3QYBA

X-ray crystal structure of human tbc1d4 (as160) rabgap domain
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
297
structure length
297
Chain Sequence
HMKVKLDYEEVGACQKEVLITWDKKLLNCRAKIRCDMEDIHTLLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKELLKQLTAQQHAILVDLGRTFPTHPYFSVQLGPGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLHMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEISPSLYAAPWFLTLFASQFSLGFVARVFDIIFLQGTEVIFKVALSLLSSQETLIMECESFENIVEFLKNTLPDMNTSEMEKIITQVFEMDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TBC1 domain family member 4
publication title Crystal structures of human TBC1D1 and TBC1D4 (AS160) RabGTPase-activating protein (RabGAP) domains reveal critical elements for GLUT4 translocation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
total genus 91
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2011-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 3qybA02
1.10.10.2750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3qybA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3qybA03
3QWLA 4P17A 2QFZA 4NC6A 4HL4A 2QQ8A 4HLQA 3QYEA 2G77A 4Z6YA 3QYBA 1FKMA 5EJCA 3HZJA
chains in the Genus database with same CATH superfamily
2A69F 2VJ5A 4ENKA 1FWZA 4G3OA 3EUHC 3HY5A 3ZQQA 2CWBA 2VF8A 1D2NA 5EDNA 4II7A 4WP2A 2EH3A 4BE1A 1S3JA 1BIBA 2FSWA 1TP4A 2Q2EA 5IOYA 1T39A 1LFPA 3H9QA 1XX5A 1IDZA 3BZ6A 4FM4B 2JVHA 2G5GX 1YHQI 3RPUD 1T0FA 4L5JA 1JJ6C 2PK9B 3TEDA 2OO9A 2VL8A 1WJEA 3D0SA 5FKNA 2MBFA 3BZCA 2H8WA 1WJ7A 2LBFA 3SYKA 5J6XA 3BHVB 2V7FA 2CHQA 1Z3YA 2DA4A 1G59A 2KRHA 3NARA 1S7EA 4CXFA 2UWMA 1JR3A 2VKVA 3WHLA 3S15J 5M5WJ 3H9GA 3SAVA 3IHPA 2DA2A 4A0YA 3PVSA 1XSVA 3T15A 3SXYA 4X6AJ 1PDNC 5HVYB 2PHGA 2XF7A 4BCGB 3E46A 5LLQA 4EQQA 3F92A 5JFRA 4NC8A 4NSRA 3SARA 2QQ8A 3PFYA 2KQRA 1FYLA 3OYAA 3QODA 1X4OA 5EXPA 2BXYA 1RKWA 3EYYA 5ERIA 3HHHA 3HOSA 2RAEA 2Z5UA 3CC2I 4EOKB 1I1GA 2K9MA 2C5VB 1DGRM 2A05A 1U2WA 5CKTA 1BJZA 1UGRB 3B7ZA 4ROEA 3GLFE 3HIFA 2M4KA 4G7HF 2VJJA 4J01A 1Y39A 3V4GA 2R7XA 5LD2C 3DV8A 2L2DA 2K9SA 4UUTA 2VDBB 1K3XA 3FK7A 1EFUB 2DMEA 4LJZF 2CZ7B 1HXDA 2ZCWA 4XM3A 3S2WA 1ETVA 2PFBA 2M45A 3K1MA 4WWCA 4PSXA 3S16J 1U78A 3OL4A 4ANJA 4S05A 1GL7A 3I4YA 2YNMD 2DYSH 2IGMA 3SDGA 5BNJB 1MBJA 2W96A 1MSEC 4I7HA 1TFBA 2CEAA 5C4XJ 2M8GX 1ZP2A 3GLGA 2O01F 1NHAA 2KJCA 3ECHA 5FO5A 1QQIA 1R4MB 3FM3A 3H3VK 4XN3A 1IXSB 2JWTA 3H1CA 4D80A 1YE9A 3EUHA 1AHJB 2JUJA 2XFSA 3KLOA 4XSZF 1SXJB 3RGSA 3A01B 1W5TA 4PCZA 1C0WA 2W82A 4GKKM 4HV6A 2OQRA 1OAOC 3BR5A 1YFHA 3GXOA 3PSIA 2HQNA 3KYDB 3T1YM 4QWQA 4YIIA 4GYIA 3TQNA 1EF4A 4D5CA 1OYIA 2C9OA 1IM2A 4HF2A 1O9KB 1HQCA 3W2WA 4L0YB 3ZH9B 2RGVA 3HU3A 2QBYB 2V9PA 4QNRA 2XGEA 1V54H 4ZDOA 2NVYJ 2LW4A 4XK8F 3DEWA 2M8EA 4UV8A 1NH3A 3EPZA 1BI0A 2ZB9A 2VI6A 2CV0A 2HOEA 2DDAA 4BCJB 2JXNA 2X6OA 3I71A 2ESNA 4JOMA 3DTKA 3VYRB 2XSJC 4XICA 3DJBA 2J5OA 3S3NA 2FNAA 2IAIA 1VG5A 4BBSJ 4TTHA 3HHGA 4BBSM 4LZJA 4M73A 1PUFA 2WAFA 4RGUA 5HDNA 3FF5A 4GCVA 4M3GA 2XFTA 1R00A 2BVLA 4LF9M 3W3CA 1H24B 3G4SI 3B6AA 4P5OA 2X8AA 4EJWA 2K9LA 3RCOA 4E70A 1TNTA 2JA7J 1QHHD 1W7PD 4RDUA 3V76A 1I50J 1AIPC 2QEXI 3LSHA 4Y52J 4KUMA 1PJIA 2VXDA 5DCMA 4KA4A 1F1ZA 4AG5A 2YS9A 1XNRM 3B02A 5IT3A 4H0EA 2ZKZA 1SMTA 3FRHA 1XNQM 4A0ZA 5K5QA 3GZNB 1HKQA 4LLNA 1LNWA 3DPTA 3C7JA 1R49A 3L09A 4WCGA 3RJPA 2Z33A 2P6SA 2DAGA 2JP7A 2OTJI 4EOLB 4FCVA 4JX6A 5F04A 3BTCA 4IKFA 3WU1B 2QM3A 1JJ8C 3CCRI 1FP2A 3VYGB 3K1PA 1YLFA 1IQPA 5ITQA 1GUUA 4EIWA 1PVEA 3KSJA 1JHFA 1ZG3A 3GQ3A 2E1MC 2EA4A 3KZZA 4CGYB 2M3AA 4BXXJ 4BU2A 1ZGJA 1FEXA 1W5CC 2J5YA 1JQJC 5J1RA 3N4MA 2HZTA 1G8XA 1KYWA 1IO2A 4MNUA 1DGFA 3J27B 2DTZA 2K9DA 2KRCA 3KSXA 1XCVA 5EXXA 4JX5A 2A68F 1WI3A 1K78B 2B9RA 1QDTA 3L2WA 2FQ4A 4KIFA 1D0YA 5IYBJ 3ABMH 2E2JJ 2R7VA 3CMAI 1IN5A 5HDKA 4MGHA 1XWIA 3QZ5B 1O4XA 4AW4A 3BJ6A 4QLCU 2P5LC 1X37A 3QAHA 4HSTA 4R79A 2MC3A 2V9VA 3V7RA 3Q0WA 1XN7A 2XRNA 1UJ8A 3IL2A 3KP2A 3CMEI 3GZ5A 2C5NB 4EJUA 2Y30A 5E8GA 3RIRA 3LAPA 2K85A 2ID3A 3FXUA 4AKIA 1G4AE 4KJZA 5IREB 1DPUA 4AIJA 5IYCJ 2R4EA 4IXAA 1VEJA 2DAEA 3NQOA 3ABLH 5M3FJ 1FC3A 4CFUB 4LF6M 2B0LA 1KA8A 3WE3A 3Q9SA 3OYFA 3LSIA 1D0XA 2VPLA 2RRUA 2EFPA 2EZLA 5ITXE 4CZZA 2COMA 1KYIA 4LITA 1JUSA 4AD9A 3IRQA 4BCND 4L9TA 1Z0XA 5L2WB 2XASA 4A12A 3QYHB 2HI3A 5DDGA 1ZAOA 3JW4A 4UHTA 3W6KB 4FCTA 3LAJA 2EK5A 4Y72B 1POGA 3MY1B 2E2HJ 4OX9M 1DGWY 2DMQA 1IN6A 2R65A 3H5NA 2VOOA 1XCBA 2LR8A 3I51A 4HW0A 1XXHA 2D7GA 3JRAA 3HOZJ 3WGIA 2UZLB 4OAZA 3RPQA 2Q1ZB 5CVUA 4LY6A 2NOJB 3FIWA 3COAC 4Y28F 1I6XA 1YX5A 2WB1N 4NUBA 1K61A 2JUGA 4AVPA 2R6FA 1W4MA 3CJRB 4MH0E 3D5SC 3LSTA 3QAUA 1ZKGA 3S3OA 1E7PA 4A3KJ 1LPQA 2ZPFB 4LF4M 1DGHB 4PGGA 4EVIA 4G4NA 4XIDA 4G4RA 2ZAOA 4FE7A 2NVQJ 2L4FA 1G4DA 1FX7A 3MVPA 3SMSA 4G6LB 1K82A 5EF6A 3HYIA 4J00A 4NSTB 1S7OA 2PMZA 1UG0A 2BJWA 2IP2A 3KZYA 3FISA 3K2LA 2GXAA 2WZJA 5ITTA 2QVOA 3HJSA 4IBJA 4M0WA 4OU7A 4K0KM 2F5DA 2DWLA 4ELLA 4F6UB 2CQXA 1H6UA 2LRDA 3MN2A 3S3MA 3L2AA 3AV0A 4LJ4A 3HJEA 3KZIC 3JAMZ 1ETXA 1R23A 2OPTA 4IBGA 3GLIB 1TNSA 4DR2M 3K0LA 3GTJJ 2IW6B 2IJLA 4FX4A 1OYWA 3TNHB 1OGUB 1W98B 1I94M 3GPPA 1NNJA 2AXTC 3BTLA 3C1DA 1IXZA 4BCMD 4DBGB 2L9SA 4GKJM 3H36A 4BJ6C 1BN5A 1IY1A 2VQFM 2LY9A 3WVEB 4YIFA 5FLMJ 4PDIA 2M0CA 2IW5A 1U9OA 1QBJA 4IBCA 2YUSA 3QU3A 3LMMA 3FXRA 3K69A 3ZQGA 3EOCB 1JTYA 1SFKA 1FJGM 1JSTB 2YU3A 1IXCA 3H5RA 2GIVA 1XS9A 4M6VA 5HS7A 4F7SB 1X58A 2CFXA 3BCBA 4HQMA 3K4MA 1QVTA 1QAOA 5KPRA 2X85A 1HA8A 2ESHA 1ON1A 3DFZA 4KITB 4ZYHA 5LEKA 4UVCA 3WTXC 3QRFF 3MJ5A 1T38A 4GRIA 2LVNC 4N4NB 1ZLJA 3LQRA 3W67A 2G0EA 3H9JA 3R0JA 3HKPA 4LF5M 4RS8A 5D4RA 3WTWC 2R7RA 3HDDA 4G6TB 4ZGEB 4XSXF 4BCQD 3MK6A 5BPVA 1EH8A 1YI2I 3TBIA 1SXJE 3IWZA 3X2QH 5CVVA 1B1BA 3EIDB 1U9NA 1XGOA 3S32A 2OF7A 5HS9A 3TMOA 3CESA 3F6VA 5CYVA 1W36D 1P6RA 3HC7A 3QOEA 1HKSA 4OU0A 1TF0B 1AA7A 5KAIC 2DD5B 1MH3A 2HZDA 1D0KA 4CYCA 3E6CC 3ERED 1OIUB 1XSDA 3M8EA 2CV2A 2HTJA 3IP4B 3D8BA 2ZMEC 2ZXJA 5ILVA 5E6JA 3A98B 5M5YJ 3CD6I 1Z21A 5E1ZB 4GDFA 2B3TA 3HPHA 5D5VB 2FUG2 4A3JJ 2WV0A 1FLIA 1Z77A 4JQFA 3GLLA 4I01A 2CRUA 4KT6A 4EGYA 2WXVB 3THGA 2X9DA 3FYDA 2HOAA 2V1XA 2D1HA 4RGSA 2DMNA 4LIUA 1ZG5A 4AWXB 4AI6A 3HOYJ 5EP4A 3F5XB 3SAWA 1ORKA 1OTRA 2BY3A 2WV1A 1PJTA 4Y3OA 1D5YA 2IN3A 2NAZA 5L3DA 1GUXA 3LOCA 3RDIA 4F70B 3NDQA 5IP9J 3AKZA 4HZFA 2IA2A 3PFIA 4ZTJA 1T8IA 4TUWA 5FB2A 4LG0B 3A8LB 2AO9A 2BHZA 5HBJB 2ADUA 3GLFA 1QZYA 3T5XA 4P55A 4ZYEA 5EP3A 4KIGA 4ABZA 3DFGA 4O6JA 5C44J 4IZZA 1RESA 1FPQA 3OYLA 4GEWA 3VKGA 4DYQA 4BB9A 1D3UB 4GFBA 1Z5BA 2DZLA 2L7IA 4KNYA 4CFNB 2P8TA 1DO2A 3O6BB 4EM2A 2W4SA 1QZEA 4BQOA 4S0HB 5GTHC 4F1IA 4X65M 3F9KA 4XLNF 5F0HA 9ANTA 2NNNA 2JGZB 5DNYA 3ZN1A 1MMGA 1ZV1A 2O5RA 1OAIA 3K1JA 3W0FA 4I5SA 4KLNA 3DOGB 3I53A 1MJ9A 5JI3E 1ZMWA 3LQQA 2ZMEA 3SZPA 3TKYA 4AG6A 4MFEA 3HTUA 3RZOJ 3V8LA 1JUMA 4F6SB 2F2CA 1CF7B 3OS1A 3UZUA 3HKZA 2MH2A 4M9SA 2D2WA 3KEOA 1HOMA 4RB0A 1PGYA 3K4JA 2HVRA 2XH9A 1R5LA 4C2TA 2W57A 2MA3A 3OS0A 4WXCA 3KEQA 4M3BA 2NVTJ 5JI2E 4GMQA 2A3SA 2KP6A 2OJED 1JB0F 5F3WA 1Y8GA 3RFWA 2DAIA 2KIUA 3KOYE 3TW6A 1LVAA 1O3QA 2BWEA 3V8KA 1P9QC 3U6QA 1X2MA 1ORYB 4D9JA 4BCPB 2EZHA 2M5ZA 3S17J 3I04M 2FNPA 5FJ8J 2VQLA 3ZCOA 2QHOB 1YOVB 4A3BJ 4NDLA 4ZJZA 1XPXA 1GKIA 1G41A 2FS1A 3HRMA 3X26B 4BBRM 1I27A 2RGHA 4L6V6 3H4JA 3F3XA 3FXJA 4M6XA 3WE2A 4QOSA 3GFMA 3FTDA 1OIYB 2F4IA 2LF7A 4N4OB 3FMRA 1QZMA 3U6EA 3CQZJ 1YW9A 3DWLE 5DYMA 5FKOA 1LE8A 4LF7M 1SG9A 1U6GA 1R4NB 1NNUC 3U61B 2F6CA 1ZG1A 4BAYA 1LEBA 2DO7A 4LOCA 2XVCA 1F43A 1JKWA 2KW0A 1K6YA 2W1OA 1I1SA 1SANA 1S29A 2QGUA 1H1SB 4CXAB 4NOOB 1IY2A 1UM8A 1P92A 1Y0UA 2XF6A 3FDYA 3O8GA 5B5EC 5LBQA 2G8LA 3W0LB 3BR1A 3HRSA 1PJQA 1Y56A 4A69C 1QRYA 5L3EA 3O0GD 5IT9S 3TDUC 4B3SM 1HW5A 3JAMK 4RKUF 3GO8A 1R58A 1R5GA 1SVLA 2GOXB 1SD4A 1SVMA 3NBIA 1ENHA 2K5CA 3E1SA 3CO6C 3FX3A 1HC8A 4ON0A 4B08A 3AG3H 4E7KA 4OW0A 2Z3XA 5KO3A 1FIPA 1GL6A 5F0FA 3FHNA 2RNGA 2VB6A 1HLVA 2VIXA 4L5EA 2HXOA 3GTMS 4FW9A 1N34M 3CUQB 4DQ2A 3ONQA 4ZPXA 4U0YA 3DKWA 1RI7A 2UV1A 3BXWA 2C99A 4N9IA 2LVSA 5GPAA 2HS5A 2HL7A 4OWRB 5EXSA 1VQNI 3U5ZB 4F6WB 4G9YA 1Z67A 4BCOB 3FTFA 3CP2A 1FTZA 1HSTA 2H27A 5LGTA 3MY5B 1GV2A 3L1PA 1LQ1A 3U6CA 2HPIA 4D7NA 1TTEA 2HQRA 3K9TA 4WXHA 3GLIE 2DQLA 3F72A 4U7DA 4XKBA 4RB1A 1JKPC 2YFQA 2VKDA 3MZ8A 1FP1D 4PZJA 3SASA 3PUFA 2V6EA 4LZZA 1MD0A 1SEUA 3RGPA 2NNYA 2FU4A 4XKCA 4FHTA 1KU9A 2PX9A 2L7HA 1KYZA 2E5ZA 8CATA 3B7NA 2Y75A 2JRTA 3HGGA 4ESBA 1J7KA 4R3DA 2R4JA 4I3ZB 3GF2A 3U21A 3V42A 2X1NB 3LCVB 1KFVA 2HTSA 1USTA 4UXNA 3TWMA 1Y8QB 2P6TA 3MCZA 3TGNA 3L00A 4QSHA 3FUXA 3MQ0A 5ITXA 1GJSA 1MKMA 1A35A 5JHUA 1OQYA 4MFDA 2NVXJ 1PJSA 3KS8A 3CGWA 1TQPA 2R92J 3J7ZI 4XL9A 2N8GA 1OJLA 1V33A 3BP8A 3GVAA 1TZLA 2Z7JA 4QTRA 4DW6A 2JK3A 4B09A 4G6ZA 1GVDA 4CUGA 3M3YJ 3Q5FA 2LG4A 2DWNA 1N77A 1FY7A 1KQ9A 1B8IB 3GTLJ 4X66M 3CTAA 2M4GA 2OZ6A 3OYEA 1YLAA 3RYRA 1BI1A 2UZDB 4G6DA 1SXJC 2A5YB 2CHVA 2BYVE 3HUGB 4PJ0C 2XRLA 3WTUC 3B57A 4HNVA 2DAOA 3DBLB 2DA3A 2UUCM 1QZZA 2E7XA 4QNMA 2IEKA 3WODF 1YO5C 1LEAA 1V5FA 2ELKA 2QNJA 3R61A 2QWWA 2DXBB 1OL2B 1EJ9A 4OR5B 1QUSA 5LEJA 5IDNB 2DHRA 2HU9A 2PMIB 1GY3B 3LSRA 4A0XA 3PO3J 4PUSA 1R4GA 2Z9OA 2DQRA 3F0CA 1Z6RA 3A45A 3HG9A 3MMPA 4J19A 4A3LJ 1W1WE 1J0RA 4R8HA 2UZBB 2DKLA 4PJMA 2LBCA 3VK7A 2BXZA 3DQVC 3OYBA 1ZK8A 4UUVA 5HOOA 2AHQA 4ELJA 3IKTA 1Y0NA 1MMNA 4BQAA 1VI0A 1V34A 3BWGA 5CVJA 3ZMTA 1KONA 1T3TA 5JR3A 4MIMA 3AJIB 1NG6A 2F5CA 1QHGA 3TOBA 1ZARA 1WIVA 2KHHA 1JUPA 3OIOA 1JGGA 2HPMA 4IIWA 2ZTDA 3HXLA 1ZRFA 5FLVA 5CQGA 3OYIA 2QZ4A 1NK3P 2Z3YA 4EM1A 3HGIA 2XGCA 1N75A 1WKMA 3IHUA 3MI9B 2L7ZA 2H8RA 5F0CA 4OB3B 4EORB 1FBSA 1LDDA 3ZQCA 3VYTB 4BS9A 4HRIA 2KL4A 2CWEA 3V7SA 4JYAM 2NS7A 2Y0SA 3OV8A 2UXCM 1JR3D 2LXEA 2KHMA 3SYLA 5CVRA 3GMEA 4BL0B 2IPQX 2R7GA 2ZCFB 2LNHC 4Q5SF 1ZQ3P 1B4AA 1O7FA 3AG4H 2DPPB 3HRUA 4ASNA 1LKXA 1Z7LA 1V92A 4LLGF 3J2PB 3W68A 3J7AY 3H4CA 1YW8A 3CCVI 2YX7A 3GFIA 2X4AA 5BOXA 3BOQA 3OYCA 1IXSA 1PRBA 2VBWA 3CF2A 2QCOA 1AKHB 3A42A 3ML6A 3ZQ7A 3CCUI 1VQPI 1IC8A 4RM2A 1B72B 2I53A 5EP2A 4M0DA 1VF9A 3GEZA 2JZ1A 3A01A 1LFBA 3E7LA 3OMYA 1K4TA 1TH3A 3KS4A 3MKZA 4PDGA 3K70C 1E32A 1ZREA 5EFQB 3HHXA 3TQSA 3F22A 4UVBA 1O9KA 1YJWI 5EGOB 2ERCA 4JBAA 2DHYA 3S1MJ 1X19A 2QBYA 2LY2A 2P7CB 3PQKA 3E6BA 4QPOA 4XORA 1FIAA 4HEA2 2UZEB 1DP7P 4RF0A 3L28A 2R93J 2VUMJ 4DV1M 2STTA 1BVSA 2ETHA 3KP7A 1NO1A 2EV0A 4EOIB 3M0EA 2JPBA 4XRMA 3TO7A 5ICFA 1TDZA 2KNZA 2P7VB 3JRGA 3GTMJ 3I4NJ 5HBEB 2XB0X 4JI7M 2HXIA 1HKTA 4BY7J 4LJ6A 3S1QJ 1VQ1A 2BS3A 5EJCA 1YRNB 3GTGJ 3WTTC 1HT1E 5ICGA 1B9MA 5FSWA 2CRGA 4FASD 2QLZA 2LH9A 3E97A 5F6FA 4YFXF 1H88C 4IF4A 1P7IA 3J81S 5FD5A 2CSOA 4YEJA 2W99A 2DA7A 3GTOJ 4LF8M 3RKYA 1WZ2A 2WPAB 3I58A 1GXPA 1IV6A 1RUOA 2JWSA 2DOAA 3KIOA 1STZA 5EP1A 3CJQB 4O3MA 3G1LA 4M74A 3M03A 1ERDA 4JXJA 2Z4SA 2DA6A 3CCQI 1ENWA 1T6SA 3Q8XA 5FROA 1WH5A 1LB2A 4BKXA 1J5EM 2CQNA 2LC2A 2Y2ZA 4B1RA 2CQKA 3H3ZA 1OKVB 2DFEA 3MKWB 2H1LA 1Z7UA 4I0BA 3B74A 2LTUA 3GO5A 4F7LB 3T6PA 2BWBA 4HX7A 2HVQA 3R9XB 2IGKA 2CQ7A 3LA2A 1BM9A 2W7NA 5GAHJ 3SHFA 2HKXA 1PM5A 4BGDA 3DKXA 2OCEA 1UGPB 4CCNA 1D1BA 1XG1A 4M6YA 4PFOA 4CFWB 5EZGA 2UXDM 1Y8RB 1ZTRA 3K2AA 4JI5M 4Q48A 3CO7C 4HLYA 1RIOH 1BU2A 4JI8M 2A6EF 4CHUA 4AYBA 2XPUA 3SBJA 3RYPA 1YTYA 4M3EA 3BHUB 1XMAA 3BLYA 2VLAA 2KDLA 3HRTA 3ROUA 1XB4A 1WH7A 2DBBA 2R5ZB 5C18A 3ZRGA 4CO8A 1BI3A 3TOAA 4IHWA 2CZ0B 5LRSA 1RKTA 1GJTA 4NXMM 5ILUA 1K78A 4ETSA 4JP0A 4UY8I 1ETWA 1Z59A 2XDVA 1R9TJ 1FSEA 1JSUB 1TH4A 2QF7A 2JY5A 4MTEA 1MDMA 2GM4A 3IG5A 2FFJA 1E3OC 4F7JB 2GBYA 3U60B 2W00A 4C30A 3ESWB 2Y69H 1WXQA 4UVAA 3A02A 2BVMA 3G6EI 2EBIA 1D1CA 5ICCA 3MZYA 5J4VA 3TDZC 4X0GA 3M8FA 4A93J 1TL8A 1RETA 2JUCA 4B7HA 3CC7I 2O61A 1B59A 4YFNF 3ZOBA 3BY6A 2W84A 4IJEA 4YOZA 3KX2A 2D45A 3SQNA 4LLLA 5FTNA 4M9ZA 2LHGA 2H1RA 3DOAA 3B9PA 2FBKA 1UCRA 4BDYA 3T8TA 5LHHA 1LTMA 2BHYA 1X1BA 4RA2A 3WU0A 2JSPA 3KE2A 1Z91A 4RM3A 3MMYB 1S6LA 5M3MJ 5GPCA 4IHXA 2WADA 4IHYA 1FMWA 3OR1C 3KFWX 4YFKF 1D3YA 2E71A 3H0GJ 4EOJB 1OFHA 3ELKA 4DBQA 1T56A 5D5XB 5FGKB 3CP8A 2CYYA 3DU5A 1NHWC 1R1TA 3KHIA 4BACA 3VYHB 4GGGA 2W48A 4AQYM 5HNFA 4IVNA 2MSYA 3BG7A 3LSMA 2K6BA 4B3MM 2LBFB 1FOKA 1KQ8A 2XLJA 1VQ7I 3AOEC 2DA5A 2W24A 3NWSA 4LB5A 3ABKH 3X28B 2KDZA 3ZMZA 2M60A 3KOXE 2F5SA 2PLYA 2FOWA 3BCAA 4R71A 5LQFB 2ISYA 4DOZA 3WG9A 5HNHA 3I64A 4WK8F 3C2GA 2CZ1B 1H1QB 1VQ6I 1ZGAA 1RR7A 4OVZB 1XTAA 1BC8C 5CYIB 2QSGX 3AG2H 2JPCA 3GRUA 4S04A 2MROB 2CUJA 5DCFA 3EYIA 2WBMA 2EKKA 4EV0A 3TN8B 3GP1A 4I76A 3QZ9B 4QOZC 1BOAA 3SATA 2ICWG 3VPRA 2BW3A 2XAUA 1ZMVA 1ETYA 3FKJA 5KK1A 3C9PA 4D82A 3BR0A 4F92B 3GLIA 1GLNA 2EB7A 3J80Z 1IN7A 2RN7A 3K4NA 4X62M 4M72A 2PJRB 2CYZB 3IC7A 5KQ8A 2LNBA 2YSRA 4JV5M 3C2HA 3TO9A 4HDUA 3X24B 5LFAA 4BY7X 5FFXA 3DA1A 1E9SA 3JCUC 4I99C 4EJOA 1BW5A 5FRMA 3HJ8A 4YHHM 2VBYA 2GXGA 3I4PA 3I01M 1YJ9I 4XGIA 4FQGA 4BUPA 1IN8A 3UK6A 2XPWA 3CF0A 4M71A 3AFHA 4UN2B 4NC6A 2OOAA 1R2ZA 4G94A 4UV9A 1VQ8I 2QDJA 3POMA 5DQVA 2PQ8A 3FXOA 2ZJRF 2Y9YA 4QPQA 2LSOA 4UB8C 2F48A 3GLHA 4XLCA 3LNQA 2VJ4A 1OPCA 3X25B 2QPAA 3VLFB 3D8LA 3C2BA 1S9HA 2KR6A 1YW7A 1NV8A 3J7YJ 3JR9A 4WX9A 3LVWA 1G71A 2UUBM 1UG2A 3WTZA 2V1NA 2CE7A 1G3IA 1WJDA 2DFIA 3AOEA 5BR8M 2H94A 3QOPA 4XLEA 4H4KC 2QFZA 3F23A 1IV8A 4XNFA 3U6PA 1JOWA 2OZUA 2P4WA 2ZC2A 4CDGA 1KU7A 2FEZA 2ZPBB 4AKGA 1U5TB 3DEEA 2LY1A 2KNAA 2KRKA 2Y20A 2LKXA 3RSNA 2HVSA 1M1EB 2M5WA 1JXSA 2KMGA 1ZAEA 1XC5A 2EJSA 3G73A 3B7QA 1TTYA 4IL6C 1E9RA 3OYMA 2O0YA 2C98A 1PUFB 1WCMJ 4BHCA 1ETOA 2LMDA 2M7BA 4FTHA 4HOBA 4B3XA 4P9FA 4XRSG 3FXMA 1AUAA 1JKRC 1T43A 2LLKA 3A4CA 3HPGA 3O2PE 3CJNA 5E3MA 2JSCA 2JJ7A 2EV5A 3BPXA 2V4JC 2HDWA 3CDIA 5EEGA 3PL8A 2P0WA 4BXFA 1IG7A 4LRSA 1WI9A 3HOUJ 2VF7A 2GIZA 2R7TA 5DCMB 2QYOA 4IRHA 1OMIA 2CUZA 4NRVA 2HFHA 3FBNB 2HOSA 2GAUA 4HSRA 5E3LA 1R1UA 2XV4S 3ABTA 1OKRA 2ZJQF 3ZC7B 1Z9CA 1P5EB 3SHGB 1V5EA 1OIPA 3LWFA 3BG5A 5A2QZ 2HQ5A 5DTDA 4NXNM 2MR9A 2E2IJ 3E21A 2MG4A 2JA6J 4LJ7A 1XDUA 4CFMB 1ONVA 3QHRB 2WC2A 2V22B 3P7NA 4U7BA 1BR2A 2VE9A 4IBIA 2NS0A 2PJQA 4GXOA 4IRGA 4RLQA 3JRIA 2IBDA 3IKVA 3HHZA 3BTIA 5E1XA 4KT5C 2WMBB 4C3JJ 1D0LA 3OTOM 4BNCA 3SEZA 4OIRF 3A1YA 3F8FA 2UZKA 2OD5A 3AL0B 3F8MA 1PJRA 5CJ9A 1GVJA 1Q39A 4A3GJ 1G3YA 1FYMA 5IT9Z 1E2XA 5AIQA 1J5YA 4HDVA 1E17A 2CP8A 1BW6A 4B7FA 2HWJA 5FRNA 1W7PB 1F36A 1TW3A 2ISZA 3CUQC 3E6MA 3ABUA 5J8FA 1MMDA 4IBBA 3T0YA 2R46A 4NHJA 2XKOA 4XONA 1YSYA 1X3WB 5AIPA 1CF7A 3ERMA 4JK1X 1XGNA 4G8XA 4FWHA 1XB2B 4DV3M 5IP6A 4U87A 5HBHB 3KYLA 4HPQA 3CCLI 3FK6A 2HEOA 2EUCA 2VE8A 2E5LM 3OIPA 2W85A 4YELA 2L7MP 4Q7JA 3M6AA 2DTRA 4P9UA 1CQTA 4DV6M 2ZPIB 4BCKB 2GQQA 3N97A 5DM6F 3LSJA 1G2HA 5J1UA 4LFCM 2DENA 2QKLB 2EUFA 4XBOA 4OGRB 4Y33A 2CW8A 4YOSA 5FLXZ 2EIMH 2LK2A 4PFPA 1FINB 2CS3A 1Y1VJ 1H28B 3GW2A 5H6RA 3I56I 1JI8A 2AHJB 3JRDA 1NG7A 3CTWB 4JX4A 2JVGA 3DBRB 4PCQA 1XXHB 2VASA 3A0BC 1UGQB 4XLFA 5IDPB 3WU2C 2D1VA 4PDKA 3HKZN 4EJVA 4EGZA 1FZPB 1LDJA 3GWZA 5TJJA 2WA0A 4UNOA 1R6BX 2MYSA 4OINF 3EJ1B 2MH8A 2QQ9A 2LWXA 1YUBA 5ITYA 1ZHFA 5M5XJ 1C9BA 2UXBM 2VPRA 5E18F 1OFIA 3BC8A 3M9AA 2Z4RA 2EA2A 1R7RA 2ELJA 4E7ZA 2CV1A 2F5PA 1MSFC 1ZELA 2EPFA 5F08A 2FMLA 2JY8A 3L29A 3PSFA 5D6EA 4PSWA 1SAXA 2IVXA 4I02A 2IW9B 3BLRB 5EEHA 3J80K 2R5YB 1NY6A 4EONB 2R7OA 3E3VA 3E6DA 1DGGA 2MABA 1D5VA 4HX8A 1G3SA 4I0AA 2O7OA 2XF3A 1T33A 2GA2A 4XOTA 4BCIB 4KISA 4N0BA 2XEPA 1DPRA 3CUQA 3OSFA 3TWLA 2Y48A 2DAMA 1IJWC 4JI3M 1QANA 3DZDA 5BNGA 3QYEA 4A3MJ 1HBXG 1NSFA 2IA1A 1MBHA 1OL1B 3S8PA 4C3HJ 4RODA 4LGWA 2IGOA 5EYRA 3U5ZA 4GIPA 4BCNB 3NWTA 4BJTA 1JT0A 2OOBA 4HEOA 1IDYA 1OKSA 2E1NA 4LB6B 3QHWB 1HSJA 1LVKA 2VKHA 2DT6A 2XGDA 1Q1VA 4L9NA 4F2LA 3LQ5B 3RE8A 2MC4A 4KYWA 2C96A 3HU1A 3BROA 1JE8A 1S7AA 1MH4A 2WSEF 4HL4A 1PJJA 2X6YA 2M7AA 2FH0A 3ZR8X 2ZFUA 5C4JJ 4PJNA 2E1OA 1SD7A 3LSKA 3CMYA 2DW4A 1MJGM 1HW2A 2RC4A 3HL2A 1MBFA 2IS2A 1XGSA 4ZYDA 3L25A 3IECA 1ZGWA 2RKOA 3HSEA 3S14J 3I9V2 1A6IA 2L7KA 5LHIA 3E0JB 4LCBA 2CFOA 1O7LA 4RAYA 2JZ0A 1MMAA 5J47A 4BEHB 3J7BA 1IUFA 2FF4A 2GNOA 3QU6A 3HOWJ 1MN3A 4AZFA 1BR4A 5DEQA 3HEFA 2XGXA 4ZDPA 2MD0A 5D5WB 1W0TA 2L6OA 1KGSA 3HB9A 3KP3A 5TISC 1MX0A 4BBRJ 2R0QC 1VTNC 4EJTA 4CYCB 2DMPA 5EXTA 1C1KA 1N36M 1D1AA 2BV6A 2KZSA 4MLOA 1KU2A 3JSPA 2FBIA 4RGXA 4IX7A 2DZOB 2JY7A 4ZGJB 4V19K 2YX4A 5L3CA 1OCZH 2KIFA 2HGCA 1UELB 2L02A 2NVUB 2YPRA 4BCMB 2LTPA 3HHYA 4B3RM 2K02A 3HUGA 3GLXA 2R7DA 3F8BA 3FKEA 4YG2F 4NNJA 4D5FA 4F93B 1HDPA 3FUVA 4BBAA 5A2QK 1K79A 4FD2A 3A8GB 1VINA 4LG2A 2P81A 4V2FA 2V79A 1ZR2A 2Y0QA 5K7HA 2EZIA 3BQZA 3GFLA 4IOCF 2E5NA 2QCUA 1J9IA 4AIHA 3QPLA 4DUZM 2IA0A 2FMYA 1HNXM 1RR8C 2GQFA 3UR3C 4FWDA 3GQ4A 3CUOA 2ZXIA 5FKKA 2L2OA 3B89A 3E4RA 1WJFA 3K1NA 1GDTA 3ZMVA 5K7ZA 4HF1A 4BCQB 1F9NA 3M07A 4BH9A 4JYKA 1CGPA 1HDDC 2XAGA 1Z5AA 1PP7U 2WJ9A 2P5TA 2ZANA 4MHGA 2CU7A 2RV8A 3BTJA 5L3BA 3WHKA 2DOEA 5D4SA 4G6QA 3G3ZA 3BG3A 1B6AA 1BC7C 2OV7A 3OY9A 2HDCA 5IT9K 2WEVB 1UHSA 3FMSA 3CC4I 2K0BX 3KFUG 5BPIA 5HDGA 5K5RA 1AHDP 3KXEC 2FD5A 1HT2E 3K9OA 3J81Z 4EOOB 4B3AA 1TWHJ 1GHCA 2XGNA 1H1PB 1OKWB 3PQJA 4PT5A 3T38A 1BOBA 4A5NA 1IUYA 4MTDA 1ON2A 1MZBA 2PEXA 4DYCA 4BQNA 4F7NB 4EOPB 4GO1A 1S72I 3QYBA 1QO0D 2XKPA 2RQPA 4HNTA 2M9HA 5GAEJ 2BEOA 4BXUA 2I7PA 2H6CA 3EUAA 3I59B 4MGIE 3PIOF 3JREA 4KRCB 5DQWA 1AKHA 4NQWB 4PJJA 1QAQA 1VZ0A 2DZNB 3LA3A 2DI3A 3SZGA 4C3IJ 4DUYM 2UUAM 5HLTA 4QHSA 1QPMA 5KQDA 1YJNI 3DTOA 4MGYE 2JTVA 3EETA 5E79C 4OMZA 4AUXA 4EM0B 4GHAA 3A0HC 4K2EA 2IRFG 2R0IA 3S2HJ 4L8RC 2YU9J 5FLXK 3IH2A 1XMKA 2CCHB 5FTKA 1NV9A 3BLQB 4G7ZF 4AIDA 4AIKA 1QMZB 2JA8J 4HLQA 4B44A 3F21A 1YIOA 2TDXA 4RB3C 1VQKI 2R7SA 2Y0SN 3KP4A 4MEXF 4KN7X 2PN6A 2WSFF 4FETA 2K40A 1H9TA 1L2DA 3PUBA 4W97A 3WHBA 1N4MA 2VQEM 4DV0M 2M1BA 3T1BA 4CCJA 4XN0A 2LKSA 1WRJA 3K7AJ 4DZPA 1NTCA 3HM5A 3DXJF 3K7AM 4IOAF 2VIIA 4BDZA 2LVAA 4IRIA 2QENA 3GCMA 5ITUA 2M30A 4XMYA 2ID6A 3CLQA 5FD6A 2IT0A 3OOUA 2FA5A 3MKLA 1H26B 3DDPB 5E1WA 5B1BH 3MEXA 2C9CA 5IPAA 1LV7A 4F52A 2CHGA 1SXJD 3VFDA 2XAJA 1IXRC 3D5LA 4G4OA 4E7HA 2FE8A 3HOTA 3TNWB 2X6WA 3FXKA 1IBMM 4U0WA 4XR6A 3TP3A 1X1CA 3AOGA 5HNBB 1XD7A 5HQ0B 3DL1A 3E5XA 5EEAA 2XAHA 4IBKA 1E9HB 2F5FA 4QIWN 2O25A 4LGYA 1TLHB 1TWGJ 5K1YA 1XXHE 2VC0A 4OOIA 2MLGA 3VEPA 4YRVA 2CUEA 5HLIA 1UNLD 1SD6A 1TWAJ 5CVIA 3DBHB 3HHWA 1V55H 3F8CA 4KHPM 3QPSA 4MGRA 2DNAA 3GRVA 1D0ZA 2MW8A 1U3EM 3IAS2 4LK1F 5IZ7D 2IGNA 2VC1A 4CHTB 2MFZA 3Q8GA 4HAMA 1PUEE 1APLC 1D8KA 3CDHA 1YITI 3U9GA 3KETA 2HQAA 3WTSC 1YX3A 1F5QB 2XAQA 1K83J 1QQWA 5EG0B 4OIQF 3RKQA 3V7CA 4EC8B 2KEBA 3UJNA 5KPZA 3C3DA 5KNLA 1TQIA 1IRFA 1SVOA 2F5VA 2ZO4A 4L18B 4LMYA 3FKIJ 3N05A 4F91B 3RI4A 4I8OA 4D1QA 1E94E 3M4OJ 4HNUA 3ZXSA 1DQUA 4RAFA 1TDHA 2L54A 1NK2P 2QSHX 2HHHM 2MGWA 2AQEA 4GH9A 2UXXA 3VYSB 1R6RA 3GUDA 3LSGA 1U0JA 4CCMA 3H0DA 2R5ZA 2IS4A 1WJ5A 2V6ZM 5IHYA 2DYRH 2LYCA 5L8RF 2M0MA 1FNNA 1Q02A 4CJ6A 1SFXA 1VQLI 2ZJPF 1NHGC 1SXJA 4L15A 3RTRA 3VK8A 2MD5A 4DJAA 2VBZA 3ZQJA 1VQMI 2GLOA 2IXSA 2A6HF 1ITYA 2Q0OA 3K4BA 4PJLA 4E7JA 2VXZA 1J09A 3HO8A 3KOZE 2EINH 5FFZA 4JI1M 1OCCH 4DIQA 2ZXWH 5KAFC 2FJ1A 2EIKH 3VYUB 2VKEA 1UGSB 2DPUA 1OFCX 4MQVA 4HA8A 2WAQA 4XKWA 4ENNA 4IMYB 2ZBKB 3DF8A 3SEQA 4F3QA 5IY5H 1T6OA 2ZJ2A 2JT1A 1G3WA 4CCKA 4EMSA 4LK0F 5JLXA 4AYBN 2X1DA 2F4MB 3K9PA 3K70D 6PAXA 1PP8F 3CCSI 2X1CA 2DOFA 2E35A 5JI6A 5E8IA 2FOKA 3FMQA 1RUNA 3K92A 3BOSA 2R45A 1VQOI 2UU9M 4XKVA 3MFKA 2C5XB 1T95A 3A03A 4D81A 3U1KA 3O8HA 4CCOA 3IH3A 2L4MA 1K4SA 2R7UA 4HQEA 2X51A 2K4BA 2FBHA 1UZCA 3KLNA 3WHCA 1R1VA 2K86A 1L8QA 3L27A 4LD5A 4RAZA 1V29B 3A8HB 5CEIB 1XO2A 4XOPA 3DLLF 2JMWA 3GRRA 5DFLA 3JR4A 1BJAA 1X1PA 2PMUA 4MO7A 5FGMA 3FHZA 3JTGA 1YQAA 2XSZD 3DPUA 4IO9F 3RKWA 3Q0UA 4DBRA 2E1CA 2CUFA 1WJCA 1QAMA 4ZH4F 3LFKA 3FTCA 1RC9A 2O03A 3ZQLA 4LGMA 2K3PA 2ZZDB 2BS2A 4HG2A 2C6YA 2PK2A 2WWYA 2ECBA 4BYYA 4BHBA 1T08B 3G33B 2FRHA 1DU0A 1JT6A 2ZM6M 3I4MJ 3WVDB 4CFUD 3BDDA 4E4HA 4MGKE 2G9XB 5TRDA 2CJJA 3NWLA 1R5ID 1TWFJ 2KZGA 1U5TC 2STWA 3K8ZA 4A3DJ 2ZPEB 2KNVA 4IPAA 3VFZA 4EC9B 3H3UA 1IAWA 2GZWA 2G9WA 3QPHA 3BPVA 4M3DA 3VODA 1GV5A 5TGTA 4ESFA 1OCTC 3Q9VA 1KSFX 1QVUA 5F1JA 1QYRA 3J81K 4IHVA 4II3A 4OVZA 4AC0A 2M2EA 3K2ZA 2EZKA 4ZTFA 2J5PA 2L7FP 4ZC3A 2ZPGB 2EKFA 5LMUM 3I3LA 2K3FA 3M1EA 3R0AA 2GWRA 4A3IJ 2OQGA 1QNTA 2XAFA 4CISA 2CQQA 2IVMA 2CO5A 3DKYA 3RKXA 2LD5A 1NVMA 4REZA 2Z16A 2HKJA 1WSUA 3UGJA 4LRTA 2KJBA 4G12A 1J59A 1ZLKA 5CQEA 2Z99A 4FX3B 4UUSB 2PJRA 5DD8A 3CF5F 2AHMA 1HW1A 2LVOC 1WVRA 4DZJA 3VDPA 2FE3A 2A5WA 1FTTA 4CFVB 4KODA 1D0MA 4C2MJ 1Q3BA 1G3TA 2NS8A 5E26A 2VJIA 3Q3SA 3WGGA 4A3FJ 2DFFA 2XSZA 3ASOH 3R8FA 2BOLA 5IP7J 2ZTCA 2MJ5B 4UB6C 2AXLA 2R7ZJ 2C5OB 1I6HJ 1P7JA 2MGQA 2HYGD 3EIHA 3MKYB 3RPUA 1URCB 2EA0A 2XC7A 3KP6A 4WXDA 1FSHA 2KIMA 1U8BA 1NJFA 1IW7F 2V26A 5EGOA 3JRHA 4OB1B 3KP5A 3GZ6A 2R62A 1K6OA 3ZP5A 1G8PA 1R2YA 4KFCA 1T2KA 4MB7A 4L78A 1Y1WJ 3L2VA 3H5AA 4NRWA 2L9VA 1R7JA 3E9SA 3ASNH 1IFYA 2JY6B 2Z8YM 3I4VA 2JA2A 2ECCA 1DUXC 3L2RA 3LW5F 1SC7A 4B47A 1IN4A 1WGNA 1E3HA 5GP9A 3AL0C 2KKOA 1B9NA 1ULYA 1MJBA 3OR2C 1K7AA 1E3PA 2G3QA 1I3AA 1ZYRF 4ESJA 2Q2EB 1MU5A 2N35A 1T98A 2EIJH 5BQTA 3KP0E 4RB2C 2H1KA 1U5TA 2X4HA 4JI6M 4Q4ZF 3ISPA 4OIOF 4PD2A 3EUKL 2YQZA 1R5HA 1F5TA 1ZRDA 4RF1A 2OAZA 1YS7A 3CZ6A 1NJGA 2APLA 2E36A 5KHDA 2CZ6B 4XLAA 2KRUA 3L26A 4RGRA 2B7EA 3JRCA 3GPYA 4P1WA 3L2UA 1DDNA 1NY5A 2R7WA 3MHVC 4EATA 4WURA 1MIJA 2DMTA 3UNGC 1A5JA 2C4GB 2QDYB 2LOOA 1Q1HA 1DGHA 4ZDLA 4IBEA 4I4LA 1OCPA 1Q3CA 4BCFB 4EEFG 3M7GA 1WHUA 3FXLA 3OOPA 2L09A 4XK4A 4A2UA 3HZJA 1TQMA 2ZSIB 1GT0C 2LDUA 1WGXA 2DLLA 2TCTA 2O8KA 4ZYAA 3SFZA 4B4CA 3FRIA 2WMAB 4BHPA 1WQ2A 2EILH 1AOYA 2XB5A 4B48A 1TT0A 3NBXX 4IBFA 2K7LA 2XUBA 2WAEA 1RPWA 2L4EA 5J8CA 2IS1A 2KDOA 5JVTA 3GQ5A 3P9CA 1R36A 2DK5A 3CF6E 3MIAB 2F4OB 3JTHA 2ZAMA 3GYHX 4A3EJ 3GLGB 3OYHA 2VN2A 4KMFA 3EQLF 3TE6A 2X48A 4S12A 2EWNA 4CIZA 4XBFA 1BL0A 4GYGA 3LVVA 1VNDA 4L4UA 2PMZN 1IRXA 4EOSB 3JRFA 4XLHA 1VDDA 4WF2A 1EH6A 1VYWB 4DR3M 1LDKB 4IQJA 1S3SA 2H5XA 5FTLA 4KRDB 1OR7C 3BHTB 4LIVA 4HLXA 1EA3A 2ZNZA 1DV0A 4B3TM 1MDMB 1YYVA 2UXNA 1UNGD 4LG3A 3G1OA 2R44A 1S5LC 2BY0A 2XROA 1IBKM 2WSCF 1RU3A 2DWMA 1Y6IA 2R4GA 2WTEA 4LJ9A 2EJRA 1W7PA 3FBIB 1X2NA 4P96A 5LGNA 3RZDJ 1SFOJ 1MNMC 1A04A 2E34A 1H25B 3FUWA 4HBLA 1TW2A 3IWFA 1O3RA 3X20B 2BY1A 1BA5A 2XF5A 2WY7Q 1TBXA 3U1DA 4NB5A 5E17F 1L1ZA 3EIEA 5KVRA 1Z6TA 3ECOA 3ZN0A 4II5B 3NAUA 1TH2A 3HBLA 3ZQIA 3FE3A 1QPIA 1FOYA 2VONA 2BKZB 4I81A 5LRRA 2VQGA 4YOOA 3DTEA 4A3CJ 1TWCJ 3TP0A 4DV7M 2OC6A 2ZFWA 3CJTB 3AAFA 4LJAA 4FVMA 3K6GA 5BMZA 5AONA 2RVCA 2ZPHB 4BY1J 4CICA 2FXAA 2M87A 2V1CA 2VT3A 3A46A 5J3LA 4E7SA 2KISA 3UKGA 3NRVA 3FM5A 3F6OA 2NRAC 4OB2B 3DTIA 1I3QJ 1MJAA 2HR3A 3R6SA 3KOWE 3IH4A 3ULQB 4AM3A 1H4LD 3B6CA 3LL7A 2PBIA 1L0OC 3P9KA 5D8LB 1WJAA 3FUTA 4R1HA 3HOVJ 4N9HA 2X49A 3HX3A 2DPDA 1X4PA 3G1MA 2X0LA 4KMUX 3KPHA 3OYJA 5GADJ 2HWVA 1DO0A 4FCWA 1OYYA 2QQBA 4CA0A 4Z6YA 3MAJA 3KW6A 2QUFA 3CCJI 3SMPA 4LG0A 1MGTA 3R60A 1IGNA 4ITVA 4NSOB 4R7GA 3BR2A 3BR6A 3TNIB 3KP1E 1ETQA 3HJQA 4BLCA 2OQ4A 3U6OA 3GTPJ 3C18A 5IWAM 4GC9A 4UN0A 5LMNM 2HKOA 1VQ4I 1QVRA 5B66C 2D0QB 2V6CA 3DU6A 2HAKA 1OR7A 2R5YA 2F5OA 5GKNA 2RDPA 1EKEA 2RNJA 3A8OB 1PYVA 3O3KA 1UB9A 1IRZA 1L2CA 1Z5CA 1HR0M 1F4IA 2LVQD 2LREA 3M1CA 2BW3B 4XRFA 5CLSA 5J40A 3CCYA 1N78A 4PK4A 3H4MA 1X3UA 4KO8A 4W5WA 2DODA 1I39A 4B7GA 3SYTA 3L2QA 1LJ9A 4ZZDA 3M8JA 4M9XA 2FX0A 1P4XA 3BZKA 1XMQM 2G7HA 5GTIC 1JKOC 2JNHA 1XMXA 1W5SA 2KT0A 3P5JA 3SDBA 1UFMA 1QA6A 4G4QA 2VODA 4XLPF 2I7NA 1AD6A 5JLWA 3H92A 5ITRA 2RQQA 5E3OA 3MD2A 2OU2A 3OWTA 4F55A 4BE2A 1MNDA 1WFXA 3BBZA 2BE5F 2L0KA 1R22A 4FT8A 5F64A 2A07F 3A2KA 2KXEA 1KQ0A 3DLAA 4FCYA 1F4KA 3CDLA 3LFUA 2XSDC 3AG1H 1QDRA 1BI2A 2WB1A 3KEYA 3ILKA 4DV4M 1YIJI 2F5NA 3VSKA 2CJMB 3ZMDA 1HQYE 3KYCB 1UAAA 3SZTA 1MNEA 3GLHB 1W36C 1MMSA 2K9NA 3U6LA 3H35A 2QP9X 4P17A 4A5MA 5DM7F 1PKDB 2WY8Q 4BEHA 2HCBA 1ZMUA 5B3SH 2W2HA 3DPLC 1SMYF 3B73A 4CH7A 1A6QA 5LHGA 1J75A 2O8XA 2NXNB 1OI9B 1VEKA 3Q0VA 3MZHA 2I40B 1N32M 3TWKA 2M34A 1VFCA 1A5TA 2R7FA 3D5RC 3PM1A 4I09A 1O57A 4XRSA 4MEYF 2AS5F 1GH6B 1UHMA 5DUKA 4JI2M 5HS8A 4DNCA 2K9QA 2PMHA 2DVWB 2HNHA 2DCEA 3GPUA 2Y0MA 4RAGA 3FXQA 5CPRB 1WWXA 4ENJA 2E1MB 3U61A 2R18A 2Y0TA 2D5VA 2XZUA 2DU9A 1H27B 2E7WA 3PNVA 1IF1A 2DXCB 1AU7A 2JN6A 4BXXX 3J80S 1UFZA 2DJIA 3QWLA 2EFWA 2EFNA 2B9SA 1IRGA 2ELHA 1QLBA 4YY3M 2OCCH 3ZPLA 4FISA 3BJAA 3OYKA 2BJVA 3BG9A 1U8RA 1AWCA 3OS2A 2WIPB 4Z2YA 1L2BA 3S93A 1FYKA 2CCIB 3OL3A 2DJNA 1A31A 4GC5A 2BS4A 2I5UA 1JR3E 4NC7A 1XMOM 1MBEA 4LFBM 3E5QA 4Q47A 3RQIA 2E60A 4FE4A 3JR5A 4DR1M 2BBYA 4TV7A 4X1EA 3GTQJ 5LMKB 5L3GA 2CH0A 2LP0A 3OYGA 1GO5A 2K27A 1H89C 2ZSHB 2UUZA 1N25A 4Y17A 4IHSA 2ZNYA 3JSOA 3K10A 3FD9A 1YG2A 2VQCA 2GXBA 3L2CA 4EOQB 3TW7A 3OIQA 1OISA 3VB2A 1REPC 2EFOA 1XGMA 1JKQC 2RGOA 3OYDA 3DP7A 4B43A 2QSFX 3VSLA 1XHBA 2DAKA 3QXEB 1QU3A 2NOGA 1AISB 3BJOA 2O3FA 3RGFB 5DYGA 3W2VA 2HDDA 3K4CA 2MLKA 5ACBA 2LVPC 4KIBA 3W2AA 7CATA 4I98B 2FOIC 4P16A 2BGCA 2J7NA 5GAGJ 4A3VB 4W1UA 5HODA 3C3EA 3G2BA 4CYDA 1BR1A 2R7QA 1SFEA 2DN0A 3PO3S 4JI4M 4BY1X 3GLGE 2VQHA 3CCEI 2G77A 1ODDA 3K4KA 1TT5B 5FKMA 2EO2A 2QA4I 3PIPF 4LJ5A 4QHTA 4DR6M 2H09A 2JRMA 2JQ7A 3REOA 3FUUA 2LF8A 3UMMA 5H6QA 4L9VA 1JHHA 2HOTA 5BS6A 5H20A 1D8JA 1H1RB 2DD4B 2FQ3A 3I59A 4IJAA 3U2RA 1H8AC 3DCFA 2I10A 4NQWA 3SJMA 5IYDJ 4CCLA 5D6FA 4HF0A 3LSPA 1OCRH 2GA1A 5ICEA 5KPTA 1FVVB 3GBGA 4LFUA 3OYNA 3D1NI 5IF1B 3L7WA 1X1AA 3SFIA 3CLOA 3HOXJ 1RRJA 1VOLA 3E5UA 4G7OF 2I8DA 2KRFA 1EH7A 2IW8B 2MH9A 1XC8A 2COBA 1IBLM 1E0EA 1MBGA 3PXGA 2WIHB 3SAUA 3JAMS 4II2A 2BY2A 4A6EA 3I5UA 4V2GA 1B8IA 1A36A 2XHKA 4WW0A 3SC3A 2JA5J 3VWBA 3BR3A 5DD4A 4DGWB 5A2QS 1P3QQ 1FBQA 1RZ4A 2CMPA 1QUTA 5DS9A 1N33M 3QYFA 1OLTA 3J7AO 1FT9A 3ZMUA 3ZQFA 2EQRA 3F8NA 3HSFA 4ZYGA 3GTKJ 3CCMI 4ROCA 3IRRA 5HLGA 1ZRCA 4I2OA 1VEGA 4KICA 1DP3A 2KFDA 4I6ZA 1W0UA 5ICPB 3KDSE 2D7EA 5C1BA 4AKHA 3K4LA 2R3SA 1GUXB 4IQ4A 3I55I 4IEJA 1UMQA 3C3WA 2V1UA 4F7ZA 4KDPA 4OIPF 4JI0M 1G6NA 1L1TA 3FTEA 1KZHA 3I54A 3WGHA 4B8XA 2O6GE 4RLFA 3GLFB 1K3WA 2V9KA 2A61A 3IUOA 3JRBA 2DK8A 5BPDA 4GHLA 1USSA 4LJ8A 1X1DA 1H0MA 4CZCA 1Z1DA 1OCOH 4AVZA 3V8JA 2B63J 2DT5A 4L9JA 3WTVC 2P5VA 2PJPA 5ED4A 4DR4M 2BNKA 2LKPA 3EDPA 3S1NJ 5E3NA 2KA6B 4BQQA 4CSWA 3VKHA 2K47A 5EG0A 4IHTA 1X3ZB 1R71A 3QP6A 1XSXA 3WTYC 2LFBA 1TC3C 2UUEB 2WFYB 2KZVA 3ZMSA 3HSRA 2NYXA 1HNZM 5HLHA 2JZYA 2OUMA 3DDQB 1UNHD 3VDUA 2F2EA 4PGHA 1LUJB 4JN6A 4D7MA 2C6TB 3LA7A 3VDXA 2VBXA 2L5QA 4CGZA 3TL4X 2ZMEB 5FLXS 1WJBA 2DT7B 3T1HM 2EFQA 4BE0A 3C58A 3PJRA 3A8MB 4DR5M 1EV7A 3BQYA 2Z2SB 2Q8KA 3HTSB 1B72A 5H2FC 1VDLA 4RBOA 3NEUA 4HV5A 1V4RA 3DEUA 3PO2J 1UHWA 3MWMA 4ANRA 3BT9A 2L9NA 3PNYA 2X6XA 3GFJA 2K4JA 3G71I 2QGSA 5IOZA 2A6TA 2ZXHA 2CW0F 2XZFA 3U6DA 1SAUA 1SD5A 5F27A 2L4AA 3W6JB 4Y13A 1WGLA 4YIRX 2TRTA 1KU3A 5C3EJ 5I5ZB 1HJPA 4X64M 2ZBKA 3P9IA 2DI0A 3ZCBB 1S8NA 1G3NC 4A6DA 3IV5A 1ZH5A 3GX4X 3IG8A 2NQ8C 3S1RJ 1HNWM 4Y4RA 3GLHE 4RMNA 5FTJA 5EZHA 5J1YA 4L5IA 4AU7A 1LE8B 4M3FA 1FMVA 1WR1B 1YRNA 1FBUA 4BCHB 2CW7A 2W25A 2F4VM 3QYGB 2QZ8A 1V5GA 3FZVA 3J7AS 4MM3B 5E20A 5D8KB 1WHCA 4ZZLA 5L3FA 2F5QA 3U6MA 2LH0A 3HU2A 1BIAA 2DFHA 2Y31A 4HYEA 4D0PA 4E6KG 2KZUA 4MQ9F 5KCMA 1V3FA 5JVGF 3HWSA 3IAM2 4L0ZB 2L9RA 4Y15A 1XDSA 4LFAM 3KVWA 3L9FA 2Z1DA 4BJ5C 2WHBB 2WAQN 2J7OA 3T8RA 2DDBA 2D7HA 5DUIA 1TD6A 2PI0A 1BBYA 1MBKA 1KXUA 1Z3XA 4RNAA 2OA4A 2ME6A 2BPMB 4YC3B 4FX0A 1ZQ9A 3HHTB 5H37D 4ZGDB 2QKMB 4U88A 2V1DA 4Y7NJ 4L16A 1QGPA 2X1EA 1FJLA 1Z05A 3BLHB 2KIQA 2Y21A 2ACJA 2VOPA 3W6VA 1CUKA 1OIZA 2YR0A 5HVQC 1O3SA 1SFUA 2AQFA 3GRYA 4ITQA 4NBQA 2KLOA 1JTXA 1LFUP 2E19A 3U6SA 1C7YA 4DV2M 1I4WA 1T0FC 3RQ4A 3VOEA 1WPKA 2RKHA 3KCCA 1O3TA 5B1AH 1P2FA 2IS6A 3ZQHA 1GABA 1HCRA 2KMUA 1VQ9I 4XQFA 4GITA 4MGZE 4CRLB 3HGYA 5ILSA 4KN4X 4KT0F 1JGSA 2W9FA 2C5RA 2XPVA 1FOXA 2G7UA 2DWZB 2L01A 4C2UA 5EQTA 4U0VA 4C9YA 1TGUA 5JHFA 4DV5M 1ETKA 1ZR4A 4IJFA 4IBDA 4CFXB 2BZTA 2O9LA 1FKMA 2OTLI 2CG4A 3GPXA 4OMYA 2DXIA 2W9ZA 2GOMA 3QQAA 5K7FA 5DYIA 4UUSA 5DV5A 2DA1A 1I5ZA 4OAYA 1FOWA 4DYRA 2RREA 1ACIA 3PNTA 1P4AA 1YS6A 3FWEA 5D5UB 4Z8XA 2VT2A 3ZGKA 2EV6A 1DU6A 1IREB 1ZN2A 3CMMA 3R4KA 1DGBA 1P4WA 2KPMA 2ME0A 3U60A 1IY0A 1IZ1A 2HYJA 3WG7H 3I0TA 2HYFA 2L3DA 1RNLA 1EE8A 5FKLA 5LGUA 3LCUA 3TO6A 4EOMB 3BG6A 5F1RA 1TR8A 1J2XA 2P5KA 4E7LA 4E7IA 3QPTA 2OPFA 1L3LA 2CGPA 3TPZA 3OSGA 2OBPA 4DR7M 2PG4A 4O5VA 4NL4H 1MW7A 1HF0A 2H6BA 4ENMA 2Y9ZA 2F5EA 3FYCA 1GVNA 4HX4A 2DMUA 1VQ5I 3S2DJ 4OB0B 2LHCA 1H9GA 5K5OA 5J4YA 1EIJA 4FWGA 2QQAA 2XIGA 5FTMA 2YR2A 1GXQA 3QP5A
chains in the Genus database with same CATH topology
2VJ5A 2IS1A 2KDOA 2QKLB 3EUHC 3ZQQA 4Y33A 3CP2A 2CW8A 4BE1A 2HPIA 3OYHA 4PFPA 2CS3A 1LFPA 3H9QA 1JI8A 2AHJB 4FM4B 1NG7A 2JVHA 4JX4A 2JVGA 4XKBA 3RPUD 2VASA 1UGQB 4XLFA 2VKDA 1IRXA 2VL8A 1WJEA 4XLHA 2WA0A 2LBFA 2V6EA 2MYSA 2V7FA 1Z3YA 1LDKB 2KRHA 1G59A 4IQJA 2UWMA 1OR7C 4XKCA 4LIVA 1EA3A 2E5ZA 3H9GA 3BC8A 4LG3A 2ELJA 4E7ZA 2CV1A 3U21A 1Y6IA 1ZELA 2R4GA 3V42A 3FBIB 2XF7A 3PSFA 4PSWA 4NC8A 2QQ8A 3PFYA 3X20B 2KQRA 4QSHA 2XF5A 2WY7Q 3QODA 3OYAA 1X4OA 2R7OA 3HOSA 4MFDA 2MABA 2K9MA 1DGRM 5CKTA 4XOTA 4KISA 4XL9A 3HBLA 2M4KA 2VJJA 4J01A 2R7XA 2VQGA 5LD2C 1TZLA 3DTEA 4CUGA 2CZ7B 3QYEA 2OC6A 2LG4A 4XM3A 1N77A 3S8PA 4PSXA 2M4GA 2IGOA 3K6GA 3OL4A 4ANJA 3OYEA 2IGMA 3NWTA 4BJTA 2ZPHB 1LVKA 2VKHA 3HUGB 2DT6A 4HNVA 4E7SA 2MC4A 4OB2B 1V5FA 2DXBB 3DTIA 1UGRB 4XN3A 3LL7A 1WJAA 1YE9A 2HU9A 4HL4A 1AHJB 2X6YA 2M7AA 1X4PA 4PUSA 2ZFUA 3ZR8X 4PJNA 3LSKA 3OYJA 2W82A 3HG9A 2IS2A 3HL2A 4CA0A 3PSIA 4PJMA 3OYBA 3DQVC 3I9V2 2L7KA 4Z6YA 3E0JB 5HOOA 2CFOA 4ELJA 4ITVA 1MMNA 1MMAA 4BEHB 3W2WA 1KONA 4MIMA 1NG6A 2D0QB 1QHGA 4ZDOA 3DU6A 1BR4A 3EPZA 4ZDPA 2MD0A 2HPMA 3HB9A 2CV0A 3HXLA 3A8OB 1PYVA 5CQGA 3OYIA 4JOMA 3DTKA 3VYRB 2XSJC 4OB3B 1N75A 3S3NA 2LREA 1D1AA 3M1CA 2BW3B 4MLOA 4IX7A 3VYTB 4BS9A 4HRIA 4BBSM 2KL4A 1N78A 4PK4A 4ZGJB 2WAFA 2Y0SA 2KHMA 4BL0B 2ZCFB 1UELB 3SYTA 3L2QA 2BVLA 3W3CA 3M8JA 4P5OA 2DPPB 2K9LA 3RCOA 1LKXA 1Z7LA 1QHHD 3SDBA 3J7AY 3H4CA 4NNJA 4F93B 3LSHA 3OYCA 2RQQA 3CF2A 2VXDA 3MD2A 3A8GB 3OWTA 4RM2A 4F55A 1MNDA 4BE2A 1WFXA 3A2KA 3DLAA 3LFUA 3OMYA 2WB1A 2E5NA 3DPTA 3KEYA 3VSKA 3MKZA 1UAAA 3K70C 1MNEA 1W36C 3UR3C 3H35A 4JX6A 2ZXIA 4IKFA 4P17A 2L2OA 2WY8Q 4BEHA 1WJFA 3DPLC 3VYGB 4CH7A 1X19A 2LY2A 4QPOA 2E1MC 4HEA2 4XORA 2WJ9A 2M3AA 4BU2A 3D5RC 3BG3A 2OV7A 3OY9A 1G8XA 2BS3A 2HNHA 2DCEA 2KRCA 5EJCA 5CPRB 4JX5A 2E1MB 4FASD 2LH9A 3L2WA 1D0YA 2R7VA 3PNVA 2DXCB 1BOBA 2DJIA 4YEJA 3QWLA 4BQNA 1QLBA 3QZ5B 3OYKA 3QYBA 2DOAA 3BG9A 4R79A 4HSTA 3OS2A 3CJQB 4HNTA 1ERDA 3S93A 3EUAA 3OL3A 5FROA 4NQWB 4PJJA 3SZGA 1VZ0A 4NC7A 2BS4A 2LC2A 5HLTA 2E60A 4AKIA 4KJZA 3MKWB 2CH0A 3OYGA 4HLQA 2ZSHB 2HVQA 2UUZA 4B44A 3OYFA 2IGKA 1D0XA 3LSIA 2R7SA 2W7NA 2VPLA 4BGDA 3K10A 3DKXA 1UGPB 4CCNA 1D1BA 2VQCA 4FETA 4LITA 4PFOA 3TW7A 3OIQA 3PUBA 4CCJA 4XN0A 3OYDA 3QYHB 4B43A 4AYBA 3VSLA 3BLYA 2VLAA 4BDZA 1QU3A 3QXEB 4XMYA 3W2VA 1DGWY 3K4CA 3H5NA 3OOUA 3ZRGA 3W2AA 2CZ0B 4F52A 4OAZA 2Q1ZB 3G2BA 3D5LA 1BR1A 2R7QA 2NOJB 4E7HA 3HOTA 2X6WA 2XDVA 1YX5A 2VQHA 4NUBA 4XR6A 2G77A 2JUGA 1X1CA 3K4KA 3DL1A 2QF7A 3CJRB 3D5SC 1E7PA 3S3OA 2ZPFB 4YRVA 2W00A 4C30A 2DD4B 2BVMA 1D1CA 4J00A 1D0ZA 2PMZA 4CCLA 4X0GA 1UG0A 3IAS2 2IGNA 3GBGA 2MFZA 3OYNA 3KX2A 1X1AA 2HQAA 2LRDA 1YX3A 3S3MA 2I8DA 1E0EA 5KNLA 4II2A 4BDYA 2F5VA 3VWBA 1X1BA 4DGWB 3N05A 4F91B 2CMPA 2JSPA 4D1QA 2L9SA 3MMYB 4RM3A 3QYFA 4BJ6C 4HNUA 2WADA 1OLTA 1DQUA 3ZXSA 1FMWA 3OR1C 3WVEB 4DBQA 2AQEA 3VYSB 4CCMA 3LMMA 1R6RA 3CP8A 3DU5A 1U0JA 3LSGA 1SFKA 3H0DA 2IS4A 1WJ5A 4BACA 1DP3A 3KHIA 3VYHB 2M0MA 2LYCA 5HNFA 3BG7A 3LSMA 3H5RA 4M6VA 2LBFB 3BCBA 3K4LA 4AKHA 4DJAA 3K4MA 4IQ4A 3NWSA 2IXSA 2X85A 1HA8A 3K4BA 4PJLA 4KITB 4E7JA 3X28B 2VXZA 1J09A 3HO8A 4GRIA 4N4NB 4DIQA 3H9JA 2R7RA 4RLFA 3BCAA 3VYUB 4G6TB 1UGSB 2V9KA 4DOZA 5HNHA 3IUOA 4ZGEB 2WAQA 4XKWA 3C2GA 3TBIA 3SEQA 4F3QA 2CZ1B 4CCKA 1X1DA 3S32A 4CZCA 3TMOA 4AVZA 3CESA 2X1DA 3K70D 1W36D 2X1CA 2CUJA 3HC7A 3QOEA 2WBMA 1AA7A 2DD5B 2HZDA 3QZ9B 4XKVA 2CV2A 4BQQA 1T95A 4CSWA 2BW3A 2XAUA 3FKJA 3IP4B 4F92B 3VKHA 4CCOA 2R7UA 1GLNA 2X51A 1Z21A 2KZVA 3K4NA 2PJRB 2CYZB 3HPHA 2FUG2 2OUMA 1V29B 3A8HB 3C2HA 4XOPA 4JQFA 3VDXA 3X24B 4KT6A 2L5QA 5LFAA 3DPUA 3TL4X 4DBRA 1WJBA 2DT7B 4BE0A 5FRMA 3PJRA 3A8MB 1WJCA 4LIUA 2Z2SB 4AI6A 2K3PA 2ZZDB 2BS2A 4HG2A 4BUPA 4Y3OA 3AFHA 4NC6A 2QDJA 2L9NA 2X6XA 3PNYA 3WVDB 3AKZA 4QPQA 2A6TA 4E4HA 2ZXHA 4ZTJA 1SAUA 4XLCA 2VJ4A 2ZPEB 3A8LB 3X25B 1S9HA 2KR6A 2V1NA 5TGTA 4IZZA 1WJDA 4XLEA 3OYLA 2QFZA 4H4KC 4XNFA 3VKGA 4II3A 4ZTFA 4Y4RA 2ZPBB 3DEEA 4AKGA 2LY1A 4ZC3A 2ZPGB 4RMNA 3RSNA 3I3LA 2HVSA 2KMGA 4AU7A 2W4SA 3DKYA 4BQOA 1FMVA 2Z16A 2CW7A 3F9KA 3QYGB 3OYMA 1V5GA 5CQEA 2M7BA 4B3XA 2PJRA 4E6KG 1MMGA 2O5RA 3A4CA 3HPGA 2A5WA 5KCMA 3IAM2 2V4JC 2HDWA 2VJIA 4BJ5C 2Z1DA 3PL8A 2P0WA 4BXFA 2BOLA 2R7TA 4MFEA 3MKYB 1Z3XA 2XC7A 3OS1A 3HKZA 4ZGDB 3HHTB 2V26A 2CUZA 2QKMB 3FBNB 3K4JA 2HVRA 2X1EA 4OB1B 4HSRA 4C2TA 3OS0A 3L2VA 2KP6A 3H5AA 5HVQC 2AQFA 1V5EA 3BG5A 3TW6A 2KLOA 2JA2A 1P9QC 4D9JA 3L2RA 1T0FC 3RQ4A 4B47A 2IS6A 3AL0C 2VQLA 3ZCOA 2KMUA 3OR2C 4XQFA 4ZJZA 4U7BA 1BR2A 4RLQA 2Q2EB 3X26B 4BBRM 4C2UA 4C9YA 3SEZA 2F4IA 4N4OB 3EUKL 5JHFA 3A1YA 3DWLE 3AL0B 1FKMA 1PJRA 2F6CA 3CZ6A 4LOCA 2DXIA 5KHDA 2CZ6B 4XLAA 2GOMA 1K6YA 2W1OA 4OAYA 2RREA 4P1WA 3PNTA 3L2UA 2XF6A 3FDYA 2R7WA 4EATA 3ZGKA 1IREB 1Y56A 3CMMA 3UNGC 2QDYB 2KPMA 5FRNA 2LOOA 4ZDLA 1MMDA 3E1SA 2K5CA 2GOXB 3BG6A 4XONA 4E7LA 3HZJA 2ZSIB 4E7KA 4E7IA 3FHNA 2RNGA 2VB6A 4ZYAA 2VIXA 4U87A 1MW7A 3KYLA 4HPQA 3ONQA 4OB0B 3OIPA 4YELA 1TT0A 2UV1A 4B48A 3RTRA 2WAEA 2ZPIB 4OWRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWL A;  4P17 A;  2QFZ A;  4NC6 A;  4HL4 A;  2QQ8 A;  4HLQ A;  3QYE A;  2G77 A;  4Z6Y A;  3QYB A;  1FKM A;  5EJC A;  3HZJ A; 
#chains in the Genus database with same CATH topology
 2A69 F;  2VJ5 A;  4ENK A;  1FWZ A;  4G3O A;  3EUH C;  3HY5 A;  3ZQQ A;  2CWB A;  2VF8 A;  1D2N A;  5EDN A;  4II7 A;  4WP2 A;  2EH3 A;  4BE1 A;  1S3J A;  1BIB A;  2FSW A;  1TP4 A;  2Q2E A;  5IOY A;  1T39 A;  1LFP A;  3H9Q A;  1XX5 A;  1IDZ A;  3BZ6 A;  4FM4 B;  2JVH A;  2G5G X;  1YHQ I;  3RPU D;  1T0F A;  4L5J A;  1JJ6 C;  2PK9 B;  3TED A;  2OO9 A;  2VL8 A;  1WJE A;  3D0S A;  5FKN A;  2MBF A;  3BZC A;  2H8W A;  1WJ7 A;  2LBF A;  3SYK A;  5J6X A;  3BHV B;  2V7F A;  2CHQ A;  1Z3Y A;  2DA4 A;  1G59 A;  2KRH A;  3NAR A;  1S7E A;  4CXF A;  2UWM A;  1JR3 A;  2VKV A;  3WHL A;  3S15 J;  5M5W J;  3H9G A;  3SAV A;  3IHP A;  2DA2 A;  4A0Y A;  3PVS A;  1XSV A;  3T15 A;  3SXY A;  4X6A J;  1PDN C;  5HVY B;  2PHG A;  2XF7 A;  4BCG B;  3E46 A;  5LLQ A;  4EQQ A;  3F92 A;  5JFR A;  4NC8 A;  4NSR A;  3SAR A;  2QQ8 A;  3PFY A;  2KQR A;  1FYL A;  3OYA A;  3QOD A;  1X4O A;  5EXP A;  2BXY A;  1RKW A;  3EYY A;  5ERI A;  3HHH A;  3HOS A;  2RAE A;  2Z5U A;  3CC2 I;  4EOK B;  1I1G A;  2K9M A;  2C5V B;  1DGR M;  2A05 A;  1U2W A;  5CKT A;  1BJZ A;  1UGR B;  3B7Z A;  4ROE A;  3GLF E;  3HIF A;  2M4K A;  4G7H F;  2VJJ A;  4J01 A;  1Y39 A;  3V4G A;  2R7X A;  5LD2 C;  3DV8 A;  2L2D A;  2K9S A;  4UUT A;  2VDB B;  1K3X A;  3FK7 A;  1EFU B;  2DME A;  4LJZ F;  2CZ7 B;  1HXD A;  2ZCW A;  4XM3 A;  3S2W A;  1ETV A;  2PFB A;  2M45 A;  3K1M A;  4WWC A;  4PSX A;  3S16 J;  1U78 A;  3OL4 A;  4ANJ A;  4S05 A;  1GL7 A;  3I4Y A;  2YNM D;  2DYS H;  2IGM A;  3SDG A;  5BNJ B;  1MBJ A;  2W96 A;  1MSE C;  4I7H A;  1TFB A;  2CEA A;  5C4X J;  2M8G X;  1ZP2 A;  3GLG A;  2O01 F;  1NHA A;  2KJC A;  3ECH A;  5FO5 A;  1QQI A;  1R4M B;  3FM3 A;  3H3V K;  4XN3 A;  1IXS B;  2JWT A;  3H1C A;  4D80 A;  1YE9 A;  3EUH A;  1AHJ B;  2JUJ A;  2XFS A;  3KLO A;  4XSZ F;  1SXJ B;  3RGS A;  3A01 B;  1W5T A;  4PCZ A;  1C0W A;  2W82 A;  4GKK M;  4HV6 A;  2OQR A;  1OAO C;  3BR5 A;  1YFH A;  3GXO A;  3PSI A;  2HQN A;  3KYD B;  3T1Y M;  4QWQ A;  4YII A;  4GYI A;  3TQN A;  1EF4 A;  4D5C A;  1OYI A;  2C9O A;  1IM2 A;  4HF2 A;  1O9K B;  1HQC A;  3W2W A;  4L0Y B;  3ZH9 B;  2RGV A;  3HU3 A;  2QBY B;  2V9P A;  4QNR A;  2XGE A;  1V54 H;  4ZDO A;  2NVY J;  2LW4 A;  4XK8 F;  3DEW A;  2M8E A;  4UV8 A;  1NH3 A;  3EPZ A;  1BI0 A;  2ZB9 A;  2VI6 A;  2CV0 A;  2HOE A;  2DDA A;  4BCJ B;  2JXN A;  2X6O A;  3I71 A;  2ESN A;  4JOM A;  3DTK A;  3VYR B;  2XSJ C;  4XIC A;  3DJB A;  2J5O A;  3S3N A;  2FNA A;  2IAI A;  1VG5 A;  4BBS J;  4TTH A;  3HHG A;  4BBS M;  4LZJ A;  4M73 A;  1PUF A;  2WAF A;  4RGU A;  5HDN A;  3FF5 A;  4GCV A;  4M3G A;  2XFT A;  1R00 A;  2BVL A;  4LF9 M;  3W3C A;  1H24 B;  3G4S I;  3B6A A;  4P5O A;  2X8A A;  4EJW A;  2K9L A;  3RCO A;  4E70 A;  1TNT A;  2JA7 J;  1QHH D;  1W7P D;  4RDU A;  3V76 A;  1I50 J;  1AIP C;  2QEX I;  3LSH A;  4Y52 J;  4KUM A;  1PJI A;  2VXD A;  5DCM A;  4KA4 A;  1F1Z A;  4AG5 A;  2YS9 A;  1XNR M;  3B02 A;  5IT3 A;  4H0E A;  2ZKZ A;  1SMT A;  3FRH A;  1XNQ M;  4A0Z A;  5K5Q A;  3GZN B;  1HKQ A;  4LLN A;  1LNW A;  3DPT A;  3C7J A;  1R49 A;  3L09 A;  4WCG A;  3RJP A;  2Z33 A;  2P6S A;  2DAG A;  2JP7 A;  2OTJ I;  4EOL B;  4FCV A;  4JX6 A;  5F04 A;  3BTC A;  4IKF A;  3WU1 B;  2QM3 A;  1JJ8 C;  3CCR I;  1FP2 A;  3VYG B;  3K1P A;  1YLF A;  1IQP A;  5ITQ A;  1GUU A;  4EIW A;  1PVE A;  3KSJ A;  1JHF A;  1ZG3 A;  3GQ3 A;  2E1M C;  2EA4 A;  3KZZ A;  4CGY B;  2M3A A;  4BXX J;  4BU2 A;  1ZGJ A;  1FEX A;  1W5C C;  2J5Y A;  1JQJ C;  5J1R A;  3N4M A;  2HZT A;  1G8X A;  1KYW A;  1IO2 A;  4MNU A;  1DGF A;  3J27 B;  2DTZ A;  2K9D A;  2KRC A;  3KSX A;  1XCV A;  5EXX A;  4JX5 A;  2A68 F;  1WI3 A;  1K78 B;  2B9R A;  1QDT A;  3L2W A;  2FQ4 A;  4KIF A;  1D0Y A;  5IYB J;  3ABM H;  2E2J J;  2R7V A;  3CMA I;  1IN5 A;  5HDK A;  4MGH A;  1XWI A;  3QZ5 B;  1O4X A;  4AW4 A;  3BJ6 A;  4QLC U;  2P5L C;  1X37 A;  3QAH A;  4HST A;  4R79 A;  2MC3 A;  2V9V A;  3V7R A;  3Q0W A;  1XN7 A;  2XRN A;  1UJ8 A;  3IL2 A;  3KP2 A;  3CME I;  3GZ5 A;  2C5N B;  4EJU A;  2Y30 A;  5E8G A;  3RIR A;  3LAP A;  2K85 A;  2ID3 A;  3FXU A;  4AKI A;  1G4A E;  4KJZ A;  5IRE B;  1DPU A;  4AIJ A;  5IYC J;  2R4E A;  4IXA A;  1VEJ A;  2DAE A;  3NQO A;  3ABL H;  5M3F J;  1FC3 A;  4CFU B;  4LF6 M;  2B0L A;  1KA8 A;  3WE3 A;  3Q9S A;  3OYF A;  3LSI A;  1D0X A;  2VPL A;  2RRU A;  2EFP A;  2EZL A;  5ITX E;  4CZZ A;  2COM A;  1KYI A;  4LIT A;  1JUS A;  4AD9 A;  3IRQ A;  4BCN D;  4L9T A;  1Z0X A;  5L2W B;  2XAS A;  4A12 A;  3QYH B;  2HI3 A;  5DDG A;  1ZAO A;  3JW4 A;  4UHT A;  3W6K B;  4FCT A;  3LAJ A;  2EK5 A;  4Y72 B;  1POG A;  3MY1 B;  2E2H J;  4OX9 M;  1DGW Y;  2DMQ A;  1IN6 A;  2R65 A;  3H5N A;  2VOO A;  1XCB A;  2LR8 A;  3I51 A;  4HW0 A;  1XXH A;  2D7G A;  3JRA A;  3HOZ J;  3WGI A;  2UZL B;  4OAZ A;  3RPQ A;  2Q1Z B;  5CVU A;  4LY6 A;  2NOJ B;  3FIW A;  3COA C;  4Y28 F;  1I6X A;  1YX5 A;  2WB1 N;  4NUB A;  1K61 A;  2JUG A;  4AVP A;  2R6F A;  1W4M A;  3CJR B;  4MH0 E;  3D5S C;  3LST A;  3QAU A;  1ZKG A;  3S3O A;  1E7P A;  4A3K J;  1LPQ A;  2ZPF B;  4LF4 M;  1DGH B;  4PGG A;  4EVI A;  4G4N A;  4XID A;  4G4R A;  2ZAO A;  4FE7 A;  2NVQ J;  2L4F A;  1G4D A;  1FX7 A;  3MVP A;  3SMS A;  4G6L B;  1K82 A;  5EF6 A;  3HYI A;  4J00 A;  4NST B;  1S7O A;  2PMZ A;  1UG0 A;  2BJW A;  2IP2 A;  3KZY A;  3FIS A;  3K2L A;  2GXA A;  2WZJ A;  5ITT A;  2QVO A;  3HJS A;  4IBJ A;  4M0W A;  4OU7 A;  4K0K M;  2F5D A;  2DWL A;  4ELL A;  4F6U B;  2CQX A;  1H6U A;  2LRD A;  3MN2 A;  3S3M A;  3L2A A;  3AV0 A;  4LJ4 A;  3HJE A;  3KZI C;  3JAM Z;  1ETX A;  1R23 A;  2OPT A;  4IBG A;  3GLI B;  1TNS A;  4DR2 M;  3K0L A;  3GTJ J;  2IW6 B;  2IJL A;  4FX4 A;  1OYW A;  3TNH B;  1OGU B;  1W98 B;  1I94 M;  3GPP A;  1NNJ A;  2AXT C;  3BTL A;  3C1D A;  1IXZ A;  4BCM D;  4DBG B;  2L9S A;  4GKJ M;  3H36 A;  4BJ6 C;  1BN5 A;  1IY1 A;  2VQF M;  2LY9 A;  3WVE B;  4YIF A;  5FLM J;  4PDI A;  2M0C A;  2IW5 A;  1U9O A;  1QBJ A;  4IBC A;  2YUS A;  3QU3 A;  3LMM A;  3FXR A;  3K69 A;  3ZQG A;  3EOC B;  1JTY A;  1SFK A;  1FJG M;  1JST B;  2YU3 A;  1IXC A;  3H5R A;  2GIV A;  1XS9 A;  4M6V A;  5HS7 A;  4F7S B;  1X58 A;  2CFX A;  3BCB A;  4HQM A;  3K4M A;  1QVT A;  1QAO A;  5KPR A;  2X85 A;  1HA8 A;  2ESH A;  1ON1 A;  3DFZ A;  4KIT B;  4ZYH A;  5LEK A;  4UVC A;  3WTX C;  3QRF F;  3MJ5 A;  1T38 A;  4GRI A;  2LVN C;  4N4N B;  1ZLJ A;  3LQR A;  3W67 A;  2G0E A;  3H9J A;  3R0J A;  3HKP A;  4LF5 M;  4RS8 A;  5D4R A;  3WTW C;  2R7R A;  3HDD A;  4G6T B;  4ZGE B;  4XSX F;  4BCQ D;  3MK6 A;  5BPV A;  1EH8 A;  1YI2 I;  3TBI A;  1SXJ E;  3IWZ A;  3X2Q H;  5CVV A;  1B1B A;  3EID B;  1U9N A;  1XGO A;  3S32 A;  2OF7 A;  5HS9 A;  3TMO A;  3CES A;  3F6V A;  5CYV A;  1W36 D;  1P6R A;  3HC7 A;  3QOE A;  1HKS A;  4OU0 A;  1TF0 B;  1AA7 A;  5KAI C;  2DD5 B;  1MH3 A;  2HZD A;  1D0K A;  4CYC A;  3E6C C;  3ERE D;  1OIU B;  1XSD A;  3M8E A;  2CV2 A;  2HTJ A;  3IP4 B;  3D8B A;  2ZME C;  2ZXJ A;  5ILV A;  5E6J A;  3A98 B;  5M5Y J;  3CD6 I;  1Z21 A;  5E1Z B;  4GDF A;  2B3T A;  3HPH A;  5D5V B;  2FUG 2;  4A3J J;  2WV0 A;  1FLI A;  1Z77 A;  4JQF A;  3GLL A;  4I01 A;  2CRU A;  4KT6 A;  4EGY A;  2WXV B;  3THG A;  2X9D A;  3FYD A;  2HOA A;  2V1X A;  2D1H A;  4RGS A;  2DMN A;  4LIU A;  1ZG5 A;  4AWX B;  4AI6 A;  3HOY J;  5EP4 A;  3F5X B;  3SAW A;  1ORK A;  1OTR A;  2BY3 A;  2WV1 A;  1PJT A;  4Y3O A;  1D5Y A;  2IN3 A;  2NAZ A;  5L3D A;  1GUX A;  3LOC A;  3RDI A;  4F70 B;  3NDQ A;  5IP9 J;  3AKZ A;  4HZF A;  2IA2 A;  3PFI A;  4ZTJ A;  1T8I A;  4TUW A;  5FB2 A;  4LG0 B;  3A8L B;  2AO9 A;  2BHZ A;  5HBJ B;  2ADU A;  3GLF A;  1QZY A;  3T5X A;  4P55 A;  4ZYE A;  5EP3 A;  4KIG A;  4ABZ A;  3DFG A;  4O6J A;  5C44 J;  4IZZ A;  1RES A;  1FPQ A;  3OYL A;  4GEW A;  3VKG A;  4DYQ A;  4BB9 A;  1D3U B;  4GFB A;  1Z5B A;  2DZL A;  2L7I A;  4KNY A;  4CFN B;  2P8T A;  1DO2 A;  3O6B B;  4EM2 A;  2W4S A;  1QZE A;  4BQO A;  4S0H B;  5GTH C;  4F1I A;  4X65 M;  3F9K A;  4XLN F;  5F0H A;  9ANT A;  2NNN A;  2JGZ B;  5DNY A;  3ZN1 A;  1MMG A;  1ZV1 A;  2O5R A;  1OAI A;  3K1J A;  3W0F A;  4I5S A;  4KLN A;  3DOG B;  3I53 A;  1MJ9 A;  5JI3 E;  1ZMW A;  3LQQ A;  2ZME A;  3SZP A;  3TKY A;  4AG6 A;  4MFE A;  3HTU A;  3RZO J;  3V8L A;  1JUM A;  4F6S B;  2F2C A;  1CF7 B;  3OS1 A;  3UZU A;  3HKZ A;  2MH2 A;  4M9S A;  2D2W A;  3KEO A;  1HOM A;  4RB0 A;  1PGY A;  3K4J A;  2HVR A;  2XH9 A;  1R5L A;  4C2T A;  2W57 A;  2MA3 A;  3OS0 A;  4WXC A;  3KEQ A;  4M3B A;  2NVT J;  5JI2 E;  4GMQ A;  2A3S A;  2KP6 A;  2OJE D;  1JB0 F;  5F3W A;  1Y8G A;  3RFW A;  2DAI A;  2KIU A;  3KOY E;  3TW6 A;  1LVA A;  1O3Q A;  2BWE A;  3V8K A;  1P9Q C;  3U6Q A;  1X2M A;  1ORY B;  4D9J A;  4BCP B;  2EZH A;  2M5Z A;  3S17 J;  3I04 M;  2FNP A;  5FJ8 J;  2VQL A;  3ZCO A;  2QHO B;  1YOV B;  4A3B J;  4NDL A;  4ZJZ A;  1XPX A;  1GKI A;  1G41 A;  2FS1 A;  3HRM A;  3X26 B;  4BBR M;  1I27 A;  2RGH A;  4L6V 6;  3H4J A;  3F3X A;  3FXJ A;  4M6X A;  3WE2 A;  4QOS A;  3GFM A;  3FTD A;  1OIY B;  2F4I A;  2LF7 A;  4N4O B;  3FMR A;  1QZM A;  3U6E A;  3CQZ J;  1YW9 A;  3DWL E;  5DYM A;  5FKO A;  1LE8 A;  4LF7 M;  1SG9 A;  1U6G A;  1R4N B;  1NNU C;  3U61 B;  2F6C A;  1ZG1 A;  4BAY A;  1LEB A;  2DO7 A;  4LOC A;  2XVC A;  1F43 A;  1JKW A;  2KW0 A;  1K6Y A;  2W1O A;  1I1S A;  1SAN A;  1S29 A;  2QGU A;  1H1S B;  4CXA B;  4NOO B;  1IY2 A;  1UM8 A;  1P92 A;  1Y0U A;  2XF6 A;  3FDY A;  3O8G A;  5B5E C;  5LBQ A;  2G8L A;  3W0L B;  3BR1 A;  3HRS A;  1PJQ A;  1Y56 A;  4A69 C;  1QRY A;  5L3E A;  3O0G D;  5IT9 S;  3TDU C;  4B3S M;  1HW5 A;  3JAM K;  4RKU F;  3GO8 A;  1R58 A;  1R5G A;  1SVL A;  2GOX B;  1SD4 A;  1SVM A;  3NBI A;  1ENH A;  2K5C A;  3E1S A;  3CO6 C;  3FX3 A;  1HC8 A;  4ON0 A;  4B08 A;  3AG3 H;  4E7K A;  4OW0 A;  2Z3X A;  5KO3 A;  1FIP A;  1GL6 A;  5F0F A;  3FHN A;  2RNG A;  2VB6 A;  1HLV A;  2VIX A;  4L5E A;  2HXO A;  3GTM S;  4FW9 A;  1N34 M;  3CUQ B;  4DQ2 A;  3ONQ A;  4ZPX A;  4U0Y A;  3DKW A;  1RI7 A;  2UV1 A;  3BXW A;  2C99 A;  4N9I A;  2LVS A;  5GPA A;  2HS5 A;  2HL7 A;  4OWR B;  5EXS A;  1VQN I;  3U5Z B;  4F6W B;  4G9Y A;  1Z67 A;  4BCO B;  3FTF A;  3CP2 A;  1FTZ A;  1HST A;  2H27 A;  5LGT A;  3MY5 B;  1GV2 A;  3L1P A;  1LQ1 A;  3U6C A;  2HPI A;  4D7N A;  1TTE A;  2HQR A;  3K9T A;  4WXH A;  3GLI E;  2DQL A;  3F72 A;  4U7D A;  4XKB A;  4RB1 A;  1JKP C;  2YFQ A;  2VKD A;  3MZ8 A;  1FP1 D;  4PZJ A;  3SAS A;  3PUF A;  2V6E A;  4LZZ A;  1MD0 A;  1SEU A;  3RGP A;  2NNY A;  2FU4 A;  4XKC A;  4FHT A;  1KU9 A;  2PX9 A;  2L7H A;  1KYZ A;  2E5Z A;  8CAT A;  3B7N A;  2Y75 A;  2JRT A;  3HGG A;  4ESB A;  1J7K A;  4R3D A;  2R4J A;  4I3Z B;  3GF2 A;  3U21 A;  3V42 A;  2X1N B;  3LCV B;  1KFV A;  2HTS A;  1UST A;  4UXN A;  3TWM A;  1Y8Q B;  2P6T A;  3MCZ A;  3TGN A;  3L00 A;  4QSH A;  3FUX A;  3MQ0 A;  5ITX A;  1GJS A;  1MKM A;  1A35 A;  5JHU A;  1OQY A;  4MFD A;  2NVX J;  1PJS A;  3KS8 A;  3CGW A;  1TQP A;  2R92 J;  3J7Z I;  4XL9 A;  2N8G A;  1OJL A;  1V33 A;  3BP8 A;  3GVA A;  1TZL A;  2Z7J A;  4QTR A;  4DW6 A;  2JK3 A;  4B09 A;  4G6Z A;  1GVD A;  4CUG A;  3M3Y J;  3Q5F A;  2LG4 A;  2DWN A;  1N77 A;  1FY7 A;  1KQ9 A;  1B8I B;  3GTL J;  4X66 M;  3CTA A;  2M4G A;  2OZ6 A;  3OYE A;  1YLA A;  3RYR A;  1BI1 A;  2UZD B;  4G6D A;  1SXJ C;  2A5Y B;  2CHV A;  2BYV E;  3HUG B;  4PJ0 C;  2XRL A;  3WTU C;  3B57 A;  4HNV A;  2DAO A;  3DBL B;  2DA3 A;  2UUC M;  1QZZ A;  2E7X A;  4QNM A;  2IEK A;  3WOD F;  1YO5 C;  1LEA A;  1V5F A;  2ELK A;  2QNJ A;  3R61 A;  2QWW A;  2DXB B;  1OL2 B;  1EJ9 A;  4OR5 B;  1QUS A;  5LEJ A;  5IDN B;  2DHR A;  2HU9 A;  2PMI B;  1GY3 B;  3LSR A;  4A0X A;  3PO3 J;  4PUS A;  1R4G A;  2Z9O A;  2DQR A;  3F0C A;  1Z6R A;  3A45 A;  3HG9 A;  3MMP A;  4J19 A;  4A3L J;  1W1W E;  1J0R A;  4R8H A;  2UZB B;  2DKL A;  4PJM A;  2LBC A;  3VK7 A;  2BXZ A;  3DQV C;  3OYB A;  1ZK8 A;  4UUV A;  5HOO A;  2AHQ A;  4ELJ A;  3IKT A;  1Y0N A;  1MMN A;  4BQA A;  1VI0 A;  1V34 A;  3BWG A;  5CVJ A;  3ZMT A;  1KON A;  1T3T A;  5JR3 A;  4MIM A;  3AJI B;  1NG6 A;  2F5C A;  1QHG A;  3TOB A;  1ZAR A;  1WIV A;  2KHH A;  1JUP A;  3OIO A;  1JGG A;  2HPM A;  4IIW A;  2ZTD A;  3HXL A;  1ZRF A;  5FLV A;  5CQG A;  3OYI A;  2QZ4 A;  1NK3 P;  2Z3Y A;  4EM1 A;  3HGI A;  2XGC A;  1N75 A;  1WKM A;  3IHU A;  3MI9 B;  2L7Z A;  2H8R A;  5F0C A;  4OB3 B;  4EOR B;  1FBS A;  1LDD A;  3ZQC A;  3VYT B;  4BS9 A;  4HRI A;  2KL4 A;  2CWE A;  3V7S A;  4JYA M;  2NS7 A;  2Y0S A;  3OV8 A;  2UXC M;  1JR3 D;  2LXE A;  2KHM A;  3SYL A;  5CVR A;  3GME A;  4BL0 B;  2IPQ X;  2R7G A;  2ZCF B;  2LNH C;  4Q5S F;  1ZQ3 P;  1B4A A;  1O7F A;  3AG4 H;  2DPP B;  3HRU A;  4ASN A;  1LKX A;  1Z7L A;  1V92 A;  4LLG F;  3J2P B;  3W68 A;  3J7A Y;  3H4C A;  1YW8 A;  3CCV I;  2YX7 A;  3GFI A;  2X4A A;  5BOX A;  3BOQ A;  3OYC A;  1IXS A;  1PRB A;  2VBW A;  3CF2 A;  2QCO A;  1AKH B;  3A42 A;  3ML6 A;  3ZQ7 A;  3CCU I;  1VQP I;  1IC8 A;  4RM2 A;  1B72 B;  2I53 A;  5EP2 A;  4M0D A;  1VF9 A;  3GEZ A;  2JZ1 A;  3A01 A;  1LFB A;  3E7L A;  3OMY A;  1K4T A;  1TH3 A;  3KS4 A;  3MKZ A;  4PDG A;  3K70 C;  1E32 A;  1ZRE A;  5EFQ B;  3HHX A;  3TQS A;  3F22 A;  4UVB A;  1O9K A;  1YJW I;  5EGO B;  2ERC A;  4JBA A;  2DHY A;  3S1M J;  1X19 A;  2QBY A;  2LY2 A;  2P7C B;  3PQK A;  3E6B A;  4QPO A;  4XOR A;  1FIA A;  4HEA 2;  2UZE B;  1DP7 P;  4RF0 A;  3L28 A;  2R93 J;  2VUM J;  4DV1 M;  2STT A;  1BVS A;  2ETH A;  3KP7 A;  1NO1 A;  2EV0 A;  4EOI B;  3M0E A;  2JPB A;  4XRM A;  3TO7 A;  5ICF A;  1TDZ A;  2KNZ A;  2P7V B;  3JRG A;  3GTM J;  3I4N J;  5HBE B;  2XB0 X;  4JI7 M;  2HXI A;  1HKT A;  4BY7 J;  4LJ6 A;  3S1Q J;  1VQ1 A;  2BS3 A;  5EJC A;  1YRN B;  3GTG J;  3WTT C;  1HT1 E;  5ICG A;  1B9M A;  5FSW A;  2CRG A;  4FAS D;  2QLZ A;  2LH9 A;  3E97 A;  5F6F A;  4YFX F;  1H88 C;  4IF4 A;  1P7I A;  3J81 S;  5FD5 A;  2CSO A;  4YEJ A;  2W99 A;  2DA7 A;  3GTO J;  4LF8 M;  3RKY A;  1WZ2 A;  2WPA B;  3I58 A;  1GXP A;  1IV6 A;  1RUO A;  2JWS A;  2DOA A;  3KIO A;  1STZ A;  5EP1 A;  3CJQ B;  4O3M A;  3G1L A;  4M74 A;  3M03 A;  1ERD A;  4JXJ A;  2Z4S A;  2DA6 A;  3CCQ I;  1ENW A;  1T6S A;  3Q8X A;  5FRO A;  1WH5 A;  1LB2 A;  4BKX A;  1J5E M;  2CQN A;  2LC2 A;  2Y2Z A;  4B1R A;  2CQK A;  3H3Z A;  1OKV B;  2DFE A;  3MKW B;  2H1L A;  1Z7U A;  4I0B A;  3B74 A;  2LTU A;  3GO5 A;  4F7L B;  3T6P A;  2BWB A;  4HX7 A;  2HVQ A;  3R9X B;  2IGK A;  2CQ7 A;  3LA2 A;  1BM9 A;  2W7N A;  5GAH J;  3SHF A;  2HKX A;  1PM5 A;  4BGD A;  3DKX A;  2OCE A;  1UGP B;  4CCN A;  1D1B A;  1XG1 A;  4M6Y A;  4PFO A;  4CFW B;  5EZG A;  2UXD M;  1Y8R B;  1ZTR A;  3K2A A;  4JI5 M;  4Q48 A;  3CO7 C;  4HLY A;  1RIO H;  1BU2 A;  4JI8 M;  2A6E F;  4CHU A;  4AYB A;  2XPU A;  3SBJ A;  3RYP A;  1YTY A;  4M3E A;  3BHU B;  1XMA A;  3BLY A;  2VLA A;  2KDL A;  3HRT A;  3ROU A;  1XB4 A;  1WH7 A;  2DBB A;  2R5Z B;  5C18 A;  3ZRG A;  4CO8 A;  1BI3 A;  3TOA A;  4IHW A;  2CZ0 B;  5LRS A;  1RKT A;  1GJT A;  4NXM M;  5ILU A;  1K78 A;  4ETS A;  4JP0 A;  4UY8 I;  1ETW A;  1Z59 A;  2XDV A;  1R9T J;  1FSE A;  1JSU B;  1TH4 A;  2QF7 A;  2JY5 A;  4MTE A;  1MDM A;  2GM4 A;  3IG5 A;  2FFJ A;  1E3O C;  4F7J B;  2GBY A;  3U60 B;  2W00 A;  4C30 A;  3ESW B;  2Y69 H;  1WXQ A;  4UVA A;  3A02 A;  2BVM A;  3G6E I;  2EBI A;  1D1C A;  5ICC A;  3MZY A;  5J4V A;  3TDZ C;  4X0G A;  3M8F A;  4A93 J;  1TL8 A;  1RET A;  2JUC A;  4B7H A;  3CC7 I;  2O61 A;  1B59 A;  4YFN F;  3ZOB A;  3BY6 A;  2W84 A;  4IJE A;  4YOZ A;  3KX2 A;  2D45 A;  3SQN A;  4LLL A;  5FTN A;  4M9Z A;  2LHG A;  2H1R A;  3DOA A;  3B9P A;  2FBK A;  1UCR A;  4BDY A;  3T8T A;  5LHH A;  1LTM A;  2BHY A;  1X1B A;  4RA2 A;  3WU0 A;  2JSP A;  3KE2 A;  1Z91 A;  4RM3 A;  3MMY B;  1S6L A;  5M3M J;  5GPC A;  4IHX A;  2WAD A;  4IHY A;  1FMW A;  3OR1 C;  3KFW X;  4YFK F;  1D3Y A;  2E71 A;  3H0G J;  4EOJ B;  1OFH A;  3ELK A;  4DBQ A;  1T56 A;  5D5X B;  5FGK B;  3CP8 A;  2CYY A;  3DU5 A;  1NHW C;  1R1T A;  3KHI A;  4BAC A;  3VYH B;  4GGG A;  2W48 A;  4AQY M;  5HNF A;  4IVN A;  2MSY A;  3BG7 A;  3LSM A;  2K6B A;  4B3M M;  2LBF B;  1FOK A;  1KQ8 A;  2XLJ A;  1VQ7 I;  3AOE C;  2DA5 A;  2W24 A;  3NWS A;  4LB5 A;  3ABK H;  3X28 B;  2KDZ A;  3ZMZ A;  2M60 A;  3KOX E;  2F5S A;  2PLY A;  2FOW A;  3BCA A;  4R71 A;  5LQF B;  2ISY A;  4DOZ A;  3WG9 A;  5HNH A;  3I64 A;  4WK8 F;  3C2G A;  2CZ1 B;  1H1Q B;  1VQ6 I;  1ZGA A;  1RR7 A;  4OVZ B;  1XTA A;  1BC8 C;  5CYI B;  2QSG X;  3AG2 H;  2JPC A;  3GRU A;  4S04 A;  2MRO B;  2CUJ A;  5DCF A;  3EYI A;  2WBM A;  2EKK A;  4EV0 A;  3TN8 B;  3GP1 A;  4I76 A;  3QZ9 B;  4QOZ C;  1BOA A;  3SAT A;  2ICW G;  3VPR A;  2BW3 A;  2XAU A;  1ZMV A;  1ETY A;  3FKJ A;  5KK1 A;  3C9P A;  4D82 A;  3BR0 A;  4F92 B;  3GLI A;  1GLN A;  2EB7 A;  3J80 Z;  1IN7 A;  2RN7 A;  3K4N A;  4X62 M;  4M72 A;  2PJR B;  2CYZ B;  3IC7 A;  5KQ8 A;  2LNB A;  2YSR A;  4JV5 M;  3C2H A;  3TO9 A;  4HDU A;  3X24 B;  5LFA A;  4BY7 X;  5FFX A;  3DA1 A;  1E9S A;  3JCU C;  4I99 C;  4EJO A;  1BW5 A;  5FRM A;  3HJ8 A;  4YHH M;  2VBY A;  2GXG A;  3I4P A;  3I01 M;  1YJ9 I;  4XGI A;  4FQG A;  4BUP A;  1IN8 A;  3UK6 A;  2XPW A;  3CF0 A;  4M71 A;  3AFH A;  4UN2 B;  4NC6 A;  2OOA A;  1R2Z A;  4G94 A;  4UV9 A;  1VQ8 I;  2QDJ A;  3POM A;  5DQV A;  2PQ8 A;  3FXO A;  2ZJR F;  2Y9Y A;  4QPQ A;  2LSO A;  4UB8 C;  2F48 A;  3GLH A;  4XLC A;  3LNQ A;  2VJ4 A;  1OPC A;  3X25 B;  2QPA A;  3VLF B;  3D8L A;  3C2B A;  1S9H A;  2KR6 A;  1YW7 A;  1NV8 A;  3J7Y J;  3JR9 A;  4WX9 A;  3LVW A;  1G71 A;  2UUB M;  1UG2 A;  3WTZ A;  2V1N A;  2CE7 A;  1G3I A;  1WJD A;  2DFI A;  3AOE A;  5BR8 M;  2H94 A;  3QOP A;  4XLE A;  4H4K C;  2QFZ A;  3F23 A;  1IV8 A;  4XNF A;  3U6P A;  1JOW A;  2OZU A;  2P4W A;  2ZC2 A;  4CDG A;  1KU7 A;  2FEZ A;  2ZPB B;  4AKG A;  1U5T B;  3DEE A;  2LY1 A;  2KNA A;  2KRK A;  2Y20 A;  2LKX A;  3RSN A;  2HVS A;  1M1E B;  2M5W A;  1JXS A;  2KMG A;  1ZAE A;  1XC5 A;  2EJS A;  3G73 A;  3B7Q A;  1TTY A;  4IL6 C;  1E9R A;  3OYM A;  2O0Y A;  2C98 A;  1PUF B;  1WCM J;  4BHC A;  1ETO A;  2LMD A;  2M7B A;  4FTH A;  4HOB A;  4B3X A;  4P9F A;  4XRS G;  3FXM A;  1AUA A;  1JKR C;  1T43 A;  2LLK A;  3A4C A;  3HPG A;  3O2P E;  3CJN A;  5E3M A;  2JSC A;  2JJ7 A;  2EV5 A;  3BPX A;  2V4J C;  2HDW A;  3CDI A;  5EEG A;  3PL8 A;  2P0W A;  4BXF A;  1IG7 A;  4LRS A;  1WI9 A;  3HOU J;  2VF7 A;  2GIZ A;  2R7T A;  5DCM B;  2QYO A;  4IRH A;  1OMI A;  2CUZ A;  4NRV A;  2HFH A;  3FBN B;  2HOS A;  2GAU A;  4HSR A;  5E3L A;  1R1U A;  2XV4 S;  3ABT A;  1OKR A;  2ZJQ F;  3ZC7 B;  1Z9C A;  1P5E B;  3SHG B;  1V5E A;  1OIP A;  3LWF A;  3BG5 A;  5A2Q Z;  2HQ5 A;  5DTD A;  4NXN M;  2MR9 A;  2E2I J;  3E21 A;  2MG4 A;  2JA6 J;  4LJ7 A;  1XDU A;  4CFM B;  1ONV A;  3QHR B;  2WC2 A;  2V22 B;  3P7N A;  4U7B A;  1BR2 A;  2VE9 A;  4IBI A;  2NS0 A;  2PJQ A;  4GXO A;  4IRG A;  4RLQ A;  3JRI A;  2IBD A;  3IKV A;  3HHZ A;  3BTI A;  5E1X A;  4KT5 C;  2WMB B;  4C3J J;  1D0L A;  3OTO M;  4BNC A;  3SEZ A;  4OIR F;  3A1Y A;  3F8F A;  2UZK A;  2OD5 A;  3AL0 B;  3F8M A;  1PJR A;  5CJ9 A;  1GVJ A;  1Q39 A;  4A3G J;  1G3Y A;  1FYM A;  5IT9 Z;  1E2X A;  5AIQ A;  1J5Y A;  4HDV A;  1E17 A;  2CP8 A;  1BW6 A;  4B7F A;  2HWJ A;  5FRN A;  1W7P B;  1F36 A;  1TW3 A;  2ISZ A;  3CUQ C;  3E6M A;  3ABU A;  5J8F A;  1MMD A;  4IBB A;  3T0Y A;  2R46 A;  4NHJ A;  2XKO A;  4XON A;  1YSY A;  1X3W B;  5AIP A;  1CF7 A;  3ERM A;  4JK1 X;  1XGN A;  4G8X A;  4FWH A;  1XB2 B;  4DV3 M;  5IP6 A;  4U87 A;  5HBH B;  3KYL A;  4HPQ A;  3CCL I;  3FK6 A;  2HEO A;  2EUC A;  2VE8 A;  2E5L M;  3OIP A;  2W85 A;  4YEL A;  2L7M P;  4Q7J A;  3M6A A;  2DTR A;  4P9U A;  1CQT A;  4DV6 M;  2ZPI B;  4BCK B;  2GQQ A;  3N97 A;  5DM6 F;  3LSJ A;  1G2H A;  5J1U A;  4LFC M;  2DEN A;  2QKL B;  2EUF A;  4XBO A;  4OGR B;  4Y33 A;  2CW8 A;  4YOS A;  5FLX Z;  2EIM H;  2LK2 A;  4PFP A;  1FIN B;  2CS3 A;  1Y1V J;  1H28 B;  3GW2 A;  5H6R A;  3I56 I;  1JI8 A;  2AHJ B;  3JRD A;  1NG7 A;  3CTW B;  4JX4 A;  2JVG A;  3DBR B;  4PCQ A;  1XXH B;  2VAS A;  3A0B C;  1UGQ B;  4XLF A;  5IDP B;  3WU2 C;  2D1V A;  4PDK A;  3HKZ N;  4EJV A;  4EGZ A;  1FZP B;  1LDJ A;  3GWZ A;  5TJJ A;  2WA0 A;  4UNO A;  1R6B X;  2MYS A;  4OIN F;  3EJ1 B;  2MH8 A;  2QQ9 A;  2LWX A;  1YUB A;  5ITY A;  1ZHF A;  5M5X J;  1C9B A;  2UXB M;  2VPR A;  5E18 F;  1OFI A;  3BC8 A;  3M9A A;  2Z4R A;  2EA2 A;  1R7R A;  2ELJ A;  4E7Z A;  2CV1 A;  2F5P A;  1MSF C;  1ZEL A;  2EPF A;  5F08 A;  2FML A;  2JY8 A;  3L29 A;  3PSF A;  5D6E A;  4PSW A;  1SAX A;  2IVX A;  4I02 A;  2IW9 B;  3BLR B;  5EEH A;  3J80 K;  2R5Y B;  1NY6 A;  4EON B;  2R7O A;  3E3V A;  3E6D A;  1DGG A;  2MAB A;  1D5V A;  4HX8 A;  1G3S A;  4I0A A;  2O7O A;  2XF3 A;  1T33 A;  2GA2 A;  4XOT A;  4BCI B;  4KIS A;  4N0B A;  2XEP A;  1DPR A;  3CUQ A;  3OSF A;  3TWL A;  2Y48 A;  2DAM A;  1IJW C;  4JI3 M;  1QAN A;  3DZD A;  5BNG A;  3QYE A;  4A3M J;  1HBX G;  1NSF A;  2IA1 A;  1MBH A;  1OL1 B;  3S8P A;  4C3H J;  4ROD A;  4LGW A;  2IGO A;  5EYR A;  3U5Z A;  4GIP A;  4BCN B;  3NWT A;  4BJT A;  1JT0 A;  2OOB A;  4HEO A;  1IDY A;  1OKS A;  2E1N A;  4LB6 B;  3QHW B;  1HSJ A;  1LVK A;  2VKH A;  2DT6 A;  2XGD A;  1Q1V A;  4L9N A;  4F2L A;  3LQ5 B;  3RE8 A;  2MC4 A;  4KYW A;  2C96 A;  3HU1 A;  3BRO A;  1JE8 A;  1S7A A;  1MH4 A;  2WSE F;  4HL4 A;  1PJJ A;  2X6Y A;  2M7A A;  2FH0 A;  3ZR8 X;  2ZFU A;  5C4J J;  4PJN A;  2E1O A;  1SD7 A;  3LSK A;  3CMY A;  2DW4 A;  1MJG M;  1HW2 A;  2RC4 A;  3HL2 A;  1MBF A;  2IS2 A;  1XGS A;  4ZYD A;  3L25 A;  3IEC A;  1ZGW A;  2RKO A;  3HSE A;  3S14 J;  3I9V 2;  1A6I A;  2L7K A;  5LHI A;  3E0J B;  4LCB A;  2CFO A;  1O7L A;  4RAY A;  2JZ0 A;  1MMA A;  5J47 A;  4BEH B;  3J7B A;  1IUF A;  2FF4 A;  2GNO A;  3QU6 A;  3HOW J;  1MN3 A;  4AZF A;  1BR4 A;  5DEQ A;  3HEF A;  2XGX A;  4ZDP A;  2MD0 A;  5D5W B;  1W0T A;  2L6O A;  1KGS A;  3HB9 A;  3KP3 A;  5TIS C;  1MX0 A;  4BBR J;  2R0Q C;  1VTN C;  4EJT A;  4CYC B;  2DMP A;  5EXT A;  1C1K A;  1N36 M;  1D1A A;  2BV6 A;  2KZS A;  4MLO A;  1KU2 A;  3JSP A;  2FBI A;  4RGX A;  4IX7 A;  2DZO B;  2JY7 A;  4ZGJ B;  4V19 K;  2YX4 A;  5L3C A;  1OCZ H;  2KIF A;  2HGC A;  1UEL B;  2L02 A;  2NVU B;  2YPR A;  4BCM B;  2LTP A;  3HHY A;  4B3R M;  2K02 A;  3HUG A;  3GLX A;  2R7D A;  3F8B A;  3FKE A;  4YG2 F;  4NNJ A;  4D5F A;  4F93 B;  1HDP A;  3FUV A;  4BBA A;  5A2Q K;  1K79 A;  4FD2 A;  3A8G B;  1VIN A;  4LG2 A;  2P81 A;  4V2F A;  2V79 A;  1ZR2 A;  2Y0Q A;  5K7H A;  2EZI A;  3BQZ A;  3GFL A;  4IOC F;  2E5N A;  2QCU A;  1J9I A;  4AIH A;  3QPL A;  4DUZ M;  2IA0 A;  2FMY A;  1HNX M;  1RR8 C;  2GQF A;  3UR3 C;  4FWD A;  3GQ4 A;  3CUO A;  2ZXI A;  5FKK A;  2L2O A;  3B89 A;  3E4R A;  1WJF A;  3K1N A;  1GDT A;  3ZMV A;  5K7Z A;  4HF1 A;  4BCQ B;  1F9N A;  3M07 A;  4BH9 A;  4JYK A;  1CGP A;  1HDD C;  2XAG A;  1Z5A A;  1PP7 U;  2WJ9 A;  2P5T A;  2ZAN A;  4MHG A;  2CU7 A;  2RV8 A;  3BTJ A;  5L3B A;  3WHK A;  2DOE A;  5D4S A;  4G6Q A;  3G3Z A;  3BG3 A;  1B6A A;  1BC7 C;  2OV7 A;  3OY9 A;  2HDC A;  5IT9 K;  2WEV B;  1UHS A;  3FMS A;  3CC4 I;  2K0B X;  3KFU G;  5BPI A;  5HDG A;  5K5R A;  1AHD P;  3KXE C;  2FD5 A;  1HT2 E;  3K9O A;  3J81 Z;  4EOO B;  4B3A A;  1TWH J;  1GHC A;  2XGN A;  1H1P B;  1OKW B;  3PQJ A;  4PT5 A;  3T38 A;  1BOB A;  4A5N A;  1IUY A;  4MTD A;  1ON2 A;  1MZB A;  2PEX A;  4DYC A;  4BQN A;  4F7N B;  4EOP B;  4GO1 A;  1S72 I;  3QYB A;  1QO0 D;  2XKP A;  2RQP A;  4HNT A;  2M9H A;  5GAE J;  2BEO A;  4BXU A;  2I7P A;  2H6C A;  3EUA A;  3I59 B;  4MGI E;  3PIO F;  3JRE A;  4KRC B;  5DQW A;  1AKH A;  4NQW B;  4PJJ A;  1QAQ A;  1VZ0 A;  2DZN B;  3LA3 A;  2DI3 A;  3SZG A;  4C3I J;  4DUY M;  2UUA M;  5HLT A;  4QHS A;  1QPM A;  5KQD A;  1YJN I;  3DTO A;  4MGY E;  2JTV A;  3EET A;  5E79 C;  4OMZ A;  4AUX A;  4EM0 B;  4GHA A;  3A0H C;  4K2E A;  2IRF G;  2R0I A;  3S2H J;  4L8R C;  2YU9 J;  5FLX K;  3IH2 A;  1XMK A;  2CCH B;  5FTK A;  1NV9 A;  3BLQ B;  4G7Z F;  4AID A;  4AIK A;  1QMZ B;  2JA8 J;  4HLQ A;  4B44 A;  3F21 A;  1YIO A;  2TDX A;  4RB3 C;  1VQK I;  2R7S A;  2Y0S N;  3KP4 A;  4MEX F;  4KN7 X;  2PN6 A;  2WSF F;  4FET A;  2K40 A;  1H9T A;  1L2D A;  3PUB A;  4W97 A;  3WHB A;  1N4M A;  2VQE M;  4DV0 M;  2M1B A;  3T1B A;  4CCJ A;  4XN0 A;  2LKS A;  1WRJ A;  3K7A J;  4DZP A;  1NTC A;  3HM5 A;  3DXJ F;  3K7A M;  4IOA F;  2VII A;  4BDZ A;  2LVA A;  4IRI A;  2QEN A;  3GCM A;  5ITU A;  2M30 A;  4XMY A;  2ID6 A;  3CLQ A;  5FD6 A;  2IT0 A;  3OOU A;  2FA5 A;  3MKL A;  1H26 B;  3DDP B;  5E1W A;  5B1B H;  3MEX A;  2C9C A;  5IPA A;  1LV7 A;  4F52 A;  2CHG A;  1SXJ D;  3VFD A;  2XAJ A;  1IXR C;  3D5L A;  4G4O A;  4E7H A;  2FE8 A;  3HOT A;  3TNW B;  2X6W A;  3FXK A;  1IBM M;  4U0W A;  4XR6 A;  3TP3 A;  1X1C A;  3AOG A;  5HNB B;  1XD7 A;  5HQ0 B;  3DL1 A;  3E5X A;  5EEA A;  2XAH A;  4IBK A;  1E9H B;  2F5F A;  4QIW N;  2O25 A;  4LGY A;  1TLH B;  1TWG J;  5K1Y A;  1XXH E;  2VC0 A;  4OOI A;  2MLG A;  3VEP A;  4YRV A;  2CUE A;  5HLI A;  1UNL D;  1SD6 A;  1TWA J;  5CVI A;  3DBH B;  3HHW A;  1V55 H;  3F8C A;  4KHP M;  3QPS A;  4MGR A;  2DNA A;  3GRV A;  1D0Z A;  2MW8 A;  1U3E M;  3IAS 2;  4LK1 F;  5IZ7 D;  2IGN A;  2VC1 A;  4CHT B;  2MFZ A;  3Q8G A;  4HAM A;  1PUE E;  1APL C;  1D8K A;  3CDH A;  1YIT I;  3U9G A;  3KET A;  2HQA A;  3WTS C;  1YX3 A;  1F5Q B;  2XAQ A;  1K83 J;  1QQW A;  5EG0 B;  4OIQ F;  3RKQ A;  3V7C A;  4EC8 B;  2KEB A;  3UJN A;  5KPZ A;  3C3D A;  5KNL A;  1TQI A;  1IRF A;  1SVO A;  2F5V A;  2ZO4 A;  4L18 B;  4LMY A;  3FKI J;  3N05 A;  4F91 B;  3RI4 A;  4I8O A;  4D1Q A;  1E94 E;  3M4O J;  4HNU A;  3ZXS A;  1DQU A;  4RAF A;  1TDH A;  2L54 A;  1NK2 P;  2QSH X;  2HHH M;  2MGW A;  2AQE A;  4GH9 A;  2UXX A;  3VYS B;  1R6R A;  3GUD A;  3LSG A;  1U0J A;  4CCM A;  3H0D A;  2R5Z A;  2IS4 A;  1WJ5 A;  2V6Z M;  5IHY A;  2DYR H;  2LYC A;  5L8R F;  2M0M A;  1FNN A;  1Q02 A;  4CJ6 A;  1SFX A;  1VQL I;  2ZJP F;  1NHG C;  1SXJ A;  4L15 A;  3RTR A;  3VK8 A;  2MD5 A;  4DJA A;  2VBZ A;  3ZQJ A;  1VQM I;  2GLO A;  2IXS A;  2A6H F;  1ITY A;  2Q0O A;  3K4B A;  4PJL A;  4E7J A;  2VXZ A;  1J09 A;  3HO8 A;  3KOZ E;  2EIN H;  5FFZ A;  4JI1 M;  1OCC H;  4DIQ A;  2ZXW H;  5KAF C;  2FJ1 A;  2EIK H;  3VYU B;  2VKE A;  1UGS B;  2DPU A;  1OFC X;  4MQV A;  4HA8 A;  2WAQ A;  4XKW A;  4ENN A;  4IMY B;  2ZBK B;  3DF8 A;  3SEQ A;  4F3Q A;  5IY5 H;  1T6O A;  2ZJ2 A;  2JT1 A;  1G3W A;  4CCK A;  4EMS A;  4LK0 F;  5JLX A;  4AYB N;  2X1D A;  2F4M B;  3K9P A;  3K70 D;  6PAX A;  1PP8 F;  3CCS I;  2X1C A;  2DOF A;  2E35 A;  5JI6 A;  5E8I A;  2FOK A;  3FMQ A;  1RUN A;  3K92 A;  3BOS A;  2R45 A;  1VQO I;  2UU9 M;  4XKV A;  3MFK A;  2C5X B;  1T95 A;  3A03 A;  4D81 A;  3U1K A;  3O8H A;  4CCO A;  3IH3 A;  2L4M A;  1K4S A;  2R7U A;  4HQE A;  2X51 A;  2K4B A;  2FBH A;  1UZC A;  3KLN A;  3WHC A;  1R1V A;  2K86 A;  1L8Q A;  3L27 A;  4LD5 A;  4RAZ A;  1V29 B;  3A8H B;  5CEI B;  1XO2 A;  4XOP A;  3DLL F;  2JMW A;  3GRR A;  5DFL A;  3JR4 A;  1BJA A;  1X1P A;  2PMU A;  4MO7 A;  5FGM A;  3FHZ A;  3JTG A;  1YQA A;  2XSZ D;  3DPU A;  4IO9 F;  3RKW A;  3Q0U A;  4DBR A;  2E1C A;  2CUF A;  1WJC A;  1QAM A;  4ZH4 F;  3LFK A;  3FTC A;  1RC9 A;  2O03 A;  3ZQL A;  4LGM A;  2K3P A;  2ZZD B;  2BS2 A;  4HG2 A;  2C6Y A;  2PK2 A;  2WWY A;  2ECB A;  4BYY A;  4BHB A;  1T08 B;  3G33 B;  2FRH A;  1DU0 A;  1JT6 A;  2ZM6 M;  3I4M J;  3WVD B;  4CFU D;  3BDD A;  4E4H A;  4MGK E;  2G9X B;  5TRD A;  2CJJ A;  3NWL A;  1R5I D;  1TWF J;  2KZG A;  1U5T C;  2STW A;  3K8Z A;  4A3D J;  2ZPE B;  2KNV A;  4IPA A;  3VFZ A;  4EC9 B;  3H3U A;  1IAW A;  2GZW A;  2G9W A;  3QPH A;  3BPV A;  4M3D A;  3VOD A;  1GV5 A;  5TGT A;  4ESF A;  1OCT C;  3Q9V A;  1KSF X;  1QVU A;  5F1J A;  1QYR A;  3J81 K;  4IHV A;  4II3 A;  4OVZ A;  4AC0 A;  2M2E A;  3K2Z A;  2EZK A;  4ZTF A;  2J5P A;  2L7F P;  4ZC3 A;  2ZPG B;  2EKF A;  5LMU M;  3I3L A;  2K3F A;  3M1E A;  3R0A A;  2GWR A;  4A3I J;  2OQG A;  1QNT A;  2XAF A;  4CIS A;  2CQQ A;  2IVM A;  2CO5 A;  3DKY A;  3RKX A;  2LD5 A;  1NVM A;  4REZ A;  2Z16 A;  2HKJ A;  1WSU A;  3UGJ A;  4LRT A;  2KJB A;  4G12 A;  1J59 A;  1ZLK A;  5CQE A;  2Z99 A;  4FX3 B;  4UUS B;  2PJR A;  5DD8 A;  3CF5 F;  2AHM A;  1HW1 A;  2LVO C;  1WVR A;  4DZJ A;  3VDP A;  2FE3 A;  2A5W A;  1FTT A;  4CFV B;  4KOD A;  1D0M A;  4C2M J;  1Q3B A;  1G3T A;  2NS8 A;  5E26 A;  2VJI A;  3Q3S A;  3WGG A;  4A3F J;  2DFF A;  2XSZ A;  3ASO H;  3R8F A;  2BOL A;  5IP7 J;  2ZTC A;  2MJ5 B;  4UB6 C;  2AXL A;  2R7Z J;  2C5O B;  1I6H J;  1P7J A;  2MGQ A;  2HYG D;  3EIH A;  3MKY B;  3RPU A;  1URC B;  2EA0 A;  2XC7 A;  3KP6 A;  4WXD A;  1FSH A;  2KIM A;  1U8B A;  1NJF A;  1IW7 F;  2V26 A;  5EGO A;  3JRH A;  4OB1 B;  3KP5 A;  3GZ6 A;  2R62 A;  1K6O A;  3ZP5 A;  1G8P A;  1R2Y A;  4KFC A;  1T2K A;  4MB7 A;  4L78 A;  1Y1W J;  3L2V A;  3H5A A;  4NRW A;  2L9V A;  1R7J A;  3E9S A;  3ASN H;  1IFY A;  2JY6 B;  2Z8Y M;  3I4V A;  2JA2 A;  2ECC A;  1DUX C;  3L2R A;  3LW5 F;  1SC7 A;  4B47 A;  1IN4 A;  1WGN A;  1E3H A;  5GP9 A;  3AL0 C;  2KKO A;  1B9N A;  1ULY A;  1MJB A;  3OR2 C;  1K7A A;  1E3P A;  2G3Q A;  1I3A A;  1ZYR F;  4ESJ A;  2Q2E B;  1MU5 A;  2N35 A;  1T98 A;  2EIJ H;  5BQT A;  3KP0 E;  4RB2 C;  2H1K A;  1U5T A;  2X4H A;  4JI6 M;  4Q4Z F;  3ISP A;  4OIO F;  4PD2 A;  3EUK L;  2YQZ A;  1R5H A;  1F5T A;  1ZRD A;  4RF1 A;  2OAZ A;  1YS7 A;  3CZ6 A;  1NJG A;  2APL A;  2E36 A;  5KHD A;  2CZ6 B;  4XLA A;  2KRU A;  3L26 A;  4RGR A;  2B7E A;  3JRC A;  3GPY A;  4P1W A;  3L2U A;  1DDN A;  1NY5 A;  2R7W A;  3MHV C;  4EAT A;  4WUR A;  1MIJ A;  2DMT A;  3UNG C;  1A5J A;  2C4G B;  2QDY B;  2LOO A;  1Q1H A;  1DGH A;  4ZDL A;  4IBE A;  4I4L A;  1OCP A;  1Q3C A;  4BCF B;  4EEF G;  3M7G A;  1WHU A;  3FXL A;  3OOP A;  2L09 A;  4XK4 A;  4A2U A;  3HZJ A;  1TQM A;  2ZSI B;  1GT0 C;  2LDU A;  1WGX A;  2DLL A;  2TCT A;  2O8K A;  4ZYA A;  3SFZ A;  4B4C A;  3FRI A;  2WMA B;  4BHP A;  1WQ2 A;  2EIL H;  1AOY A;  2XB5 A;  4B48 A;  1TT0 A;  3NBX X;  4IBF A;  2K7L A;  2XUB A;  2WAE A;  1RPW A;  2L4E A;  5J8C A;  2IS1 A;  2KDO A;  5JVT A;  3GQ5 A;  3P9C A;  1R36 A;  2DK5 A;  3CF6 E;  3MIA B;  2F4O B;  3JTH A;  2ZAM A;  3GYH X;  4A3E J;  3GLG B;  3OYH A;  2VN2 A;  4KMF A;  3EQL F;  3TE6 A;  2X48 A;  4S12 A;  2EWN A;  4CIZ A;  4XBF A;  1BL0 A;  4GYG A;  3LVV A;  1VND A;  4L4U A;  2PMZ N;  1IRX A;  4EOS B;  3JRF A;  4XLH A;  1VDD A;  4WF2 A;  1EH6 A;  1VYW B;  4DR3 M;  1LDK B;  4IQJ A;  1S3S A;  2H5X A;  5FTL A;  4KRD B;  1OR7 C;  3BHT B;  4LIV A;  4HLX A;  1EA3 A;  2ZNZ A;  1DV0 A;  4B3T M;  1MDM B;  1YYV A;  2UXN A;  1UNG D;  4LG3 A;  3G1O A;  2R44 A;  1S5L C;  2BY0 A;  2XRO A;  1IBK M;  2WSC F;  1RU3 A;  2DWM A;  1Y6I A;  2R4G A;  2WTE A;  4LJ9 A;  2EJR A;  1W7P A;  3FBI B;  1X2N A;  4P96 A;  5LGN A;  3RZD J;  1SFO J;  1MNM C;  1A04 A;  2E34 A;  1H25 B;  3FUW A;  4HBL A;  1TW2 A;  3IWF A;  1O3R A;  3X20 B;  2BY1 A;  1BA5 A;  2XF5 A;  2WY7 Q;  1TBX A;  3U1D A;  4NB5 A;  5E17 F;  1L1Z A;  3EIE A;  5KVR A;  1Z6T A;  3ECO A;  3ZN0 A;  4II5 B;  3NAU A;  1TH2 A;  3HBL A;  3ZQI A;  3FE3 A;  1QPI A;  1FOY A;  2VON A;  2BKZ B;  4I81 A;  5LRR A;  2VQG A;  4YOO A;  3DTE A;  4A3C J;  1TWC J;  3TP0 A;  4DV7 M;  2OC6 A;  2ZFW A;  3CJT B;  3AAF A;  4LJA A;  4FVM A;  3K6G A;  5BMZ A;  5AON A;  2RVC A;  2ZPH B;  4BY1 J;  4CIC A;  2FXA A;  2M87 A;  2V1C A;  2VT3 A;  3A46 A;  5J3L A;  4E7S A;  2KIS A;  3UKG A;  3NRV A;  3FM5 A;  3F6O A;  2NRA C;  4OB2 B;  3DTI A;  1I3Q J;  1MJA A;  2HR3 A;  3R6S A;  3KOW E;  3IH4 A;  3ULQ B;  4AM3 A;  1H4L D;  3B6C A;  3LL7 A;  2PBI A;  1L0O C;  3P9K A;  5D8L B;  1WJA A;  3FUT A;  4R1H A;  3HOV J;  4N9H A;  2X49 A;  3HX3 A;  2DPD A;  1X4P A;  3G1M A;  2X0L A;  4KMU X;  3KPH A;  3OYJ A;  5GAD J;  2HWV A;  1DO0 A;  4FCW A;  1OYY A;  2QQB A;  4CA0 A;  4Z6Y A;  3MAJ A;  3KW6 A;  2QUF A;  3CCJ I;  3SMP A;  4LG0 A;  1MGT A;  3R60 A;  1IGN A;  4ITV A;  4NSO B;  4R7G A;  3BR2 A;  3BR6 A;  3TNI B;  3KP1 E;  1ETQ A;  3HJQ A;  4BLC A;  2OQ4 A;  3U6O A;  3GTP J;  3C18 A;  5IWA M;  4GC9 A;  4UN0 A;  5LMN M;  2HKO A;  1VQ4 I;  1QVR A;  5B66 C;  2D0Q B;  2V6C A;  3DU6 A;  2HAK A;  1OR7 A;  2R5Y A;  2F5O A;  5GKN A;  2RDP A;  1EKE A;  2RNJ A;  3A8O B;  1PYV A;  3O3K A;  1UB9 A;  1IRZ A;  1L2C A;  1Z5C A;  1HR0 M;  1F4I A;  2LVQ D;  2LRE A;  3M1C A;  2BW3 B;  4XRF A;  5CLS A;  5J40 A;  3CCY A;  1N78 A;  4PK4 A;  3H4M A;  1X3U A;  4KO8 A;  4W5W A;  2DOD A;  1I39 A;  4B7G A;  3SYT A;  3L2Q A;  1LJ9 A;  4ZZD A;  3M8J A;  4M9X A;  2FX0 A;  1P4X A;  3BZK A;  1XMQ M;  2G7H A;  5GTI C;  1JKO C;  2JNH A;  1XMX A;  1W5S A;  2KT0 A;  3P5J A;  3SDB A;  1UFM A;  1QA6 A;  4G4Q A;  2VOD A;  4XLP F;  2I7N A;  1AD6 A;  5JLW A;  3H92 A;  5ITR A;  2RQQ A;  5E3O A;  3MD2 A;  2OU2 A;  3OWT A;  4F55 A;  4BE2 A;  1MND A;  1WFX A;  3BBZ A;  2BE5 F;  2L0K A;  1R22 A;  4FT8 A;  5F64 A;  2A07 F;  3A2K A;  2KXE A;  1KQ0 A;  3DLA A;  4FCY A;  1F4K A;  3CDL A;  3LFU A;  2XSD C;  3AG1 H;  1QDR A;  1BI2 A;  2WB1 A;  3KEY A;  3ILK A;  4DV4 M;  1YIJ I;  2F5N A;  3VSK A;  2CJM B;  3ZMD A;  1HQY E;  3KYC B;  1UAA A;  3SZT A;  1MNE A;  3GLH B;  1W36 C;  1MMS A;  2K9N A;  3U6L A;  3H35 A;  2QP9 X;  4P17 A;  4A5M A;  5DM7 F;  1PKD B;  2WY8 Q;  4BEH A;  2HCB A;  1ZMU A;  5B3S H;  2W2H A;  3DPL C;  1SMY F;  3B73 A;  4CH7 A;  1A6Q A;  5LHG A;  1J75 A;  2O8X A;  2NXN B;  1OI9 B;  1VEK A;  3Q0V A;  3MZH A;  2I40 B;  1N32 M;  3TWK A;  2M34 A;  1VFC A;  1A5T A;  2R7F A;  3D5R C;  3PM1 A;  4I09 A;  1O57 A;  4XRS A;  4MEY F;  2AS5 F;  1GH6 B;  1UHM A;  5DUK A;  4JI2 M;  5HS8 A;  4DNC A;  2K9Q A;  2PMH A;  2DVW B;  2HNH A;  2DCE A;  3GPU A;  2Y0M A;  4RAG A;  3FXQ A;  5CPR B;  1WWX A;  4ENJ A;  2E1M B;  3U61 A;  2R18 A;  2Y0T A;  2D5V A;  2XZU A;  2DU9 A;  1H27 B;  2E7W A;  3PNV A;  1IF1 A;  2DXC B;  1AU7 A;  2JN6 A;  4BXX X;  3J80 S;  1UFZ A;  2DJI A;  3QWL A;  2EFW A;  2EFN A;  2B9S A;  1IRG A;  2ELH A;  1QLB A;  4YY3 M;  2OCC H;  3ZPL A;  4FIS A;  3BJA A;  3OYK A;  2BJV A;  3BG9 A;  1U8R A;  1AWC A;  3OS2 A;  2WIP B;  4Z2Y A;  1L2B A;  3S93 A;  1FYK A;  2CCI B;  3OL3 A;  2DJN A;  1A31 A;  4GC5 A;  2BS4 A;  2I5U A;  1JR3 E;  4NC7 A;  1XMO M;  1MBE A;  4LFB M;  3E5Q A;  4Q47 A;  3RQI A;  2E60 A;  4FE4 A;  3JR5 A;  4DR1 M;  2BBY A;  4TV7 A;  4X1E A;  3GTQ J;  5LMK B;  5L3G A;  2CH0 A;  2LP0 A;  3OYG A;  1GO5 A;  2K27 A;  1H89 C;  2ZSH B;  2UUZ A;  1N25 A;  4Y17 A;  4IHS A;  2ZNY A;  3JSO A;  3K10 A;  3FD9 A;  1YG2 A;  2VQC A;  2GXB A;  3L2C A;  4EOQ B;  3TW7 A;  3OIQ A;  1OIS A;  3VB2 A;  1REP C;  2EFO A;  1XGM A;  1JKQ C;  2RGO A;  3OYD A;  3DP7 A;  4B43 A;  2QSF X;  3VSL A;  1XHB A;  2DAK A;  3QXE B;  1QU3 A;  2NOG A;  1AIS B;  3BJO A;  2O3F A;  3RGF B;  5DYG A;  3W2V A;  2HDD A;  3K4C A;  2MLK A;  5ACB A;  2LVP C;  4KIB A;  3W2A A;  7CAT A;  4I98 B;  2FOI C;  4P16 A;  2BGC A;  2J7N A;  5GAG J;  4A3V B;  4W1U A;  5HOD A;  3C3E A;  3G2B A;  4CYD A;  1BR1 A;  2R7Q A;  1SFE A;  2DN0 A;  3PO3 S;  4JI4 M;  4BY1 X;  3GLG E;  2VQH A;  3CCE I;  2G77 A;  1ODD A;  3K4K A;  1TT5 B;  5FKM A;  2EO2 A;  2QA4 I;  3PIP F;  4LJ5 A;  4QHT A;  4DR6 M;  2H09 A;  2JRM A;  2JQ7 A;  3REO A;  3FUU A;  2LF8 A;  3UMM A;  5H6Q A;  4L9V A;  1JHH A;  2HOT A;  5BS6 A;  5H20 A;  1D8J A;  1H1R B;  2DD4 B;  2FQ3 A;  3I59 A;  4IJA A;  3U2R A;  1H8A C;  3DCF A;  2I10 A;  4NQW A;  3SJM A;  5IYD J;  4CCL A;  5D6F A;  4HF0 A;  3LSP A;  1OCR H;  2GA1 A;  5ICE A;  5KPT A;  1FVV B;  3GBG A;  4LFU A;  3OYN A;  3D1N I;  5IF1 B;  3L7W A;  1X1A A;  3SFI A;  3CLO A;  3HOX J;  1RRJ A;  1VOL A;  3E5U A;  4G7O F;  2I8D A;  2KRF A;  1EH7 A;  2IW8 B;  2MH9 A;  1XC8 A;  2COB A;  1IBL M;  1E0E A;  1MBG A;  3PXG A;  2WIH B;  3SAU A;  3JAM S;  4II2 A;  2BY2 A;  4A6E A;  3I5U A;  4V2G A;  1B8I A;  1A36 A;  2XHK A;  4WW0 A;  3SC3 A;  2JA5 J;  3VWB A;  3BR3 A;  5DD4 A;  4DGW B;  5A2Q S;  1P3Q Q;  1FBQ A;  1RZ4 A;  2CMP A;  1QUT A;  5DS9 A;  1N33 M;  3QYF A;  1OLT A;  3J7A O;  1FT9 A;  3ZMU A;  3ZQF A;  2EQR A;  3F8N A;  3HSF A;  4ZYG A;  3GTK J;  3CCM I;  4ROC A;  3IRR A;  5HLG A;  1ZRC A;  4I2O A;  1VEG A;  4KIC A;  1DP3 A;  2KFD A;  4I6Z A;  1W0U A;  5ICP B;  3KDS E;  2D7E A;  5C1B A;  4AKH A;  3K4L A;  2R3S A;  1GUX B;  4IQ4 A;  3I55 I;  4IEJ A;  1UMQ A;  3C3W A;  2V1U A;  4F7Z A;  4KDP A;  4OIP F;  4JI0 M;  1G6N A;  1L1T A;  3FTE A;  1KZH A;  3I54 A;  3WGH A;  4B8X A;  2O6G E;  4RLF A;  3GLF B;  1K3W A;  2V9K A;  2A61 A;  3IUO A;  3JRB A;  2DK8 A;  5BPD A;  4GHL A;  1USS A;  4LJ8 A;  1X1D A;  1H0M A;  4CZC A;  1Z1D A;  1OCO H;  4AVZ A;  3V8J A;  2B63 J;  2DT5 A;  4L9J A;  3WTV C;  2P5V A;  2PJP A;  5ED4 A;  4DR4 M;  2BNK A;  2LKP A;  3EDP A;  3S1N J;  5E3N A;  2KA6 B;  4BQQ A;  4CSW A;  3VKH A;  2K47 A;  5EG0 A;  4IHT A;  1X3Z B;  1R71 A;  3QP6 A;  1XSX A;  3WTY C;  2LFB A;  1TC3 C;  2UUE B;  2WFY B;  2KZV A;  3ZMS A;  3HSR A;  2NYX A;  1HNZ M;  5HLH A;  2JZY A;  2OUM A;  3DDQ B;  1UNH D;  3VDU A;  2F2E A;  4PGH A;  1LUJ B;  4JN6 A;  4D7M A;  2C6T B;  3LA7 A;  3VDX A;  2VBX A;  2L5Q A;  4CGZ A;  3TL4 X;  2ZME B;  5FLX S;  1WJB A;  2DT7 B;  3T1H M;  2EFQ A;  4BE0 A;  3C58 A;  3PJR A;  3A8M B;  4DR5 M;  1EV7 A;  3BQY A;  2Z2S B;  2Q8K A;  3HTS B;  1B72 A;  5H2F C;  1VDL A;  4RBO A;  3NEU A;  4HV5 A;  1V4R A;  3DEU A;  3PO2 J;  1UHW A;  3MWM A;  4ANR A;  3BT9 A;  2L9N A;  3PNY A;  2X6X A;  3GFJ A;  2K4J A;  3G71 I;  2QGS A;  5IOZ A;  2A6T A;  2ZXH A;  2CW0 F;  2XZF A;  3U6D A;  1SAU A;  1SD5 A;  5F27 A;  2L4A A;  3W6J B;  4Y13 A;  1WGL A;  4YIR X;  2TRT A;  1KU3 A;  5C3E J;  5I5Z B;  1HJP A;  4X64 M;  2ZBK A;  3P9I A;  2DI0 A;  3ZCB B;  1S8N A;  1G3N C;  4A6D A;  3IV5 A;  1ZH5 A;  3GX4 X;  3IG8 A;  2NQ8 C;  3S1R J;  1HNW M;  4Y4R A;  3GLH E;  4RMN A;  5FTJ A;  5EZH A;  5J1Y A;  4L5I A;  4AU7 A;  1LE8 B;  4M3F A;  1FMV A;  1WR1 B;  1YRN A;  1FBU A;  4BCH B;  2CW7 A;  2W25 A;  2F4V M;  3QYG B;  2QZ8 A;  1V5G A;  3FZV A;  3J7A S;  4MM3 B;  5E20 A;  5D8K B;  1WHC A;  4ZZL A;  5L3F A;  2F5Q A;  3U6M A;  2LH0 A;  3HU2 A;  1BIA A;  2DFH A;  2Y31 A;  4HYE A;  4D0P A;  4E6K G;  2KZU A;  4MQ9 F;  5KCM A;  1V3F A;  5JVG F;  3HWS A;  3IAM 2;  4L0Z B;  2L9R A;  4Y15 A;  1XDS A;  4LFA M;  3KVW A;  3L9F A;  2Z1D A;  4BJ5 C;  2WHB B;  2WAQ N;  2J7O A;  3T8R A;  2DDB A;  2D7H A;  5DUI A;  1TD6 A;  2PI0 A;  1BBY A;  1MBK A;  1KXU A;  1Z3X A;  4RNA A;  2OA4 A;  2ME6 A;  2BPM B;  4YC3 B;  4FX0 A;  1ZQ9 A;  3HHT B;  5H37 D;  4ZGD B;  2QKM B;  4U88 A;  2V1D A;  4Y7N J;  4L16 A;  1QGP A;  2X1E A;  1FJL A;  1Z05 A;  3BLH B;  2KIQ A;  2Y21 A;  2ACJ A;  2VOP A;  3W6V A;  1CUK A;  1OIZ A;  2YR0 A;  5HVQ C;  1O3S A;  1SFU A;  2AQF A;  3GRY A;  4ITQ A;  4NBQ A;  2KLO A;  1JTX A;  1LFU P;  2E19 A;  3U6S A;  1C7Y A;  4DV2 M;  1I4W A;  1T0F C;  3RQ4 A;  3VOE A;  1WPK A;  2RKH A;  3KCC A;  1O3T A;  5B1A H;  1P2F A;  2IS6 A;  3ZQH A;  1GAB A;  1HCR A;  2KMU A;  1VQ9 I;  4XQF A;  4GIT A;  4MGZ E;  4CRL B;  3HGY A;  5ILS A;  4KN4 X;  4KT0 F;  1JGS A;  2W9F A;  2C5R A;  2XPV A;  1FOX A;  2G7U A;  2DWZ B;  2L01 A;  4C2U A;  5EQT A;  4U0V A;  4C9Y A;  1TGU A;  5JHF A;  4DV5 M;  1ETK A;  1ZR4 A;  4IJF A;  4IBD A;  4CFX B;  2BZT A;  2O9L A;  1FKM A;  2OTL I;  2CG4 A;  3GPX A;  4OMY A;  2DXI A;  2W9Z A;  2GOM A;  3QQA A;  5K7F A;  5DYI A;  4UUS A;  5DV5 A;  2DA1 A;  1I5Z A;  4OAY A;  1FOW A;  4DYR A;  2RRE A;  1ACI A;  3PNT A;  1P4A A;  1YS6 A;  3FWE A;  5D5U B;  4Z8X A;  2VT2 A;  3ZGK A;  2EV6 A;  1DU6 A;  1IRE B;  1ZN2 A;  3CMM A;  3R4K A;  1DGB A;  1P4W A;  2KPM A;  2ME0 A;  3U60 A;  1IY0 A;  1IZ1 A;  2HYJ A;  3WG7 H;  3I0T A;  2HYF A;  2L3D A;  1RNL A;  1EE8 A;  5FKL A;  5LGU A;  3LCU A;  3TO6 A;  4EOM B;  3BG6 A;  5F1R A;  1TR8 A;  1J2X A;  2P5K A;  4E7L A;  4E7I A;  3QPT A;  2OPF A;  1L3L A;  2CGP A;  3TPZ A;  3OSG A;  2OBP A;  4DR7 M;  2PG4 A;  4O5V A;  4NL4 H;  1MW7 A;  1HF0 A;  2H6B A;  4ENM A;  2Y9Z A;  2F5E A;  3FYC A;  1GVN A;  4HX4 A;  2DMU A;  1VQ5 I;  3S2D J;  4OB0 B;  2LHC A;  1H9G A;  5K5O A;  5J4Y A;  1EIJ A;  4FWG A;  2QQA A;  2XIG A;  5FTM A;  2YR2 A;  1GXQ A;  3QP5 A; 
#chains in the Genus database with same CATH homology
 2VJ5 A;  2IS1 A;  2KDO A;  2QKL B;  3EUH C;  3ZQQ A;  4Y33 A;  3CP2 A;  2CW8 A;  4BE1 A;  2HPI A;  3OYH A;  4PFP A;  2CS3 A;  1LFP A;  3H9Q A;  1JI8 A;  2AHJ B;  4FM4 B;  1NG7 A;  2JVH A;  4JX4 A;  2JVG A;  4XKB A;  3RPU D;  2VAS A;  1UGQ B;  4XLF A;  2VKD A;  1IRX A;  2VL8 A;  1WJE A;  4XLH A;  2WA0 A;  2LBF A;  2V6E A;  2MYS A;  2V7F A;  1Z3Y A;  1LDK B;  2KRH A;  1G59 A;  4IQJ A;  2UWM A;  1OR7 C;  4XKC A;  4LIV A;  1EA3 A;  2E5Z A;  3H9G A;  3BC8 A;  4LG3 A;  2ELJ A;  4E7Z A;  2CV1 A;  3U21 A;  1Y6I A;  1ZEL A;  2R4G A;  3V42 A;  3FBI B;  2XF7 A;  3PSF A;  4PSW A;  4NC8 A;  2QQ8 A;  3PFY A;  3X20 B;  2KQR A;  4QSH A;  2XF5 A;  2WY7 Q;  3QOD A;  3OYA A;  1X4O A;  2R7O A;  3HOS A;  4MFD A;  2MAB A;  2K9M A;  1DGR M;  5CKT A;  4XOT A;  4KIS A;  4XL9 A;  3HBL A;  2M4K A;  2VJJ A;  4J01 A;  2R7X A;  2VQG A;  5LD2 C;  1TZL A;  3DTE A;  4CUG A;  2CZ7 B;  3QYE A;  2OC6 A;  2LG4 A;  4XM3 A;  1N77 A;  3S8P A;  4PSX A;  2M4G A;  2IGO A;  3K6G A;  3OL4 A;  4ANJ A;  3OYE A;  2IGM A;  3NWT A;  4BJT A;  2ZPH B;  1LVK A;  2VKH A;  3HUG B;  2DT6 A;  4HNV A;  4E7S A;  2MC4 A;  4OB2 B;  1V5F A;  2DXB B;  3DTI A;  1UGR B;  4XN3 A;  3LL7 A;  1WJA A;  1YE9 A;  2HU9 A;  4HL4 A;  1AHJ B;  2X6Y A;  2M7A A;  1X4P A;  4PUS A;  2ZFU A;  3ZR8 X;  4PJN A;  3LSK A;  3OYJ A;  2W82 A;  3HG9 A;  2IS2 A;  3HL2 A;  4CA0 A;  3PSI A;  4PJM A;  3OYB A;  3DQV C;  3I9V 2;  2L7K A;  4Z6Y A;  3E0J B;  5HOO A;  2CFO A;  4ELJ A;  4ITV A;  1MMN A;  1MMA A;  4BEH B;  3W2W A;  1KON A;  4MIM A;  1NG6 A;  2D0Q B;  1QHG A;  4ZDO A;  3DU6 A;  1BR4 A;  3EPZ A;  4ZDP A;  2MD0 A;  2HPM A;  3HB9 A;  2CV0 A;  3HXL A;  3A8O B;  1PYV A;  5CQG A;  3OYI A;  4JOM A;  3DTK A;  3VYR B;  2XSJ C;  4OB3 B;  1N75 A;  3S3N A;  2LRE A;  1D1A A;  3M1C A;  2BW3 B;  4MLO A;  4IX7 A;  3VYT B;  4BS9 A;  4HRI A;  4BBS M;  2KL4 A;  1N78 A;  4PK4 A;  4ZGJ B;  2WAF A;  2Y0S A;  2KHM A;  4BL0 B;  2ZCF B;  1UEL B;  3SYT A;  3L2Q A;  2BVL A;  3W3C A;  3M8J A;  4P5O A;  2DPP B;  2K9L A;  3RCO A;  1LKX A;  1Z7L A;  1QHH D;  3SDB A;  3J7A Y;  3H4C A;  4NNJ A;  4F93 B;  3LSH A;  3OYC A;  2RQQ A;  3CF2 A;  2VXD A;  3MD2 A;  3A8G B;  3OWT A;  4RM2 A;  4F55 A;  1MND A;  4BE2 A;  1WFX A;  3A2K A;  3DLA A;  3LFU A;  3OMY A;  2WB1 A;  2E5N A;  3DPT A;  3KEY A;  3VSK A;  3MKZ A;  1UAA A;  3K70 C;  1MNE A;  1W36 C;  3UR3 C;  3H35 A;  4JX6 A;  2ZXI A;  4IKF A;  4P17 A;  2L2O A;  2WY8 Q;  4BEH A;  1WJF A;  3DPL C;  3VYG B;  4CH7 A;  1X19 A;  2LY2 A;  4QPO A;  2E1M C;  4HEA 2;  4XOR A;  2WJ9 A;  2M3A A;  4BU2 A;  3D5R C;  3BG3 A;  2OV7 A;  3OY9 A;  1G8X A;  2BS3 A;  2HNH A;  2DCE A;  2KRC A;  5EJC A;  5CPR B;  4JX5 A;  2E1M B;  4FAS D;  2LH9 A;  3L2W A;  1D0Y A;  2R7V A;  3PNV A;  2DXC B;  1BOB A;  2DJI A;  4YEJ A;  3QWL A;  4BQN A;  1QLB A;  3QZ5 B;  3OYK A;  3QYB A;  2DOA A;  3BG9 A;  4R79 A;  4HST A;  3OS2 A;  3CJQ B;  4HNT A;  1ERD A;  3S93 A;  3EUA A;  3OL3 A;  5FRO A;  4NQW B;  4PJJ A;  3SZG A;  1VZ0 A;  4NC7 A;  2BS4 A;  2LC2 A;  5HLT A;  2E60 A;  4AKI A;  4KJZ A;  3MKW B;  2CH0 A;  3OYG A;  4HLQ A;  2ZSH B;  2HVQ A;  2UUZ A;  4B44 A;  3OYF A;  2IGK A;  1D0X A;  3LSI A;  2R7S A;  2W7N A;  2VPL A;  4BGD A;  3K10 A;  3DKX A;  1UGP B;  4CCN A;  1D1B A;  2VQC A;  4FET A;  4LIT A;  4PFO A;  3TW7 A;  3OIQ A;  3PUB A;  4CCJ A;  4XN0 A;  3OYD A;  3QYH B;  4B43 A;  4AYB A;  3VSL A;  3BLY A;  2VLA A;  4BDZ A;  1QU3 A;  3QXE B;  4XMY A;  3W2V A;  1DGW Y;  3K4C A;  3H5N A;  3OOU A;  3ZRG A;  3W2A A;  2CZ0 B;  4F52 A;  4OAZ A;  2Q1Z B;  3G2B A;  3D5L A;  1BR1 A;  2R7Q A;  2NOJ B;  4E7H A;  3HOT A;  2X6W A;  2XDV A;  1YX5 A;  2VQH A;  4NUB A;  4XR6 A;  2G77 A;  2JUG A;  1X1C A;  3K4K A;  3DL1 A;  2QF7 A;  3CJR B;  3D5S C;  1E7P A;  3S3O A;  2ZPF B;  4YRV A;  2W00 A;  4C30 A;  2DD4 B;  2BVM A;  1D1C A;  4J00 A;  1D0Z A;  2PMZ A;  4CCL A;  4X0G A;  1UG0 A;  3IAS 2;  2IGN A;  3GBG A;  2MFZ A;  3OYN A;  3KX2 A;  1X1A A;  2HQA A;  2LRD A;  1YX3 A;  3S3M A;  2I8D A;  1E0E A;  5KNL A;  4II2 A;  4BDY A;  2F5V A;  3VWB A;  1X1B A;  4DGW B;  3N05 A;  4F91 B;  2CMP A;  2JSP A;  4D1Q A;  2L9S A;  3MMY B;  4RM3 A;  3QYF A;  4BJ6 C;  4HNU A;  2WAD A;  1OLT A;  1DQU A;  3ZXS A;  1FMW A;  3OR1 C;  3WVE B;  4DBQ A;  2AQE A;  3VYS B;  4CCM A;  3LMM A;  1R6R A;  3CP8 A;  3DU5 A;  1U0J A;  3LSG A;  1SFK A;  3H0D A;  2IS4 A;  1WJ5 A;  4BAC A;  1DP3 A;  3KHI A;  3VYH B;  2M0M A;  2LYC A;  5HNF A;  3BG7 A;  3LSM A;  3H5R A;  4M6V A;  2LBF B;  3BCB A;  3K4L A;  4AKH A;  4DJA A;  3K4M A;  4IQ4 A;  3NWS A;  2IXS A;  2X85 A;  1HA8 A;  3K4B A;  4PJL A;  4KIT B;  4E7J A;  3X28 B;  2VXZ A;  1J09 A;  3HO8 A;  4GRI A;  4N4N B;  4DIQ A;  3H9J A;  2R7R A;  4RLF A;  3BCA A;  3VYU B;  4G6T B;  1UGS B;  2V9K A;  4DOZ A;  5HNH A;  3IUO A;  4ZGE B;  2WAQ A;  4XKW A;  3C2G A;  3TBI A;  3SEQ A;  4F3Q A;  2CZ1 B;  4CCK A;  1X1D A;  3S32 A;  4CZC A;  3TMO A;  4AVZ A;  3CES A;  2X1D A;  3K70 D;  1W36 D;  2X1C A;  2CUJ A;  3HC7 A;  3QOE A;  2WBM A;  1AA7 A;  2DD5 B;  2HZD A;  3QZ9 B;  4XKV A;  2CV2 A;  4BQQ A;  1T95 A;  4CSW A;  2BW3 A;  2XAU A;  3FKJ A;  3IP4 B;  4F92 B;  3VKH A;  4CCO A;  2R7U A;  1GLN A;  2X51 A;  1Z21 A;  2KZV A;  3K4N A;  2PJR B;  2CYZ B;  3HPH A;  2FUG 2;  2OUM A;  1V29 B;  3A8H B;  3C2H A;  4XOP A;  4JQF A;  3VDX A;  3X24 B;  4KT6 A;  2L5Q A;  5LFA A;  3DPU A;  3TL4 X;  4DBR A;  1WJB A;  2DT7 B;  4BE0 A;  5FRM A;  3PJR A;  3A8M B;  1WJC A;  4LIU A;  2Z2S B;  4AI6 A;  2K3P A;  2ZZD B;  2BS2 A;  4HG2 A;  4BUP A;  4Y3O A;  3AFH A;  4NC6 A;  2QDJ A;  2L9N A;  2X6X A;  3PNY A;  3WVD B;  3AKZ A;  4QPQ A;  2A6T A;  4E4H A;  2ZXH A;  4ZTJ A;  1SAU A;  4XLC A;  2VJ4 A;  2ZPE B;  3A8L B;  3X25 B;  1S9H A;  2KR6 A;  2V1N A;  5TGT A;  4IZZ A;  1WJD A;  4XLE A;  3OYL A;  2QFZ A;  4H4K C;  4XNF A;  3VKG A;  4II3 A;  4ZTF A;  4Y4R A;  2ZPB B;  3DEE A;  4AKG A;  2LY1 A;  4ZC3 A;  2ZPG B;  4RMN A;  3RSN A;  3I3L A;  2HVS A;  2KMG A;  4AU7 A;  2W4S A;  3DKY A;  4BQO A;  1FMV A;  2Z16 A;  2CW7 A;  3F9K A;  3QYG B;  3OYM A;  1V5G A;  5CQE A;  2M7B A;  4B3X A;  2PJR A;  4E6K G;  1MMG A;  2O5R A;  3A4C A;  3HPG A;  2A5W A;  5KCM A;  3IAM 2;  2V4J C;  2HDW A;  2VJI A;  4BJ5 C;  2Z1D A;  3PL8 A;  2P0W A;  4BXF A;  2BOL A;  2R7T A;  4MFE A;  3MKY B;  1Z3X A;  2XC7 A;  3OS1 A;  3HKZ A;  4ZGD B;  3HHT B;  2V26 A;  2CUZ A;  2QKM B;  3FBN B;  3K4J A;  2HVR A;  2X1E A;  4OB1 B;  4HSR A;  4C2T A;  3OS0 A;  3L2V A;  2KP6 A;  3H5A A;  5HVQ C;  2AQF A;  1V5E A;  3BG5 A;  3TW6 A;  2KLO A;  2JA2 A;  1P9Q C;  4D9J A;  3L2R A;  1T0F C;  3RQ4 A;  4B47 A;  2IS6 A;  3AL0 C;  2VQL A;  3ZCO A;  2KMU A;  3OR2 C;  4XQF A;  4ZJZ A;  4U7B A;  1BR2 A;  4RLQ A;  2Q2E B;  3X26 B;  4BBR M;  4C2U A;  4C9Y A;  3SEZ A;  2F4I A;  4N4O B;  3EUK L;  5JHF A;  3A1Y A;  3DWL E;  3AL0 B;  1FKM A;  1PJR A;  2F6C A;  3CZ6 A;  4LOC A;  2DXI A;  5KHD A;  2CZ6 B;  4XLA A;  2GOM A;  1K6Y A;  2W1O A;  4OAY A;  2RRE A;  4P1W A;  3PNT A;  3L2U A;  2XF6 A;  3FDY A;  2R7W A;  4EAT A;  3ZGK A;  1IRE B;  1Y56 A;  3CMM A;  3UNG C;  2QDY B;  2KPM A;  5FRN A;  2LOO A;  4ZDL A;  1MMD A;  3E1S A;  2K5C A;  2GOX B;  3BG6 A;  4XON A;  4E7L A;  3HZJ A;  2ZSI B;  4E7K A;  4E7I A;  3FHN A;  2RNG A;  2VB6 A;  4ZYA A;  2VIX A;  4U87 A;  1MW7 A;  3KYL A;  4HPQ A;  3ONQ A;  4OB0 B;  3OIP A;  4YEL A;  1TT0 A;  2UV1 A;  4B48 A;  3RTR A;  2WAE A;  2ZPI B;  4OWR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...