3QYBA

X-ray crystal structure of human tbc1d4 (as160) rabgap domain
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
297
structure length
297
Chain Sequence
HMKVKLDYEEVGACQKEVLITWDKKLLNCRAKIRCDMEDIHTLLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKELLKQLTAQQHAILVDLGRTFPTHPYFSVQLGPGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLHMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEISPSLYAAPWFLTLFASQFSLGFVARVFDIIFLQGTEVIFKVALSLLSSQETLIMECESFENIVEFLKNTLPDMNTSEMEKIITQVFEMDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of human TBC1D1 and TBC1D4 (AS160) RabGTPase-activating protein (RabGAP) domains reveal critical elements for GLUT4 translocation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
molecule keywords TBC1 domain family member 4
total genus 91
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2011-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 3qybA02
1.10.10.2750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3qybA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3qybA03
4P17A 3HZJA 4NC6A 3QWLA 4HLQA 3QYEA 5EJCA 4Z6YA 2QFZA 4HL4A 3QYBA 2QQ8A 2G77A 1FKMA
chains in the Genus database with same CATH superfamily
2WIHB 1ZG3A 5J6XA 2RQQA 3D5RC 3GO8A 2Z33A 4L0YB 2ZXHA 1Z5BA 2VL8A 3K4CA 2LC2A 2QEXI 2IN3A 2HR3A 2LLKA 4FWGA 1TP4A 3BR1A 1YTYA 1CF7B 4ROEA 4KN7X 2WFYB 2JZ0A 5CYIB 5E79C 4OVZB 2Y69H 5K7FA 2O7OA 4GHAA 1U2WA 3E5QA 4EM2A 2RNJA 2R7FA 1BBYA 3CP8A 1P7JA 2WTEA 4ZZLA 3CCRI 2QA4I 5C4XJ 1J9IA 3H92A 2OU2A 2XRLA 5LRSA 2WWYA 5D6FA 4I7HA 3FUTA 4ZDLA 2LVAA 3B9PA 1QNTA 2ZNYA 4ENJA 3W6VA 3PFIA 2CZ1B 5LEJA 4BGDA 3HDDA 2DXIA 1PRBA 5GKNA 3OR1C 4U87A 2JA6J 4YHHM 3LOCA 2EFOA 4D1QA 1D0ZA 2R4JA 1MDMB 3KS4A 5EXTA 4XQFA 4IQJA 3DTKA 1ENHA 4A3BJ 3HPHA 2HCBA 4NSRA 4OWRB 2HQRA 4II7A 3P9IA 1E2XA 3DFZA 1M1EB 1IUYA 4QNRA 2KZUA 1E32A 2P5VA 2C5OB 5FKKA 1AOYA 1O3RA 1H24B 4HQMA 2I40B 4KUMA 2DFIA 1WZ2A 3ABUA 3L27A 4GYGA 5CEIB 3L2RA 5DCMA 2ETHA 2HL7A 2ZC2A 5E1XA 3U1DA 3E6CC 4BXUA 4CZZA 6PAXA 5IYDJ 2BS2A 2XAJA 1ORYB 3KZYA 3J81K 2MH9A 2B9RA 2CRGA 1C9BA 3D5LA 4EQQA 5EXPA 3GXOA 2PLYA 1V34A 4K0KM 4YC3B 4L4UA 4DR7M 4LGYA 3CZ6A 3TW6A 2DWMA 4XNFA 4EM0B 3SZPA 1F5TA 1X37A 3IAS2 3TO6A 3G73A 1MW7A 4DYRA 3AOGA 2FSWA 5DV5A 3HOXJ 3H4JA 1IRXA 1XS9A 3CLOA 2C9OA 1J0RA 1BL0A 3KP4A 4EIWA 5L3GA 3OL3A 2FA5A 2M7AA 1TWGJ 5EG0A 5L2WB 3U61B 4IOAF 1E94E 1HDDC 2KEBA 1TTYA 3PSIA 3VYSB 3FIWA 4HLYA 3GLGE 2BOLA 3CJQB 3A4CA 2JZYA 4ZZDA 3J27B 3GQ3A 1VEKA 4QOZC 2CFOA 1H0MA 3K1MA 3BZCA 5E1ZB 4V19K 1W36D 2F5DA 1V4RA 4UV8A 2Y30A 4A6EA 4RAZA 3B74A 3S2WA 1QA6A 1ITYA 3F8BA 4NXMM 1XSXA 1Z7LA 2M4GA 1IY1A 2MSYA 1J5YA 2F5EA 1LEBA 4X65M 1IZ1A 1DO0A 4LJ9A 1L3LA 4UV9A 4NQWB 1IDYA 4BB9A 2ZCFB 1JKOC 3BR5A 1YJWI 5HLHA 3M1CA 3MKWB 3AJIB 4B09A 3JAMK 2JZ1A 1POGA 4BCGB 4R1HA 3QOEA 2CQKA 2DWNA 2XGDA 4D5CA 5LFAA 1FYLA 3HHWA 4M9SA 3DQVC 3ZQGA 4KLNA 3ZCBB 3FXMA 2VF7A 3I4NJ 1MBGA 3VPRA 4BNCA 2IW9B 1QPMA 5D5WB 3RCOA 1H8AC 1I3AA 1OI9B 3D8LA 2BVLA 5HBJB 2K3FA 3DDQB 1X3UA 5FRMA 2E5LM 2QSHX 1IBMM 2F5QA 4IHWA 4BE2A 2KA6B 1STZA 4Z2YA 4OIPF 1JXSA 2QDYB 3NDQA 1E0EA 1IXSB 1QHHD 2ISYA 4ROCA 1FP2A 2ZXIA 2VLAA 4ZH4F 3F6VA 1CQTA 4BBRM 1SMTA 3JW4A 5J1YA 4BL0B 3RE8A 1R7RA 5CVJA 4BQAA 4XOPA 5CPRB 1O3QA 1QHGA 1I3QJ 2O0YA 4QLCU 3FUUA 3F23A 3VKHA 3OYKA 1NJGA 3GRRA 4LK1F 5DYIA 2NAZA 1QO0D 2BJVA 4L9NA 3K6GA 3BG6A 1WIVA 1U9OA 4G4OA 2NYXA 1OKVB 1ZN2A 1HF0A 2L7FP 2G7UA 1FSEA 4OMYA 5IT9S 3D8BA 5LGUA 1DGBA 4XKCA 1JGSA 2XIGA 4NSOB 4HYEA 1MMGA 2RREA 3RYPA 4GC9A 2XF7A 3WTVC 3ABKH 4BXFA 2FOIC 5D5XB 4F3QA 4YG2F 2LNHC 4I02A 4S05A 1SANA 3G71I 3COAC 1A5JA 2LOOA 1P9QC 3EUKL 1ZREA 5ICPB 3L2AA 3Q9VA 3JRDA 2O03A 4DV6M 5JI2E 4BLCA 3OYMA 2DAMA 2B3TA 1WKMA 5F64A 1G3NC 1BR1A 2V9PA 3EETA 3CMYA 5D8LB 4ELLA 1GV5A 3I5UA 4Y33A 1ETXA 2Y2ZA 1RIOH 3GRYA 3K8ZA 4UN2B 4IF4A 3E6DA 4LB5A 1Y0NA 2AHJB 2ME0A 1FC3A 2WAFA 2JP7A 3DLAA 4BHBA 3EPZA 2LK2A 3ILKA 4LJ4A 2DFHA 2YX7A 4C2UA 2HDWA 2F2EA 2P7VB 2L4EA 4UVAA 3V8KA 1DPUA 3FYDA 4BXXJ 3KFUG 4LJAA 3GTQJ 2N8GA 3RGPA 3QOPA 1X4OA 3AV0A 3F6OA 5DUIA 3L26A 1A6QA 2R45A 3S3OA 1I6HJ 1UG0A 2IGKA 1A35A 3ZMZA 3OS1A 2E71A 3FWEA 3K10A 4MO7A 4CFNB 1KYIA 1KU3A 2ID3A 2LD5A 3HJ8A 2XSJC 3REOA 2LP0A 2H27A 2V6ZM 3G1OA 3BLQB 3V8LA 2BWBA 1VQ7I 4LF5M 3V4GA 1DGGA 1ZGAA 2JGZB 1JOWA 3SAUA 3QYFA 1R4MB 3V42A 2L7HA 1JR3A 2HGCA 5LGTA 1J5EM 2HDDA 1Y1WJ 1U5TB 3HGYA 4JOMA 5C3EJ 3K2AA 2DJIA 3V8JA 1EJ9A 1ETVA 2HOAA 2M8GX 1VINA 3CJRB 2W99A 1Y1VJ 1FX7A 1BJAA 4N4OB 2BWEA 1JHFA 2W7NA 3VWBA 2DQRA 1ZTRA 1T43A 4G6DA 1WGXA 2LH9A 1H25B 3CGWA 3E6BA 3GPPA 4LF8M 2E19A 3M8EA 3C58A 1RZ4A 1Q02A 3U6DA 3CF5F 5CVRA 3L2WA 2Z2SB 3H5RA 3J2PB 2EA0A 4GGGA 4ZGDB 4CCLA 2MROB 4HX7A 1YHQI 4IBGA 5IY5H 2KIMA 2X1EA 4LF9M 2LBFB 3CCEI 3CC4I 4IHSA 1TNSA 2LR8A 4XSXF 3S32A 1HW2A 1WRJA 2CCIB 2E1NA 1SG9A 1XGSA 2DVWB 3VDPA 1TBXA 3GTMJ 4V2GA 2K9LA 1HQCA 3KSJA 1YS7A 1ZHFA 3PO2J 1RNLA 3W67A 1RU3A 4LF6M 4OGRB 3FD9A 1X1BA 3K4JA 1R5LA 1XHBA 3BCBA 3VSKA 2UXNA 2OPTA 3WHKA 2P6SA 4F52A 1VDLA 3KP7A 4BCQB 4OAYA 3ZGKA 2IGMA 1J09A 4AIHA 1RESA 2CE7A 1YYVA 3KOWE 2UXDM 2L7KA 4AG6A 2CV0A 2FRHA 4NB5A 5GAGJ 2XAGA 2EBIA 1H26B 2DBBA 4EMSA 4L0ZB 2UZLB 2XF5A 1K78B 4RB0A 5FFXA 1NH3A 4QHTA 2P6TA 3HOYJ 3KSXA 3A1YA 4IOCF 2XDVA 1IN8A 1DP7P 1W5CC 2X1DA 4RF1A 4HLXA 4CICA 4GKJM 2AQEA 3ZCOA 2LY2A 3SYTA 1RUOA 1VNDA 2XF6A 4HX8A 2FX0A 2QKLB 1L2CA 2LW4A 2RN7A 3IH2A 4CSWA 3F8FA 3SDGA 1I6XA 5HNHA 3K2LA 2KKOA 2MLKA 2R7QA 3ISPA 4I98B 1LEAA 2F4VM 1QVTA 5ERIA 1H9TA 4BDZA 2R0QC 2WV1A 4WWCA 2PJRB 2X51A 2BZTA 1D8KA 2X6YA 3OS2A 2V22B 2TDXA 2VDBB 4B3RM 2F5PA 1IXCA 2M4KA 2FMLA 1JB0F 5L3FA 4IKFA 1T3TA 5FLXS 1HQYE 4KIGA 1P4AA 5TGTA 3S2DJ 4D7NA 2FBHA 3GRVA 3GP1A 2OCCH 3M9AA 1QBJA 5ACBA 3ELKA 2R4EA 2AXLA 4YFKF 3T1HM 4F1IA 3L1PA 5E3OA 4NC7A 2ADUA 3QQAA 3OIPA 3BG3A 1W7PB 4IHTA 2DPPB 1R6BX 2BYVE 1FBQA 2DO7A 3FM3A 3ECOA 1D8JA 4CCOA 2C9CA 5C4JJ 4LFAM 1S8NA 3CCMI 1ZMVA 1XX5A 3M4OJ 3U60B 1TH3A 5DUKA 4ESBA 3S1NJ 1UGPB 2C5RA 1T33A 1JI8A 2O8XA 1QDRA 2LWXA 4M71A 4ZYDA 4IRGA 2JJ7A 3FDYA 3DTIA 1GY3B 1V54H 3EUHC 1VDDA 3ABMH 4L16A 3FMQA 3NEUA 4TUWA 2JUGA 4M6XA 3I71A 5GAEJ 3QU3A 2GM4A 2ZJQF 3JR4A 3BR6A 1LQ1A 2ZNZA 2ZCWA 3ZQQA 1BR2A 1MU5A 4S12A 1JTXA 3SEZA 4QOSA 3OYEA 4M9ZA 2ECCA 2O3FA 1Z59A 1HLVA 2HQAA 2CUFA 3FRIA 2D1HA 2W85A 3H9JA 3NBXX 4BCJB 2ID6A 1S6LA 4KMUX 4AIKA 4RGXA 4IJFA 3K69A 2EKKA 4NOOB 1FYMA 4NNJA 1ETQA 2F2CA 2BY3A 4XKBA 3HG9A 3CCQI 3U6OA 1XGMA 4ZYEA 1XMOM 1MJ9A 3PSFA 5EEAA 3U60A 1OYWA 2ELJA 4EOJB 1XG1A 1TT5B 3HU1A 1R49A 3HZJA 1IG7A 4BCQD 2RGOA 2OZUA 2VJJA 3AG3H 4LG0B 3LWFA 2EIJH 2C6YA 4NRVA 3HHYA 4B1RA 4G6LB 5C1BA 1PP7U 4EGYA 3PVSA 1BC8C 4PDKA 2JPBA 2JMWA 2FJ1A 1ZMWA 3AL0B 3QZ9B 4F7JB 1PKDB 2ZSIB 2NXNB 4LJ7A 2IRFG 1U8BA 2RC4A 3LVWA 3KYCB 1JJ8C 3ERMA 1YO5C 3IUOA 4EC9B 2ECBA 3KOYE 2IBDA 3ZQJA 4CHTB 1E9SA 4DGWB 3HJSA 2R7GA 4LGMA 3OOUA 2MGWA 4BY7X 3O0GD 1K3XA 5A2QK 4M3FA 4AD9A 2M0MA 4BU2A 2CJJA 1SXJE 2FNPA 5D4SA 3QAHA 2WEVB 2ZM6M 1Q3CA 2UV1A 2JSPA 4YRVA 1Q39A 2LDUA 5F1JA 3GX4X 4UUSA 3QPTA 1G41A 4HOBA 1FBSA 2G7HA 3ESWB 3F3XA 1HKTA 2QBYA 2MBFA 2DAGA 1TGUA 3EUHA 2WSFF 4L5JA 2UXBM 2ISZA 1ZV1A 3KX2A 1BOAA 3OY9A 4HX4A 3M8FA 3ROUA 2GIZA 5HODA 3KFWX 1FNNA 3IECA 4ENMA 1H1SB 2BV6A 3HTUA 2VQHA 3GPUA 3HYIA 3W68A 2K9QA 4EOKB 4R3DA 3CJTB 1YSYA 2CHQA 2HWJA 5DD4A 1MBKA 3A45A 3F22A 1XXHA 3HU3A 4B44A 1HCRA 1SFOJ 3TQNA 4G6QA 2ACJA 2YX4A 4DIQA 4F55A 1VQNI 3DL1A 3I51A 1R5HA 1XXHE 4P17A 2CWEA 2ZZDB 4JI7M 1YLFA 4B8XA 1GVNA 1IF1A 5F0CA 5LMKB 3ZN0A 3GF2A 3ZXSA 4EOMB 1Y8GA 3TW7A 3TGNA 1TF0B 2LG4A 2DWZB 1S29A 3PIOF 4JI4M 4MGHA 2KIQA 1Y6IA 4ENNA 3V7RA 1PDNC 1ZRFA 4ABZA 2F5FA 3A01B 3ECHA 2I8DA 3JRAA 1HNWM 1EV7A 1MN3A 2KRUA 1CUKA 4IBKA 3UGJA 2DODA 3CDHA 4XK4A 2M1BA 3UJNA 1VEGA 4Y28F 2XASA 2EA2A 1OCCH 4ZGJB 5DYGA 3EOCB 3DLLF 1IY2A 4MTEA 4II3A 3LA7A 3GFMA 3ZP5A 2QCOA 1FZPB 3O2PE 5IDPB 2CG4A 3RPQA 3FXJA 2QZ4A 2AO9A 2VIXA 3BP8A 5C18A 2ZXJA 1K78A 5IP6A 2L2DA 3CCLI 1XSVA 4N0BA 3MK6A 4NC8A 4CFVB 2Y31A 1EF4A 2R93J 3D0SA 1F9NA 4UY8I 1QUTA 3O8HA 1D1CA 3SMSA 2HTSA 3BTLA 2P7CB 4QSHA 4N9IA 1L0OC 2CW8A 3DPTA 2DA7A 1N33M 4OB1B 4LRTA 2K27A 1OTRA 3CJNA 5KNLA 3CO6C 1ZRCA 4ZGEB 2M8EA 1AA7A 1JE8A 2PJPA 2K02A 2N35A 5BPDA 2MR9A 3MQ0A 1X1PA 4M6YA 3J80Z 2CO5A 1YIJI 3CUOA 4BJ5C 5J8CA 2XF3A 3PM1A 4UUTA 2HAKA 5L3DA 5HBEB 3RSNA 2CCHB 5JLWA 4EM1A 3TBIA 1E7PA 4OVZA 1SD6A 3F92A 5GADJ 3GZ6A 4B48A 3WU0A 4RKUF 2XSDC 2MGQA 4A3JJ 3K9OA 2V4JC 3U6SA 3B02A 2J5YA 3X25B 2CQNA 3M7GA 3T8TA 1ZYRF 2LSOA 4A0XA 2DXCB 1UHWA 2ZFUA 5FO5A 2CU7A 1TQIA 4GEWA 4RS8A 2BEOA 1ETKA 1ZK8A 1QPIA 2Y9ZA 3X28B 1UM8A 3BTJA 1C0WA 2IVMA 3KLOA 4C2TA 2WAQN 1IN7A 1GLNA 3NQOA 4GIPA 2CSOA 4F92B 2J7OA 2NS8A 3IKVA 2CGPA 2W2HA 1X3ZB 1TLHB 2EB7A 4V2FA 2XZUA 1MSEC 1WXQA 5F08A 1JTYA 1LVAA 3X26B 5IHYA 2VBWA 2KMGA 1OIYB 2Z7JA 4EOOB 3VK8A 5LBQA 1Z9CA 4EOPB 3HO8A 3RZDJ 4BYYA 1OYYA 1WGNA 1XPXA 4M0WA 4WP2A 1D0KA 3BBZA 3L00A 3F8MA 2Z3YA 2CHGA 4I6ZA 4XICA 1E9HB 2VI6A 3HBLA 4DUZM 3BJOA 3VODA 3L2UA 1Z21A 2B9SA 5I5ZB 4BCND 3I55I 2A6TA 2YNMD 5LGNA 2L7MP 2P4WA 1F36A 1D0LA 2K4JA 2LRDA 2QHOB 4AVZA 3H3VK 4CCJA 4K2EA 3JAMS 3WODF 4XLPF 1ZH5A 2B63J 2L09A 3F9KA 4L8RC 1MNEA 1TTEA 2Q2EB 1QAOA 4EEFG 2VT2A 3LSHA 3QWLA 1FIPA 2L9NA 2DMNA 1Z5CA 2L4MA 1N34M 1WHCA 5K7ZA 1TC3C 4CHUA 3L2VA 3GZ5A 4M74A 2VOPA 4BJ6C 5KPRA 3I4PA 2DAIA 2JY6B 2KZSA 4B3XA 2DK5A 2DMUA 2DKLA 2K40A 2IA2A 4Y15A 3HOSA 3F21A 2NS0A 1AIPC 3BLYA 2KPMA 5AONA 1H9GA 1EA3A 2W24A 1JSUB 4DV7M 3K7AJ 3RGFB 1SAXA 1QZMA 2YUSA 3MJ5A 4C3JJ 1FOYA 1R1TA 2EPFA 2KZVA 4BE0A 2L0KA 3WTSC 4C3IJ 4OU7A 2OF7A 1W5TA 4S04A 4ZC3A 5JHFA 2X49A 3GTKJ 1S7OA 1FKMA 3BY6A 3EJ1B 2COMA 4J01A 3DXJF 4CCKA 5DM6F 1H6UA 1K4TA 3HRSA 2E2HJ 4BCMB 2XPWA 2EILH 3GLIE 3LQRA 4CYDA 3HKZA 1ACIA 2ZPIB 4HV5A 1JR3E 2VJ4A 4CH7A 3MCZA 2NNNA 4QTRA 3MKYB 2LVNC 1B8IA 5FLVA 4DR5M 2V1NA 1R2ZA 1X2NA 4JQFA 2NQ8C 2QZ8A 3RKYA 1FYKA 1VQLI 2QDJA 5KPTA 5JVGF 2XAHA 2E2JJ 2W9FA 1G71A 2P5KA 3CDLA 3ZRGA 4Y4RA 5HNBB 3FBIB 2M2EA 3I4VA 1PP8F 3I54A 3BT9A 5FTKA 1L8QA 3GFLA 1MD0A 4WXDA 4I0BA 2UXXA 3KOZE 5IWAM 1KYWA 3WTWC 3W6KB 1QAQA 2EFNA 4KA4A 2Z3XA 4YY3M 1FWZA 2AHMA 1Y8QB 2M5ZA 2GOXB 2J5OA 1PJQA 5LQFB 2X4HA 1F4IA 5AIQA 4AWXB 5M5XJ 4HG2A 3KZIC 5B5EC 3BTCA 1P2FA 3FTCA 2G9WA 3HM5A 2H09A 3PJRA 1FVVB 2Q1ZB 3CMEI 4B3TM 2F5CA 2QGSA 2ZBKA 3MY1B 1JT6A 4HAMA 4Y7NJ 1YS6A 4Y72B 2FQ3A 3BR2A 1RKTA 2Y0SA 1IDZA 3LAPA 2X1CA 4A3VB 3K4NA 3P9KA 1OKRA 2HWVA 3VDXA 3NBIA 5ITRA 4P16A 5HVQC 1VQ5I 3IV5A 4CGZA 3IAM2 1NNUC 4BBRJ 1VTNC 3GLIA 1C7YA 3S1QJ 3HJEA 3HC7A 1LE8A 2KDOA 5E17F 2DNAA 1HXDA 4BAYA 2YSRA 5L3CA 3SAWA 3V7SA 1EH6A 1WJ7A 2R7ZJ 5KAIC 1JJ6C 2UUEB 4M3BA 1BN5A 5ILUA 1APLC 1XN7A 4H0EA 1OKWB 1JUMA 1KQ0A 4A5NA 2GA1A 3I59A 1ZGWA 2OZ6A 1OCRH 1OAOC 5CJ9A 5BNJB 4DR2M 4JX6A 2LHCA 1X2MA 2Y20A 2X4AA 3LSMA 1BIBA 2JA7J 3Q0UA 3BHTB 4DR4M 1VQPI 1U8RA 4WX9A 4Y52J 3ASOH 5IT9K 3PL8A 4J19A 4BCIB 4KICA 1ZELA 2Z4SA 4EJTA 2MH8A 2VKDA 2VONA 2NNYA 4G7HF 2R4GA 4LGWA 5BPVA 5ICCA 2ZMEB 4BY7J 5DFLA 3KP5A 1OL1B 4EJWA 2DA4A 3S17J 1UB9A 4IRHA 4OAZA 1Q1VA 1OKSA 1MMAA 2QNJA 1AD6A 4F93B 3FK6A 2GXAA 1UAAA 2NVQJ 2G3QA 2ZJRF 2M5WA 4LD5A 2UU9M 4LLLA 4DZPA 5A2QZ 3HEFA 3S1MJ 1DGWY 3TQSA 1DU0A 1DO2A 1ZAOA 1DU6A 2NOJB 2BKZB 4YIRX 2ZANA 2A07F 2WSEF 3JRHA 4I01A 2LKPA 5ED4A 1XC5A 4WK8F 1Y39A 4CIZA 3VB2A 1D0MA 2XHKA 2X1NB 2DFFA 3S16J 4XN0A 3W0FA 3ASNH 4CZCA 2W00A 4XN3A 5LRRA 1N32M 2ZTCA 3LSPA 2G77A 2HOTA 2OTJI 1I39A 1MX0A 4IX7A 4A69C 1HNZM 3EIEA 1PUEE 2PK9B 4GO1A 3ABTA 3RPUA 2IAIA 4LLNA 1MJGM 1GXQA 2W48A 1YJ9I 3WHLA 1QZYA 4BY1X 5KAFC 3S14J 5EEHA 2DYRH 2R7XA 1RI7A 1GV2A 3BG7A 2IGOA 1U5TC 3E21A 2PHGA 3ZMTA 1XO2A 3LA3A 3P9CA 1W7PA 5IOYA 1Z67A 1FBUA 5TISC 3HWSA 3CF2A 4UXNA 1HSJA 4GMQA 3BJAA 4G7ZF 4RNAA 4QPQA 4I09A 3KVWA 1VQKI 2Q2EA 3HUGA 3KP3A 3GQ4A 3QHRB 5D4RA 4CFWB 1H1RB 3POMA 1ULYA 2CH0A 3PUBA 1JKWA 4DBGB 4IPAA 3A03A 3PIPF 1RPWA 3LMMA 4TTHA 2IA0A 3EQLF 4E7JA 2KJBA 5HOOA 4KT0F 3H9GA 4Q47A 1K7AA 4R7GA 3C2HA 3TNHB 5LEKA 2LXEA 2EFQA 4PSWA 4D9JA 4DNCA 5DDGA 2DPDA 2OBPA 4YOSA 1SVOA 2UUAM 1OISA 5BS6A 4GDFA 2FOKA 4A3KJ 4CXFA 3WHBA 3CUQA 3VYTB 2VE9A 1AISB 1I1SA 2LKXA 2Y0MA 2XFTA 3TDUC 1SEUA 1A31A 1UGQB 5DCMB 3TDZC 2DHYA 1BM9A 2EV6A 1HDPA 3ZQFA 4MTDA 3IHPA 1J7KA 3TP0A 4D81A 1OQYA 1GT0C 3M03A 2DT5A 4BDYA 4GC5A 4NXNM 3IRQA 3J81S 3SBJA 1XMXA 4DR3M 3PNYA 4DV5M 3U6QA 4MIMA 4ESJA 1K3WA 1XDUA 2JWSA 3IH3A 4XBOA 2GXGA 5FSWA 2LTPA 3DU6A 4II5B 1V5FA 1SMYF 2CYYA 1YW8A 4HDVA 5KO3A 1NO1A 4HZFA 2AHQA 2FFJA 3ZMDA 4YOZA 3BR3A 4G4RA 3HX3A 2IJLA 3F8NA 3OWTA 3AOEA 1O3TA 5HVYB 5ITXA 3H35A 4AQYM 1V55H 3ZN1A 2UUZA 4IHXA 1UELB 1I1GA 3M0EA 1Z7UA 4OMZA 3HGIA 3JR9A 1YFHA 1S72I 1U3EM 2YU3A 2BGCA 2K6BA 5HNFA 4REZA 3WVDB 5CVUA 5F0HA 4FE4A 2LTUA 2H8WA 4A0ZA 5FKOA 3DP7A 1UNGD 1HNXM 1MBHA 1R4NB 2X8AA 1BI1A 4NL4H 2LYCA 2VKEA 5FGKB 1K79A 4MGZE 1FY7A 2GZWA 2LBCA 4JI6M 1WJDA 1TZLA 2MC4A 2OUMA 4DBQA 1PUFA 5BOXA 1GH6B 3FYCA 1TL8A 1FJLA 4W5WA 1R36A 2ELKA 2PX9A 5IP9J 1MMDA 5EXSA 5GPAA 1ETWA 1S7AA 1MGTA 2B0LA 3GLXA 5ILSA 2DTZA 3S15J 3FBNB 5K5OA 2L6OA 3N05A 1PJJA 3TKYA 1BI0A 1GUXB 2XLJA 2XGCA 1SVLA 2L9RA 4NUBA 4CUGA 3E5UA 1DGFA 2JXNA 3LFKA 2JUJA 3FHZA 3WTZA 1SFUA 2VKVA 4BBAA 3FK7A 1LNWA 4XRSG 2KNVA 3GEZA 1MJAA 5H20A 2MFZA 7CATA 1SFEA 2KDZA 2LVPC 4WURA 1QVRA 1NK3P 1P92A 2HQ5A 3E97A 4HV6A 4LIVA 2ME6A 1FOKA 3QHWB 3BQYA 3IG8A 2VJIA 5FTJA 1SD4A 3C1DA 3DCFA 3DFGA 2IW8B 1D3UB 4FE7A 3KXEC 3B7ZA 4ANRA 1OR7C 4ZJZA 3SEQA 1HBXG 1CGPA 4F70B 3LQQA 4DV0M 1UMQA 3S93A 3MKZA 3SASA 4JI2M 2BVMA 5ITYA 1BW6A 4AW4A 2OOBA 1L2DA 3K2ZA 1GABA 1XD7A 2DOFA 2G0EA 4IBDA 2Z16A 5HLGA 3OYLA 3BHVB 4O6JA 4F7SB 2LFBA 3GCMA 4AIJA 1G59A 1NHGC 3JCUC 3VYRB 2FOWA 2D7GA 3RKQA 2GQFA 4A12A 4B08A 1YX5A 3O6BB 3JRIA 4ESFA 2A69F 2X6XA 2YQZA 3HKZN 2ERCA 3A8OB 1LDKB 4G8XA 2QQ8A 4U0YA 3HY5A 1V5GA 4XK8F 1XDSA 1LFPA 2H1LA 2LNBA 2CMPA 1MBEA 3BPXA 3R0JA 4KIFA 2KQRA 5DM7F 4RB2C 3M07A 1TH4A 2ZO4A 2D2WA 2OV7A 5JR3A 3E0JB 2ICWG 3G3ZA 4UB8C 3BLHB 2V1UA 3Q9SA 3KETA 4HSTA 3EIHA 1SVMA 3GLHB 1XMAA 1VEJA 1R6RA 2CQ7A 1JSTB 1N4MA 4HSRA 2KHHA 3A98B 1L1TA 2NRAC 1RR7A 2I10A 4DOZA 1OPCA 1G3TA 4ITQA 2HNHA 3FXRA 3H3UA 1U6GA 4LIUA 5F1RA 2BBYA 1ZQ3P 5FRNA 4DZJA 3D1NI 2JRTA 2ZFWA 2EZKA 4MH0E 2CRUA 2V6EA 3K4MA 1LFUP 2JVHA 4B3MM 2L7ZA 3PQJA 4E7IA 2WSCF 4DBRA 4LCBA 3CC7I 4BCPB 2M87A 1PJIA 1AUAA 3KDSE 1AWCA 1G2HA 4U0WA 3CMAI 2JNHA 3LFUA 1SXJD 3TN8B 1LVKA 2IP2A 2HOEA 2M45A 4DYCA 3T8RA 2QKMB 2W84A 3LW5F 2JRMA 4D5FA 4X0GA 3UKGA 3HHTB 4FASD 3GW2A 1EE8A 1V5EA 3K4KA 2VQCA 3BROA 3MFKA 4EJVA 3JRFA 4MB7A 1OFIA 2QENA 4GXOA 4XLAA 2L7IA 3BR0A 1F43A 5B3SH 1RC9A 3GPXA 3W6JB 2LVSA 3RKWA 2DXBB 4EORB 1VFCA 2RKOA 1N78A 1MMNA 2KLOA 1MMSA 3FMSA 2C98A 4I76A 4U7BA 5J8FA 4FT8A 4PT5A 3GRUA 2R18A 1Y56A 3E4RA 3PO3J 3DOGB 1TT0A 1N75A 4PCQA 3KOXE 4XLCA 2FNAA 2CQQA 1S3JA 1G3SA 2R7SA 2KIFA 5HS8A 2ELHA 2K9NA 2MW8A 2Y21A 5F27A 4F2LA 3LA2A 3AOEC 3FISA 2MJ5B 3Q8GA 3Q0WA 4M73A 1P5EB 5FB2A 3M1EA 4NSTB 4BXXX 3SHGB 3QRFF 2KXEA 3KLNA 2WIPB 4DV2M 2A3SA 2Z5UA 2V6CA 3Q3SA 2HKJA 4P5OA 3GLHA 3KW6A 4KDPA 3H9QA 2AXTC 5B1BH 3OSGA 2ESHA 4FETA 1GUUA 3GLGB 4JYAM 1SFKA 2Y0SN 2HQNA 1BVSA 3FHNA 4IJAA 4OU0A 4P96A 3ONQA 3RDIA 2RVCA 1BOBA 5LHHA 3OR2C 4LF7M 2RGVA 4ANJA 2OC6A 4C9YA 3F5XB 4XGIA 4XBFA 2M60A 1MH4A 4OIQF 1OCPA 1HKSA 5EF6A 3W2VA 4UB6C 3HIFA 1FINB 1REPC 1QVUA 2FQ4A 2OJED 1KFVA 4G12A 3ZQHA 1B9NA 1KZHA 3RPUD 1NV9A 4JI1M 2PMHA 4AC0A 5J40A 4A3DJ 5B1AH 4BQQA 1DGHB 2C4GB 4C2MJ 2R5YB 2LF7A 2DAOA 2QCUA 5J3LA 5FD6A 2DYSH 2D1VA 2HVRA 1WJFA 3S1RJ 3TWLA 4JXJA 4UHTA 1DV0A 4MGYE 4BEHA 3P5JA 3VOEA 3I04M 2R7DA 2HU9A 3V7CA 3R8FA 5J47A 1O4XA 4HDUA 4A93J 2W25A 1SC7A 1UGRB 5EGOB 1VF9A 4LFUA 2R44A 2IS6A 1WJ5A 2LVOC 4XLNF 2Y75A 1WHUA 4W1UA 4FTHA 4EJUA 3E6MA 3GFJA 2L01A 3GFIA 4XSZF 4CYCB 3JAMZ 1UHSA 4LG0A 4X62M 1FT9A 3T0YA 1XCBA 3QP5A 1F1ZA 5GTHC 1SXJA 1LJ9A 3IRRA 2KR6A 1IRFA 4AI6A 5C44J 3OYJA 3HTSB 5FKMA 5D8KB 5HLTA 3IG5A 4KHPM 2EZIA 2VB6A 3BTIA 2R7VA 4PCZA 5BNGA 3NRVA 3HOTA 2ZMEA 2Y0TA 2MLGA 2DPUA 4F6WB 3CMMA 5H2FC 1PUFB 3KP6A 1MNDA 1RRJA 3U6LA 5KHDA 3B73A 4FCWA 4E7HA 3FUXA 1UZCA 2LKSA 3H0GJ 1OR7A 1C1KA 2QF7A 3CESA 2EA4A 1WH7A 4A3GJ 3PQKA 5GTIC 2DZLA 2BY2A 3HOVJ 3GZNB 3MHVC 3DBLB 4M0DA 3SMPA 4EATA 1I4WA 1QDTA 3B6CA 1XNRM 2CJMB 3WGHA 5E18F 3KP0E 2E60A 2VKHA 1UFZA 1HJPA 3U6CA 1R1UA 3EUAA 1IN4A 2OQ4A 2C96A 3AL0C 3KEQA 5FD5A 2CHVA 4L9VA 3L25A 2LBFA 3O3KA 3J7AS 1QZZA 2KJCA 1NHWC 2O5RA 2VF8A 1TWAJ 3H0DA 1F4KA 2R46A 2XKPA 2ZKZA 1R00A 1H28B 2PMIB 4BCHB 3KEYA 1LE8B 2HHHM 5LMNM 2PQ8A 3DEWA 3JRCA 5ITQA 1O7FA 2HKOA 4RA2A 4I4LA 3IP4B 5E3LA 2GA2A 2CV1A 4A2UA 4A3EJ 2QYOA 3CCVI 1WH5A 1B72B 1U9NA 5DD8A 2XGEA 3CP2A 3J81Z 2UZDB 4RM2A 1OCTC 4UNOA 4BCOB 1G3IA 1MJBA 4EJOA 2VOOA 2RRUA 1O9KA 2HFHA 2DHRA 3A01A 1YG2A 1IAWA 5IPAA 1IV8A 1T08B 1YI2I 3ZPLA 2BJWA 4E7SA 2E1MC 3DU5A 1OCZH 1WJAA 3TOBA 3FUWA 2PEXA 4ZYGA 1HOMA 3HXLA 3JRGA 2UUBM 4L5IA 4P55A 1S3SA 4E7LA 2VJ5A 1WVRA 1BIAA 2NVYJ 3QZ5B 5H37D 5F3WA 1ZR2A 1V92A 3LSGA 3K9TA 4IBJA 2NOGA 3CCYA 4F6UB 4FVMA 5FROA 2KDLA 3L28A 2CV2A 2OAZA 3CCSI 3R61A 3L09A 2JK3A 3S2HJ 2K9DA 4TV7A 1R2YA 4B4CA 4I0AA 2DD4B 4RLFA 3DJBA 1OIUB 4IBBA 1IV6A 2DZOB 4HEOA 2EIMH 4RB3C 4RAGA 2W9ZA 3Q8XA 1E9RA 2OA4A 4OX9M 4AUXA 3ZMUA 4CFUD 4XKVA 2HZTA 2CUZA 2LREA 3M8JA 1QLBA 1USTA 2DTRA 3PXGA 3BJ6A 4BQOA 1H27B 2IW5A 3GMEA 2DMPA 4IQ4A 1OIZA 5J1UA 3W3CA 4LLGF 5E1WA 2HDCA 5FJ8J 1N77A 1GHCA 3GLGA 2ZAOA 2XGNA 1LV7A 3KEOA 5LD2C 1QUSA 3BOQA 2EUCA 3DPLC 2F48A 2HXOA 1WFXA 3GPYA 2H1RA 1ZARA 4LITA 1UG2A 2IXSA 2DLLA 3QAUA 4IO9F 3MZ8A 3DKXA 3FKIJ 1D1BA 2JN6A 3R60A 1K6YA 3SZTA 2ZMEC 3OMYA 2IGNA 4U7DA 3AG2H 2W82A 1TQPA 1T38A 1FTZA 2EUFA 4U88A 2BHZA 3A2KA 4E70A 1H89C 1KA8A 1YJNI 5IREB 4RDUA 4AIDA 5DQWA 5E20A 1CF7A 1IGNA 4Q4ZF 5FLXZ 3CF0A 5ICFA 1HA8A 4XLFA 4M72A 1VOLA 2DCEA 1USSA 3RFWA 2C5VB 3H4CA 2I7PA 2EJRA 1MNMC 4EONB 4L9JA 1MH3A 4N4NB 4XORA 5CYVA 4AVPA 3M3YJ 2APLA 2BPMB 3VFDA 2DU9A 3RQ4A 2XC7A 3SJMA 1NG7A 1GVJA 2LHGA 3HHHA 3G4SI 1IRGA 3MY5B 2D5VA 1EKEA 4CYCA 1ZRDA 3I56I 1KU7A 4A6DA 3ZMSA 2MH2A 1LUJB 1VZ0A 4FQGA 1XB4A 2M30A 2DA2A 3ML6A 2DDAA 2X0LA 1XSDA 4JI3M 3UMMA 2RAEA 4ENKA 1T95A 1E3OC 3PO3S 1IRZA 4PGGA 4BBSJ 5K5QA 4QHSA 2L5QA 2K3PA 3CLQA 5D5VB 4WW0A 3SDBA 3U6MA 1FP1D 4LOCA 4RAFA 4BE1A 3DTEA 2K9MA 3U2RA 2R5YA 2E5NA 3C9PA 1XXHB 5ITXE 1W7PD 2NVTJ 1X19A 3R0AA 3QODA 3ULQB 3MZYA 2JUCA 5M3MJ 2R5ZA 3H3ZA 2FBKA 3BXWA 5IOZA 4L5EA 1TD6A 2BS4A 2DT6A 1JHHA 5EZHA 3S8PA 3TO9A 1TFBA 4IBCA 5FTNA 3HUGB 1JR3D 2PMZA 2Y48A 4LMYA 3T5XA 4QIWN 2MABA 2NS7A 4DW6A 1QAMA 2QFZA 1I94M 3TWKA 3T15A 4GITA 1Q1HA 2BXZA 2JVGA 4MQVA 4BH9A 2VQEM 9ANTA 1H1PB 1R5ID 5E26A 2HTJA 3WHCA 3WE3A 2XPUA 3H5NA 1T98A 2EFWA 1VQ9I 1VQ6I 2XFSA 3BWGA 3GLHE 3AFHA 3NAUA 4AKGA 3Q0VA 3RQIA 3JREA 3IL2A 4RBOA 4N9HA 4RF0A 1W98B 3VYUB 2WB1N 3SFIA 4CFUB 3NWSA 3A42A 1QQIA 4A3CJ 2KRCA 2MA3A 2PMUA 1P4WA 3HHXA 2STTA 4B47A 2OQRA 4CJ6A 5F6FA 3GWZA 3JR5A 5EEGA 5F04A 2YFQA 1LKXA 3TE6A 3VKGA 4GHLA 2HS5A 4RGSA 3TEDA 4LFBM 3ERED 1ZGJA 3KP2A 2WMAB 3X20B 4L18B 2M34A 1I50J 3ZQ7A 2EK5A 1YRNB 2C5XB 1XTAA 1TH2A 2FXAA 1X1DA 4RLQA 4HNVA 2DA6A 1BC7C 3QPSA 2CP8A 2F5NA 4HNUA 4XRFA 2KNZA 4KO8A 1T6SA 1UFMA 2VXDA 4HPQA 2RGHA 3VSLA 1GXPA 3JRBA 4B3SM 3LCVB 5EYRA 1W1WE 4IMYB 3T38A 3U21A 1E17A 1ENWA 1R22A 1T0FA 4NDLA 2P5TA 2QSGX 3G33B 1SFXA 2QUFA 3DV8A 3HSFA 2HPMA 1G4DA 1Z3XA 2ZSHB 2QP9X 3DOAA 3E9SA 1RKWA 3IH4A 1TDZA 2V9KA 2WAEA 3K1NA 4KIBA 2H1KA 4BEHB 1QGPA 2CWBA 2QGUA 4HA8A 3UR3C 1JT0A 5L3EA 5LLQA 1PJSA 2O25A 4FCVA 3RGSA 2VPRA 2PI0A 4CXAB 3K7AM 2E5ZA 5IYBJ 3FTFA 5FTMA 3H36A 4M3GA 1R23A 2W4SA 3IKTA 3I53A 2IS2A 1BA5A 2BNKA 1QQWA 5TJJA 2IS4A 5LHIA 3CTAA 2UZBB 2CZ0B 1X1AA 3QYEA 3OYCA 4OB0B 2A6EF 4MFDA 4XRMA 2PMZN 4F7LB 1WI3A 1PVEA 1G6NA 1MBFA 3WG9A 1ORKA 3R6SA 3DEEA 1ETOA 2BE5F 4XLEA 2HEOA 5K1YA 3VLFB 1IW7F 1XMKA 2UZKA 2JA8J 3A8GB 1G8PA 3QYGB 3DBHB 3FX3A 4H4KC 4A5MA 3UZUA 1EH8A 1P7IA 4I2OA 1IREB 4D0PA 2DWLA 2PBIA 2KRKA 5EJCA 1L2BA 1B59A 1J2XA 3PNTA 1X3WB 2V26A 4JYKA 3HOZJ 3B7QA 4PK4A 4GYIA 3C18A 2ZB9A 3GUDA 3ZOBA 4KYWA 1ERDA 2BY0A 3E7LA 4PFPA 4PJNA 4BACA 3KP1E 1UCRA 3WTYC 1U0JA 1UHMA 1PJTA 1G8XA 2ZBKB 1XNQM 4X66M 4CCMA 1P6RA 2H5XA 3L2QA 4GRIA 3TNIB 5E3NA 2GBYA 3OL4A 4ELJA 1OFCX 4PJ0C 1VYWB 4X64M 4EVIA 3OYAA 1K4SA 1SXJC 2WBMA 2WC2A 1KQ9A 1GDTA 3HHGA 4LG3A 3GLLA 2FEZA 2DT7B 3I01M 4HL4A 4Q48A 1L1ZA 1AKHB 4M3EA 2XH9A 3E46A 3L2CA 4O5VA 2UZEB 1HW1A 2TCTA 1AHDP 2GLOA 4BQNA 3ZQCA 5GPCA 1SAUA 1IO2A 1X1CA 2OTLI 2EIKH 2M0CA 2LY9A 3K0LA 2L02A 2HPIA 4GH9A 2R0IA 3ZR8X 2LMDA 3DF8A 2IS1A 1GUXA 3TNWB 4LZZA 4AKIA 4PDIA 4HW0A 4XKWA 1H88C 1NV8A 1OMIA 2GOMA 4BHCA 2KFDA 1P4XA 4E7ZA 1N25A 1VQ4I 4RGUA 3EYIA 4BJTA 4GFBA 2J5PA 1R5GA 1VQ8I 5DNYA 1W4MA 2CW7A 1NG6A 3KYDB 3O8GA 2DMTA 4A3FJ 1B4AA 4FISA 2WY8Q 3HU2A 4RMNA 1YITI 1WQ2A 2M3AA 4PSXA 2KRFA 2ZJ2A 1A6IA 4MEYF 4CDGA 2I53A 4JX4A 2EINH 1JGGA 1HR0M 2J7NA 1DDNA 4LZJA 4BBSM 3HRTA 4HNTA 3T1BA 2EH3A 1WJCA 4I3ZB 1FSHA 4F7ZA 3BDDA 1BU2A 5H6QA 3KS8A 2EFPA 3KYLA 3LVVA 1K82A 1PYVA 1Y8RB 3FUVA 3BHUB 3X24B 2HVQA 5EXXA 2DD5B 4A3LJ 2R7OA 2HZDA 5GAHJ 4B7GA 4OIOF 1Z91A 4FWHA 2JSCA 2FU4A 3QXEB 4L9TA 3VEPA 4PD2A 4IXAA 3IC7A 3OYNA 4Z6YA 2BY1A 2G5GX 1D0XA 1O3SA 4G4QA 3DBRB 2F5SA 5DS9A 3CUQB 2IT0A 2R62A 2A05A 1Z5AA 3CCJI 1KGSA 3THGA 2VUMJ 1MIJA 1YLAA 2VC0A 3K1JA 4IVNA 3KHIA 2CW0F 4KT5C 4BCNB 5HS9A 3K70C 2WB1A 4LJ8A 2KISA 2QQAA 5ITUA 2COBA 3TWMA 4KITB 3RIRA 3RI4A 2PJRA 3L9FA 2L3DA 3K92A 2DI3A 2E35A 3U9GA 4ASNA 2XEPA 5BPIA 2DDBA 2V79A 3DA1A 3ZMVA 4YFNF 3QPHA 1NJFA 2GXBA 2XAQA 5LMUM 5BMZA 4C3HJ 4EV0A 1G4AE 1QZEA 1V3FA 2DAKA 2LY1A 2OQGA 5DTDA 3RZOJ 3L7WA 2DMQA 2F5VA 3BPVA 4LG2A 3SYLA 2STWA 2ZPHB 4ZYAA 4BHPA 3WVEB 2CFXA 2IPQX 1K83J 1S7EA 1WSUA 5FGMA 3FM5A 2QSFX 4Y13A 1ODDA 3BQZA 1U78A 4LRSA 2KRHA 2NVUB 2H8RA 4KNYA 4I8OA 2UXCM 4G7OF 1W36C 1S5LC 1A04A 2L4AA 3KIOA 5M3FJ 1W5SA 2W1OA 3DTOA 4QWQA 3K70D 4WXHA 3MEXA 4I81A 1BR4A 1ON1A 4LF4M 1TWFJ 1X58A 1LB2A 4OB3B 4CFMB 1IXSA 1BI3A 4OR5B 2B7EA 4PFOA 4MEXF 3HSRA 2OPFA 4XLHA 2DJNA 1PGYA 3AKZA 3BG5A 1J59A 4KRDB 5CQEA 2YU9J 4EOIB 3BZKA 2Y9YA 3E3VA 4KFCA 2JY7A 4I99C 1I5ZA 1GVDA 4FW9A 1G3WA 4R79A 1BI2A 3OYBA 1IY0A 5ITTA 3GLIB 3C2BA 1KU9A 2M9HA 4BUPA 2X6OA 1Z0XA 3MWMA 2L54A 3FXOA 1KXUA 3UNGC 5GP9A 2HYJA 1R7JA 3B57A 2ZXWH 4IJEA 4LK0F 4NBQA 2EWNA 3EYYA 2VXZA 2XB0X 1V29B 3CQZJ 2WJ9A 2WMBB 4II2A 2RKHA 4G94A 1S9HA 4IBEA 4HEA2 1DUXC 1B8IB 3DZDA 5EP4A 1UGSB 3LSTA 5HDNA 2K0BX 1XWIA 3OTOM 3C7JA 3D5SC 1VQ1A 2UUCM 4JI8M 1FMVA 5B66C 3S3NA 5F0FA 1EH7A 3KZZA 2KP6A 3K1PA 5FKNA 4FCYA 4PJLA 2X85A 4YFXF 5JFRA 1D3YA 5EP1A 3ZH9B 1XCVA 1AU7A 3WGGA 4B43A 3OYGA 4RAYA 3TO7A 1TW2A 2F5OA 2R7WA 4ON0A 1ZQ9A 4LFCM 4QNMA 2WY7Q 3G1LA 4LB6B 3OYHA 3GTPJ 2XZFA 3E5XA 2KHMA 1TDHA 3U61A 3K4LA 3SXYA 3ZQIA 3T6PA 3CF6E 3U5ZB 2Q8KA 3R9XB 1MKMA 2OD5A 5IYCJ 3FF5A 4A3IJ 4Q5SF 4FD2A 4UVBA 3HSEA 3SZGA 2XROA 4AG5A 3P7NA 2K5CA 1BJZA 4AYBA 3SAVA 1WJBA 5D5UB 4D82A 5FKLA 5KQDA 1TWHJ 3LCUA 1ZMUA 4O3MA 1TNTA 4S0HB 2JWTA 3HOWJ 1IC8A 2EO2A 4JN6A 4A3MJ 2Z1DA 1LFBA 2R65A 2FE8A 4FM4B 4F7NB 2H94A 3BOSA 2ZPFB 4XR6A 3JTGA 1IJWC 2G8LA 4IBFA 4OOIA 4DJAA 4Q7JA 1E3HA 2VIIA 3QP6A 3B89A 2IA1A 3DWLE 4NQWA 2XSZA 3EDPA 4AU7A 1H1QB 2VODA 1GJSA 2X48A 3U5ZA 3WG7H 1XC8A 4MNUA 5JI6A 4MFEA 4L78A 2W96A 2F6CA 4RB1A 1ZAEA 4PJMA 2D0QB 1JUSA 5KQ8A 2P5LC 2RV8A 2JQ7A 2D7HA 1Z3YA 1DP3A 3A0HC 1UJ8A 3I3LA 1IBKM 1Z6RA 4C30A 1VQMI 1D1AA 2ZPEB 1GL7A 5HDGA 4D7MA 2R7TA 3E1SA 2LVQD 2CUEA 2WPAB 3GTOJ 1VG5A 1ZLKA 4JP0A 5ILVA 3MZHA 1RR8C 4PDGA 2Z99A 2KMUA 1T2KA 1A36A 2VPLA 2AS5F 1Z05A 2DZNB 1D5YA 4DV1M 3J7YJ 4ZDOA 2FMYA 3F72A 4XOTA 4KT6A 1T39A 1ON2A 3L29A 4CA0A 3DPUA 1Q3BA 1PJRA 4PGHA 2BW3B 3G6EI 4EGZA 4KODA 2JY8A 2O61A 2R5ZB 4EOLB 2PK2A 3WGIA 2DENA 3W0LB 3H1CA 4CGYB 2D45A 4EOSB 1LDJA 3LQ5B 1YQAA 2CUJA 4AYBN 8CATA 4NRWA 1NY6A 4E4HA 3J80K 2K85A 1OGUB 4CCNA 3GBGA 2PN6A 4ZYHA 4B7HA 3A8MB 2EV0A 4LJ5A 5EZGA 2RQPA 5FTLA 1Z1DA 1MSFC 3MMPA 5CVVA 4PUSA 4FX3B 4QPOA 2YS9A 3AAFA 3EIDB 3TOAA 1G3YA 2A5WA 5KK1A 3FTEA 2BHYA 1SD7A 2A68F 1EFUB 1QANA 3F8CA 4IL6C 2A61A 4P9UA 3LSRA 3VFZA 3G1MA 1SD5A 1A5TA 5JHUA 5L3BA 3LNQA 1B9MA 3SQNA 3RJPA 4IRIA 2RNGA 4G6ZA 3I59B 4JI0M 2ZJPF 4JI5M 2A6HF 3I58A 1RUNA 5IT9Z 3I9V2 3SYKA 2DA1A 2P81A 2V1XA 3CCUI 1XGNA 2VN2A 1FLIA 5D6EA 5IZ7D 1ONVA 2WADA 2Z9OA 4D80A 3B7NA 4MHGA 4UVCA 1VQOI 2D7EA 4JBAA 2JY5A 2WA0A 4YIFA 5HBHB 4DV3M 2VBYA 2OO9A 2WXVB 3SARA 4BCFB 1HC8A 4NHJA 1T56A 2GAUA 1OJLA 1X4PA 4L15A 2E1CA 1BW5A 2O6GE 3ZQLA 4LY6A 3HPGA 2PJQA 1OLTA 4X1EA 4UUVA 1IN5A 2DN0A 4XRSA 3X2QH 4Y3OA 2XV4S 2GIVA 4GKKM 2MD0A 2HYGD 2OCEA 2VBXA 3I0TA 4G6TB 2VT3A 3TMOA 1IFYA 2ZTDA 3VK7A 1YOVB 5EGOA 3BG9A 1K6OA 5DEQA 5L8RF 1O57A 2H6BA 4IBIA 3GO5A 3W2AA 2IEKA 1IN6A 3K4BA 1NHAA 3TP3A 2HKXA 1QMZB 3MI9B 2K7LA 3MVPA 5E3MA 4CRLB 4OINF 4P9FA 1E3PA 3MIAB 1HT2E 1QRYA 4DV4M 4CO8A 1FOXA 1OIPA 3GLFE 1UNLD 2CZ7B 4BS9A 2EZHA 4RGRA 3J7BA 3VYGB 3AG4H 1ZG1A 2ZPBB 2BXYA 2VQGA 2P8TA 4HLQA 3J7AO 4BCMD 3U1KA 3JTHA 1AKHA 3FMRA 3HHZA 3KPHA 3A02A 3WTUC 3C3EA 2QLZA 4G4NA 1ETYA 2F4IA 5E8IA 1XB2B 2QBYB 4HF0A 5EP3A 3V76A 1D5VA 5HS7A 2CYZB 1FTTA 1PM5A 1QU3A 3WU2C 4FX0A 3OIOA 3B6AA 1JUPA 2WV0A 4U0VA 3NARA 1D2NA 2FS1A 1MZBA 3RTRA 5ICGA 1R71A 4EC8B 4DQ2A 1NK2P 4J00A 2EQRA 2HI3A 2XGXA 2DOAA 4EOQB 1NY5A 2AQFA 3GLFB 2YPRA 1GJTA 4GCVA 1WCMJ 4AZFA 5DQVA 1TQMA 1NVMA 2WAQA 3JSPA 1D0YA 2GWRA 2E7XA 3MD2A 4KN4X 5JI3E 5J1RA 3GYHX 4IZZA 1KSFX 2XKOA 3OOPA 4ZTFA 1XGOA 2QM3A 3WE2A 2PG4A 2CS3A 2FF4A 3SFZA 1IBLM 1JKRC 4FCTA 5JLXA 1Y0UA 3J80S 3OS0A 3MAJA 1HSTA 1NTCA 3CO7C 3HRMA 4MLOA 3C3DA 3K9PA 3H5AA 3CUQC 3IWFA 3MKLA 1B72A 2CQXA 2K86A 3VDUA 3GLFA 2WZJA 1K61A 2R7UA 5IP7J 1JKQC 1YX3A 5KCMA 2XPVA 3GTMS 4MGKE 3CC2I 1MDMA 5CVIA 5EP2A 3NWLA 1HW5A 3ABLH 5EDNA 1ZKGA 1T0FC 5E6JA 1Z77A 4JK1X 2XB5A 1I27A 1WI9A 1EIJA 1ZR4A 3HOUJ 3HKPA 3LAJA 2V1DA 4KMFA 1IXRC 5E8GA 4Z8XA 4X6AJ 3A8HB 2BW3A 5HDKA 2V9VA 3HGGA 4DR1M 4E7KA 5IT3A 3FXKA 4ZPXA 4AM3A 5LHGA 1IM2A 3OV8A 3FE3A 2TRTA 3A46A 2DMEA 2L2OA 2Z8YM 4RM3A 3QPLA 5ICEA 3G2BA 2XVCA 3OIQA 2QWWA 2R7RA 1R4GA 4BKXA 3GVAA 4HF1A 5KPZA 1U5TA 3N4MA 5AIPA 1JKPC 2EZLA 2YR2A 2XAFA 2FUG2 4LJZF 3PUFA 4M3DA 1UNHD 1T6OA 1FEXA 3GTLJ 2F4OB 2KNAA 2HYFA 1OFHA 3I64A 1YRNA 4W97A 5EFQB 1DGHA 4XIDA 3S3MA 5HLIA 3JSOA 2FE3A 3SHFA 3MMYB 4I5SA 2E1MB 3GTGJ 5CKTA 3WTTC 2E34A 1KQ8A 4DYQA 1KONA 1O7LA 1P3QQ 3M6AA 3FXQA 3MN2A 4XMYA 4WF2A 4XONA 3DDPB 5J4VA 5DYMA 4MGIE 2BS3A 4NC6A 5K7HA 4DR6M 2Y0QA 2FBIA 1B1BA 2MYSA 4M9XA 5BQTA 4F91B 1YE9A 2XSZD 1TWCJ 2ESNA 4WXCA 1DPRA 1GO5A 2LH0A 4KRCB 3SC3A 4FX4A 1OCOH 1QYRA 1IQPA 2LF8A 2L9VA 2FH0A 3HL2A 2VE8A 1LDDA 1OAIA 3FTDA 5M5YJ 4IHYA 1HKQA 2L4FA 4P1WA 3A8LB 5KVRA 4FWDA 1TW3A 1GKIA 4A0YA 1YW9A 1SXJB 1KU2A 3DKWA 4OIRF 3BLRB 3BC8A 4F6SB 3GQ5A 2E36A 2KT0A 5IF1B 2XUBA 1T8IA 1V33A 3HJQA 2RDPA 4KISA 3OYIA 2VQFM 5IDNB 1XMQM 4PZJA 4CISA 1B6AA 1LPQA 2H6CA 4YELA 2ZPGB 2MG4A 2QQBA 4BCKB 5A2QS 2Q0OA 3QU6A 1R9TJ 1WGLA 1YUBA 3FKEA 1YW7A 2DW4A 1F5QB 4B7FA 2KZGA 4ZTJA 4JV5M 3I4MJ 3FXLA 3F0CA 2FD5A 3FRHA 5EG0B 2XAUA 3ZC7B 2L9SA 3DKYA 5BR8M 1FOWA 1NNJA 2KL4A 3QYHB 4LJ6A 2GNOA 3OYFA 4G9YA 4B3AA 3IWZA 1AHJB 3QYBA 3N97A 2E2IJ 5EQTA 4UN0A 3AG1H 2QQ9A 2W57A 1NSFA 2DAEA 3RKXA 4OW0A 2G9XB 1ZLJA 3OYDA 1J75A 1IUFA 2E1OA 4R71A 3LSKA 1Z6TA 4MQ9F 3CTWB 2DA5A 3BZ6A 2F4MB 2MD5A 4CFXB 1OL2B 2C5NB 3J7AY 2IVXA 2C6TB 3FXUA 2KIUA 1URCB 2DQLA 2O01F 2PFBA 2K4BA 4ZDPA 3LSJA 4WCGA 2K9SA 4OB2B 2HVSA 3T1YM 5CQGA 2YR0A 4DUYM 3U6EA 4UUSB 5HQ0B 2NVXJ 4IIWA 3A0BC 3J7ZI 3WTXC 3DEUA 4YEJA 1H4LD 4E6KG 1MBJA 2V7FA 2JA2A 1LTMA 4HF2A 2GQQA 3CDIA 2VASA 2M7BA 2JPCA 2EKFA 2P0WA 1KYZA 2R3SA 1RETA 3IHUA 4XL9A 2UWMA 2R6FA 1ZG5A 4HRIA 2R92J 3Q5FA 4R8HA 3C2GA 1YIOA 1FMWA 1WR1B 1R58A 1WJEA 2HXIA 1FPQA 3BCAA 4YIIA 3KE2A 3KCCA 2EJSA 2X9DA 3C3WA 3OSFA 4PJJA 3VYHB 2XRNA 3TL4X 1JQJC 3HB9A 2O8KA 2I5UA 3R4KA 1IXZA 1VI0A 3FZVA 2IW6B 3LL7A 1N36M 1DGRM 4HBLA 2OOAA 2VBZA 4HQEA 2I7NA 4JX5A 1DQUA 5FFZA 4M6VA 3RYRA 1FJGM 1W0TA 2E7WA 3H4MA 5K5RA 3NWTA 1FIAA 4IHVA 4L6V6 3UK6A 4MGRA 1HT1E 1W0UA 4FHTA 3CD6I 2JT1A 3HRUA 2QPAA 1R1VA 2EV5A 2VQLA 2MC3A 3TPZA 4KJZA 5H6RA 2DK8A 2X6WA 4XM3A 2DA3A 5CLSA 2JA5J 4RODA 2A5YB 2DFEA 2KW0A 3GTJJ 3SATA 4Y17A 1ZP2A 3W2WA 3FKJA 2CEAA 3PNVA 2DOEA 2WHBB 4ETSA 4G3OA 4MM3B 5M5WJ 1WWXA 2C99A 2HOSA 3LSIA 5J4YA 2ZAMA 4IEJA 5JVTA 2CZ6B 5FLXK 5FLMJ 2DI0A 1O9KB 2VC1A 4BY1J 3I4YA 4ITVA 2K47A 3U6PA 2V1CA 1WPKA 2Z4RA 2QVOA 1OYIA 3PFYA 5DCFA 4AKHA 2JTVA 4YOOA 3WU1B 1TR8A 5TRDA 1GL6A 2O9LA
chains in the Genus database with same CATH topology
2LG4A 4KITB 2DXBB 2RQQA 3D5RC 2PJRA 1N78A 1MMNA 2KLOA 1Y6IA 2ZXHA 4BBRM 2VL8A 4U7BA 2I8DA 3K4CA 2LC2A 1Y56A 4ZGJB 1TT0A 1N75A 4XLCA 4II3A 2LY1A 2R7SA 2ZPHB 2F5VA 3CP8A 2VIXA 4ZYAA 3WVEB 4NC8A 4ZDLA 2KRHA 1D1CA 4P5OA 1W36C 3H9QA 4QSHA 2CW8A 3DPTA 2CZ1B 4FETA 4OB1B 4ZGEB 4BGDA 1SFKA 5KNLA 2DXIA 2W1OA 3OR1C 4U87A 3K70D 3FHNA 1AA7A 1BR4A 3ONQA 4D1QA 4OB3B 1D0ZA 1BOBA 3OR2C 4ANJA 2OC6A 4C9YA 4BJ5C 4PFOA 4XQFA 4IQJA 3DTKA 3RSNA 4XLHA 3W2VA 3HPHA 3TBIA 3AKZA 4OWRB 3BG5A 5CQEA 1E7PA 4B48A 3RPUD 2V4JC 4R79A 3X25B 3OYBA 2DXCB 2ZFUA 4BUPA 4BQQA 3L2RA 3X28B 3UNGC 2BS2A 2HVRA 1WJFA 4C2TA 1GLNA 3D5LA 2VXZA 4BEHA 4F92B 1V29B 2WJ9A 4II2A 2HU9A 3CZ6A 3TW6A 4XNFA 1S9HA 4HEA2 3IAS2 1UGRB 1UGSB 1MW7A 3X26B 1IRXA 3D5SC 2IS6A 2KMGA 1FMVA 1WJ5A 3S3NA 3HO8A 2KP6A 4PJLA 2X85A 3OL3A 2M7AA 2KR6A 4B43A 3OYGA 4AI6A 3PSIA 3OYJA 3VYSB 3HBLA 5HLTA 2R7WA 2VB6A 2BOLA 1Z21A 2WY7Q 3A4CA 3CJQB 3OYHA 3L2UA 3HOTA 2R7VA 2KHMA 3K4LA 2A6TA 2CFOA 3CMMA 1W36D 1MNDA 5KHDA 4E7HA 2LRDA 4AVZA 4CCJA 3SZGA 3CESA 2QF7A 2K5CA 4AYBA 3F9KA 1WJBA 1MNEA 2Q2EB 1Z7LA 2M4GA 3LSHA 3QWLA 2L9NA 4EATA 2Z1DA 3L2VA 4BJ6C 2ZCFB 4NQWB 4FM4B 2E60A 4B3XA 2VKHA 4XR6A 2ZPFB 3HOSA 3M1CA 3MKWB 3EUAA 4DJAA 3BLYA 2KPMA 3AL0C 1EA3A 2LBFA 3DWLE 2O5RA 3QOEA 4AU7A 5LFAA 3H0DA 4MFEA 3KEYA 2F6CA 3DQVC 4PJMA 2D0QB 2KZVA 4BE0A 3IP4B 2CV1A 1Z3YA 1DP3A 4BBSM 3I3LA 4C30A 4ZC3A 3RCOA 5JHFA 1D1AA 2ZPEB 2BVLA 2R7TA 3CP2A 3E1SA 1FKMA 5FRMA 4J01A 4RM2A 4CCKA 2QDYB 4BE2A 2KMUA 1E0EA 3HKZA 1QHHD 2VPLA 2ZPIB 2VJ4A 4CH7A 3MKYB 4ZDOA 4E7SA 2ZXIA 4XOTA 2E1MC 3DU5A 2VLAA 4KT6A 1WJAA 2V1NA 3HXLA 4JQFA 4CA0A 3DPUA 4BL0B 1PJRA 2QDJA 2BW3B 4E7LA 4XOPA 5CPRB 1QHGA 2VJ5A 3QZ5B 3ZRGA 4Y4RA 3FBIB 3LSGA 3OYKA 3VKHA 5FROA 2CV2A 2CUJA 3K6GA 3BG6A 4E4HA 4CCNA 3GBGA 2DD4B 2GOXB 4RLFA 3A8MB 4XKCA 1MMGA 4PUSA 4QPOA 4HG2A 2A5WA 2RREA 2XF7A 4XKVA 4BXFA 4F3QA 2CUZA 2LREA 3M8JA 1QLBA 2LOOA 1P9QC 3EUKL 4BQOA 3PJRA 2Q1ZB 4IQ4A 3W3CA 2RNGA 1N77A 5LD2C 3OYMA 3DPLC 3I9V2 2Y0SA 2X1CA 1WFXA 1BR1A 4LITA 3K4NA 2IXSA 2WADA 3VDXA 3DKXA 1D1BA 4Y33A 2WA0A 1K6YA 5HVQC 3IAM2 3OMYA 2IGNA 3HC7A 2KDOA 2W82A 1X4PA 2AHJB 2WAFA 3DLAA 3EPZA 3A2KA 3HPGA 1OLTA 4Y3OA 2HDWA 4C2UA 2MD0A 4G6TB 3TMOA 3BG9A 1HA8A 4XLFA 2DCEA 3H4CA 4JX6A 1X4OA 3W2AA 3LSMA 4N4NB 3S3OA 4XORA 3K4BA 1UG0A 2IGKA 3RQ4A 2XC7A 3OS1A 1NG7A 3K10A 2XSJC 3PL8A 1ZELA 1VZ0A 2VKDA 2R4GA 2CZ7B 4BS9A 3VYGB 4OAZA 3QYFA 1T95A 1MMAA 2ZPBB 3V42A 2VQGA 4F93B 1UAAA 4HLQA 2L5QA 2K3PA 4JOMA 1DGWY 3SDBA 2DJIA 2F4IA 2NOJB 4BE1A 4LOCA 3DTEA 2K9MA 3CJRB 2E5NA 2CYZB 1QU3A 4N4OB 3RTRA 2W7NA 1X19A 4XN0A 3QODA 4J00A 3VWBA 2LH9A 4CZCA 2W00A 2DOAA 4XN3A 2AQFA 2G77A 4IX7A 2WAQA 2BS4A 2DT6A 1D0YA 3S8PA 3MD2A 4IZZA 3L2WA 2Z2SB 3HUGB 2PMZA 3H5RA 4ZGDB 2MABA 4CCLA 4ZTFA 2CS3A 2R7XA 2QFZA 2X1EA 2LBFB 2JVGA 3OS0A 3BG7A 2IGOA 3S32A 4MLOA 3H5AA 3H5NA 2R7UA 3AFHA 2K9LA 4AKGA 1YX3A 5KCMA 3CF2A 3VYUB 1X1BA 3K4JA 3BCBA 3NWSA 4QPQA 3VSKA 4F52A 2KRCA 1T0FC 4OAYA 3ZGKA 2IGMA 1J09A 4B47A 2L7KA 2CH0A 3PUBA 2CV0A 3A8HB 1LKXA 2BW3A 4E7KA 3VKGA 3LMMA 2XF5A 4E7JA 3X20B 5HOOA 3H9GA 3C2HA 2L2OA 4RM3A 3A1YA 4PSWA 2XDVA 3G2BA 4D9JA 3OIQA 4RLQA 2X1DA 2R7RA 1X1DA 4HNVA 2AQEA 3ZCOA 2LY2A 3SYTA 4HNUA 2FUG2 2XF6A 4HPQA 2VXDA 3VYTB 2QKLB 3VSLA 4CSWA 3U21A 1UGQB 5HNHA 2R7QA 3S3MA 3MMYB 2E1MB 5CKTA 2HPMA 4BDZA 4BDYA 1Z3XA 2PJRB 2X51A 2ZSHB 1KONA 2V9KA 2WAEA 2X6YA 4XMYA 3OS2A 3PNYA 4BEHB 4XONA 4MIMA 2M4KA 3UR3C 4IKFA 2BS3A 4NC6A 2MYSA 4F91B 5TGTA 2E5ZA 1YE9A 3DU6A 1V5FA 2W4SA 2IS2A 2IS4A 3OWTA 2CZ0B 1X1AA 3QYEA 3OYCA 3HL2A 4OB0B 3H35A 4MFDA 2UUZA 4P1WA 3A8LB 1UELB 4NC7A 3DEEA 3OIPA 4XLEA 3BG3A 3QYGB 3BC8A 5HNFA 3A8GB 3WVDB 2DPPB 4KISA 4H4KC 3OYIA 1IREB 2LYCA 4CCOA 4DBQA 1WJDA 1TZLA 2MC4A 2OUMA 3PNTA 5EJCA 4YELA 2V26A 1UGPB 2ZPGB 1JI8A 4PK4A 4ZTJA 1MMDA 1ERDA 3FDYA 3DTIA 4PFPA 4PJNA 4BACA 3EUHC 2XAUA 2L9SA 3DKYA 1U0JA 3FBNB 2KL4A 2JUGA 3N05A 3QYHB 1G8XA 3OYFA 4NUBA 4CCMA 3QYBA 4CUGA 3ZQQA 3L2QA 1AHJB 4GRIA 1BR2A 3OL4A 3SEZA 4ELJA 2MFZA 3OYEA 3OYDA 4LIVA 2HQAA 3OYAA 2WBMA 3H9JA 3LSKA 2VJIA 4LG3A 2DT7B 1OR7C 4ZJZA 3SEQA 4HL4A 3J7AY 4NNJA 4XKBA 3HG9A 3S93A 3MKZA 4BQNA 4ZDPA 4OB2B 2BVMA 3PSFA 2HVSA 2ELJA 1SAUA 2Z16A 1X1CA 5CQGA 3OYLA 3HZJA 4YEJA 2HPIA 2VJJA 4E6KG 1G59A 2V7FA 2JA2A 3VYRB 3ZR8X 2VASA 2M7BA 2IS1A 1YX5A 2P0WA 4XL9A 4AKIA 4XKWA 2UWMA 2X6XA 4HRIA 3AL0B 3C2GA 2GOMA 3QZ9B 4E7ZA 1LDKB 1FMWA 2ZSIB 3A8OB 1WJEA 3BCAA 2QQ8A 4BJTA 1V5GA 1LFPA 2CMPA 4PJJA 2CW7A 1NG6A 2KQRA 3VYHB 3TL4X 3HB9A 2OV7A 3IUOA 2WY8Q 4RMNA 3E0JB 4DGWB 3LL7A 2M3AA 3OOUA 4PSXA 4HSTA 1DGRM 1R6RA 4JX5A 4JX4A 1DQUA 2M0MA 4HSRA 4BU2A 4M6VA 4HNTA 2UV1A 3NWTA 2JSPA 4YRVA 1WJCA 4DOZA 2HNHA 4LIUA 5FRNA 3KYLA 2VQLA 1PYVA 4KJZA 2V6EA 3K4MA 2X6WA 3X24B 2HVQA 2JVHA 4XM3A 4E7IA 4DBRA 2DD5B 3KX2A 2R7OA 3OY9A 2HZDA 3W2WA 3FKJA 3PNVA 3QXEB 2VQHA 3LFUA 1LVKA 3OYNA 3LSIA 4B44A 2QKMB 4X0GA 2CZ6B 4Z6YA 1D0XA 3HHTB 4DIQA 4F55A 4FASD 3DL1A 4ITVA 4P17A 2ZZDB 1V5EA 3K4KA 3KHIA 2VQCA 3PFYA 3ZXSA 4AKHA 4XLAA 3K70C 3TW7A 2WB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P17 A;  3HZJ A;  4NC6 A;  3QWL A;  4HLQ A;  3QYE A;  5EJC A;  4Z6Y A;  2QFZ A;  4HL4 A;  3QYB A;  2QQ8 A;  2G77 A;  1FKM A; 
#chains in the Genus database with same CATH topology
 2WIH B;  1ZG3 A;  5J6X A;  2RQQ A;  3D5R C;  3GO8 A;  2Z33 A;  4L0Y B;  2ZXH A;  1Z5B A;  2VL8 A;  3K4C A;  2LC2 A;  2QEX I;  2IN3 A;  2HR3 A;  2LLK A;  4FWG A;  1TP4 A;  3BR1 A;  1YTY A;  1CF7 B;  4ROE A;  4KN7 X;  2WFY B;  2JZ0 A;  5CYI B;  5E79 C;  4OVZ B;  2Y69 H;  5K7F A;  2O7O A;  4GHA A;  1U2W A;  3E5Q A;  4EM2 A;  2RNJ A;  2R7F A;  1BBY A;  3CP8 A;  1P7J A;  2WTE A;  4ZZL A;  3CCR I;  2QA4 I;  5C4X J;  1J9I A;  3H92 A;  2OU2 A;  2XRL A;  5LRS A;  2WWY A;  5D6F A;  4I7H A;  3FUT A;  4ZDL A;  2LVA A;  3B9P A;  1QNT A;  2ZNY A;  4ENJ A;  3W6V A;  3PFI A;  2CZ1 B;  5LEJ A;  4BGD A;  3HDD A;  2DXI A;  1PRB A;  5GKN A;  3OR1 C;  4U87 A;  2JA6 J;  4YHH M;  3LOC A;  2EFO A;  4D1Q A;  1D0Z A;  2R4J A;  1MDM B;  3KS4 A;  5EXT A;  4XQF A;  4IQJ A;  3DTK A;  1ENH A;  4A3B J;  3HPH A;  2HCB A;  4NSR A;  4OWR B;  2HQR A;  4II7 A;  3P9I A;  1E2X A;  3DFZ A;  1M1E B;  1IUY A;  4QNR A;  2KZU A;  1E32 A;  2P5V A;  2C5O B;  5FKK A;  1AOY A;  1O3R A;  1H24 B;  4HQM A;  2I40 B;  4KUM A;  2DFI A;  1WZ2 A;  3ABU A;  3L27 A;  4GYG A;  5CEI B;  3L2R A;  5DCM A;  2ETH A;  2HL7 A;  2ZC2 A;  5E1X A;  3U1D A;  3E6C C;  4BXU A;  4CZZ A;  6PAX A;  5IYD J;  2BS2 A;  2XAJ A;  1ORY B;  3KZY A;  3J81 K;  2MH9 A;  2B9R A;  2CRG A;  1C9B A;  3D5L A;  4EQQ A;  5EXP A;  3GXO A;  2PLY A;  1V34 A;  4K0K M;  4YC3 B;  4L4U A;  4DR7 M;  4LGY A;  3CZ6 A;  3TW6 A;  2DWM A;  4XNF A;  4EM0 B;  3SZP A;  1F5T A;  1X37 A;  3IAS 2;  3TO6 A;  3G73 A;  1MW7 A;  4DYR A;  3AOG A;  2FSW A;  5DV5 A;  3HOX J;  3H4J A;  1IRX A;  1XS9 A;  3CLO A;  2C9O A;  1J0R A;  1BL0 A;  3KP4 A;  4EIW A;  5L3G A;  3OL3 A;  2FA5 A;  2M7A A;  1TWG J;  5EG0 A;  5L2W B;  3U61 B;  4IOA F;  1E94 E;  1HDD C;  2KEB A;  1TTY A;  3PSI A;  3VYS B;  3FIW A;  4HLY A;  3GLG E;  2BOL A;  3CJQ B;  3A4C A;  2JZY A;  4ZZD A;  3J27 B;  3GQ3 A;  1VEK A;  4QOZ C;  2CFO A;  1H0M A;  3K1M A;  3BZC A;  5E1Z B;  4V19 K;  1W36 D;  2F5D A;  1V4R A;  4UV8 A;  2Y30 A;  4A6E A;  4RAZ A;  3B74 A;  3S2W A;  1QA6 A;  1ITY A;  3F8B A;  4NXM M;  1XSX A;  1Z7L A;  2M4G A;  1IY1 A;  2MSY A;  1J5Y A;  2F5E A;  1LEB A;  4X65 M;  1IZ1 A;  1DO0 A;  4LJ9 A;  1L3L A;  4UV9 A;  4NQW B;  1IDY A;  4BB9 A;  2ZCF B;  1JKO C;  3BR5 A;  1YJW I;  5HLH A;  3M1C A;  3MKW B;  3AJI B;  4B09 A;  3JAM K;  2JZ1 A;  1POG A;  4BCG B;  4R1H A;  3QOE A;  2CQK A;  2DWN A;  2XGD A;  4D5C A;  5LFA A;  1FYL A;  3HHW A;  4M9S A;  3DQV C;  3ZQG A;  4KLN A;  3ZCB B;  3FXM A;  2VF7 A;  3I4N J;  1MBG A;  3VPR A;  4BNC A;  2IW9 B;  1QPM A;  5D5W B;  3RCO A;  1H8A C;  1I3A A;  1OI9 B;  3D8L A;  2BVL A;  5HBJ B;  2K3F A;  3DDQ B;  1X3U A;  5FRM A;  2E5L M;  2QSH X;  1IBM M;  2F5Q A;  4IHW A;  4BE2 A;  2KA6 B;  1STZ A;  4Z2Y A;  4OIP F;  1JXS A;  2QDY B;  3NDQ A;  1E0E A;  1IXS B;  1QHH D;  2ISY A;  4ROC A;  1FP2 A;  2ZXI A;  2VLA A;  4ZH4 F;  3F6V A;  1CQT A;  4BBR M;  1SMT A;  3JW4 A;  5J1Y A;  4BL0 B;  3RE8 A;  1R7R A;  5CVJ A;  4BQA A;  4XOP A;  5CPR B;  1O3Q A;  1QHG A;  1I3Q J;  2O0Y A;  4QLC U;  3FUU A;  3F23 A;  3VKH A;  3OYK A;  1NJG A;  3GRR A;  4LK1 F;  5DYI A;  2NAZ A;  1QO0 D;  2BJV A;  4L9N A;  3K6G A;  3BG6 A;  1WIV A;  1U9O A;  4G4O A;  2NYX A;  1OKV B;  1ZN2 A;  1HF0 A;  2L7F P;  2G7U A;  1FSE A;  4OMY A;  5IT9 S;  3D8B A;  5LGU A;  1DGB A;  4XKC A;  1JGS A;  2XIG A;  4NSO B;  4HYE A;  1MMG A;  2RRE A;  3RYP A;  4GC9 A;  2XF7 A;  3WTV C;  3ABK H;  4BXF A;  2FOI C;  5D5X B;  4F3Q A;  4YG2 F;  2LNH C;  4I02 A;  4S05 A;  1SAN A;  3G71 I;  3COA C;  1A5J A;  2LOO A;  1P9Q C;  3EUK L;  1ZRE A;  5ICP B;  3L2A A;  3Q9V A;  3JRD A;  2O03 A;  4DV6 M;  5JI2 E;  4BLC A;  3OYM A;  2DAM A;  2B3T A;  1WKM A;  5F64 A;  1G3N C;  1BR1 A;  2V9P A;  3EET A;  3CMY A;  5D8L B;  4ELL A;  1GV5 A;  3I5U A;  4Y33 A;  1ETX A;  2Y2Z A;  1RIO H;  3GRY A;  3K8Z A;  4UN2 B;  4IF4 A;  3E6D A;  4LB5 A;  1Y0N A;  2AHJ B;  2ME0 A;  1FC3 A;  2WAF A;  2JP7 A;  3DLA A;  4BHB A;  3EPZ A;  2LK2 A;  3ILK A;  4LJ4 A;  2DFH A;  2YX7 A;  4C2U A;  2HDW A;  2F2E A;  2P7V B;  2L4E A;  4UVA A;  3V8K A;  1DPU A;  3FYD A;  4BXX J;  3KFU G;  4LJA A;  3GTQ J;  2N8G A;  3RGP A;  3QOP A;  1X4O A;  3AV0 A;  3F6O A;  5DUI A;  3L26 A;  1A6Q A;  2R45 A;  3S3O A;  1I6H J;  1UG0 A;  2IGK A;  1A35 A;  3ZMZ A;  3OS1 A;  2E71 A;  3FWE A;  3K10 A;  4MO7 A;  4CFN B;  1KYI A;  1KU3 A;  2ID3 A;  2LD5 A;  3HJ8 A;  2XSJ C;  3REO A;  2LP0 A;  2H27 A;  2V6Z M;  3G1O A;  3BLQ B;  3V8L A;  2BWB A;  1VQ7 I;  4LF5 M;  3V4G A;  1DGG A;  1ZGA A;  2JGZ B;  1JOW A;  3SAU A;  3QYF A;  1R4M B;  3V42 A;  2L7H A;  1JR3 A;  2HGC A;  5LGT A;  1J5E M;  2HDD A;  1Y1W J;  1U5T B;  3HGY A;  4JOM A;  5C3E J;  3K2A A;  2DJI A;  3V8J A;  1EJ9 A;  1ETV A;  2HOA A;  2M8G X;  1VIN A;  3CJR B;  2W99 A;  1Y1V J;  1FX7 A;  1BJA A;  4N4O B;  2BWE A;  1JHF A;  2W7N A;  3VWB A;  2DQR A;  1ZTR A;  1T43 A;  4G6D A;  1WGX A;  2LH9 A;  1H25 B;  3CGW A;  3E6B A;  3GPP A;  4LF8 M;  2E19 A;  3M8E A;  3C58 A;  1RZ4 A;  1Q02 A;  3U6D A;  3CF5 F;  5CVR A;  3L2W A;  2Z2S B;  3H5R A;  3J2P B;  2EA0 A;  4GGG A;  4ZGD B;  4CCL A;  2MRO B;  4HX7 A;  1YHQ I;  4IBG A;  5IY5 H;  2KIM A;  2X1E A;  4LF9 M;  2LBF B;  3CCE I;  3CC4 I;  4IHS A;  1TNS A;  2LR8 A;  4XSX F;  3S32 A;  1HW2 A;  1WRJ A;  2CCI B;  2E1N A;  1SG9 A;  1XGS A;  2DVW B;  3VDP A;  1TBX A;  3GTM J;  4V2G A;  2K9L A;  1HQC A;  3KSJ A;  1YS7 A;  1ZHF A;  3PO2 J;  1RNL A;  3W67 A;  1RU3 A;  4LF6 M;  4OGR B;  3FD9 A;  1X1B A;  3K4J A;  1R5L A;  1XHB A;  3BCB A;  3VSK A;  2UXN A;  2OPT A;  3WHK A;  2P6S A;  4F52 A;  1VDL A;  3KP7 A;  4BCQ B;  4OAY A;  3ZGK A;  2IGM A;  1J09 A;  4AIH A;  1RES A;  2CE7 A;  1YYV A;  3KOW E;  2UXD M;  2L7K A;  4AG6 A;  2CV0 A;  2FRH A;  4NB5 A;  5GAG J;  2XAG A;  2EBI A;  1H26 B;  2DBB A;  4EMS A;  4L0Z B;  2UZL B;  2XF5 A;  1K78 B;  4RB0 A;  5FFX A;  1NH3 A;  4QHT A;  2P6T A;  3HOY J;  3KSX A;  3A1Y A;  4IOC F;  2XDV A;  1IN8 A;  1DP7 P;  1W5C C;  2X1D A;  4RF1 A;  4HLX A;  4CIC A;  4GKJ M;  2AQE A;  3ZCO A;  2LY2 A;  3SYT A;  1RUO A;  1VND A;  2XF6 A;  4HX8 A;  2FX0 A;  2QKL B;  1L2C A;  2LW4 A;  2RN7 A;  3IH2 A;  4CSW A;  3F8F A;  3SDG A;  1I6X A;  5HNH A;  3K2L A;  2KKO A;  2MLK A;  2R7Q A;  3ISP A;  4I98 B;  1LEA A;  2F4V M;  1QVT A;  5ERI A;  1H9T A;  4BDZ A;  2R0Q C;  2WV1 A;  4WWC A;  2PJR B;  2X51 A;  2BZT A;  1D8K A;  2X6Y A;  3OS2 A;  2V22 B;  2TDX A;  2VDB B;  4B3R M;  2F5P A;  1IXC A;  2M4K A;  2FML A;  1JB0 F;  5L3F A;  4IKF A;  1T3T A;  5FLX S;  1HQY E;  4KIG A;  1P4A A;  5TGT A;  3S2D J;  4D7N A;  2FBH A;  3GRV A;  3GP1 A;  2OCC H;  3M9A A;  1QBJ A;  5ACB A;  3ELK A;  2R4E A;  2AXL A;  4YFK F;  3T1H M;  4F1I A;  3L1P A;  5E3O A;  4NC7 A;  2ADU A;  3QQA A;  3OIP A;  3BG3 A;  1W7P B;  4IHT A;  2DPP B;  1R6B X;  2BYV E;  1FBQ A;  2DO7 A;  3FM3 A;  3ECO A;  1D8J A;  4CCO A;  2C9C A;  5C4J J;  4LFA M;  1S8N A;  3CCM I;  1ZMV A;  1XX5 A;  3M4O J;  3U60 B;  1TH3 A;  5DUK A;  4ESB A;  3S1N J;  1UGP B;  2C5R A;  1T33 A;  1JI8 A;  2O8X A;  1QDR A;  2LWX A;  4M71 A;  4ZYD A;  4IRG A;  2JJ7 A;  3FDY A;  3DTI A;  1GY3 B;  1V54 H;  3EUH C;  1VDD A;  3ABM H;  4L16 A;  3FMQ A;  3NEU A;  4TUW A;  2JUG A;  4M6X A;  3I71 A;  5GAE J;  3QU3 A;  2GM4 A;  2ZJQ F;  3JR4 A;  3BR6 A;  1LQ1 A;  2ZNZ A;  2ZCW A;  3ZQQ A;  1BR2 A;  1MU5 A;  4S12 A;  1JTX A;  3SEZ A;  4QOS A;  3OYE A;  4M9Z A;  2ECC A;  2O3F A;  1Z59 A;  1HLV A;  2HQA A;  2CUF A;  3FRI A;  2D1H A;  2W85 A;  3H9J A;  3NBX X;  4BCJ B;  2ID6 A;  1S6L A;  4KMU X;  4AIK A;  4RGX A;  4IJF A;  3K69 A;  2EKK A;  4NOO B;  1FYM A;  4NNJ A;  1ETQ A;  2F2C A;  2BY3 A;  4XKB A;  3HG9 A;  3CCQ I;  3U6O A;  1XGM A;  4ZYE A;  1XMO M;  1MJ9 A;  3PSF A;  5EEA A;  3U60 A;  1OYW A;  2ELJ A;  4EOJ B;  1XG1 A;  1TT5 B;  3HU1 A;  1R49 A;  3HZJ A;  1IG7 A;  4BCQ D;  2RGO A;  2OZU A;  2VJJ A;  3AG3 H;  4LG0 B;  3LWF A;  2EIJ H;  2C6Y A;  4NRV A;  3HHY A;  4B1R A;  4G6L B;  5C1B A;  1PP7 U;  4EGY A;  3PVS A;  1BC8 C;  4PDK A;  2JPB A;  2JMW A;  2FJ1 A;  1ZMW A;  3AL0 B;  3QZ9 B;  4F7J B;  1PKD B;  2ZSI B;  2NXN B;  4LJ7 A;  2IRF G;  1U8B A;  2RC4 A;  3LVW A;  3KYC B;  1JJ8 C;  3ERM A;  1YO5 C;  3IUO A;  4EC9 B;  2ECB A;  3KOY E;  2IBD A;  3ZQJ A;  4CHT B;  1E9S A;  4DGW B;  3HJS A;  2R7G A;  4LGM A;  3OOU A;  2MGW A;  4BY7 X;  3O0G D;  1K3X A;  5A2Q K;  4M3F A;  4AD9 A;  2M0M A;  4BU2 A;  2CJJ A;  1SXJ E;  2FNP A;  5D4S A;  3QAH A;  2WEV B;  2ZM6 M;  1Q3C A;  2UV1 A;  2JSP A;  4YRV A;  1Q39 A;  2LDU A;  5F1J A;  3GX4 X;  4UUS A;  3QPT A;  1G41 A;  4HOB A;  1FBS A;  2G7H A;  3ESW B;  3F3X A;  1HKT A;  2QBY A;  2MBF A;  2DAG A;  1TGU A;  3EUH A;  2WSF F;  4L5J A;  2UXB M;  2ISZ A;  1ZV1 A;  3KX2 A;  1BOA A;  3OY9 A;  4HX4 A;  3M8F A;  3ROU A;  2GIZ A;  5HOD A;  3KFW X;  1FNN A;  3IEC A;  4ENM A;  1H1S B;  2BV6 A;  3HTU A;  2VQH A;  3GPU A;  3HYI A;  3W68 A;  2K9Q A;  4EOK B;  4R3D A;  3CJT B;  1YSY A;  2CHQ A;  2HWJ A;  5DD4 A;  1MBK A;  3A45 A;  3F22 A;  1XXH A;  3HU3 A;  4B44 A;  1HCR A;  1SFO J;  3TQN A;  4G6Q A;  2ACJ A;  2YX4 A;  4DIQ A;  4F55 A;  1VQN I;  3DL1 A;  3I51 A;  1R5H A;  1XXH E;  4P17 A;  2CWE A;  2ZZD B;  4JI7 M;  1YLF A;  4B8X A;  1GVN A;  1IF1 A;  5F0C A;  5LMK B;  3ZN0 A;  3GF2 A;  3ZXS A;  4EOM B;  1Y8G A;  3TW7 A;  3TGN A;  1TF0 B;  2LG4 A;  2DWZ B;  1S29 A;  3PIO F;  4JI4 M;  4MGH A;  2KIQ A;  1Y6I A;  4ENN A;  3V7R A;  1PDN C;  1ZRF A;  4ABZ A;  2F5F A;  3A01 B;  3ECH A;  2I8D A;  3JRA A;  1HNW M;  1EV7 A;  1MN3 A;  2KRU A;  1CUK A;  4IBK A;  3UGJ A;  2DOD A;  3CDH A;  4XK4 A;  2M1B A;  3UJN A;  1VEG A;  4Y28 F;  2XAS A;  2EA2 A;  1OCC H;  4ZGJ B;  5DYG A;  3EOC B;  3DLL F;  1IY2 A;  4MTE A;  4II3 A;  3LA7 A;  3GFM A;  3ZP5 A;  2QCO A;  1FZP B;  3O2P E;  5IDP B;  2CG4 A;  3RPQ A;  3FXJ A;  2QZ4 A;  2AO9 A;  2VIX A;  3BP8 A;  5C18 A;  2ZXJ A;  1K78 A;  5IP6 A;  2L2D A;  3CCL I;  1XSV A;  4N0B A;  3MK6 A;  4NC8 A;  4CFV B;  2Y31 A;  1EF4 A;  2R93 J;  3D0S A;  1F9N A;  4UY8 I;  1QUT A;  3O8H A;  1D1C A;  3SMS A;  2HTS A;  3BTL A;  2P7C B;  4QSH A;  4N9I A;  1L0O C;  2CW8 A;  3DPT A;  2DA7 A;  1N33 M;  4OB1 B;  4LRT A;  2K27 A;  1OTR A;  3CJN A;  5KNL A;  3CO6 C;  1ZRC A;  4ZGE B;  2M8E A;  1AA7 A;  1JE8 A;  2PJP A;  2K02 A;  2N35 A;  5BPD A;  2MR9 A;  3MQ0 A;  1X1P A;  4M6Y A;  3J80 Z;  2CO5 A;  1YIJ I;  3CUO A;  4BJ5 C;  5J8C A;  2XF3 A;  3PM1 A;  4UUT A;  2HAK A;  5L3D A;  5HBE B;  3RSN A;  2CCH B;  5JLW A;  4EM1 A;  3TBI A;  1E7P A;  4OVZ A;  1SD6 A;  3F92 A;  5GAD J;  3GZ6 A;  4B48 A;  3WU0 A;  4RKU F;  2XSD C;  2MGQ A;  4A3J J;  3K9O A;  2V4J C;  3U6S A;  3B02 A;  2J5Y A;  3X25 B;  2CQN A;  3M7G A;  3T8T A;  1ZYR F;  2LSO A;  4A0X A;  2DXC B;  1UHW A;  2ZFU A;  5FO5 A;  2CU7 A;  1TQI A;  4GEW A;  4RS8 A;  2BEO A;  1ETK A;  1ZK8 A;  1QPI A;  2Y9Z A;  3X28 B;  1UM8 A;  3BTJ A;  1C0W A;  2IVM A;  3KLO A;  4C2T A;  2WAQ N;  1IN7 A;  1GLN A;  3NQO A;  4GIP A;  2CSO A;  4F92 B;  2J7O A;  2NS8 A;  3IKV A;  2CGP A;  2W2H A;  1X3Z B;  1TLH B;  2EB7 A;  4V2F A;  2XZU A;  1MSE C;  1WXQ A;  5F08 A;  1JTY A;  1LVA A;  3X26 B;  5IHY A;  2VBW A;  2KMG A;  1OIY B;  2Z7J A;  4EOO B;  3VK8 A;  5LBQ A;  1Z9C A;  4EOP B;  3HO8 A;  3RZD J;  4BYY A;  1OYY A;  1WGN A;  1XPX A;  4M0W A;  4WP2 A;  1D0K A;  3BBZ A;  3L00 A;  3F8M A;  2Z3Y A;  2CHG A;  4I6Z A;  4XIC A;  1E9H B;  2VI6 A;  3HBL A;  4DUZ M;  3BJO A;  3VOD A;  3L2U A;  1Z21 A;  2B9S A;  5I5Z B;  4BCN D;  3I55 I;  2A6T A;  2YNM D;  5LGN A;  2L7M P;  2P4W A;  1F36 A;  1D0L A;  2K4J A;  2LRD A;  2QHO B;  4AVZ A;  3H3V K;  4CCJ A;  4K2E A;  3JAM S;  3WOD F;  4XLP F;  1ZH5 A;  2B63 J;  2L09 A;  3F9K A;  4L8R C;  1MNE A;  1TTE A;  2Q2E B;  1QAO A;  4EEF G;  2VT2 A;  3LSH A;  3QWL A;  1FIP A;  2L9N A;  2DMN A;  1Z5C A;  2L4M A;  1N34 M;  1WHC A;  5K7Z A;  1TC3 C;  4CHU A;  3L2V A;  3GZ5 A;  4M74 A;  2VOP A;  4BJ6 C;  5KPR A;  3I4P A;  2DAI A;  2JY6 B;  2KZS A;  4B3X A;  2DK5 A;  2DMU A;  2DKL A;  2K40 A;  2IA2 A;  4Y15 A;  3HOS A;  3F21 A;  2NS0 A;  1AIP C;  3BLY A;  2KPM A;  5AON A;  1H9G A;  1EA3 A;  2W24 A;  1JSU B;  4DV7 M;  3K7A J;  3RGF B;  1SAX A;  1QZM A;  2YUS A;  3MJ5 A;  4C3J J;  1FOY A;  1R1T A;  2EPF A;  2KZV A;  4BE0 A;  2L0K A;  3WTS C;  4C3I J;  4OU7 A;  2OF7 A;  1W5T A;  4S04 A;  4ZC3 A;  5JHF A;  2X49 A;  3GTK J;  1S7O A;  1FKM A;  3BY6 A;  3EJ1 B;  2COM A;  4J01 A;  3DXJ F;  4CCK A;  5DM6 F;  1H6U A;  1K4T A;  3HRS A;  2E2H J;  4BCM B;  2XPW A;  2EIL H;  3GLI E;  3LQR A;  4CYD A;  3HKZ A;  1ACI A;  2ZPI B;  4HV5 A;  1JR3 E;  2VJ4 A;  4CH7 A;  3MCZ A;  2NNN A;  4QTR A;  3MKY B;  2LVN C;  1B8I A;  5FLV A;  4DR5 M;  2V1N A;  1R2Z A;  1X2N A;  4JQF A;  2NQ8 C;  2QZ8 A;  3RKY A;  1FYK A;  1VQL I;  2QDJ A;  5KPT A;  5JVG F;  2XAH A;  2E2J J;  2W9F A;  1G71 A;  2P5K A;  3CDL A;  3ZRG A;  4Y4R A;  5HNB B;  3FBI B;  2M2E A;  3I4V A;  1PP8 F;  3I54 A;  3BT9 A;  5FTK A;  1L8Q A;  3GFL A;  1MD0 A;  4WXD A;  4I0B A;  2UXX A;  3KOZ E;  5IWA M;  1KYW A;  3WTW C;  3W6K B;  1QAQ A;  2EFN A;  4KA4 A;  2Z3X A;  4YY3 M;  1FWZ A;  2AHM A;  1Y8Q B;  2M5Z A;  2GOX B;  2J5O A;  1PJQ A;  5LQF B;  2X4H A;  1F4I A;  5AIQ A;  4AWX B;  5M5X J;  4HG2 A;  3KZI C;  5B5E C;  3BTC A;  1P2F A;  3FTC A;  2G9W A;  3HM5 A;  2H09 A;  3PJR A;  1FVV B;  2Q1Z B;  3CME I;  4B3T M;  2F5C A;  2QGS A;  2ZBK A;  3MY1 B;  1JT6 A;  4HAM A;  4Y7N J;  1YS6 A;  4Y72 B;  2FQ3 A;  3BR2 A;  1RKT A;  2Y0S A;  1IDZ A;  3LAP A;  2X1C A;  4A3V B;  3K4N A;  3P9K A;  1OKR A;  2HWV A;  3VDX A;  3NBI A;  5ITR A;  4P16 A;  5HVQ C;  1VQ5 I;  3IV5 A;  4CGZ A;  3IAM 2;  1NNU C;  4BBR J;  1VTN C;  3GLI A;  1C7Y A;  3S1Q J;  3HJE A;  3HC7 A;  1LE8 A;  2KDO A;  5E17 F;  2DNA A;  1HXD A;  4BAY A;  2YSR A;  5L3C A;  3SAW A;  3V7S A;  1EH6 A;  1WJ7 A;  2R7Z J;  5KAI C;  1JJ6 C;  2UUE B;  4M3B A;  1BN5 A;  5ILU A;  1APL C;  1XN7 A;  4H0E A;  1OKW B;  1JUM A;  1KQ0 A;  4A5N A;  2GA1 A;  3I59 A;  1ZGW A;  2OZ6 A;  1OCR H;  1OAO C;  5CJ9 A;  5BNJ B;  4DR2 M;  4JX6 A;  2LHC A;  1X2M A;  2Y20 A;  2X4A A;  3LSM A;  1BIB A;  2JA7 J;  3Q0U A;  3BHT B;  4DR4 M;  1VQP I;  1U8R A;  4WX9 A;  4Y52 J;  3ASO H;  5IT9 K;  3PL8 A;  4J19 A;  4BCI B;  4KIC A;  1ZEL A;  2Z4S A;  4EJT A;  2MH8 A;  2VKD A;  2VON A;  2NNY A;  4G7H F;  2R4G A;  4LGW A;  5BPV A;  5ICC A;  2ZME B;  4BY7 J;  5DFL A;  3KP5 A;  1OL1 B;  4EJW A;  2DA4 A;  3S17 J;  1UB9 A;  4IRH A;  4OAZ A;  1Q1V A;  1OKS A;  1MMA A;  2QNJ A;  1AD6 A;  4F93 B;  3FK6 A;  2GXA A;  1UAA A;  2NVQ J;  2G3Q A;  2ZJR F;  2M5W A;  4LD5 A;  2UU9 M;  4LLL A;  4DZP A;  5A2Q Z;  3HEF A;  3S1M J;  1DGW Y;  3TQS A;  1DU0 A;  1DO2 A;  1ZAO A;  1DU6 A;  2NOJ B;  2BKZ B;  4YIR X;  2ZAN A;  2A07 F;  2WSE F;  3JRH A;  4I01 A;  2LKP A;  5ED4 A;  1XC5 A;  4WK8 F;  1Y39 A;  4CIZ A;  3VB2 A;  1D0M A;  2XHK A;  2X1N B;  2DFF A;  3S16 J;  4XN0 A;  3W0F A;  3ASN H;  4CZC A;  2W00 A;  4XN3 A;  5LRR A;  1N32 M;  2ZTC A;  3LSP A;  2G77 A;  2HOT A;  2OTJ I;  1I39 A;  1MX0 A;  4IX7 A;  4A69 C;  1HNZ M;  3EIE A;  1PUE E;  2PK9 B;  4GO1 A;  3ABT A;  3RPU A;  2IAI A;  4LLN A;  1MJG M;  1GXQ A;  2W48 A;  1YJ9 I;  3WHL A;  1QZY A;  4BY1 X;  5KAF C;  3S14 J;  5EEH A;  2DYR H;  2R7X A;  1RI7 A;  1GV2 A;  3BG7 A;  2IGO A;  1U5T C;  3E21 A;  2PHG A;  3ZMT A;  1XO2 A;  3LA3 A;  3P9C A;  1W7P A;  5IOY A;  1Z67 A;  1FBU A;  5TIS C;  3HWS A;  3CF2 A;  4UXN A;  1HSJ A;  4GMQ A;  3BJA A;  4G7Z F;  4RNA A;  4QPQ A;  4I09 A;  3KVW A;  1VQK I;  2Q2E A;  3HUG A;  3KP3 A;  3GQ4 A;  3QHR B;  5D4R A;  4CFW B;  1H1R B;  3POM A;  1ULY A;  2CH0 A;  3PUB A;  1JKW A;  4DBG B;  4IPA A;  3A03 A;  3PIP F;  1RPW A;  3LMM A;  4TTH A;  2IA0 A;  3EQL F;  4E7J A;  2KJB A;  5HOO A;  4KT0 F;  3H9G A;  4Q47 A;  1K7A A;  4R7G A;  3C2H A;  3TNH B;  5LEK A;  2LXE A;  2EFQ A;  4PSW A;  4D9J A;  4DNC A;  5DDG A;  2DPD A;  2OBP A;  4YOS A;  1SVO A;  2UUA M;  1OIS A;  5BS6 A;  4GDF A;  2FOK A;  4A3K J;  4CXF A;  3WHB A;  3CUQ A;  3VYT B;  2VE9 A;  1AIS B;  1I1S A;  2LKX A;  2Y0M A;  2XFT A;  3TDU C;  1SEU A;  1A31 A;  1UGQ B;  5DCM B;  3TDZ C;  2DHY A;  1BM9 A;  2EV6 A;  1HDP A;  3ZQF A;  4MTD A;  3IHP A;  1J7K A;  3TP0 A;  4D81 A;  1OQY A;  1GT0 C;  3M03 A;  2DT5 A;  4BDY A;  4GC5 A;  4NXN M;  3IRQ A;  3J81 S;  3SBJ A;  1XMX A;  4DR3 M;  3PNY A;  4DV5 M;  3U6Q A;  4MIM A;  4ESJ A;  1K3W A;  1XDU A;  2JWS A;  3IH3 A;  4XBO A;  2GXG A;  5FSW A;  2LTP A;  3DU6 A;  4II5 B;  1V5F A;  1SMY F;  2CYY A;  1YW8 A;  4HDV A;  5KO3 A;  1NO1 A;  4HZF A;  2AHQ A;  2FFJ A;  3ZMD A;  4YOZ A;  3BR3 A;  4G4R A;  3HX3 A;  2IJL A;  3F8N A;  3OWT A;  3AOE A;  1O3T A;  5HVY B;  5ITX A;  3H35 A;  4AQY M;  1V55 H;  3ZN1 A;  2UUZ A;  4IHX A;  1UEL B;  1I1G A;  3M0E A;  1Z7U A;  4OMZ A;  3HGI A;  3JR9 A;  1YFH A;  1S72 I;  1U3E M;  2YU3 A;  2BGC A;  2K6B A;  5HNF A;  4REZ A;  3WVD B;  5CVU A;  5F0H A;  4FE4 A;  2LTU A;  2H8W A;  4A0Z A;  5FKO A;  3DP7 A;  1UNG D;  1HNX M;  1MBH A;  1R4N B;  2X8A A;  1BI1 A;  4NL4 H;  2LYC A;  2VKE A;  5FGK B;  1K79 A;  4MGZ E;  1FY7 A;  2GZW A;  2LBC A;  4JI6 M;  1WJD A;  1TZL A;  2MC4 A;  2OUM A;  4DBQ A;  1PUF A;  5BOX A;  1GH6 B;  3FYC A;  1TL8 A;  1FJL A;  4W5W A;  1R36 A;  2ELK A;  2PX9 A;  5IP9 J;  1MMD A;  5EXS A;  5GPA A;  1ETW A;  1S7A A;  1MGT A;  2B0L A;  3GLX A;  5ILS A;  2DTZ A;  3S15 J;  3FBN B;  5K5O A;  2L6O A;  3N05 A;  1PJJ A;  3TKY A;  1BI0 A;  1GUX B;  2XLJ A;  2XGC A;  1SVL A;  2L9R A;  4NUB A;  4CUG A;  3E5U A;  1DGF A;  2JXN A;  3LFK A;  2JUJ A;  3FHZ A;  3WTZ A;  1SFU A;  2VKV A;  4BBA A;  3FK7 A;  1LNW A;  4XRS G;  2KNV A;  3GEZ A;  1MJA A;  5H20 A;  2MFZ A;  7CAT A;  1SFE A;  2KDZ A;  2LVP C;  4WUR A;  1QVR A;  1NK3 P;  1P92 A;  2HQ5 A;  3E97 A;  4HV6 A;  4LIV A;  2ME6 A;  1FOK A;  3QHW B;  3BQY A;  3IG8 A;  2VJI A;  5FTJ A;  1SD4 A;  3C1D A;  3DCF A;  3DFG A;  2IW8 B;  1D3U B;  4FE7 A;  3KXE C;  3B7Z A;  4ANR A;  1OR7 C;  4ZJZ A;  3SEQ A;  1HBX G;  1CGP A;  4F70 B;  3LQQ A;  4DV0 M;  1UMQ A;  3S93 A;  3MKZ A;  3SAS A;  4JI2 M;  2BVM A;  5ITY A;  1BW6 A;  4AW4 A;  2OOB A;  1L2D A;  3K2Z A;  1GAB A;  1XD7 A;  2DOF A;  2G0E A;  4IBD A;  2Z16 A;  5HLG A;  3OYL A;  3BHV B;  4O6J A;  4F7S B;  2LFB A;  3GCM A;  4AIJ A;  1G59 A;  1NHG C;  3JCU C;  3VYR B;  2FOW A;  2D7G A;  3RKQ A;  2GQF A;  4A12 A;  4B08 A;  1YX5 A;  3O6B B;  3JRI A;  4ESF A;  2A69 F;  2X6X A;  2YQZ A;  3HKZ N;  2ERC A;  3A8O B;  1LDK B;  4G8X A;  2QQ8 A;  4U0Y A;  3HY5 A;  1V5G A;  4XK8 F;  1XDS A;  1LFP A;  2H1L A;  2LNB A;  2CMP A;  1MBE A;  3BPX A;  3R0J A;  4KIF A;  2KQR A;  5DM7 F;  4RB2 C;  3M07 A;  1TH4 A;  2ZO4 A;  2D2W A;  2OV7 A;  5JR3 A;  3E0J B;  2ICW G;  3G3Z A;  4UB8 C;  3BLH B;  2V1U A;  3Q9S A;  3KET A;  4HST A;  3EIH A;  1SVM A;  3GLH B;  1XMA A;  1VEJ A;  1R6R A;  2CQ7 A;  1JST B;  1N4M A;  4HSR A;  2KHH A;  3A98 B;  1L1T A;  2NRA C;  1RR7 A;  2I10 A;  4DOZ A;  1OPC A;  1G3T A;  4ITQ A;  2HNH A;  3FXR A;  3H3U A;  1U6G A;  4LIU A;  5F1R A;  2BBY A;  1ZQ3 P;  5FRN A;  4DZJ A;  3D1N I;  2JRT A;  2ZFW A;  2EZK A;  4MH0 E;  2CRU A;  2V6E A;  3K4M A;  1LFU P;  2JVH A;  4B3M M;  2L7Z A;  3PQJ A;  4E7I A;  2WSC F;  4DBR A;  4LCB A;  3CC7 I;  4BCP B;  2M87 A;  1PJI A;  1AUA A;  3KDS E;  1AWC A;  1G2H A;  4U0W A;  3CMA I;  2JNH A;  3LFU A;  1SXJ D;  3TN8 B;  1LVK A;  2IP2 A;  2HOE A;  2M45 A;  4DYC A;  3T8R A;  2QKM B;  2W84 A;  3LW5 F;  2JRM A;  4D5F A;  4X0G A;  3UKG A;  3HHT B;  4FAS D;  3GW2 A;  1EE8 A;  1V5E A;  3K4K A;  2VQC A;  3BRO A;  3MFK A;  4EJV A;  3JRF A;  4MB7 A;  1OFI A;  2QEN A;  4GXO A;  4XLA A;  2L7I A;  3BR0 A;  1F43 A;  5B3S H;  1RC9 A;  3GPX A;  3W6J B;  2LVS A;  3RKW A;  2DXB B;  4EOR B;  1VFC A;  2RKO A;  1N78 A;  1MMN A;  2KLO A;  1MMS A;  3FMS A;  2C98 A;  4I76 A;  4U7B A;  5J8F A;  4FT8 A;  4PT5 A;  3GRU A;  2R18 A;  1Y56 A;  3E4R A;  3PO3 J;  3DOG B;  1TT0 A;  1N75 A;  4PCQ A;  3KOX E;  4XLC A;  2FNA A;  2CQQ A;  1S3J A;  1G3S A;  2R7S A;  2KIF A;  5HS8 A;  2ELH A;  2K9N A;  2MW8 A;  2Y21 A;  5F27 A;  4F2L A;  3LA2 A;  3AOE C;  3FIS A;  2MJ5 B;  3Q8G A;  3Q0W A;  4M73 A;  1P5E B;  5FB2 A;  3M1E A;  4NST B;  4BXX X;  3SHG B;  3QRF F;  2KXE A;  3KLN A;  2WIP B;  4DV2 M;  2A3S A;  2Z5U A;  2V6C A;  3Q3S A;  2HKJ A;  4P5O A;  3GLH A;  3KW6 A;  4KDP A;  3H9Q A;  2AXT C;  5B1B H;  3OSG A;  2ESH A;  4FET A;  1GUU A;  3GLG B;  4JYA M;  1SFK A;  2Y0S N;  2HQN A;  1BVS A;  3FHN A;  4IJA A;  4OU0 A;  4P96 A;  3ONQ A;  3RDI A;  2RVC A;  1BOB A;  5LHH A;  3OR2 C;  4LF7 M;  2RGV A;  4ANJ A;  2OC6 A;  4C9Y A;  3F5X B;  4XGI A;  4XBF A;  2M60 A;  1MH4 A;  4OIQ F;  1OCP A;  1HKS A;  5EF6 A;  3W2V A;  4UB6 C;  3HIF A;  1FIN B;  1REP C;  1QVU A;  2FQ4 A;  2OJE D;  1KFV A;  4G12 A;  3ZQH A;  1B9N A;  1KZH A;  3RPU D;  1NV9 A;  4JI1 M;  2PMH A;  4AC0 A;  5J40 A;  4A3D J;  5B1A H;  4BQQ A;  1DGH B;  2C4G B;  4C2M J;  2R5Y B;  2LF7 A;  2DAO A;  2QCU A;  5J3L A;  5FD6 A;  2DYS H;  2D1V A;  2HVR A;  1WJF A;  3S1R J;  3TWL A;  4JXJ A;  4UHT A;  1DV0 A;  4MGY E;  4BEH A;  3P5J A;  3VOE A;  3I04 M;  2R7D A;  2HU9 A;  3V7C A;  3R8F A;  5J47 A;  1O4X A;  4HDU A;  4A93 J;  2W25 A;  1SC7 A;  1UGR B;  5EGO B;  1VF9 A;  4LFU A;  2R44 A;  2IS6 A;  1WJ5 A;  2LVO C;  4XLN F;  2Y75 A;  1WHU A;  4W1U A;  4FTH A;  4EJU A;  3E6M A;  3GFJ A;  2L01 A;  3GFI A;  4XSZ F;  4CYC B;  3JAM Z;  1UHS A;  4LG0 A;  4X62 M;  1FT9 A;  3T0Y A;  1XCB A;  3QP5 A;  1F1Z A;  5GTH C;  1SXJ A;  1LJ9 A;  3IRR A;  2KR6 A;  1IRF A;  4AI6 A;  5C44 J;  3OYJ A;  3HTS B;  5FKM A;  5D8K B;  5HLT A;  3IG5 A;  4KHP M;  2EZI A;  2VB6 A;  3BTI A;  2R7V A;  4PCZ A;  5BNG A;  3NRV A;  3HOT A;  2ZME A;  2Y0T A;  2MLG A;  2DPU A;  4F6W B;  3CMM A;  5H2F C;  1PUF B;  3KP6 A;  1MND A;  1RRJ A;  3U6L A;  5KHD A;  3B73 A;  4FCW A;  4E7H A;  3FUX A;  1UZC A;  2LKS A;  3H0G J;  1OR7 A;  1C1K A;  2QF7 A;  3CES A;  2EA4 A;  1WH7 A;  4A3G J;  3PQK A;  5GTI C;  2DZL A;  2BY2 A;  3HOV J;  3GZN B;  3MHV C;  3DBL B;  4M0D A;  3SMP A;  4EAT A;  1I4W A;  1QDT A;  3B6C A;  1XNR M;  2CJM B;  3WGH A;  5E18 F;  3KP0 E;  2E60 A;  2VKH A;  1UFZ A;  1HJP A;  3U6C A;  1R1U A;  3EUA A;  1IN4 A;  2OQ4 A;  2C96 A;  3AL0 C;  3KEQ A;  5FD5 A;  2CHV A;  4L9V A;  3L25 A;  2LBF A;  3O3K A;  3J7A S;  1QZZ A;  2KJC A;  1NHW C;  2O5R A;  2VF8 A;  1TWA J;  3H0D A;  1F4K A;  2R46 A;  2XKP A;  2ZKZ A;  1R00 A;  1H28 B;  2PMI B;  4BCH B;  3KEY A;  1LE8 B;  2HHH M;  5LMN M;  2PQ8 A;  3DEW A;  3JRC A;  5ITQ A;  1O7F A;  2HKO A;  4RA2 A;  4I4L A;  3IP4 B;  5E3L A;  2GA2 A;  2CV1 A;  4A2U A;  4A3E J;  2QYO A;  3CCV I;  1WH5 A;  1B72 B;  1U9N A;  5DD8 A;  2XGE A;  3CP2 A;  3J81 Z;  2UZD B;  4RM2 A;  1OCT C;  4UNO A;  4BCO B;  1G3I A;  1MJB A;  4EJO A;  2VOO A;  2RRU A;  1O9K A;  2HFH A;  2DHR A;  3A01 A;  1YG2 A;  1IAW A;  5IPA A;  1IV8 A;  1T08 B;  1YI2 I;  3ZPL A;  2BJW A;  4E7S A;  2E1M C;  3DU5 A;  1OCZ H;  1WJA A;  3TOB A;  3FUW A;  2PEX A;  4ZYG A;  1HOM A;  3HXL A;  3JRG A;  2UUB M;  4L5I A;  4P55 A;  1S3S A;  4E7L A;  2VJ5 A;  1WVR A;  1BIA A;  2NVY J;  3QZ5 B;  5H37 D;  5F3W A;  1ZR2 A;  1V92 A;  3LSG A;  3K9T A;  4IBJ A;  2NOG A;  3CCY A;  4F6U B;  4FVM A;  5FRO A;  2KDL A;  3L28 A;  2CV2 A;  2OAZ A;  3CCS I;  3R61 A;  3L09 A;  2JK3 A;  3S2H J;  2K9D A;  4TV7 A;  1R2Y A;  4B4C A;  4I0A A;  2DD4 B;  4RLF A;  3DJB A;  1OIU B;  4IBB A;  1IV6 A;  2DZO B;  4HEO A;  2EIM H;  4RB3 C;  4RAG A;  2W9Z A;  3Q8X A;  1E9R A;  2OA4 A;  4OX9 M;  4AUX A;  3ZMU A;  4CFU D;  4XKV A;  2HZT A;  2CUZ A;  2LRE A;  3M8J A;  1QLB A;  1UST A;  2DTR A;  3PXG A;  3BJ6 A;  4BQO A;  1H27 B;  2IW5 A;  3GME A;  2DMP A;  4IQ4 A;  1OIZ A;  5J1U A;  3W3C A;  4LLG F;  5E1W A;  2HDC A;  5FJ8 J;  1N77 A;  1GHC A;  3GLG A;  2ZAO A;  2XGN A;  1LV7 A;  3KEO A;  5LD2 C;  1QUS A;  3BOQ A;  2EUC A;  3DPL C;  2F48 A;  2HXO A;  1WFX A;  3GPY A;  2H1R A;  1ZAR A;  4LIT A;  1UG2 A;  2IXS A;  2DLL A;  3QAU A;  4IO9 F;  3MZ8 A;  3DKX A;  3FKI J;  1D1B A;  2JN6 A;  3R60 A;  1K6Y A;  3SZT A;  2ZME C;  3OMY A;  2IGN A;  4U7D A;  3AG2 H;  2W82 A;  1TQP A;  1T38 A;  1FTZ A;  2EUF A;  4U88 A;  2BHZ A;  3A2K A;  4E70 A;  1H89 C;  1KA8 A;  1YJN I;  5IRE B;  4RDU A;  4AID A;  5DQW A;  5E20 A;  1CF7 A;  1IGN A;  4Q4Z F;  5FLX Z;  3CF0 A;  5ICF A;  1HA8 A;  4XLF A;  4M72 A;  1VOL A;  2DCE A;  1USS A;  3RFW A;  2C5V B;  3H4C A;  2I7P A;  2EJR A;  1MNM C;  4EON B;  4L9J A;  1MH3 A;  4N4N B;  4XOR A;  5CYV A;  4AVP A;  3M3Y J;  2APL A;  2BPM B;  3VFD A;  2DU9 A;  3RQ4 A;  2XC7 A;  3SJM A;  1NG7 A;  1GVJ A;  2LHG A;  3HHH A;  3G4S I;  1IRG A;  3MY5 B;  2D5V A;  1EKE A;  4CYC A;  1ZRD A;  3I56 I;  1KU7 A;  4A6D A;  3ZMS A;  2MH2 A;  1LUJ B;  1VZ0 A;  4FQG A;  1XB4 A;  2M30 A;  2DA2 A;  3ML6 A;  2DDA A;  2X0L A;  1XSD A;  4JI3 M;  3UMM A;  2RAE A;  4ENK A;  1T95 A;  1E3O C;  3PO3 S;  1IRZ A;  4PGG A;  4BBS J;  5K5Q A;  4QHS A;  2L5Q A;  2K3P A;  3CLQ A;  5D5V B;  4WW0 A;  3SDB A;  3U6M A;  1FP1 D;  4LOC A;  4RAF A;  4BE1 A;  3DTE A;  2K9M A;  3U2R A;  2R5Y A;  2E5N A;  3C9P A;  1XXH B;  5ITX E;  1W7P D;  2NVT J;  1X19 A;  3R0A A;  3QOD A;  3ULQ B;  3MZY A;  2JUC A;  5M3M J;  2R5Z A;  3H3Z A;  2FBK A;  3BXW A;  5IOZ A;  4L5E A;  1TD6 A;  2BS4 A;  2DT6 A;  1JHH A;  5EZH A;  3S8P A;  3TO9 A;  1TFB A;  4IBC A;  5FTN A;  3HUG B;  1JR3 D;  2PMZ A;  2Y48 A;  4LMY A;  3T5X A;  4QIW N;  2MAB A;  2NS7 A;  4DW6 A;  1QAM A;  2QFZ A;  1I94 M;  3TWK A;  3T15 A;  4GIT A;  1Q1H A;  2BXZ A;  2JVG A;  4MQV A;  4BH9 A;  2VQE M;  9ANT A;  1H1P B;  1R5I D;  5E26 A;  2HTJ A;  3WHC A;  3WE3 A;  2XPU A;  3H5N A;  1T98 A;  2EFW A;  1VQ9 I;  1VQ6 I;  2XFS A;  3BWG A;  3GLH E;  3AFH A;  3NAU A;  4AKG A;  3Q0V A;  3RQI A;  3JRE A;  3IL2 A;  4RBO A;  4N9H A;  4RF0 A;  1W98 B;  3VYU B;  2WB1 N;  3SFI A;  4CFU B;  3NWS A;  3A42 A;  1QQI A;  4A3C J;  2KRC A;  2MA3 A;  2PMU A;  1P4W A;  3HHX A;  2STT A;  4B47 A;  2OQR A;  4CJ6 A;  5F6F A;  3GWZ A;  3JR5 A;  5EEG A;  5F04 A;  2YFQ A;  1LKX A;  3TE6 A;  3VKG A;  4GHL A;  2HS5 A;  4RGS A;  3TED A;  4LFB M;  3ERE D;  1ZGJ A;  3KP2 A;  2WMA B;  3X20 B;  4L18 B;  2M34 A;  1I50 J;  3ZQ7 A;  2EK5 A;  1YRN B;  2C5X B;  1XTA A;  1TH2 A;  2FXA A;  1X1D A;  4RLQ A;  4HNV A;  2DA6 A;  1BC7 C;  3QPS A;  2CP8 A;  2F5N A;  4HNU A;  4XRF A;  2KNZ A;  4KO8 A;  1T6S A;  1UFM A;  2VXD A;  4HPQ A;  2RGH A;  3VSL A;  1GXP A;  3JRB A;  4B3S M;  3LCV B;  5EYR A;  1W1W E;  4IMY B;  3T38 A;  3U21 A;  1E17 A;  1ENW A;  1R22 A;  1T0F A;  4NDL A;  2P5T A;  2QSG X;  3G33 B;  1SFX A;  2QUF A;  3DV8 A;  3HSF A;  2HPM A;  1G4D A;  1Z3X A;  2ZSH B;  2QP9 X;  3DOA A;  3E9S A;  1RKW A;  3IH4 A;  1TDZ A;  2V9K A;  2WAE A;  3K1N A;  4KIB A;  2H1K A;  4BEH B;  1QGP A;  2CWB A;  2QGU A;  4HA8 A;  3UR3 C;  1JT0 A;  5L3E A;  5LLQ A;  1PJS A;  2O25 A;  4FCV A;  3RGS A;  2VPR A;  2PI0 A;  4CXA B;  3K7A M;  2E5Z A;  5IYB J;  3FTF A;  5FTM A;  3H36 A;  4M3G A;  1R23 A;  2W4S A;  3IKT A;  3I53 A;  2IS2 A;  1BA5 A;  2BNK A;  1QQW A;  5TJJ A;  2IS4 A;  5LHI A;  3CTA A;  2UZB B;  2CZ0 B;  1X1A A;  3QYE A;  3OYC A;  4OB0 B;  2A6E F;  4MFD A;  4XRM A;  2PMZ N;  4F7L B;  1WI3 A;  1PVE A;  1G6N A;  1MBF A;  3WG9 A;  1ORK A;  3R6S A;  3DEE A;  1ETO A;  2BE5 F;  4XLE A;  2HEO A;  5K1Y A;  3VLF B;  1IW7 F;  1XMK A;  2UZK A;  2JA8 J;  3A8G B;  1G8P A;  3QYG B;  3DBH B;  3FX3 A;  4H4K C;  4A5M A;  3UZU A;  1EH8 A;  1P7I A;  4I2O A;  1IRE B;  4D0P A;  2DWL A;  2PBI A;  2KRK A;  5EJC A;  1L2B A;  1B59 A;  1J2X A;  3PNT A;  1X3W B;  2V26 A;  4JYK A;  3HOZ J;  3B7Q A;  4PK4 A;  4GYI A;  3C18 A;  2ZB9 A;  3GUD A;  3ZOB A;  4KYW A;  1ERD A;  2BY0 A;  3E7L A;  4PFP A;  4PJN A;  4BAC A;  3KP1 E;  1UCR A;  3WTY C;  1U0J A;  1UHM A;  1PJT A;  1G8X A;  2ZBK B;  1XNQ M;  4X66 M;  4CCM A;  1P6R A;  2H5X A;  3L2Q A;  4GRI A;  3TNI B;  5E3N A;  2GBY A;  3OL4 A;  4ELJ A;  1OFC X;  4PJ0 C;  1VYW B;  4X64 M;  4EVI A;  3OYA A;  1K4S A;  1SXJ C;  2WBM A;  2WC2 A;  1KQ9 A;  1GDT A;  3HHG A;  4LG3 A;  3GLL A;  2FEZ A;  2DT7 B;  3I01 M;  4HL4 A;  4Q48 A;  1L1Z A;  1AKH B;  4M3E A;  2XH9 A;  3E46 A;  3L2C A;  4O5V A;  2UZE B;  1HW1 A;  2TCT A;  1AHD P;  2GLO A;  4BQN A;  3ZQC A;  5GPC A;  1SAU A;  1IO2 A;  1X1C A;  2OTL I;  2EIK H;  2M0C A;  2LY9 A;  3K0L A;  2L02 A;  2HPI A;  4GH9 A;  2R0I A;  3ZR8 X;  2LMD A;  3DF8 A;  2IS1 A;  1GUX A;  3TNW B;  4LZZ A;  4AKI A;  4PDI A;  4HW0 A;  4XKW A;  1H88 C;  1NV8 A;  1OMI A;  2GOM A;  4BHC A;  2KFD A;  1P4X A;  4E7Z A;  1N25 A;  1VQ4 I;  4RGU A;  3EYI A;  4BJT A;  4GFB A;  2J5P A;  1R5G A;  1VQ8 I;  5DNY A;  1W4M A;  2CW7 A;  1NG6 A;  3KYD B;  3O8G A;  2DMT A;  4A3F J;  1B4A A;  4FIS A;  2WY8 Q;  3HU2 A;  4RMN A;  1YIT I;  1WQ2 A;  2M3A A;  4PSX A;  2KRF A;  2ZJ2 A;  1A6I A;  4MEY F;  4CDG A;  2I53 A;  4JX4 A;  2EIN H;  1JGG A;  1HR0 M;  2J7N A;  1DDN A;  4LZJ A;  4BBS M;  3HRT A;  4HNT A;  3T1B A;  2EH3 A;  1WJC A;  4I3Z B;  1FSH A;  4F7Z A;  3BDD A;  1BU2 A;  5H6Q A;  3KS8 A;  2EFP A;  3KYL A;  3LVV A;  1K82 A;  1PYV A;  1Y8R B;  3FUV A;  3BHU B;  3X24 B;  2HVQ A;  5EXX A;  2DD5 B;  4A3L J;  2R7O A;  2HZD A;  5GAH J;  4B7G A;  4OIO F;  1Z91 A;  4FWH A;  2JSC A;  2FU4 A;  3QXE B;  4L9T A;  3VEP A;  4PD2 A;  4IXA A;  3IC7 A;  3OYN A;  4Z6Y A;  2BY1 A;  2G5G X;  1D0X A;  1O3S A;  4G4Q A;  3DBR B;  2F5S A;  5DS9 A;  3CUQ B;  2IT0 A;  2R62 A;  2A05 A;  1Z5A A;  3CCJ I;  1KGS A;  3THG A;  2VUM J;  1MIJ A;  1YLA A;  2VC0 A;  3K1J A;  4IVN A;  3KHI A;  2CW0 F;  4KT5 C;  4BCN B;  5HS9 A;  3K70 C;  2WB1 A;  4LJ8 A;  2KIS A;  2QQA A;  5ITU A;  2COB A;  3TWM A;  4KIT B;  3RIR A;  3RI4 A;  2PJR A;  3L9F A;  2L3D A;  3K92 A;  2DI3 A;  2E35 A;  3U9G A;  4ASN A;  2XEP A;  5BPI A;  2DDB A;  2V79 A;  3DA1 A;  3ZMV A;  4YFN F;  3QPH A;  1NJF A;  2GXB A;  2XAQ A;  5LMU M;  5BMZ A;  4C3H J;  4EV0 A;  1G4A E;  1QZE A;  1V3F A;  2DAK A;  2LY1 A;  2OQG A;  5DTD A;  3RZO J;  3L7W A;  2DMQ A;  2F5V A;  3BPV A;  4LG2 A;  3SYL A;  2STW A;  2ZPH B;  4ZYA A;  4BHP A;  3WVE B;  2CFX A;  2IPQ X;  1K83 J;  1S7E A;  1WSU A;  5FGM A;  3FM5 A;  2QSF X;  4Y13 A;  1ODD A;  3BQZ A;  1U78 A;  4LRS A;  2KRH A;  2NVU B;  2H8R A;  4KNY A;  4I8O A;  2UXC M;  4G7O F;  1W36 C;  1S5L C;  1A04 A;  2L4A A;  3KIO A;  5M3F J;  1W5S A;  2W1O A;  3DTO A;  4QWQ A;  3K70 D;  4WXH A;  3MEX A;  4I81 A;  1BR4 A;  1ON1 A;  4LF4 M;  1TWF J;  1X58 A;  1LB2 A;  4OB3 B;  4CFM B;  1IXS A;  1BI3 A;  4OR5 B;  2B7E A;  4PFO A;  4MEX F;  3HSR A;  2OPF A;  4XLH A;  2DJN A;  1PGY A;  3AKZ A;  3BG5 A;  1J59 A;  4KRD B;  5CQE A;  2YU9 J;  4EOI B;  3BZK A;  2Y9Y A;  3E3V A;  4KFC A;  2JY7 A;  4I99 C;  1I5Z A;  1GVD A;  4FW9 A;  1G3W A;  4R79 A;  1BI2 A;  3OYB A;  1IY0 A;  5ITT A;  3GLI B;  3C2B A;  1KU9 A;  2M9H A;  4BUP A;  2X6O A;  1Z0X A;  3MWM A;  2L54 A;  3FXO A;  1KXU A;  3UNG C;  5GP9 A;  2HYJ A;  1R7J A;  3B57 A;  2ZXW H;  4IJE A;  4LK0 F;  4NBQ A;  2EWN A;  3EYY A;  2VXZ A;  2XB0 X;  1V29 B;  3CQZ J;  2WJ9 A;  2WMB B;  4II2 A;  2RKH A;  4G94 A;  1S9H A;  4IBE A;  4HEA 2;  1DUX C;  1B8I B;  3DZD A;  5EP4 A;  1UGS B;  3LST A;  5HDN A;  2K0B X;  1XWI A;  3OTO M;  3C7J A;  3D5S C;  1VQ1 A;  2UUC M;  4JI8 M;  1FMV A;  5B66 C;  3S3N A;  5F0F A;  1EH7 A;  3KZZ A;  2KP6 A;  3K1P A;  5FKN A;  4FCY A;  4PJL A;  2X85 A;  4YFX F;  5JFR A;  1D3Y A;  5EP1 A;  3ZH9 B;  1XCV A;  1AU7 A;  3WGG A;  4B43 A;  3OYG A;  4RAY A;  3TO7 A;  1TW2 A;  2F5O A;  2R7W A;  4ON0 A;  1ZQ9 A;  4LFC M;  4QNM A;  2WY7 Q;  3G1L A;  4LB6 B;  3OYH A;  3GTP J;  2XZF A;  3E5X A;  2KHM A;  1TDH A;  3U61 A;  3K4L A;  3SXY A;  3ZQI A;  3T6P A;  3CF6 E;  3U5Z B;  2Q8K A;  3R9X B;  1MKM A;  2OD5 A;  5IYC J;  3FF5 A;  4A3I J;  4Q5S F;  4FD2 A;  4UVB A;  3HSE A;  3SZG A;  2XRO A;  4AG5 A;  3P7N A;  2K5C A;  1BJZ A;  4AYB A;  3SAV A;  1WJB A;  5D5U B;  4D82 A;  5FKL A;  5KQD A;  1TWH J;  3LCU A;  1ZMU A;  4O3M A;  1TNT A;  4S0H B;  2JWT A;  3HOW J;  1IC8 A;  2EO2 A;  4JN6 A;  4A3M J;  2Z1D A;  1LFB A;  2R65 A;  2FE8 A;  4FM4 B;  4F7N B;  2H94 A;  3BOS A;  2ZPF B;  4XR6 A;  3JTG A;  1IJW C;  2G8L A;  4IBF A;  4OOI A;  4DJA A;  4Q7J A;  1E3H A;  2VII A;  3QP6 A;  3B89 A;  2IA1 A;  3DWL E;  4NQW A;  2XSZ A;  3EDP A;  4AU7 A;  1H1Q B;  2VOD A;  1GJS A;  2X48 A;  3U5Z A;  3WG7 H;  1XC8 A;  4MNU A;  5JI6 A;  4MFE A;  4L78 A;  2W96 A;  2F6C A;  4RB1 A;  1ZAE A;  4PJM A;  2D0Q B;  1JUS A;  5KQ8 A;  2P5L C;  2RV8 A;  2JQ7 A;  2D7H A;  1Z3Y A;  1DP3 A;  3A0H C;  1UJ8 A;  3I3L A;  1IBK M;  1Z6R A;  4C30 A;  1VQM I;  1D1A A;  2ZPE B;  1GL7 A;  5HDG A;  4D7M A;  2R7T A;  3E1S A;  2LVQ D;  2CUE A;  2WPA B;  3GTO J;  1VG5 A;  1ZLK A;  4JP0 A;  5ILV A;  3MZH A;  1RR8 C;  4PDG A;  2Z99 A;  2KMU A;  1T2K A;  1A36 A;  2VPL A;  2AS5 F;  1Z05 A;  2DZN B;  1D5Y A;  4DV1 M;  3J7Y J;  4ZDO A;  2FMY A;  3F72 A;  4XOT A;  4KT6 A;  1T39 A;  1ON2 A;  3L29 A;  4CA0 A;  3DPU A;  1Q3B A;  1PJR A;  4PGH A;  2BW3 B;  3G6E I;  4EGZ A;  4KOD A;  2JY8 A;  2O61 A;  2R5Z B;  4EOL B;  2PK2 A;  3WGI A;  2DEN A;  3W0L B;  3H1C A;  4CGY B;  2D45 A;  4EOS B;  1LDJ A;  3LQ5 B;  1YQA A;  2CUJ A;  4AYB N;  8CAT A;  4NRW A;  1NY6 A;  4E4H A;  3J80 K;  2K85 A;  1OGU B;  4CCN A;  3GBG A;  2PN6 A;  4ZYH A;  4B7H A;  3A8M B;  2EV0 A;  4LJ5 A;  5EZG A;  2RQP A;  5FTL A;  1Z1D A;  1MSF C;  3MMP A;  5CVV A;  4PUS A;  4FX3 B;  4QPO A;  2YS9 A;  3AAF A;  3EID B;  3TOA A;  1G3Y A;  2A5W A;  5KK1 A;  3FTE A;  2BHY A;  1SD7 A;  2A68 F;  1EFU B;  1QAN A;  3F8C A;  4IL6 C;  2A61 A;  4P9U A;  3LSR A;  3VFZ A;  3G1M A;  1SD5 A;  1A5T A;  5JHU A;  5L3B A;  3LNQ A;  1B9M A;  3SQN A;  3RJP A;  4IRI A;  2RNG A;  4G6Z A;  3I59 B;  4JI0 M;  2ZJP F;  4JI5 M;  2A6H F;  3I58 A;  1RUN A;  5IT9 Z;  3I9V 2;  3SYK A;  2DA1 A;  2P81 A;  2V1X A;  3CCU I;  1XGN A;  2VN2 A;  1FLI A;  5D6E A;  5IZ7 D;  1ONV A;  2WAD A;  2Z9O A;  4D80 A;  3B7N A;  4MHG A;  4UVC A;  1VQO I;  2D7E A;  4JBA A;  2JY5 A;  2WA0 A;  4YIF A;  5HBH B;  4DV3 M;  2VBY A;  2OO9 A;  2WXV B;  3SAR A;  4BCF B;  1HC8 A;  4NHJ A;  1T56 A;  2GAU A;  1OJL A;  1X4P A;  4L15 A;  2E1C A;  1BW5 A;  2O6G E;  3ZQL A;  4LY6 A;  3HPG A;  2PJQ A;  1OLT A;  4X1E A;  4UUV A;  1IN5 A;  2DN0 A;  4XRS A;  3X2Q H;  4Y3O A;  2XV4 S;  2GIV A;  4GKK M;  2MD0 A;  2HYG D;  2OCE A;  2VBX A;  3I0T A;  4G6T B;  2VT3 A;  3TMO A;  1IFY A;  2ZTD A;  3VK7 A;  1YOV B;  5EGO A;  3BG9 A;  1K6O A;  5DEQ A;  5L8R F;  1O57 A;  2H6B A;  4IBI A;  3GO5 A;  3W2A A;  2IEK A;  1IN6 A;  3K4B A;  1NHA A;  3TP3 A;  2HKX A;  1QMZ B;  3MI9 B;  2K7L A;  3MVP A;  5E3M A;  4CRL B;  4OIN F;  4P9F A;  1E3P A;  3MIA B;  1HT2 E;  1QRY A;  4DV4 M;  4CO8 A;  1FOX A;  1OIP A;  3GLF E;  1UNL D;  2CZ7 B;  4BS9 A;  2EZH A;  4RGR A;  3J7B A;  3VYG B;  3AG4 H;  1ZG1 A;  2ZPB B;  2BXY A;  2VQG A;  2P8T A;  4HLQ A;  3J7A O;  4BCM D;  3U1K A;  3JTH A;  1AKH A;  3FMR A;  3HHZ A;  3KPH A;  3A02 A;  3WTU C;  3C3E A;  2QLZ A;  4G4N A;  1ETY A;  2F4I A;  5E8I A;  1XB2 B;  2QBY B;  4HF0 A;  5EP3 A;  3V76 A;  1D5V A;  5HS7 A;  2CYZ B;  1FTT A;  1PM5 A;  1QU3 A;  3WU2 C;  4FX0 A;  3OIO A;  3B6A A;  1JUP A;  2WV0 A;  4U0V A;  3NAR A;  1D2N A;  2FS1 A;  1MZB A;  3RTR A;  5ICG A;  1R71 A;  4EC8 B;  4DQ2 A;  1NK2 P;  4J00 A;  2EQR A;  2HI3 A;  2XGX A;  2DOA A;  4EOQ B;  1NY5 A;  2AQF A;  3GLF B;  2YPR A;  1GJT A;  4GCV A;  1WCM J;  4AZF A;  5DQV A;  1TQM A;  1NVM A;  2WAQ A;  3JSP A;  1D0Y A;  2GWR A;  2E7X A;  3MD2 A;  4KN4 X;  5JI3 E;  5J1R A;  3GYH X;  4IZZ A;  1KSF X;  2XKO A;  3OOP A;  4ZTF A;  1XGO A;  2QM3 A;  3WE2 A;  2PG4 A;  2CS3 A;  2FF4 A;  3SFZ A;  1IBL M;  1JKR C;  4FCT A;  5JLX A;  1Y0U A;  3J80 S;  3OS0 A;  3MAJ A;  1HST A;  1NTC A;  3CO7 C;  3HRM A;  4MLO A;  3C3D A;  3K9P A;  3H5A A;  3CUQ C;  3IWF A;  3MKL A;  1B72 A;  2CQX A;  2K86 A;  3VDU A;  3GLF A;  2WZJ A;  1K61 A;  2R7U A;  5IP7 J;  1JKQ C;  1YX3 A;  5KCM A;  2XPV A;  3GTM S;  4MGK E;  3CC2 I;  1MDM A;  5CVI A;  5EP2 A;  3NWL A;  1HW5 A;  3ABL H;  5EDN A;  1ZKG A;  1T0F C;  5E6J A;  1Z77 A;  4JK1 X;  2XB5 A;  1I27 A;  1WI9 A;  1EIJ A;  1ZR4 A;  3HOU J;  3HKP A;  3LAJ A;  2V1D A;  4KMF A;  1IXR C;  5E8G A;  4Z8X A;  4X6A J;  3A8H B;  2BW3 A;  5HDK A;  2V9V A;  3HGG A;  4DR1 M;  4E7K A;  5IT3 A;  3FXK A;  4ZPX A;  4AM3 A;  5LHG A;  1IM2 A;  3OV8 A;  3FE3 A;  2TRT A;  3A46 A;  2DME A;  2L2O A;  2Z8Y M;  4RM3 A;  3QPL A;  5ICE A;  3G2B A;  2XVC A;  3OIQ A;  2QWW A;  2R7R A;  1R4G A;  4BKX A;  3GVA A;  4HF1 A;  5KPZ A;  1U5T A;  3N4M A;  5AIP A;  1JKP C;  2EZL A;  2YR2 A;  2XAF A;  2FUG 2;  4LJZ F;  3PUF A;  4M3D A;  1UNH D;  1T6O A;  1FEX A;  3GTL J;  2F4O B;  2KNA A;  2HYF A;  1OFH A;  3I64 A;  1YRN A;  4W97 A;  5EFQ B;  1DGH A;  4XID A;  3S3M A;  5HLI A;  3JSO A;  2FE3 A;  3SHF A;  3MMY B;  4I5S A;  2E1M B;  3GTG J;  5CKT A;  3WTT C;  2E34 A;  1KQ8 A;  4DYQ A;  1KON A;  1O7L A;  1P3Q Q;  3M6A A;  3FXQ A;  3MN2 A;  4XMY A;  4WF2 A;  4XON A;  3DDP B;  5J4V A;  5DYM A;  4MGI E;  2BS3 A;  4NC6 A;  5K7H A;  4DR6 M;  2Y0Q A;  2FBI A;  1B1B A;  2MYS A;  4M9X A;  5BQT A;  4F91 B;  1YE9 A;  2XSZ D;  1TWC J;  2ESN A;  4WXC A;  1DPR A;  1GO5 A;  2LH0 A;  4KRC B;  3SC3 A;  4FX4 A;  1OCO H;  1QYR A;  1IQP A;  2LF8 A;  2L9V A;  2FH0 A;  3HL2 A;  2VE8 A;  1LDD A;  1OAI A;  3FTD A;  5M5Y J;  4IHY A;  1HKQ A;  2L4F A;  4P1W A;  3A8L B;  5KVR A;  4FWD A;  1TW3 A;  1GKI A;  4A0Y A;  1YW9 A;  1SXJ B;  1KU2 A;  3DKW A;  4OIR F;  3BLR B;  3BC8 A;  4F6S B;  3GQ5 A;  2E36 A;  2KT0 A;  5IF1 B;  2XUB A;  1T8I A;  1V33 A;  3HJQ A;  2RDP A;  4KIS A;  3OYI A;  2VQF M;  5IDN B;  1XMQ M;  4PZJ A;  4CIS A;  1B6A A;  1LPQ A;  2H6C A;  4YEL A;  2ZPG B;  2MG4 A;  2QQB A;  4BCK B;  5A2Q S;  2Q0O A;  3QU6 A;  1R9T J;  1WGL A;  1YUB A;  3FKE A;  1YW7 A;  2DW4 A;  1F5Q B;  4B7F A;  2KZG A;  4ZTJ A;  4JV5 M;  3I4M J;  3FXL A;  3F0C A;  2FD5 A;  3FRH A;  5EG0 B;  2XAU A;  3ZC7 B;  2L9S A;  3DKY A;  5BR8 M;  1FOW A;  1NNJ A;  2KL4 A;  3QYH B;  4LJ6 A;  2GNO A;  3OYF A;  4G9Y A;  4B3A A;  3IWZ A;  1AHJ B;  3QYB A;  3N97 A;  2E2I J;  5EQT A;  4UN0 A;  3AG1 H;  2QQ9 A;  2W57 A;  1NSF A;  2DAE A;  3RKX A;  4OW0 A;  2G9X B;  1ZLJ A;  3OYD A;  1J75 A;  1IUF A;  2E1O A;  4R71 A;  3LSK A;  1Z6T A;  4MQ9 F;  3CTW B;  2DA5 A;  3BZ6 A;  2F4M B;  2MD5 A;  4CFX B;  1OL2 B;  2C5N B;  3J7A Y;  2IVX A;  2C6T B;  3FXU A;  2KIU A;  1URC B;  2DQL A;  2O01 F;  2PFB A;  2K4B A;  4ZDP A;  3LSJ A;  4WCG A;  2K9S A;  4OB2 B;  2HVS A;  3T1Y M;  5CQG A;  2YR0 A;  4DUY M;  3U6E A;  4UUS B;  5HQ0 B;  2NVX J;  4IIW A;  3A0B C;  3J7Z I;  3WTX C;  3DEU A;  4YEJ A;  1H4L D;  4E6K G;  1MBJ A;  2V7F A;  2JA2 A;  1LTM A;  4HF2 A;  2GQQ A;  3CDI A;  2VAS A;  2M7B A;  2JPC A;  2EKF A;  2P0W A;  1KYZ A;  2R3S A;  1RET A;  3IHU A;  4XL9 A;  2UWM A;  2R6F A;  1ZG5 A;  4HRI A;  2R92 J;  3Q5F A;  4R8H A;  3C2G A;  1YIO A;  1FMW A;  1WR1 B;  1R58 A;  1WJE A;  2HXI A;  1FPQ A;  3BCA A;  4YII A;  3KE2 A;  3KCC A;  2EJS A;  2X9D A;  3C3W A;  3OSF A;  4PJJ A;  3VYH B;  2XRN A;  3TL4 X;  1JQJ C;  3HB9 A;  2O8K A;  2I5U A;  3R4K A;  1IXZ A;  1VI0 A;  3FZV A;  2IW6 B;  3LL7 A;  1N36 M;  1DGR M;  4HBL A;  2OOA A;  2VBZ A;  4HQE A;  2I7N A;  4JX5 A;  1DQU A;  5FFZ A;  4M6V A;  3RYR A;  1FJG M;  1W0T A;  2E7W A;  3H4M A;  5K5R A;  3NWT A;  1FIA A;  4IHV A;  4L6V 6;  3UK6 A;  4MGR A;  1HT1 E;  1W0U A;  4FHT A;  3CD6 I;  2JT1 A;  3HRU A;  2QPA A;  1R1V A;  2EV5 A;  2VQL A;  2MC3 A;  3TPZ A;  4KJZ A;  5H6R A;  2DK8 A;  2X6W A;  4XM3 A;  2DA3 A;  5CLS A;  2JA5 J;  4ROD A;  2A5Y B;  2DFE A;  2KW0 A;  3GTJ J;  3SAT A;  4Y17 A;  1ZP2 A;  3W2W A;  3FKJ A;  2CEA A;  3PNV A;  2DOE A;  2WHB B;  4ETS A;  4G3O A;  4MM3 B;  5M5W J;  1WWX A;  2C99 A;  2HOS A;  3LSI A;  5J4Y A;  2ZAM A;  4IEJ A;  5JVT A;  2CZ6 B;  5FLX K;  5FLM J;  2DI0 A;  1O9K B;  2VC1 A;  4BY1 J;  3I4Y A;  4ITV A;  2K47 A;  3U6P A;  2V1C A;  1WPK A;  2Z4R A;  2QVO A;  1OYI A;  3PFY A;  5DCF A;  4AKH A;  2JTV A;  4YOO A;  3WU1 B;  1TR8 A;  5TRD A;  1GL6 A;  2O9L A; 
#chains in the Genus database with same CATH homology
 2LG4 A;  4KIT B;  2DXB B;  2RQQ A;  3D5R C;  2PJR A;  1N78 A;  1MMN A;  2KLO A;  1Y6I A;  2ZXH A;  4BBR M;  2VL8 A;  4U7B A;  2I8D A;  3K4C A;  2LC2 A;  1Y56 A;  4ZGJ B;  1TT0 A;  1N75 A;  4XLC A;  4II3 A;  2LY1 A;  2R7S A;  2ZPH B;  2F5V A;  3CP8 A;  2VIX A;  4ZYA A;  3WVE B;  4NC8 A;  4ZDL A;  2KRH A;  1D1C A;  4P5O A;  1W36 C;  3H9Q A;  4QSH A;  2CW8 A;  3DPT A;  2CZ1 B;  4FET A;  4OB1 B;  4ZGE B;  4BGD A;  1SFK A;  5KNL A;  2DXI A;  2W1O A;  3OR1 C;  4U87 A;  3K70 D;  3FHN A;  1AA7 A;  1BR4 A;  3ONQ A;  4D1Q A;  4OB3 B;  1D0Z A;  1BOB A;  3OR2 C;  4ANJ A;  2OC6 A;  4C9Y A;  4BJ5 C;  4PFO A;  4XQF A;  4IQJ A;  3DTK A;  3RSN A;  4XLH A;  3W2V A;  3HPH A;  3TBI A;  3AKZ A;  4OWR B;  3BG5 A;  5CQE A;  1E7P A;  4B48 A;  3RPU D;  2V4J C;  4R79 A;  3X25 B;  3OYB A;  2DXC B;  2ZFU A;  4BUP A;  4BQQ A;  3L2R A;  3X28 B;  3UNG C;  2BS2 A;  2HVR A;  1WJF A;  4C2T A;  1GLN A;  3D5L A;  2VXZ A;  4BEH A;  4F92 B;  1V29 B;  2WJ9 A;  4II2 A;  2HU9 A;  3CZ6 A;  3TW6 A;  4XNF A;  1S9H A;  4HEA 2;  3IAS 2;  1UGR B;  1UGS B;  1MW7 A;  3X26 B;  1IRX A;  3D5S C;  2IS6 A;  2KMG A;  1FMV A;  1WJ5 A;  3S3N A;  3HO8 A;  2KP6 A;  4PJL A;  2X85 A;  3OL3 A;  2M7A A;  2KR6 A;  4B43 A;  3OYG A;  4AI6 A;  3PSI A;  3OYJ A;  3VYS B;  3HBL A;  5HLT A;  2R7W A;  2VB6 A;  2BOL A;  1Z21 A;  2WY7 Q;  3A4C A;  3CJQ B;  3OYH A;  3L2U A;  3HOT A;  2R7V A;  2KHM A;  3K4L A;  2A6T A;  2CFO A;  3CMM A;  1W36 D;  1MND A;  5KHD A;  4E7H A;  2LRD A;  4AVZ A;  4CCJ A;  3SZG A;  3CES A;  2QF7 A;  2K5C A;  4AYB A;  3F9K A;  1WJB A;  1MNE A;  2Q2E B;  1Z7L A;  2M4G A;  3LSH A;  3QWL A;  2L9N A;  4EAT A;  2Z1D A;  3L2V A;  4BJ6 C;  2ZCF B;  4NQW B;  4FM4 B;  2E60 A;  4B3X A;  2VKH A;  4XR6 A;  2ZPF B;  3HOS A;  3M1C A;  3MKW B;  3EUA A;  4DJA A;  3BLY A;  2KPM A;  3AL0 C;  1EA3 A;  2LBF A;  3DWL E;  2O5R A;  3QOE A;  4AU7 A;  5LFA A;  3H0D A;  4MFE A;  3KEY A;  2F6C A;  3DQV C;  4PJM A;  2D0Q B;  2KZV A;  4BE0 A;  3IP4 B;  2CV1 A;  1Z3Y A;  1DP3 A;  4BBS M;  3I3L A;  4C30 A;  4ZC3 A;  3RCO A;  5JHF A;  1D1A A;  2ZPE B;  2BVL A;  2R7T A;  3CP2 A;  3E1S A;  1FKM A;  5FRM A;  4J01 A;  4RM2 A;  4CCK A;  2QDY B;  4BE2 A;  2KMU A;  1E0E A;  3HKZ A;  1QHH D;  2VPL A;  2ZPI B;  2VJ4 A;  4CH7 A;  3MKY B;  4ZDO A;  4E7S A;  2ZXI A;  4XOT A;  2E1M C;  3DU5 A;  2VLA A;  4KT6 A;  1WJA A;  2V1N A;  3HXL A;  4JQF A;  4CA0 A;  3DPU A;  4BL0 B;  1PJR A;  2QDJ A;  2BW3 B;  4E7L A;  4XOP A;  5CPR B;  1QHG A;  2VJ5 A;  3QZ5 B;  3ZRG A;  4Y4R A;  3FBI B;  3LSG A;  3OYK A;  3VKH A;  5FRO A;  2CV2 A;  2CUJ A;  3K6G A;  3BG6 A;  4E4H A;  4CCN A;  3GBG A;  2DD4 B;  2GOX B;  4RLF A;  3A8M B;  4XKC A;  1MMG A;  4PUS A;  4QPO A;  4HG2 A;  2A5W A;  2RRE A;  2XF7 A;  4XKV A;  4BXF A;  4F3Q A;  2CUZ A;  2LRE A;  3M8J A;  1QLB A;  2LOO A;  1P9Q C;  3EUK L;  4BQO A;  3PJR A;  2Q1Z B;  4IQ4 A;  3W3C A;  2RNG A;  1N77 A;  5LD2 C;  3OYM A;  3DPL C;  3I9V 2;  2Y0S A;  2X1C A;  1WFX A;  1BR1 A;  4LIT A;  3K4N A;  2IXS A;  2WAD A;  3VDX A;  3DKX A;  1D1B A;  4Y33 A;  2WA0 A;  1K6Y A;  5HVQ C;  3IAM 2;  3OMY A;  2IGN A;  3HC7 A;  2KDO A;  2W82 A;  1X4P A;  2AHJ B;  2WAF A;  3DLA A;  3EPZ A;  3A2K A;  3HPG A;  1OLT A;  4Y3O A;  2HDW A;  4C2U A;  2MD0 A;  4G6T B;  3TMO A;  3BG9 A;  1HA8 A;  4XLF A;  2DCE A;  3H4C A;  4JX6 A;  1X4O A;  3W2A A;  3LSM A;  4N4N B;  3S3O A;  4XOR A;  3K4B A;  1UG0 A;  2IGK A;  3RQ4 A;  2XC7 A;  3OS1 A;  1NG7 A;  3K10 A;  2XSJ C;  3PL8 A;  1ZEL A;  1VZ0 A;  2VKD A;  2R4G A;  2CZ7 B;  4BS9 A;  3VYG B;  4OAZ A;  3QYF A;  1T95 A;  1MMA A;  2ZPB B;  3V42 A;  2VQG A;  4F93 B;  1UAA A;  4HLQ A;  2L5Q A;  2K3P A;  4JOM A;  1DGW Y;  3SDB A;  2DJI A;  2F4I A;  2NOJ B;  4BE1 A;  4LOC A;  3DTE A;  2K9M A;  3CJR B;  2E5N A;  2CYZ B;  1QU3 A;  4N4O B;  3RTR A;  2W7N A;  1X19 A;  4XN0 A;  3QOD A;  4J00 A;  3VWB A;  2LH9 A;  4CZC A;  2W00 A;  2DOA A;  4XN3 A;  2AQF A;  2G77 A;  4IX7 A;  2WAQ A;  2BS4 A;  2DT6 A;  1D0Y A;  3S8P A;  3MD2 A;  4IZZ A;  3L2W A;  2Z2S B;  3HUG B;  2PMZ A;  3H5R A;  4ZGD B;  2MAB A;  4CCL A;  4ZTF A;  2CS3 A;  2R7X A;  2QFZ A;  2X1E A;  2LBF B;  2JVG A;  3OS0 A;  3BG7 A;  2IGO A;  3S32 A;  4MLO A;  3H5A A;  3H5N A;  2R7U A;  3AFH A;  2K9L A;  4AKG A;  1YX3 A;  5KCM A;  3CF2 A;  3VYU B;  1X1B A;  3K4J A;  3BCB A;  3NWS A;  4QPQ A;  3VSK A;  4F52 A;  2KRC A;  1T0F C;  4OAY A;  3ZGK A;  2IGM A;  1J09 A;  4B47 A;  2L7K A;  2CH0 A;  3PUB A;  2CV0 A;  3A8H B;  1LKX A;  2BW3 A;  4E7K A;  3VKG A;  3LMM A;  2XF5 A;  4E7J A;  3X20 B;  5HOO A;  3H9G A;  3C2H A;  2L2O A;  4RM3 A;  3A1Y A;  4PSW A;  2XDV A;  3G2B A;  4D9J A;  3OIQ A;  4RLQ A;  2X1D A;  2R7R A;  1X1D A;  4HNV A;  2AQE A;  3ZCO A;  2LY2 A;  3SYT A;  4HNU A;  2FUG 2;  2XF6 A;  4HPQ A;  2VXD A;  3VYT B;  2QKL B;  3VSL A;  4CSW A;  3U21 A;  1UGQ B;  5HNH A;  2R7Q A;  3S3M A;  3MMY B;  2E1M B;  5CKT A;  2HPM A;  4BDZ A;  4BDY A;  1Z3X A;  2PJR B;  2X51 A;  2ZSH B;  1KON A;  2V9K A;  2WAE A;  2X6Y A;  4XMY A;  3OS2 A;  3PNY A;  4BEH B;  4XON A;  4MIM A;  2M4K A;  3UR3 C;  4IKF A;  2BS3 A;  4NC6 A;  2MYS A;  4F91 B;  5TGT A;  2E5Z A;  1YE9 A;  3DU6 A;  1V5F A;  2W4S A;  2IS2 A;  2IS4 A;  3OWT A;  2CZ0 B;  1X1A A;  3QYE A;  3OYC A;  3HL2 A;  4OB0 B;  3H35 A;  4MFD A;  2UUZ A;  4P1W A;  3A8L B;  1UEL B;  4NC7 A;  3DEE A;  3OIP A;  4XLE A;  3BG3 A;  3QYG B;  3BC8 A;  5HNF A;  3A8G B;  3WVD B;  2DPP B;  4KIS A;  4H4K C;  3OYI A;  1IRE B;  2LYC A;  4CCO A;  4DBQ A;  1WJD A;  1TZL A;  2MC4 A;  2OUM A;  3PNT A;  5EJC A;  4YEL A;  2V26 A;  1UGP B;  2ZPG B;  1JI8 A;  4PK4 A;  4ZTJ A;  1MMD A;  1ERD A;  3FDY A;  3DTI A;  4PFP A;  4PJN A;  4BAC A;  3EUH C;  2XAU A;  2L9S A;  3DKY A;  1U0J A;  3FBN B;  2KL4 A;  2JUG A;  3N05 A;  3QYH B;  1G8X A;  3OYF A;  4NUB A;  4CCM A;  3QYB A;  4CUG A;  3ZQQ A;  3L2Q A;  1AHJ B;  4GRI A;  1BR2 A;  3OL4 A;  3SEZ A;  4ELJ A;  2MFZ A;  3OYE A;  3OYD A;  4LIV A;  2HQA A;  3OYA A;  2WBM A;  3H9J A;  3LSK A;  2VJI A;  4LG3 A;  2DT7 B;  1OR7 C;  4ZJZ A;  3SEQ A;  4HL4 A;  3J7A Y;  4NNJ A;  4XKB A;  3HG9 A;  3S93 A;  3MKZ A;  4BQN A;  4ZDP A;  4OB2 B;  2BVM A;  3PSF A;  2HVS A;  2ELJ A;  1SAU A;  2Z16 A;  1X1C A;  5CQG A;  3OYL A;  3HZJ A;  4YEJ A;  2HPI A;  2VJJ A;  4E6K G;  1G59 A;  2V7F A;  2JA2 A;  3VYR B;  3ZR8 X;  2VAS A;  2M7B A;  2IS1 A;  1YX5 A;  2P0W A;  4XL9 A;  4AKI A;  4XKW A;  2UWM A;  2X6X A;  4HRI A;  3AL0 B;  3C2G A;  2GOM A;  3QZ9 B;  4E7Z A;  1LDK B;  1FMW A;  2ZSI B;  3A8O B;  1WJE A;  3BCA A;  2QQ8 A;  4BJT A;  1V5G A;  1LFP A;  2CMP A;  4PJJ A;  2CW7 A;  1NG6 A;  2KQR A;  3VYH B;  3TL4 X;  3HB9 A;  2OV7 A;  3IUO A;  2WY8 Q;  4RMN A;  3E0J B;  4DGW B;  3LL7 A;  2M3A A;  3OOU A;  4PSX A;  4HST A;  1DGR M;  1R6R A;  4JX5 A;  4JX4 A;  1DQU A;  2M0M A;  4HSR A;  4BU2 A;  4M6V A;  4HNT A;  2UV1 A;  3NWT A;  2JSP A;  4YRV A;  1WJC A;  4DOZ A;  2HNH A;  4LIU A;  5FRN A;  3KYL A;  2VQL A;  1PYV A;  4KJZ A;  2V6E A;  3K4M A;  2X6W A;  3X24 B;  2HVQ A;  2JVH A;  4XM3 A;  4E7I A;  4DBR A;  2DD5 B;  3KX2 A;  2R7O A;  3OY9 A;  2HZD A;  3W2W A;  3FKJ A;  3PNV A;  3QXE B;  2VQH A;  3LFU A;  1LVK A;  3OYN A;  3LSI A;  4B44 A;  2QKM B;  4X0G A;  2CZ6 B;  4Z6Y A;  1D0X A;  3HHT B;  4DIQ A;  4F55 A;  4FAS D;  3DL1 A;  4ITV A;  4P17 A;  2ZZD B;  1V5E A;  3K4K A;  3KHI A;  2VQC A;  3PFY A;  3ZXS A;  4AKH A;  4XLA A;  3K70 C;  3TW7 A;  2WB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...