A;  3CO6 C;  3BBZ A;  3SXY A;  3QHW B;  1P5E B;  3SYT A;  3H9J A;  2C96 A;  3FM3 A;  1JTX A;  5IP7 J;  2WIP B;  4E7K A;  4A3M J;  4CHU A;  1Q3C A;  2GA1 A;  4XLH A;  4C2U A;  4NSR A;  4WW0 A;  2DO7 A;  2ZXW H;  3IWZ A;  2LWX A;  3L7W A;  2Y31 A;  5E1X A;  1JR3 D;  2HQ5 A;  3P5J A;  4BEH A;  4BBS M;  4Q5S F;  4ANJ A;  3EOC B;  2FMY A;  3QYB A;  5HDG A;  5HOO A;  3H4M A;  2NNY A;  1XG1 A;  1NHG C;  3QZ9 B;  3DKX A;  4W97 A;  2ZCF B;  3H0G J;  3K4L A;  4ZYG A;  1MJG M;  2K9S A;  3L2W A;  4BXX J;  1HKQ A;  1LE8 B;  3M7G A;  3G1L A;  2QVO A;  3LOC A;  3OOP A;  4BBR J;  4ZYE A;  5IP6 A;  3Q5F A;  1JI8 A;  2C5O B;  1L2D A;  2L7K A;  3BWG A;  2AS5 F;  2OCC H;  1YTY A;  4BQQ A;  4CCJ A;  4Y17 A;  4DQ2 A;  4YFX F;  4OIO F;  3G33 B;  2EV5 A;  3GZ6 A;  2FBK A;  3U6C A;  1T95 A;  3OR1 C;  5CYV A;  3HL2 A;  4PFO A;  2E2H J;  1N77 A;  3L25 A;  2DZL A;  5TIS C;  2O9L A;  1MMN A;  4ZH4 F;  4EOL B;  1NK2 P;  3HHZ A;  5C3E J;  2H1L A;  2V1U A;  1T0F A;  3ECH A;  1JUP A;  4BJT A;  3RJP A;  5EGO B;  4NUB A;  4FX3 B;  3ZMD A;  1YO5 C;  2RC4 A;  3LNQ A;  2RKH A;  3BTL A;  3J81 Z;  3MKW B;  5LHI A;  2X6O A;  2KZU A;  5JLW A;  5BPD A;  3HX3 A;  1KU7 A;  2LVS A;  3B57 A;  1Q39 A;  2F5O A;  2DPD A;  4ZC3 A;  3J80 Z;  1XMX A;  4TTH A;  4HNV A;  1QMZ B;  1F4K A;  4XRF A;  3RYR A;  2R7D A;  4IL6 C;  5JR3 A;  3HGI A;  3L2A A;  1FOY A;  4BL0 B;  4PJJ A;  2EIM H;  1T0F C;  2ZBK A;  3OWT A;  3T0Y A;  3OSF A;  2XFT A;  3KZI C;  3GLH A;  2F4V M;  2HTJ A;  1VDD A;  1TWF J;  4JI8 M;  5EJC A;  1X3W B;  4MIM A;  5CVJ A;  3WTU C;  2ELH A;  3I4P A;  3ZN0 A;  4II7 A;  2LK2 A;  4HNT A;  4KLN A;  1RKW A;  3WHC A;  3L28 A;  2A3S A;  2N35 A;  1XTA A;  2QNJ A;  2JVG A;  2UZK A;  3GZ5 A;  4IIW A;  4YG2 F;  3RKX A;  2UV1 A;  2UXN A;  4B47 A;  1DQU A;  1XXH A;  4IOC F;  1UNH D;  4GFB A;  5HLT A;  3AOE A;  3C1D A;  3S14 J;  4ENM A;  3CCS I;  2D0Q B;  2CE7 A;  3HJE A;  1R00 A;  3KYL A;  3ZQI A;  2R0Q C;  1VQN I;  2UZD B;  1OQY A;  1MNM C;  3K69 A;  1F36 A;  3IKT A;  2O01 F;  3FXR A;  2FFJ A;  4GKJ M;  1HW1 A;  2XUB A;  1VQ4 I;  3V8L A;  2OD5 A;  3GFM A;  3HOV J;  4A6E A;  3IH4 A;  2F5N A;  1SFO J;  1VEG A;  5J1R A;  4II3 A;  1IRX A;  1Z7U A;  1DPU A;  3AOE C;  1E3O C;  1MX0 A;  2ADU A;  3WHB A;  1ACI A;  2LC2 A;  3WU2 C;  4ZDO A;  2MG4 A;  1Y0N A;  2CYY A;  3S2H J;  4LF8 M;  2ECC A;  2JUC A;  1BC7 C;  2CGP A;  1PVE A;  4GEW A;  4GGG A;  4O5V A;  4NHJ A;  3BHT B;  4K0K M;  1SFU A;  3SQN A;  2C5N B;  4BKX A;  3A1Y A;  5FJ8 J;  6PAX A;  5KPR A;  2GAU A;  2X1E A;  1FMV A;  1QZM A;  2CUE A;  4CO8 A;  1U78 A;  1CF7 B;  3HSR A;  1FYK A;  2UZE B;  3A8L B;  2K47 A;  2L09 A;  1H1Q B;  1OI9 B;  3OIP A;  1W0T A;  1BU2 A;  2PFB A;  1USS A;  3C18 A;  2IA0 A;  4L16 A;  1TWH J;  4J19 A;  2R5Y B;  3B02 A;  1IBL M;  4QOZ C;  1BN5 A;  5B1A H;  1QPM A;  2P81 A;  3OYC A;  3UKG A;  3MK6 A;  1WWX A;  4CRL B;  3AAF A;  4EOK B;  3MD2 A;  5H6R A;  4XRS G;  3J81 K;  4P96 A;  4OB0 B;  4A0Y A;  4BJ6 C;  5HQ0 B;  2ZAN A;  2EJR A;  1H9G A;  5LHH A;  4DYC A;  2K9N A;  3J80 K;  1MBK A;  3K7A J;  1ZP2 A;  4A3G J;  4L78 A;  3QAU A;  1DGG A;  2FRH A;  3L2U A;  3A01 B;  1V33 A;  1T08 B;  2E60 A;  2ZJP F;  4AUX A;  2CUZ A;  2F4M B;  1BA5 A;  4DV3 M;  2QUF A;  5AIQ A;  5HBH B;  5C4J J;  2XSJ C;  5TJJ A;  4L5I A;  3HOT A;  1WI9 A;  3OYL A;  5K7F A;  4BDZ A;  5IDN B;  4F91 B;  1J5E M;  5IT9 Z;  2VQE M;  3S2D J;  4DV5 M;  4EV0 A;  1J0R A;  4PJL A;  4X0G A;  3VYH B;  3GQ5 A;  3S15 J;  2CJM B;  2X1C A;  1WJF A;  4HF0 A;  3V7C A;  2DPU A;  1TLH B;  3T5X A;  4KMF A;  3PO3 S;  3RPU A;  2HAK A;  5FGK B;  2RKO A;  3WTY C;  1JKO C;  1AOY A;  3PIO F;  2R3S A;  5GPA A;  1R4N B;  3MCZ A;  1LVK A;  1GT0 C;  1SMT A;  2LDU A;  3OMY A;  4S0H B;  2R5Z B;  2FBH A;  1GJS A;  2Z5U A;  1HSJ A;  5TGT A;  1O7F A;  4R1H A;  1I4W A;  3BZC A;  1K4S A;  3POM A;  4G7O F;  4EON B;  1WZ2 A;  1Z77 A;  2AQF A;  3ASO H;  2A68 F;  4XID A;  2HDC A;  3SBJ A;  2HGC A;  2C5V B;  3I64 A;  3SDB A;  2IXS A;  3QHR B;  4LGM A;  1YIO A;  4NDL A;  3G2B A;  1X2N A;  4WWC A;  4GMQ A;  3L1P A;  4F92 B;  4EGY A;  2BHZ A;  3LSH A;  5FFX A;  2EUF A;  4CDG A;  2XF6 A;  4XKV A;  1O9K B;  1X1P A;  3HJQ A;  3ZQL A;  5IRE B;  2ZXI A;  4XK4 A;  3CF5 F;  2WAF A;  4F1I A;  1OKW B;  4F6U B;  2E34 A;  1BR1 A;  3GLF E;  1WGX A;  5JFR A;  2ZO4 A;  1B6A A;  2IEK A;  4P1W A;  3BC8 A;  2IN3 A;  4FET A;  2Y2Z A;  3FF5 A;  5IOZ A;  4UN0 A;  2E5Z A;  2PBI A;  3JRE A;  3K9P A;  4DR3 M;  1FBS A;  4CFW B;  1YIJ I;  1FBU A;  4DBQ A;  2Y0S A;  1KU3 A;  4XBO A;  2A05 A;  2DFI A;  5F27 A;  1Y1V J;  5DM6 F;  3LWF A;  3BPV A;  2XGE A;  3D0S A;  1DGF A;  4B3A A;  4CFU D;  1A5T A;  1T56 A;  3VKG A;  1R6R A;  4F55 A;  4NXN M;  3PM1 A;  3ZGK A;  4XBF A;  5FLV A;  4IJF A;  3OY9 A;  3BDD A;  3FXK A;  2HKO A;  1K78 A;  2W57 A;  4NSO B;  3K6G A;  2DEN A;  4DBG B;  4DV7 M;  3GO5 A;  2FJ1 A;  2XGN A;  4ESJ A;  2DLL A;  3KEO A;  2X85 A;  3CCV I;  5CYI B;  4AKH A;  2KIF A;  1OTR A;  3ZMU A;  2HEO A;  2AHM A;  4UVB A;  3TBI A;  3LA7 A;  1ETX A;  5FKN A;  3AG1 H;  4D0P A;  2OQG A;  2JMW A;  3BR0 A;  3FUX A;  4HQE A;  3CUQ A;  3IP4 B;  4OWR B;  4NXM M;  3KP6 A;  3WTT C;  1HST A;  2CV0 A;  5DUK A;  3MAJ A;  5ILS A;  4L9V A;  2LVP C;  4F3Q A;  3MKZ A;  2D1H A;  5F6F A;  3RKQ A;  5IT9 K;  4A2U A;  4UXN A;  3RGP A;  3K1P A;  3V8J A;  2XB5 A;  4I4L A;  1JT6 A;  4NL4 H;  4BHP A;  3B6C A;  5DD4 A;  4M3G A;  2JZY A;  1O3S A;  2E36 A;  5E26 A;  3OS0 A;  4XRM A;  3V42 A;  4FIS A;  3CGW A;  2CS3 A;  3HC7 A;  5FKO A;  3CUQ C;  5IPA A;  1BW5 A;  3COA C;  5FRO A;  1FTT A;  3BR6 A;  3FUT A;  2PMZ A;  3O3K A;  4MGR A;  5FLX Z;  2IGM A;  4IMY B;  2ZBK B;  8CAT A;  2F5S A;  3LCV B;  3T1Y M;  1X3Z B;  2CG4 A;  2JN6 A;  2WA0 A;  3GFJ A;  3GLH B;  2LHC A;  3MN2 A;  2OBP A;  2LH0 A;  3BR3 A;  2ACJ A;  2H8W A;  2LFB A;  4DR4 M;  2BWE A;  1OCP A;  3HRS A;  3WTZ A;  2TRT A;  1P92 A;  2K02 A;  4AQY M;  2Z16 A;  4F7N B;  2C5X B;  2UXC M;  2JWS A;  5H20 A;  4ZYA A;  5KO3 A;  2XLJ A;  1I3Q J;  2KHM A;  5LGN A;  4G7Z F;  2UXD M;  3T8T A;  2ELK A;  3DWL E;  1NG6 A;  5GAH J;  3DOA A;  1Z0X A;  4I98 B;  4XLP F;  2EO2 A;  4M9S A;  3I54 A;  3RI4 A;  1XXH B;  4HST A;  4JX4 A;  2Q2E A;  4XN3 A;  1K7A A;  2JA5 J;  1U9O A;  2VT3 A;  3TOA A;  1T8I A;  1VF9 A;  1YW8 A;  3V7R A;  3GPY A;  3EQL F;  3MEX A;  1ZKG A;  1AA7 A;  1WH7 A;  1YS6 A;  4V2G A;  4UV8 A;  5HLI A;  2A5Y B;  2DK8 A;  2FOW A;  2IP2 A;  4MQV A;  4D5C A;  4ZYD A;  1YI2 I;  4FVM A;  3HHX A;  3F8C A;  3QYF A;  2UXB M;  2V7F A;  3CJN A;  4M73 A;  4I81 A;  2WAQ A;  5LMN M;  3KS8 A;  5FTM A;  2CFO A;  4RB2 C;  4EM2 A;  3K1N A;  3KDS E;  3QP5 A;  3H3Z A;  4A5N A;  1UGS B;  5FGM A;  2FX0 A;  1JJ8 C;  2K0B X;  5LMU M;  1X2M A;  4LFA M;  2J7N A;  2M5W A;  4NNJ A;  4Q48 A;  2R7S A;  3VEP A;  4C3H J;  4CCL A;  3QPL A;  4YII A;  1F4I A;  4XKW A;  1RNL A;  4YIF A;  3I4M J;  2M8G X;  1OCZ H;  1TQP A;  4RS8 A;  2XHK A;  3HO8 A;  4LF9 M;  1FSE A;  1WSU A;  4FWG A;  2EA2 A;  2R7R A;  3ELK A;  3U1D A;  1IC8 A;  1R1T A;  3BR2 A;  5LLQ A;  3PO2 J;  1E32 A;  2KXE A;  4MO7 A;  1E9H B;  4M0D A;  3GLF A;  2WZJ A;  4A3F J;  1B8I A;  1YIT I;  1N32 M;  3FTD A;  1SEU A;  1FIA A;  5BPI A;  2M60 A;  2HQN A;  3IAM 2;  4BE0 A;  4HLQ A;  1WQ2 A;  1EIJ A;  1IFY A;  2LVO C;  4FCV A;  1U0J A;  1W7P A;  2KZS A;  2HXO A;  2L02 A;  1R7R A;  3DKY A;  3ZQJ A;  3GUD A;  4XLN F;  1O7L A;  1AKH A;  1QRY A;  2XH9 A;  1JOW A;  3ABU A;  5J4Y A;  1O4X A;  2R46 A;  1R58 A;  4F2L A;  1NHW C;  3F8F A;  1N33 M;  1F9N A;  3ESW B;  1FX7 A;  4S04 A;  1I5Z A;  3QYG B;  4HZF A;  5ILU A;  3GBG A;  2XEP A;  3LSR A;  3A2K A;  5FLX K;  1YX5 A;  3CF2 A;  2DXB B;  3ML6 A;  3CTW B;  4II2 A;  1R6B X;  3FUW A;  3KW6 A;  1E0E A;  3J7B A;  4DZJ A;  2IJL A;  4F52 A;  3GW2 A;  4QOS A;  2VF8 A;  2ME0 A;  1IUY A;  3TDU C;  3KPH A;  2XF3 A;  2V26 A;  3DBR B;  4ITV A;  2WY8 Q;  4NQW B;  4Z8X A;  1IAW A;  2HVQ A;  2RRE A;  2CQ7 A;  5BNG A;  5E17 F;  4RLQ A;  1W4M A;  2WAE A;  1XCV A;  3DKW A;  1P4A A;  1JKR C;  1V3F A;  3K9O A;  1FMW A;  3V8K A;  4A3J J;  2PMZ N;  1KGS A;  1GXP A;  4ZGD B;  2XC7 A;  4BHB A;  2F5P A;  3U6S A;  4P16 A;  1CGP A;  2CCH B;  4FWD A;  5ICE A;  2H1K A;  1B9N A;  5CLS A;  1ZGW A;  2FBI A;  2FSW A;  1HQC A;  1ERD A;  2K3F A;  2R45 A;  3W0L B;  3SAS A;  1VQ9 I;  4GH9 A;  2JXN A;  1NVM A;  4AID A;  2EPF A;  2L3D A;  1IN7 A;  3KHI A;  1H28 B;  3P9I A;  2PMU A;  3JCU C;  1ZG3 A;  3PUF A;  4C9Y A;  1ZR2 A;  3R9X B;  3KP1 E;  3L2Q A;  4HDU A;  1PJT A;  2DU9 A;  1Z6R A;  5C18 A;  2KNZ A;  2VC1 A;  1ZLJ A;  2GOX B;  3QAH A;  9ANT A;  2L2D A;  4S05 A;  4ROD A;  4LOC A;  2HQR A;  3AG3 H;  3LAJ A;  2L9N A;  1J5Y A;  3F8B A;  5F3W A;  4XLA A;  3TED A;  1GUX A;  2GM4 A;  1QDR A;  1IJW C;  2LRE A;  3H9Q A;  4EJO A;  1DV0 A;  2JRM A;  1WCM J;  3R6S A;  3IEC A;  1MJB A;  2EFN A;  2BW3 A;  2I8D A;  3BLY A;  4NC6 A;  1QGP A;  3M0E A;  2XGD A;  3HGY A;  4I99 C;  1I39 A;  1Y8Q B;  3QOE A;  2C99 A;  3GRR A;  4AU7 A;  4WX9 A;  2EZL A;  2VBX A;  1LFU P;  2XRN A;  1XGN A;  4XRS A;  1U3E M;  2IW8 B;  1ORK A;  1IRZ A;  1QUS A;  1L2C A;  4E7J A;  1U5T A;  4YHH M;  2XAG A;  2Y9Y A;  3FRI A;  4MGY E;  1OCC H;  5LD2 C;  2I53 A;  4CIS A;  4LK0 F;  1OCT C;  1K78 B;  2VE8 A;  4EM1 A;  4BYY A;  1QHH D;  4N4N B;  2WMB B;  3HRU A;  4KO8 A;  3SAU A;  3GF2 A;  1FYL A;  1L0O C;  4I3Z B;  4G4R A;  1D8K A;  1X3U A;  3CUQ B;  4Y52 J;  3R4K A;  5F0F A;  5DS9 A;  5K1Y A;  2CQN A;  5ERI A;  1GHC A;  3MIA B;  3SAW A;  1AUA A;  5B3S H;  1LE8 A;  2KRC A;  1R5L A;  3E1S A;  3CDI A;  4E7L A;  1ONV A;  1P9Q C;  2QEX I;  3EYI A;  1H4L D;  3SZG A;  1S6L A;  2OA4 A;  2XPU A;  4DV0 M;  1NNJ A;  5E79 C;  1FOK A;  1Z67 A;  3TOB A;  1ZTR A;  4FE7 A;  3SFI A;  3C3E A;  3FTC A;  2FE3 A;  3GTO J;  4ZTJ A;  2L6O A;  3C58 A;  3U6M A;  2XF5 A;  3VDX A;  4IQJ A;  1IN5 A;  5FKM A;  1WJA A;  3HJS A;  2KHH A;  1GDT A;  4BCJ B;  3AL0 C;  3J7A Y;  3B89 A;  2OU2 A;  4G3O A;  1BI3 A;  4WXD A;  2Y9Z A;  1YHQ I;  2H6C A;  2A6E F;  2J5Y A;  4IVN A;  1PGY A;  1OKV B;  1APL C;  4QNR A;  4DJA A;  1Z7L A;  4XLE A;  3BHU B;  1E3P A;  2CHQ A;  2OPF A;  2CMP A;  3W67 A;  3HKP A;  4M9Z A;  1D1B A;  1ZAO A;  3OIO A;  3RKW A;  3AKZ A;  3CC4 I;  3RKY A;  1UJ8 A;  4ELL A;  5DYM A;  4RKU F;  3E0J B;  4CCO A;  2RDP A;  3KP7 A;  5E8I A;  3ECO A;  4II5 B;  4RF0 A;  4X62 M;  4MTE A;  1Y1W J;  1MIJ A;  2RRU A;  2VXZ A;  3ZQH A;  1P4W A;  1UNG D;  2WIH B;  4I01 A;  3IG5 A;  3LSK A;  4DV2 M;  1PM5 A;  1TQI A;  5DYI A;  5DDG A;  3VSL A;  2ZPH B;  2R65 A;  4HOB A;  3S3M A;  1QAN A;  2Y30 A;  2QBY A;  5HLG A;  2K4B A;  2DI3 A;  2M2E A;  2CV1 A;  2OJE D;  4IBF A;  4BCQ D;  2ZAM A;  3EIH A;  1VQ6 I;  2NNN A;  1IY0 A;  3OYM A;  2LY1 A;  2VQL A;  2ZSH B;  1L1T A;  3FKI J;  3EID B;  5JHU A;  3LW5 F;  2DZO B;  3K2A A;  1VQ8 I;  2L7H A;  1V54 H;  4IHS A;  2M0M A;  3S1R J;  2HDW A;  1IDY A;  1MNE A;  4PD2 A;  2PG4 A;  3L2C A;  2JA6 J;  2DHY A;  3BLQ B;  4HEO A;  2B9R A;  2LG4 A;  2DFF A;  1TTE A;  1K79 A;  3Q0U A;  2O03 A;  5DFL A;  3TQN A;  4QNM A;  3GLF B;  1WJ7 A;  1B8I B;  2CFX A;  2VJJ A;  2KEB A;  4LRS A;  5IYC J;  2VBZ A;  4NRV A;  2AQE A;  4DYR A;  4CIZ A;  2GLO A;  1I6X A;  5CVI A;  5E3O A;  2XB0 X;  2EH3 A;  3R61 A;  4F7S B;  5KQD A;  1AKH B;  4V2F A;  3W6K B;  3CCU I;  5FD6 A;  5LGT A;  3F6O A;  2IS4 A;  1YS7 A;  2G3Q A;  1JTY A;  4LFB M;  3BXW A;  3LQQ A;  5F0H A;  5K7H A;  2UU9 M;  4RLF A;  1YJW I;  1ZG5 A;  2V9P A;  2BXY A;  5ICC A;  3K70 C;  4L18 B;  1R36 A;  2EIJ H;  4L8R C;  1IY2 A;  2AO9 A;  3ABM H;  3HYI A;  3QPT A;  2STW A;  3LA3 A;  3BT9 A;  2WV0 A;  5EXT A;  3CD6 I;  3HPG A;  3LVW A;  2M87 A;  1TW2 A;  4IX7 A;  1VQ5 I;  1QQW A;  4HQM A;  5FTJ A;  4I7H A;  3PXG A;  4LMY A;  4LJZ F;  1S29 A;  3A01 A;  2GWR A;  3SZP A;  3JTG A;  3KFW X;  5F08 A;  4EGZ A;  4YOO A;  3H3U A;  1N4M A;  1K6Y A;  3RDI A;  4IBE A;  2DD5 B;  3DTE A;  2V79 A;  1XHB A;  1ON2 A;  4KIF A;  1ZK8 A;  2RQQ A;  1T38 A;  1EH8 A;  4KRD B;  1DGB A;  1OCR H;  2CZ0 B;  2HWV A;  1BJA A;  1IW7 F;  4BAY A;  4UY8 I;  3UR3 C;  1VQL I;  4HG2 A;  4E7Z A;  1VEJ A;  4MGZ E;  4BCI B;  2VC0 A;  3TL4 X;  3NDQ A;  1TL8 A;  1WPK A;  3I53 A;  4L5E A;  2L7Z A;  2OAZ A;  1DU6 A;  4XK8 F;  1TF0 B;  3PJR A;  2LKP A;  1QVT A;  7CAT A;  3VOE A;  4ROE A;  1KYI A;  3KP3 A;  1QDT A;  2DHR A;  3BCB A;  4XSX F;  3U6L A;  4KUM A;  3WTV C;  3NAU A;  2C9C A;  2M3A A;  5LGU A;  2Z4R A;  4IBD A;  3EET A;  1GUX B;  3BLR B;  4F70 B;  1TFB A;  1UHW A;  5GAG J;  1EE8 A;  2QQB A;  2F5Q A;  3WVD B;  1GO5 A;  4C2M J;  1HJP A;  3KOW E;  2ZXH A;  2RGV A;  2BW3 B;  3CQZ J;  1I1S A;  3DQV C;  3F6V A;  3FDY A;  3KZY A;  4IHY A;  1GLN A;  3LSI A;  1FP2 A;  3HTU A;  3OYN A;  3KET A;  3ROU A;  4R71 A;  2ZME A;  3W3C A;  3I56 I;  3S1Q J;  3LSG A;  4JXJ A;  3LQ5 B;  2HOA A;  4A12 A;  4FW9 A;  1Z9C A;  2QSF X;  1U5T B;  1V5G A;  3X28 B;  2VJ5 A;  1W0U A;  3FTF A;  1YJN I;  2YFQ A;  4LG2 A;  2EIL H;  1HDD C;  2VPL A;  2JNH A;  2VXD A;  4BQA A;  3G1O A;  2L4M A;  3HDD A;  1SAU A;  2M34 A;  2V9V A;  3I4V A;  2DMQ A;  4EOS B;  4F6W B;  3RPU D;  4YRV A;  3F8M A;  1MH4 A;  3S8P A;  1RUN A;  1G3T A;  4ENK A;  3A42 A;  4IHT A;  1SAN A;  3OIQ A;  2ZME C;  4ENJ A;  1H6U A;  3J2P B;  2COM A;  4RGR A;  4IOA F;  2C6T B;  2CSO A;  4Q47 A;  2NYX A;  2DYR H;  5ITU A;  2DA4 A;  3IRQ A;  2LYC A;  2W25 A;  1X4P A;  2JSP A;  4P9U A;  1OMI A;  4D9J A;  5IHY A;  1WJ5 A;  2CWB A;  1SD7 A;  5ICG A;  1LFP A;  1VZ0 A;  2JY7 A;  4LF4 M;  4KJZ A;  4DOZ A;  3AL0 B;  1D8J A;  4Q7J A;  4MGH A;  2IA2 A;  4NOO B;  4B3R M;  4U87 A;  4QTR A;  3RZO J;  2H1R A;  3ZRG A;  4ZTF A;  2Z99 A;  4A3E J;  3EIE A;  1GXQ A;  3GP1 A;  2K9L A;  5K5O A;  4FCW A;  3GLI B;  2XPW A;  4MTD A;  3GTK J;  2BS3 A;  3QU3 A;  2M7A A;  2K85 A;  2DT6 A;  4R79 A;  4BE1 A;  4BNC A;  2QYO A;  3Q8X A;  1DPR A;  2P5K A;  4L4U A;  4I0A A;  5BNJ B;  3RGF B;  4ESF A;  3LCU A;  3KYD B;  3K2Z A;  5JVG F;  3ZQQ A;  2G9X B;  1IBM M;  1QU3 A;  1V55 H;  2Z3Y A;  4YC3 B;  5FO5 A;  4GHA A;  3R0J A;  2ZZD B;  3O2P E;  3W6V A;  4XKC A;  2ISY A;  3C2H A;  3KVW A;  4PJN A;  4J01 A;  4OGR B;  3FBN B;  2O25 A;  2QQ8 A;  1XSD A;  4JV5 M;  4PSW A;  1GVN A;  2VT2 A;  4Y72 B;  1WRJ A;  2BBY A;  2BOL A;  3A8M B;  3P9C A;  3HHW A;  1GV2 A;  2WV1 A;  1RR8 C;  2MR9 A;  2EV0 A;  2DWL A;  2BXZ A;  2LLK A;  2H09 A;  1SXJ D;  5C1B A;  4YOZ A;  2KRF A;  2VON A;  4BCK B;  3KYC B;  2QF7 A;  3FUU A;  3BG5 A;  1XDU A;  1ZAR A;  3LQR A;  3MMY B;  4BHC A;  4IBK A;  3FIS A;  3OV8 A;  4B1R A;  3GFL A;  1G2H A;  2WY7 Q;  2EA0 A;  2W84 A;  4XNF A;  2ISZ A;  1ZEL A;  4X66 M;  3J7Y J;  1MSF C;  5FRN A;  3KOZ E;  2WFY B;  2QBY B;  1ZRF A;  2QP9 X;  3C3W A;  1KSF X;  2FEZ A;  2CV2 A;  2YU3 A;  3FMQ A;  1PP8 F;  2XRL A;  1FLI A;  2UUA M;  2L4E A;  5B66 C;  1XWI A;  1HW5 A;  2VOD A;  2QGU A;  2LKS A;  5F1R A;  3QPS A;  3Q0V A;  2PQ8 A;  2V1N A;  1RRJ A;  2HNH A;  5L3C A;  5KNL A;  1EJ9 A;  2Y69 H;  2APL A;  2WEV B;  5A2Q S;  1HC8 A;  2DZN B;  2R0I A;  4PSX A;  2QLZ A;  4C3I J;  4I6Z A;  2JA2 A;  5EQT A;  1TP4 A;  2X48 A;  5EXS A;  1QZY A;  1WH5 A;  3I58 A;  4LJ4 A;  4LJ5 A;  1WXQ A;  3HRT A;  3OYF A;  4IKF A;  2VKH A;  1O3R A;  3L09 A;  3F5X B;  3D1N I;  1LPQ A;  3R8F A;  3FMS A;  2CZ1 B;  2DFH A;  5FSW A;  2W99 A;  3WGH A;  1W5S A;  1F1Z A;  4PDK A;  4LFU A;  3E9S A;  4BU2 A;  1TC3 C;  2OUM A;  3DV8 A;  4IZZ A;  2ZPG B;  1LDJ A;  1HNZ M;  3CMM A;  5D5U B;  1XDS A;  2XRO A;  3WGG A;  4OU7 A;  4AI6 A;  2HVR A;  2ZJQ F;  2CQX A;  5IYB J;  4EOP B;  1W5T A;  2BS2 A;  3H5N A;  4QPO A;  3A02 A;  1NJF A;  1YLF A;  2JVH A;  2R7U A;  4GYI A;  1OAI A;  2HYG D;  2XGX A;  2DA5 A;  3CDH A;  3HOX J;  1S3J A;  1IN6 A;  3O8H A;  2E5N A;  2LNB A;  1T33 A;  1XN7 A;  1Y8R B;  4CSW A;  2JA8 J;  1IY1 A;  4DV1 M;  2MJ5 B;  3M4O J;  1QVU A;  1TDZ A;  4JI3 M;  3B7N A;  3KS4 A;  4IBJ A;  4D80 A;  4GHL A;  1C1K A;  2CQQ A;  5BR8 M;  2VKE A;  1HLV A;  2KZV A;  4D1Q A;  2XSZ A;  1LUJ B;  2Y0Q A;  1MJA A;  1U6G A;  4L6V 6;  4F7Z A;  4YY3 M;  3HEF A;  5BPV A;  4P55 A;  2CZ7 B;  1YE9 A;  1FT9 A;  3ZP5 A;  1H9T A;  1ULY A;  4NRW A;  3T1B A;  4IO9 F;  4BCN D;  2HYF A;  1GJT A;  3U61 A;  4JX6 A;  4DW6 A;  3PNV A;  1YUB A;  3GFI A;  4BCM B;  2CUF A;  4LJ8 A;  4QHT A;  1NY5 A;  4XGI A;  1RPW A;  5M3M J;  3OYI A;  1J75 A;  2IS1 A;  4BY7 X;  4NQW A;  4ZPX A;  1IZ1 A;  2DAO A;  2JY5 A;  2VQF M;  2QKM B;  3MVP A;  2PK9 B;  3CCR I;  5BMZ A;  3OOU A;  3QZ5 B;  2OOB A;  3G73 A;  2WTE A;  5KPT A;  2O8X A;  2ZFU A;  3TW7 A;  2MW8 A;  5GPC A;  3A45 A;  2COB A;  1G3I A;  3GTQ J;  2IRF G;  1HT1 E;  1PJR A;  4X64 M;  1W7P D;  1ETY A;  1R5H A;  2DDA A;  4NC7 A;  3RYP A;  2EFW A;  5BS6 A;  1PJI A;  4KIC A;  3GRV A;  2DCE A;  2ZFW A;  5FKL A;  5D8K B;  3OYD A;  3HZJ A;  1QA6 A;  5F04 A;  3DZD A;  1PDN C;  2QWW A;  2E1M B;  4HX8 A;  2D5V A;  1OIY B;  5CEI B;  4AIH A;  2WHB B;  4C3J J;  1Z1D A;  4Y33 A;  1D2N A;  1ZMU A;  1TT0 A;  2P6S A;  1KU2 A;  2ZME B;  5M5X J;  2FS1 A;  5GKN A;  1XNQ M;  2GIZ A;  4GIT A;  2EZK A;  2VQG A;  4HA8 A;  5D4S A;  1K61 A;  1UGQ B;  4N9I A;  2X1D A;  2CRU A;  3CCJ I;  3WU1 B;  3M6A A;  2TCT A;  2CEA A;  3ABT A;  4HX7 A;  5J1U A;  3CF0 A;  3FE3 A;  4HBL A;  4IEJ A;  4LD5 A;  1EH7 A;  5IY5 H;  2B3T A;  3CME I;  1EH6 A;  1ODD A;  4IPA A;  1MU5 A;  2YU9 J;  3DL1 A;  2Z33 A;  5J40 A;  2MD0 A;  4CA0 A;  1NV8 A;  1TBX A;  3H3V K;  2IW9 B;  2M9H A;  2F6C A;  3JRF A;  1AHD P;  3WTS C;  4KHP M;  1NTC A;  3M8F A;  4Z2Y A;  2IT0 A;  3S32 A;  2E19 A;  2IPQ X;  4E4H A;  1VTN C;  2WSC F;  2FOK A;  1TH3 A;  4RGX A;  4XLC A;  1K83 J;  3F21 A;  3GLL A;  2ZTC A;  4BE2 A;  2EUC A;  2PJP A;  2ZPB B;  2IS6 A;  3MY5 B;  4KMU X;  2BVL A;  2HKJ A;  2F5D A;  1V92 A;  5GAD J;  5C4X J;  3U21 A;  1GVJ A;  3B7Z A;  3KE2 A;  4GKK M;  5IYD J;  3DU6 A;  2QGS A;  3QP6 A;  3X2Q H;  1I3A A;  4XL9 A;  1G6N A;  1UCR A;  2K27 A;  3HIF A;  4CUG A;  4RDU A;  3BR5 A;  4OAY A;  3N4M A;  3QWL A;  3HY5 A;  1VIN A;  3FMR A;  1BM9 A;  4KIB A;  4YFK F;  4EAT A;  3GPP A;  1VOL A;  4IRH A;  3B7Q A;  2UZL B;  2QFZ A;  2DWM A;  3VKH A;  4CZZ A;  4WCG A;  1VEK A;  4LFC M;  2C5R A;  4IQ4 A;  1G3W A;  4JI0 M;  2VBW A;  2JY8 A;  2IGN A;  2E2J J;  3PNT A;  1E9S A;  4J00 A;  1ORY B;  1TDH A;  1T6S A;  3FYC A;  1Y8G A;  2W00 A;  4Y7N J;  4CXF A;  3VYG B;  4B43 A;  4L0Z B;  1MSE C;  2UUZ A;  1TNS A;  2JUG A;  2QZ4 A;  1BJZ A;  3V76 A;  2L7F P;  2XV4 S;  1N75 A;  1TNT A;  4B3X A;  1FWZ A;  1MBE A;  2MH9 A;  3DF8 A;  4LB6 B;  5LRS A;  4XLF A;  4KA4 A;  3CP8 A;  1SC7 A;  1TWA J;  4M3F A;  3GQ4 A;  4IRI A;  4G6Q A;  3H36 A;  2A61 A;  3VYT B;  1NK3 P;  3CJR B;  4ITQ A;  5LFA A;  4BBS J;  2DK5 A;  1D0Z A;  3BRO A;  2DA7 A;  1H27 B;  4LF5 M;  4XMY A;  5D6E A;  2O6G E;  1ETW A;  2L54 A;  4FT8 A;  2M30 A;  2R4G A;  4KYW A;  4EM0 B;  3R60 A;  2HOE A;  2DN0 A;  1R4M B;  2HFH A;  2CW8 A;  1U2W A;  4HL4 A;  2AXT C;  4RMN A;  2XZF A;  2LMD A;  5J8C A;  1JKQ C;  4XM3 A;  5H37 D;  1VQ7 I;  2L9S A;  4HF1 A;  5EZG A;  1JKW A;  3Q3S A;  3X20 B;  3IL2 A;  2X9D A;  2FNA A;  4HSR A;  1D3Y A;  2H6B A;  4M6V A;  5LHG A;  4KFC A;  4B48 A;  2IGO A;  3HHT B;  3JRI A;  2EIN H;  3PQJ A;  3VPR A;  5HVY B;  1I94 M;  2RVC A;  4HRI A;  4DIQ A;  1H1P B;  1S8N A;  3HGG A;  3BR1 A;  2JZ1 A;  2A07 F;  2G7U A;  4CHT B;  3S1M J;  3WTW C;  5ICP B;  3HJ8 A;  1IQP A;  2GXA A;  3GLI E;  3I59 A;  2XAU A;  1XMO M;  2VPR A;  2YS9 A;  2RQP A;  4PT5 A;  3NRV A;  4JI2 M;  4RAG A;  2E1O A;  3C2G A;  2HU9 A;  5D5V B;  1VQM I;  4IHW A;  1G3N C;  3TNI B;  2BJW A;  3GRU A;  5CVU A;  1HW2 A;  1REP C;  3E6B A;  2WMA B;  1I50 J;  2W96 A;  4ZZL A;  3W0F A;  2WAD A;  5FFZ A;  4GO1 A;  5E3L A;  3GTM S;  4WK8 F;  4RM3 A;  1ZRC A;  1HQY E;  3TP3 A;  3F23 A;  2L01 A;  2LOO A;  1RET A;  2N8G A;  5DD8 A;  2KJB A;  3FKE A;  4CCM A;  3OYJ A;  2P5T A;  3DPT A;  3JRC A;  3L2V A;  2MAB A;  5J8F A;  1ZQ3 P;  3U61 B;  1UHS A;  3VK8 A;  1GY3 B;  2UUC M;  1UB9 A;  3BG6 A;  4RAY A;  3KSJ A;  3LSP A;  3FXJ A;  2B9S A;  1OL2 B;  4N4O B;  3U1K A;  1K3X A;  1B72 A;  1LFB A;  2DME A;  1ZR4 A;  2KA6 B;  1WKM A;  3K4K A;  4WXC A;  3GLX A;  1RKT A;  3AV0 A;  5J3L A;  3J7A O;  2CHV A;  2LRD A;  4AIK A;  3B73 A;  2MH8 A;  1EA3 A;  3DEU A;  5C44 J;  1IN8 A;  1TH2 A;  3K70 D;  1KQ8 A;  2CZ6 B;  2OC6 A;  4GDF A;  1AD6 A;  2VII A;  3MMP A;  3DCF A;  3E5Q A;  1IXC A;  3DPL C;  1P3Q Q;  4L9N A;  1LKX A;  3ONQ A;  3WG9 A;  4ZGJ B;  5FLM J;  4TV7 A;  5JI2 E;  1SD6 A;  2DPP B;  4R7G A;  5A2Q Z;  2JY6 B;  4XOR A;  3T1H M;  2V6E A;  4P5O A;  2LR8 A;  2OF7 A;  1UST A;  3N97 A;  3FZV A;  5LBQ A;  3HOY J;  2DJN A;  1DP3 A;  1QZZ A;  3QU6 A;  2JPC A;  3QOD A;  4M72 A;  5JI6 A;  2O7O A;  2F5C A;  3IC7 A;  4I02 A;  1BIA A;  4YEJ A;  1IXS A;  3B74 A;  1XO2 A;  3DBL B;  2I40 B;  4BBR M;  4RAZ A;  4W1U A;  1Z05 A;  1JHH A;  4HX4 A;  3VFD A;  1G71 A;  4D5F A;  3DLA A;  3LVV A;  3IHP A;  1WHC A;  1QAO A;  3LSJ A;  2H94 A;  3TNH B;  2R7F A;  3ZMS A;  2X1N B;  4BJ5 C;  2Q0O A;  2Z1D A;  4D82 A;  4MNU A;  2X4H A;  1YQA A;  4LLL A;  2KRK A;  3P7N A;  2MYS A;  1ZG1 A;  1E7P A;  1PUE E;  4CCN A;  3FX3 A;  4GC9 A;  3B9P A;  3WE2 A;  5IP9 J;  2FOI C;  1ZYR F;  4JI7 M;  2IVX A;  1XMA A;  3TP0 A;  1BL0 A;  4OMY A;  5E3N A;  3TPZ A;  3HSE A;  4AD9 A;  4UB6 C;  3Q9S A;  2XIG A;  3I3L A;  1Y6I A;  2VLA A;  4N9H A;  4BH9 A;  4FQG A;  4P9F A;  4EC9 B;  4AYB A;  5E1W A;  2VOP A;  1MN3 A;  2IBD A;  1MMA A;  2HPI A;  1Z6T A;  1C7Y A;  4JYA M;  3EJ1 B;  3TO7 A;  5M5Y J;  1U8R A;  2HPM A;  3HOW J;  1N34 M;  4DBR A;  1H89 C;  2K9Q A;  2DAM A;  5KAF C;  2WPA B;  1MW7 A;  1NV9 A;  1U5T C;  2ZM6 M;  3CJT B;  3ZCB B;  3EUK L;  3CZ6 A;  4MEX F;  4RF1 A;  2W24 A;  3C9P A;  3CMY A;  4UUV A;  1TT5 B;  2F4O B;  2HWJ A;  4A5M A;  4MEY F;  5L3D A;  1HT2 E;  4MFD A;  2E7X A;  2LXE A;  4E70 A;  4BY7 J;  3J7A S;  2DTZ A;  2FU4 A;  5CVR A;  3ERE D;  1R1V A;  2NQ8 C;  1LQ1 A;  3ZQ7 A;  1A31 A;  1PRB A;  1IF1 A;  3CP2 A;  1D1A A;  4ELJ A;  1IV8 A;  3GLI A;  3ZR8 X;  2ELJ A;  3PFI A;  3F22 A;  1XMQ M;  3EUH A;  1LNW A;  2QSH X;  2ZPE B;  2WB1 A;  3NAR A;  4G4Q A;  4OAZ A;  4PFP A;  3WVE B;  1FZP B;  3H9G A;  3BJA A;  3M07 A;  5DV5 A;  3CTA A;  1E2X A;  3GTJ J;  4U7D A;  1DO2 A;  3SEQ A;  4GRI A;  4BXF A;  2VDB B;  4BCH B;  2NVX J;  2NVT J;  3S93 A;  2E7W A;  1A04 A;  5A2Q K;  2NS7 A;  3C7J A;  3MJ5 A;  4L5J A;  5K5Q A;  2CJJ A;  3EUH C;  1MBF A;  2EA4 A;  2XAF A;  5JI3 E;  5EYR A;  4KT0 F;  1Z5C A;  4OVZ A;  3CDL A;  3T6P A;  5EEG A;  2HOT A;  2VI6 A;  3KLO A;  4HDV A;  1CQT A;  2YPR A;  3ZQG A;  3AG4 H;  3H5A A;  1WJE A;  3M8E A;  2MLK A;  3CCY A;  5EG0 A;  1YSY A;  1T39 A;  2ETH A;  5EF6 A;  1MH3 A;  3ILK A;  2K6B A;  2K3P A;  3KCC A;  1XX5 A;  2R92 J;  3RSN A;  3FXL A;  5HLH A;  3A46 A;  1HNW M;  1D0K A;  4EOI B;  4BBA A;  3JR5 A;  4M74 A;  3TQS A;  1R71 A;  2VF7 A;  1YW9 A;  3SFZ A;  2RV8 A;  4D81 A;  3FXO A;  3DTK A;  4ZGE B;  5D5X B;  4MB7 A;  5BOX A;  1V4R A;  1UG0 A;  1HF0 A;  5I5Z B;  1H8A C;  4QPQ A;  1IG7 A;  1JE8 A;  1X1C A;  2EKF A;  1SFK A;  2JK3 A;  1OAO C;  3HU2 A;  5ITX E;  2LBF A;  2IW6 B;  3G3Z A;  3D8L A;  1J2X A;  1QQI A;  2CW0 F;  2Y20 A;  2MLG A;  4PUS A;  3QOP A;  1QBJ A;  1X19 A;  2NS0 A;  2DWN A;  1FJG M;  1EF4 A;  2W82 A;  2HQA A;  3U6D A;  2W9Z A;  2EB7 A;  3GWZ A;  3HU1 A;  4CIC A;  4KOD A;  3QYH B;  5EP4 A;  1F5Q B;  5BQT A;  3IHU A;  2YQZ A;  4OX9 M;  3CMA I;  3FYD A;  1PYV A;  2FXA A;  2JA7 J;  3I59 B;  2ZJ2 A;  3HU3 A;  2R7W A;  3OSG A;  3FBI B;  3VK7 A;  4AYB N;  3MQ0 A;  1X4O A;  1VFC A;  3V4G A;  5D6F A;  4L9J A;  1B59 A;  1FBQ A;  3H92 A;  1D0M A;  2VBY A;  4ZYH A;  5CVV A;  1QPI A;  4PJ0 C;  1GV5 A;  1NJG A;  1D5Y A;  4DR6 M;  3BY6 A;  3I71 A;  2FH0 A;  1YLA A;  5IWA M;  5ACB A;  1KQ9 A;  3N05 A;  3W2W A;  3RCO A;  1R22 A;  2OZ6 A;  4OIR F;  2KIU A;  3KIO A;  2FE8 A;  5TRD A;  4A3K J;  3WTX C;  4JI4 M;  1YJ9 I;  4E6K G;  3CF6 E;  3CES A;  1IRE B;  3K4C A;  1G8P A;  2Y21 A;  1X1B A;  2E71 A;  3OYE A;  2STT A;  2DAE A;  4EJV A;  3JRB A;  4EOQ B;  4MQ9 F;  1WGL A;  2VKD A;  2X51 A;  2FF4 A;  1AHJ B;  3DDP B;  2LVN C;  3I9V 2;  4JYK A;  4M6Y A;  4U88 A;  4HLY A;  4FCY A;  3HOU J;  2R7T A;  2CO5 A;  1B72 B;  2UXX A;  3LST A;  1XC5 A;  3DU5 A;  3NWT A;  1JST B;  2WXV B;  1XD7 A;  3X26 B;  2RGH A;  3NBI A;  4KT5 C;  2LH9 A;  3E7L A;  3V7S A;  4DR5 M;  1XSV A;  4CZC A;  4HLX A;  3A03 A;  2WB1 N;  3SAR A;  4G6T B;  2H27 A;  3FM5 A;  2V6C A;  4R8H A;  2EWN A;  4ENN A;  3IH2 A;  4KIS A;  1JGG A;  3U60 A;  2KRU A;  1JUS A;  2EV6 A;  3G6E I;  1YFH A;  2KFD A;  1MND A;  3GPX A;  5D8L B;  3S16 J;  1W98 B;  2CP8 A;  2EQR A;  4G94 A;  1ETO A;  1PUF A;  5J47 A;  1BOA A;  4RB0 A;  2BKZ B;  2L9V A;  2R44 A;  2MSY A;  3EPZ A;  3IUO A;  1AIS B;  2OOA A;  1E9R A;  4RGU A;  5DCM A;  1WJD A;  3A0H C;  4XIC A;  2XVC A;  3F9K A;  1D0L A;  1N36 M;  2PJR A;  2YUS A;  2DMP A;  2IGK A;  3PVS A;  4KRC B;  1UGP B;  1DGH A;  1RC9 A;  1YW7 A;  3S3O A;  5L3B A;  2HL7 A;  1W36 C;  1D0X A;  3HKZ A;  4OU0 A;  2P7C B;  1IXS B;  2HTS A;  1R9T J;  1A36 A;  5J1Y A;  5ICF A;  4OIQ F;  3FXQ A;  4B08 A;  5B5E C;  3S3N A;  2M7B A;  5GTI C;  2VIX A;  2F48 A;  2Y75 A;  4OIP F;  5GP9 A;  2P8T A;  4X6A J;  4BQO A;  1FC3 A;  2XSZ D;  2OCE A;  3AG2 H;  3K1M A;  4B3S M;  3BG7 A;  1NO1 A;  2HXI A;  4BDY A;  3W68 A;  1DP7 P;  2KRH A;  3KZZ A;  3JR4 A;  2W1O A;  3PQK A;  1NHA A;  5KK1 A;  3ZMT A;  2PEX A;  4LRT A;  5JHF A;  2L7M P;  4NC8 A;  1P7I A;  3GRY A;  3BZK A;  4GYG A;  4EMS A;  1L8Q A;  3GYH X;  4B7H A;  1OKS A;  5E6J A;  4DR1 M;  1KA8 A;  4MGI E;  4IBG A;  1XCB A;  3X25 B;  2ICW G;  2E35 A;  1MMG A;  3CCM I;  4AKI A;  2V4J C;  4RNA A;  2VJ4 A;  2E1M C;  2QCU A;  1FIP A;  5ED4 A;  3BTC A;  2O8K A;  4LLN A;  3LL7 A;  4RM2 A;  3WOD F;  4RBO A;  1I6H J;  1TD6 A;  4M71 A;  2WSE F;  5L3F A;  3K1J A;  3HTS B;  1Z5A A;  1FKM A;  2OO9 A;  2B0L A;  4U7B A;  4PZJ A;  5ITX A;  2P0W A;  1LEA A;  2VL8 A;  5IOY A;  4C30 A;  1Z5B A;  3MZH A;  3NWS A;  2LVA A;  2HOS A;  3F72 A;  3CCE I;  1GAB A;  3F92 A;  5HS7 A;  2BJV A;  2MFZ A;  4EOO B;  3KLN A;  4AZF A;  4R3D A;  3D8B A;  4BGD A;  1IV6 A;  3U6O A;  4M3B A;  3FWE A;  3A0B C;  3GX4 X;  3GQ3 A;  1X58 A;  2RN7 A;  4IBI A;  5B1B H;  4JI5 M;  4HPQ A;  2L9R A;  4PGH A;  3IG8 A;  4Q4Z F;  4REZ A;  2G8L A;  2VAS A;  1H1S B;  1A5J A;  2QHO B;  2V6Z M;  4ABZ A;  5GAE J;  2M4K A;  4XQF A;  1D5V A;  1QZE A;  1HDP A;  4IBC A;  3DTI A;  3BLH B;  3MKL A;  5F1J A;  1E94 E;  3H1C A;  1SG9 A;  1SVL A;  5HNB B;  1QVR A;  3E3V A;  1DO0 A;  1LVA A;  1RR7 A;  3RE8 A;  2MC3 A;  3JRH A;  1TGU A;  2BWB A;  2XAH A;  2C4G B;  4OB1 B;  2ZNZ A;  3IKV A;  4B44 A;  3PUB A;  2L2O A;  1STZ A;  2KP6 A;  1UFZ A;  4IJA A;  4I8O A;  3K0L A;  4JBA A;  4Y3O A;  5LEJ A;  3KSX A;  2JP7 A;  1BIB A;  3W2V A;  3JSO A;  2KQR A;  3QQA A;  3JTH A;  4AWX B;  4OVZ B;  5DQV A;  2KMG A;  1PP7 U;  1KYW A;  2QQA A;  3K2L A;  5CPR B;  2JWT A;  2QSG X;  1SFE A;  3S2W A;  3WE3 A;  4LLG F;  2YX4 A;  1MMD A;  3RFW A;  3H4J A;  5EG0 B;  1QNT A;  4ASN A;  1JR3 E;  3HG9 A;  2BYV E;  3MKY B;  4UVA A;  1IRF A;  3I4N J;  1A35 A;  1XS9 A;  4JOM A;  1O3T A;  3FUV A;  4TUW A;  1GUU A;  3K4M A;  4XON A;  4V19 K;  1TZL A;  2AHQ A;  2M1B A;  4CJ6 A;  1EV7 A;  1MGT A;  2PMI B;  4UVC A;  2V1C A;  1WR1 B;  2K40 A;  4B3M M;  3KX2 A;  1XGS A;  4CH7 A;  1UFM A;  4KT6 A;  3HKZ N;  2JRT A;  5DCF A;  1ENH A;  4YFN F;  1GKI A;  2H5X A;  1T43 A;  2MD5 A;  2LY2 A;  4JQF A;  5H2F C;  2G0E A;  3TMO A;  2EFO A;  2LBF B;  1MZB A;  1OIS A;  2KIM A;  4OR5 B;  4LF7 M;  1T6O A;  2WBM A;  1IXZ A;  4FM4 B;  2L4F A;  2NOG A;  2V1X A;  3OL3 A;  4C2T A;  1OYW A;  1UZC A;  2ZJR F;  2X4A A;  3BJ6 A;  3X24 B;  1E3H A;  3ZC7 B;  3HXL A;  4BCO B;  5HDN A;  3JRD A;  1IO2 A;  2NXN B;  3Q8G A;  2KNV A;  2BNK A;  2EK5 A;  2VQH A;  3RTR A;  2DTR A;  2KR6 A;  5DQW A;  2LF7 A;  3H35 A;  4KNY A;  3BOQ A;  4A0X A;  3QRF F;  2W2H A;  1HXD A;  1HR0 M;  5FTK A;  2P5L C;  1S72 I;  4ANR A;  2J5P A;  3L2R A;  2X6X A;  2Y0T A;  4QIW N;  2DT5 A;  4LB5 A;  1S7O A;  3PFY A;  5FD5 A;  4EC8 B;  2G7H A;  2LY9 A;  4PCQ A;  1SXJ E;  2K5C A;  2V22 B;  4L9T A;  2W4S A;  4A0Z A;  2JZ0 A;  1GVD A;  2IW5 A;  4LGW A;  2Q1Z B;  4KN4 X;  2DT7 B;  1J9I A;  3IV5 A;  1OCO H;  1FOW A;  3WHL A;  2HI3 A;  3W6J B;  1OR7 A;  2O5R A;  3GLG B;  1QAQ A;  2CQK A;  4CFN B;  4X65 M;  3PIP F;  3PL8 A;  2KKO A;  5AIP A;  1JT0 A;  2E1C A;  1OIP A;  3CLQ A;  3RQ4 A;  4B4C A;  4EVI A;  3FTE A;  5DUI A;  3I01 M;  4FD2 A;  4XKB A;  2QDY B;  3BTI A;  1IN4 A;  1BI0 A;  1ZGA A;  3BPX A;  3F8N A;  1OYY A;  3VDP A;  2R7Z J;  3DDQ B;  1S7A A;  4GXO A;  4DUZ M;  1O57 A;  2QEN A;  1YOV B;  4XN0 A;  2P6T A;  4IBB A;  2L5Q A;  4H4K C;  2G9W A;  3WU0 A;  1O3Q A;  2DA6 A;  1OR7 C;  4FX0 A;  5M3F J;  2UUE B;  3U60 B;  3TGN A;  2DAG A;  3SJM A;  4BCF B;  2R6F A;  1R23 A;  2DOA A;  2VB6 A;  3J27 B;  1KQ0 A;  2O61 A;  3CC7 I;  2MGQ A;  2B63 J;  1PUF B;  1FOX A;  3JSP A;  1LDD A;  2P4W A;  2VKV A;  4OW0 A;  1Y56 A;  2IAI A;  3ABL H;  1YRN A;  2V1D A;  2KDO A;  5D4R A;  3FXU A;  4LIT A;  4I2O A;  1JXS A;  2L7I A;  5DCM B;  2E5L M;  2OZU A;  2HHH M;  2E2I J;  4CFX B;  1R5G A;  1RZ4 A;  3DFG A;  4EJU A;  2LBC A;  4QLC U;  1R1U A;  3SZT A;  2PJR B;  5LRR A;  4BCG B;  3A98 B;  2P5V A;  2KDL A;  1DGH B;  3U5Z A;  3NEU A;  1FJL A;  2ESH A;  3H4C A;  2CWE A;  5HOD A;  2ZPF B;  4YOS A;  2MA3 A;  3OYA A;  1H24 B;  3RPQ A;  1WFX A;  3S1N J;  4JI1 M;  2NVU B;  3E4R A;  1IUF A;  4LY6 A;  2YR2 A;  1XPX A;  1QO0 D;  3UZU A;  1V5F A;  4NBQ A;  5CQG A;  1M1E B;  2DW4 A;  4QWQ A;  3CC2 I;  5E18 F;  2NVQ J;  4CGZ A;  1VYW B;  1P7J A;  4IXA A;  2G77 A;  1KXU A;  3TO9 A;  4XOP A;  1XB2 B;  1ZH5 A;  4M3E A;  5E8G A;  1MJ9 A;  2DDB A;  3HPH A;  3L27 A;  2EKK A;  3JAM K;  2LW4 A;  1YG2 A;  5EP3 A;  2R7V A;  3HOS A;  5FTN A;  4EOJ B;  1DGW Y;  1POG A;  2F2E A;  1JR3 A;  1RU3 A;  2CHG A;  1VND A;  4I0B A;  3DP7 A;  1PJQ A;  5ITY A;  2BGC A;  4AVZ A;  1G4D A;  1GL7 A;  1FEX A;  1AIP C;  3PNY A;  1JHF A;  1VG5 A;  2BHY A;  3LFK A;  2FD5 A;  3PO3 J;  1P4X A;  4BXU A;  3OTO M;  3ASN H;  2IVM A;  4GC5 A;  3BQY A;  3EYY A;  2D1V A;  1KZH A;  2XFS A;  1P2F A;  2LF8 A;  2D7H A;  5LEK A;  2WJ9 A;  2XPV A;  1WJC A;  2F2C A;  1KYZ A;  2ME6 A;  3SC3 A;  1SFX A;  2GOM A;  3FK7 A;  1YX3 A;  3K10 A;  3OYK A;  1R5I D;  2IA1 A;  4G8X A;  1Z3Y A;  2TDX A;  3VYS B;  3BQZ A;  4H0E A;  1ZRE A;  1D0Y A;  1R49 A;  4B3T M;  3HBL A;  4HV6 A;  1X1A A;  1RUO A;  3FHN A;  2JQ7 A;  1R2Y A;  3BP8 A;  1HOM A;  4GCV A;  4MGK E;  2JPB A;  2NVY J;  3ZQF A;  2ZAO A;  3VSK A;  1BVS A;  3ZMV A;  2BY2 A;  4BEH B;  2B7E A;  2A69 F;  2W9F A;  3D5R C;  5L3G A;  4EJT A;  4DV4 M;  1MKM A;  4IHX A;  2QPA A;  1UM8 A;  3CUO A;  1G59 A;  1XSX A;  3Q9V A;  4LZJ A;  2KW0 A;  3U6Q A;  2KLO A;  4B8X A;  2R4E A;  4HYE A;  2WWY A;  1LV7 A;  3O0G D;  1SXJ A;  3ABK H;  4OB2 B;  3L00 A;  2R7Q A;  1OL1 B;  1D3U B;  3BCA A;  5D5W B;  3B6A A;  2HVS A;  3F3X A;  5IZ7 D;  2EJS A;  4P17 A;  4L0Y B;  3TN8 B;  3I5U A;  2HZD A;  1C0W A;  1DU0 A;  2MRO B;  2VQC A;  2HCB A;  4OIN F;  1AU7 A;  2HR3 A;  2K7L A;  3FIW A;  2KNA A;  3K4J A;  3A8H B;  3G1M A;  1VQK I;  4M6X A;  2XGC A;  3UK6 A;  1QYR A;  2H8R A;  2KZG A;  4BCQ B;  1NY6 A;  2LP0 A;  1V5E A;  2XAJ A;  2R7X A;  2LVQ D;  2XF7 A;  1SXJ C;  3M1C A;  3UNG C;  3VOD A;  2A6T A;  2KL4 A;  1FTZ A;  1OYI A;  3HRM A;  2DWZ B;  1FPQ A;  2Q8K A;  4A3I J;  4D7N A;  4EOR B;  2FUG 2;  4WF2 A;  1DDN A;  1Q3B A;  3OL4 A;  2KPM A;  3VYR B;  3KP0 E;  1JQJ C;  4G6D A;  2GXB A;  3HM5 A;  2XDV A;  2ZNY A;  4AIJ A;  2DXC B;  2ECB A;  4QSH A;  2KIQ A;  4ZDL A;  1Q1H A;  3MFK A;  1E17 A;  3U6E A;  2E1N A;  3ULQ B;  1VQP I;  4UN2 B;  4JN6 A;  1PJS A;  3M8J A;  4KDP A;  5KPZ A;  4IHV A;  1SD5 A;  2A6H F;  1IGN A;  1UNL D;  2BS4 A;  4BY1 J;  5E3M A;  4MH0 E;  2HZT A;  1RES A;  5FB2 A;  2K86 A;  2GQF A;  2JUJ A;  5L8R F;  2HDD A;  4E7S A;  3SMP A;  4PCZ A;  3FKJ A;  4MHG A;  3VFZ A;  4U0V A;  3KP4 A;  4IRG A;  4LIV A;  3ISP A;  1PKD B;  1BR4 A;  2K9M A;  4XR6 A;  2ERC A;  1B9M A;  2CYZ B;  3HOZ J;  5FTL A;  5HS9 A;  3DOG B;  3O8G A;  2PJQ A;  3KP5 A;  4EQQ A;  4CYC A;  2EFP A;  1OIU B;  3E5X A;  2P7V B;  3SYL A;  2XSD C;  1JSU B;  2X6Y A;  1HKT A;  4LGY A;  3BOS A;  4DNC A;  2DA1 A;  4CXA B;  1FSH A;  5HDK A;  1QAM A;  4RGS A;  2YNM D;  5EXP A;  3HSF A;  3TE6 A;  1Y39 A;  1KU9 A;  4HEA 2;  2RAE A;  1OKR A;  3SMS A;  1SMY F;  3KOY E;  3E5U A;  4F6S B;  2PI0 A;  1A6Q A;  2PLY A;  2Z7J A;  1ETK A;  2BY1 A;  1SVO A;  4LJ6 A;  2EIK H;  3WG7 H;  1R2Z A;  3RZD J;  1XC8 A;  2J7O A;  4QHS A;  2ZSI B;  4PDI A;  2MBF A;  1VQO I;  3O6B B;  3GO8 A;  2WC2 A;  2XAQ A;  1MDM A;  3TKY A;  3EDP A;  5E20 A;  1IBK M;  3VDU A;  2O0Y A;  1WHU A;  3F0C A;  3W2A A;  3UJN A;  3Q0W A;  3U2R A;  2UWM A;  1ZMV A;  3TDZ C;  5ITQ A;  3JAM S;  2DD4 B;  1U9N A;  2CU7 A;  1WGN A;  2FML A;  3DFZ A;  2NS8 A;  4UV9 A;  3VLF B;  1ZN2 A;  2HYJ A;  2MC4 A;  5CQE A;  3S17 J;  3VB2 A;  4CFV B;  1GL6 A;  4ZZD A;  4CGY B;  2Y0S N;  1XB4 A;  3C2B A;  5KHD A;  2R93 J;  2DMN A;  2DBB A;  4HNU A;  3TO6 A;  4UUT A;  2QDJ A;  1IRG A;  2I10 A;  3I4Y A;  5K5R A;  2KT0 A;  5KCM A;  2R62 A;  1VDL A;  2F5F A;  2CW7 A;  2K4J A;  2M8E A;  4LG0 A;  5KVR A;  2BPM B;  1B1B A;  3MZ8 A;  1XGO A;  4W5W A;  1BBY A;  3KP2 A;  4BB9 A;  4KIT B;  3AJI B;  3HB9 A;  3JRA A;  2OTL I;  3TWL A;  4JI6 M;  3K8Z A;  1YYV A;  4ZDP A;  3DTO A;  4UUS A;  4M0W A;  4NB5 A;  1UAA A;  1YRN B;  3KOX E;  3BZ6 A;  2DA2 A;  4WP2 A;  4DGW B;  3GCM A;  5EFQ B;  4EEF G;  2IS2 A;  4CFM B;  3E21 A;  2DQL A;  3REO A;  1BC8 C;  4WUR A;  2GA2 A;  4UHT A;  3T8R A;  4LJ7 A;  2GNO A;  3U5Z B;  2CCI B;  3UGJ A;  2LSO A;  3WHK A;  1QHG A;  2OQR A;  4PGG A;  4BXX X;  2LTP A;  1MBH A;  1HA8 A;  3H0D A;  3CCQ I;  1ON1 A;  3AFH A;  1P6R A;  1X1D A;  1CUK A;  2ESN A;  2ZKZ A;  1B4A A;  5HBE B;  3GTM J;  1AWC A;  2I7P A;  4L15 A;  1Z3X A;  4BQN A;  1UG2 A;  3HUG A;  2UUB M;  3ZPL A;  1QUT A;  3SAT A;  4LF6 M;  3K92 A;  1XNR M;  2D2W A;  4RAF A;  2K9D A;  1OIZ A;  2ZB9 A;  2RGO A;  3DLL F;  4A6D A;  2NAZ A;  5ITT A;  1NNU C;  2EBI A;  1URC B;  2DQR A;  3BHV B;  1NSF A;  1V29 B;  2QKL B;  4G9Y A;  4LIU A;  2M4G A;  2AHJ B;  4G6L B;  1BOB A;  2BE5 F;  1TH4 A;  5HVQ C;  4BCP B;  2XAS A;  4GIP A;  2DAI A;  1JKP C;  3GTG J;  1KFV A;  4IF4 A;  2F4I A;  5GTH C;  1FNN A;  3MZY A;  3E46 A;  2KMU A;  4Y4R A;  2DOE A;  3MY1 B;  3J81 S;  2QM3 A;  3M9A A;  2HKX A;  5HNH A;  1MMS A;  4LJ9 A;  4LCB A;  5DNY A;  1LJ9 A;  2VJI A;  3M1E A;  2X8A A;  1Q02 A;  3J80 S;  3KFU G;  1UEL B;  2OV7 A;  3CLO A;  1Q1V A;  2LD5 A;  5IF1 B;  1JUM A;  2RNJ A;  1W36 D;  4BCM D;  1ZLK A;  2FQ4 A;  3MI9 B;  3IH3 A;  3DA1 A;  5CJ9 A;  3GTL J;  3DEW A;  4G6Z A;  5H6Q A;  1TR8 A;  3ZQC A;  1ITY A;  2W48 A;  4CYD A;  4F7L B;  2D7G A;  5DEQ A;  3J7Z I;  3VWB A;  1G3Y A;  2ZTD A;  1ZGJ A;  4PDG A;  1EFU B;  2CH0 A;  3ERM A;  3GZN B;  3GLG E;  4PJM A;  5EEH A;  1OFC X;  3RIR A;  2C6Y A;  2JSC A;  3DPU A;  4K2E A;  3GME A;  1OGU B;  2DOD A;  3TNW B;  3E97 A;  2DJI A;  1XMK A;  2WAQ N;  3OR2 C;  4X1E A;  3K4N A;  2EZH A;  4A3V B;  1KON A;  2F5V A;  5EXX A;  2M5Z A;  2Z8Y M;  4U0Y A;  4UNO A;  3L26 A;  2BEO A;  2V9K A;  2XKP A;  2LNH C;  4CCK A;  2MGW A;  2LTU A;  4A3D J;  1FP1 D;  1ETQ A; 
#chains in the Genus database with same CATH homology
 2Z16 A;  3OS2 A;  3S3O A;  1W36 C;  4Z6Y A;  4AI6 A;  4ZYA A;  1D0X A;  3HKZ A;  2KHM A;  4MFE A;  2BS2 A;  3S3N A;  2M7B A;  3DWL E;  2VIX A;  1NG6 A;  3H5N A;  4QPO A;  3K4B A;  2JVH A;  2R7U A;  2ZPI B;  4XOT A;  4BQO A;  3TW6 A;  4HST A;  4JX4 A;  4XN3 A;  2E5N A;  4YEL A;  3BG7 A;  4BDY A;  4CSW A;  2KRH A;  2W1O A;  1AA7 A;  3OYH A;  2KZV A;  5JHF A;  4D1Q A;  4NC8 A;  3A8O B;  1WJB A;  2A5W A;  3QYF A;  2V7F A;  2CZ7 B;  3X25 B;  2WAQ A;  1YE9 A;  1MMG A;  3A4C A;  1BR2 A;  2V4J C;  4AKI A;  5FRM A;  2CFO A;  2VJ4 A;  2E1M C;  3D5S C;  4JX6 A;  1UGS B;  3PNV A;  3DEE A;  3LL7 A;  4RM2 A;  5HNF A;  4NNJ A;  4PK4 A;  3OYI A;  2IS1 A;  2R7S A;  3BG9 A;  4CCL A;  3PSF A;  1FKM A;  4XKW A;  4U7B A;  2QKM B;  2P0W A;  2VL8 A;  3OOU A;  3QZ5 B;  4C30 A;  3HO8 A;  2ZFU A;  1J09 A;  3NWS A;  2R7R A;  3TW7 A;  3BG3 A;  4OB3 B;  2MFZ A;  1PJR A;  4BGD A;  4NC7 A;  2DCE A;  4HPQ A;  3OYD A;  3HZJ A;  2VAS A;  2E1M B;  3IAM 2;  4BE0 A;  4BS9 A;  4HLQ A;  2Q2E B;  3LSM A;  1U0J A;  2M4K A;  3DKY A;  4Y33 A;  4FAS D;  4XQF A;  1TT0 A;  3OYB A;  3DTI A;  2NOJ B;  1D1C A;  2CUJ A;  4MLO A;  3LMM A;  3QYE A;  1DGR M;  2VQG A;  1UGQ B;  2RNG A;  3QYG B;  4OB1 B;  3GBG A;  3A2K A;  4B44 A;  3PUB A;  1YX5 A;  2L2O A;  2X1D A;  3CF2 A;  4II2 A;  2DXB B;  2KP6 A;  4Y3O A;  1E0E A;  4F52 A;  3W2V A;  2KQR A;  3DL1 A;  1QLB A;  2KMG A;  2V26 A;  4ITV A;  2MD0 A;  2WY8 Q;  4NQW B;  5CPR B;  4CA0 A;  2HVQ A;  2RRE A;  4BAC A;  4RLQ A;  2DXI A;  2WAE A;  2F6C A;  1MMD A;  4F93 B;  1FMW A;  3HG9 A;  3MKY B;  3S32 A;  3PSI A;  4JOM A;  4E4H A;  4XON A;  4ZGD B;  3K4M A;  2XC7 A;  2BVM A;  4XLC A;  1TZL A;  4BE2 A;  3KX2 A;  1ERD A;  2ZPB B;  2IS6 A;  4CH7 A;  4KT6 A;  3EUA A;  2BVL A;  3KHI A;  3U21 A;  3SEZ A;  4C9Y A;  1UGR B;  2Z2S B;  2LY2 A;  4JQF A;  3L2Q A;  3TMO A;  2LBF B;  3DU6 A;  2GOX B;  2WBM A;  4XL9 A;  4BUP A;  4CUG A;  4LOC A;  2L9N A;  4XLA A;  4OAY A;  4FM4 B;  4AKG A;  1S9H A;  3QWL A;  3OL3 A;  4C2T A;  1LDK B;  2LRE A;  3H9Q A;  3X24 B;  4EAT A;  3HXL A;  2BW3 A;  2I8D A;  3BLY A;  4NC6 A;  3CJQ B;  3ZXS A;  4AU7 A;  3VKH A;  2HVR A;  3QOE A;  3QXE B;  2VQH A;  3RTR A;  2KR6 A;  4IQ4 A;  3H35 A;  3HUG B;  2IGN A;  3PNT A;  5CKT A;  4J00 A;  4E7J A;  3L2R A;  2X6X A;  2W00 A;  3PFY A;  4B43 A;  3VYG B;  5LD2 C;  1OLT A;  2UUZ A;  2JUG A;  2K5C A;  2W4S A;  2R7O A;  2Q1Z B;  2DT7 B;  3IAS 2;  1QHH D;  4N4N B;  1N75 A;  2X6W A;  4B3X A;  2O5R A;  3KEY A;  4XLF A;  3CP8 A;  3A8G B;  3PL8 A;  3OS1 A;  3RQ4 A;  3VYT B;  3CJR B;  1N78 A;  5LFA A;  4XKB A;  1D0Z A;  3VYU B;  2QDY B;  1G8X A;  4XMY A;  2KRC A;  2W7N A;  4JX5 A;  2R4G A;  3E1S A;  3H5R A;  4E7L A;  4XN0 A;  2L5Q A;  4H4K C;  3D5L A;  1P9Q C;  1OR7 C;  2CW8 A;  4HL4 A;  4RMN A;  3SZG A;  1Z21 A;  2DOA A;  2VB6 A;  4XM3 A;  2L9S A;  4E7H A;  1JI8 A;  1Y56 A;  4ZTJ A;  2XF5 A;  3X20 B;  3VDX A;  2KDO A;  4IQJ A;  1NG7 A;  4HSR A;  4LIT A;  4M6V A;  1WJA A;  4B48 A;  2IGO A;  3HHT B;  4E7I A;  3LFU A;  3AL0 C;  4LG3 A;  3J7A Y;  2PJR B;  3OYG A;  4HRI A;  4DIQ A;  4ZJZ A;  3H4C A;  3ZCO A;  4DJA A;  2ZPF B;  1Z7L A;  4XLE A;  3SYT A;  3OYA A;  3H9J A;  1WFX A;  2CMP A;  1D1B A;  4E7K A;  2XAU A;  3AKZ A;  4XLH A;  1V5F A;  5CQG A;  3C2G A;  2HU9 A;  4C2U A;  3E0J B;  4CCO A;  2G77 A;  4XOP A;  4BEH A;  4BBS M;  4ANJ A;  3HPH A;  3QYB A;  5HOO A;  2R7V A;  2VXZ A;  3QZ9 B;  3HOS A;  3DKX A;  2ZCF B;  2WAD A;  3K4L A;  3L2W A;  1DGW Y;  4RM3 A;  3LSK A;  2LOO A;  3VSL A;  2ZPH B;  3S3M A;  4AVZ A;  4CCM A;  3OYJ A;  3PNY A;  3DPT A;  3L2V A;  2L7K A;  2MAB A;  2CV1 A;  4BQQ A;  4CCJ A;  3OYM A;  2LY1 A;  2VQL A;  2ZSH B;  3BG6 A;  3OR1 C;  3HL2 A;  1T95 A;  2WJ9 A;  4N4O B;  1WJC A;  4PFO A;  1N77 A;  1MMN A;  3K4K A;  2GOM A;  2M0M A;  1YX3 A;  3K10 A;  3OYK A;  2HDW A;  1MNE A;  4BJT A;  2LRD A;  1Z3Y A;  4NUB A;  1EA3 A;  3VYS B;  3K70 D;  3MKW B;  2CZ6 B;  1D0Y A;  2OC6 A;  2LG4 A;  3DPL C;  3HBL A;  4ZC3 A;  1X1A A;  1LKX A;  4HNV A;  3ONQ A;  3FHN A;  4ZGJ B;  2VJJ A;  2DPP B;  4BL0 B;  4XOR A;  2V6E A;  4PJJ A;  1T0F C;  4P5O A;  3OWT A;  2AQE A;  3VSK A;  5EJC A;  4BEH B;  1DP3 A;  4MIM A;  3D5R C;  4HNT A;  3QOD A;  2IS4 A;  1G59 A;  4YEJ A;  2KLO A;  4BBR M;  2JVG A;  4RLF A;  4OB2 B;  2R7Q A;  3K70 C;  3DLA A;  2UV1 A;  3BCA A;  4B47 A;  1DQU A;  2HVS A;  4P17 A;  2HZD A;  5HLT A;  2VQC A;  4BJ5 C;  3HPG A;  2Z1D A;  3K4J A;  3A8H B;  4IX7 A;  2D0Q B;  3KYL A;  2MYS A;  1E7P A;  4CCN A;  1V5E A;  2R7X A;  2XF7 A;  1K6Y A;  3M1C A;  3UNG C;  2A6T A;  3I3L A;  2DD5 B;  2KL4 A;  3DTE A;  1Y6I A;  2VLA A;  2FUG 2;  2RQQ A;  4AYB A;  3OL4 A;  4II3 A;  1IRX A;  2KPM A;  3VYR B;  2CZ0 B;  2DXC B;  2XDV A;  1MMA A;  2LC2 A;  2HPI A;  3UR3 C;  4ZDO A;  4QSH A;  4ZDL A;  4HG2 A;  2HPM A;  2QFZ A;  4E7Z A;  3M8J A;  4DBR A;  2BS4 A;  3TL4 X;  1MW7 A;  1HA8 A;  4E7S A;  3A1Y A;  3PJR A;  3FKJ A;  3EUK L;  3CZ6 A;  4LIV A;  1BR4 A;  2X1E A;  1FMV A;  2K9M A;  4XR6 A;  4MFD A;  2CYZ B;  3A8L B;  3BCB A;  2M3A A;  3OIP A;  3CP2 A;  1D1A A;  4ELJ A;  3ZR8 X;  2ELJ A;  2X6Y A;  3OYC A;  3WVD B;  2ZPE B;  2ZXH A;  2WB1 A;  2BW3 B;  3MD2 A;  4OB0 B;  3DQV C;  3FDY A;  4OAZ A;  4PFP A;  4BJ6 C;  3WVE B;  1GLN A;  3H9G A;  3LSI A;  4HEA 2;  3OYN A;  3W3C A;  3LSG A;  3SEQ A;  4BXF A;  4GRI A;  3L2U A;  2E60 A;  1V5G A;  2CUZ A;  3X28 B;  2VJ5 A;  3S93 A;  2XSJ C;  2ZSI B;  2VPL A;  2VXD A;  3HOT A;  3OYL A;  4BDZ A;  1SAU A;  4F91 B;  3EUH C;  3W2A A;  3RPU D;  4YRV A;  3S8P A;  2UWM A;  4PJL A;  4X0G A;  3VYH B;  2DD4 B;  3OIQ A;  2X1C A;  1WJF A;  3H5A A;  1WJE A;  2MC4 A;  5CQE A;  2K3P A;  2LYC A;  1X4P A;  2JSP A;  5KHD A;  4D9J A;  1LVK A;  1WJ5 A;  3RSN A;  4HNU A;  2QDJ A;  1LFP A;  1VZ0 A;  4KJZ A;  4DOZ A;  3AL0 B;  3OMY A;  5KCM A;  2CW7 A;  5TGT A;  3DTK A;  4U87 A;  4ZGE B;  3ZRG A;  4ZTF A;  2K9L A;  2AQF A;  2BS3 A;  1UG0 A;  4KIT B;  3HB9 A;  4ZDP A;  3SDB A;  4QPQ A;  2M7A A;  1X1C A;  1SFK A;  2IXS A;  1UAA A;  2LBF A;  2DT6 A;  3G2B A;  4R79 A;  4BE1 A;  4F92 B;  4PUS A;  3LSH A;  4DGW B;  1X19 A;  2IS2 A;  2XF6 A;  4XKV A;  3ZQQ A;  2HQA A;  2W82 A;  2ZXI A;  1QU3 A;  2WAF A;  3QYH B;  1BR1 A;  1QHG A;  2ZZD B;  4P1W A;  3BC8 A;  3C2H A;  4FET A;  4PJN A;  4XKC A;  3H0D A;  4J01 A;  2E5Z A;  2QQ8 A;  1PYV A;  1X1D A;  3AFH A;  3FBN B;  4PSW A;  2R7W A;  2BOL A;  4DBQ A;  3A8M B;  2Y0S A;  3FBI B;  1X4O A;  1Z3X A;  4BQN A;  3VKG A;  1R6R A;  4F55 A;  3ZGK A;  2QF7 A;  3OY9 A;  3N05 A;  3W2W A;  3BG5 A;  3MMY B;  3K6G A;  3RCO A;  1V29 B;  2QKL B;  4LIU A;  2AHJ B;  2M4G A;  1BOB A;  2WY7 Q;  4XNF A;  5FRN A;  5HVQ C;  1ZEL A;  4E6K G;  3CES A;  2X85 A;  2F4I A;  1IRE B;  3K4C A;  4AKH A;  2KMU A;  1X1B A;  4Y4R A;  3OYE A;  2CV2 A;  3TBI A;  2VKD A;  2X51 A;  5HNH A;  1AHJ B;  2ZPG B;  2VJI A;  3I9V 2;  3IP4 B;  4OWR B;  2R7T A;  1UEL B;  2OV7 A;  3NWT A;  3DU5 A;  3X26 B;  2V1N A;  2CV0 A;  1W36 D;  2HNH A;  2LH9 A;  4F3Q A;  4CZC A;  5KNL A;  3MKZ A;  4G6T B;  4PSX A;  4KIS A;  2JA2 A;  3VWB A;  4PJM A;  2CH0 A;  1MND A;  3OYF A;  4IKF A;  3DPU A;  3OS0 A;  3V42 A;  2VKH A;  2DJI A;  2CS3 A;  3HC7 A;  3OR2 C;  3EPZ A;  3IUO A;  3K4N A;  5FRO A;  1KON A;  2F5V A;  2CZ1 B;  2PMZ A;  2IGM A;  1WJD A;  2WA0 A;  3F9K A;  2PJR A;  2V9K A;  4BU2 A;  2IGK A;  4CCK A;  2OUM A;  1UGP B;  4IZZ A;  3CMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...