3QYCA

Structure of a dimeric anti-her2 single domain antibody
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
VQLVESGGGLIKPGGSLRLSCAASGVRLSAYDMAWVRQAPGKGLEWVSAISSSGGSTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTAVYYCVTLPDLCPGDNCTYPDASWGQGTMVTVSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VH domain of IgG molecule
publication title Crystal Structure of a Human Single Domain Antibody Dimer Formed through V(H)-V(H) Non-Covalent Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 30
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qycA00
1TZIB 1IAIH 1QACA 5I1LA 1HI6B 3VG0H 3PWPD 1I7ZB 3NCCB 4XBEH 1URLA 4YFDB 5JHLL 3JXAA 4G5ZH 4HF5L 4JJ5B 2XG4A 3W82A 3L6FA 3S3PA 1EZVY 1HYSC 2Z93A 2YUVA 4DZBB 4F7PA 5IBTH 4K9EC 5J6GA 3SGKA 1CK0L 4K3HA 2XI9A 1A7QH 2BOBA 3KNBA 2VZ1A 2Y06H 4JFPA 5CIPH 1U3YA 5C0ND 3LKQA 2DQDH 1DQML 4ISVA 1I7UA 1MCFA 1S7VA 1FGNL 2X4UA 3VD9A 2BHZA 3INUH 5BVPH 2E9IA 1S7WA 3RBGA 1HHKB 3GFUA 2VXSL 4YNYB 3GKWH 1FNSH 1HQRB 3EJZC 5HHQB 4KI5C 1KB5H 3WLWC 4MA7L 4L8CB 3VWJB 3VXOA 1ZEAL 4RMSA 2LVCA 2GT9B 5HGGS 4GRWE 5JQ6H 4UDTA 3KLHD 5CUSH 5DZNA 4FQCL 4XPGH 4XBEL 1YPZF 1SEBA 4G5ZL 2XRAH 1NAKL 4HEME 1BFOA 5JIKA 3PWPE 4HZLA 1EFXB 4L9DA 1ADQH 5IBTL 1CDHA 1KJ2H 5K9QG 5ID1A 3PABB 5I75B 3BZ4A 4PRPE 1A7QL 5GGSB 5HI4C 4LSSL 3D2UB 4C56E 3H0TA 5F7MC 4I0PA 5E8OB 5DF0A 3QH3B 1INDH 4G80B 1PY4A 2DQDL 4ZO7A 3VXPA 1LP9B 3RVTC 4HJGB 4JQVC 5JOFA 1IKNA 4P2RD 1UZ8B 3BO8B 1NCDH 1U6AH 3HZYB 1YECH 4HD9A 3AM8A 3B3IA 3ROOA 3SDCA 3FFCD 3TESA 2ESVE 4E41B 3BUYA 3L5IA 5BRZD 3UYPA 1UACL 3EHBD 2GQHA 3WUZA 1KB5L 1NCTA 2ADJA 1QFWM 4Y5YA 5J1AA 1M7DA 1IT9L 4QCIA 3IKKA 2FEDC 1O7VA 5C2BL 3CX5J 5J06A 1KG0B 3GMPA 3GJFH 4JFOA 5FKPB 4XP9L 4ZFZA 1Q9LB 5C0RL 1ADQL 1KEGH 5GGTH 1QBAA 4EDXA 1XCTB 2PYEB 2H41A 4OCWH 1F90L 4PJCF 4OCYL 2NX5A 3VWKB 1V7NH 3A0OA 2ATPB 2WINB 4JM2F 3MJ9H 3RGVC 1DBBH 1HHGA 1RZJC 4ZUTA 3MJGX 3R0MA 1U6AL 3ULSB 3TVMD 3SKOB 1FSKB 2WBWB 3WIHA 1I4FA 2DBLH 4P2RE 5DQJA 1OSZA 3FFCE 5F7YC 1DBKH 3D39D 4RMWA 5BRZE 2EIBA 4RISL 4LEOB 5KS9B 2GKIA 3KWWB 5EOQH 5EIIA 3G5ZA 1F2XK 2O26U 3BPLC 4MXWH 5ENWB 4KUZL 4LPWA 3RA7L 3U0WH 2I07B 3M17A 5GRVL 1YN6B 5BS0B 2APBA 3GRWL 4NBYB 1DUYB 4Y4KA 2GCYA 2Q3ZA 4OZHB 4ZTOH 3SHSA 4P46C 2H32A 1RD6A 4OCWL 1CQYA 1T0NA 3D0VB 4LCCC 1A6AB 3U7WH 2CD0A 1LK3L 4XNQA 2X4SA 2EC8A 3VFMB 3T3ME 3WIFB 1DBBL 2YEZA 3C08L 1UYWH 3MNVA 1Y0LB 3V8CA 5ISZA 4QRRA 3OKEB 1MIEL 4BFBD 4FXKB 2VISA 1NEUA 3ARVA 2P8LB 2QQKL 2MWCA 2IQ9H 1KV3A 5EIVA 2AEIT 5I8CB 4Y16C 3VFUA 3OKMA 4M9OA 4P3DA 2QBWA 3UC0L 2QL1A 1YDPB 2H1PH 5J1SC 5EOQL 3WNNA 3D85D 3D39E 1FLRH 3LZFH 3RHWK 4D0BB 4OFYD 4X9BA 5KVDL 3WLBB 4UV7H 3LKRB 3EYOA 3QI9B 2H45A 4Z7VF 3SKMB 4WUUB 2GJZB 3OF6D 3BKJH 2AXJA 4X6CE 1F4YL 3IB4A 2IPUK 1HYSD 3T4YB 4ZTOL 2VL5A 1DBAH 4MNGA 2J6EA 3G6AB 3QPXL 2J7LA 4BYHA 4ZUVA 4J12A 2ID5A 1UM5L 1ONQB 2JIXB 1PGRB 1U8OA 3IXAB 1K8IA 1UYWL 3EOAA 4TUOB 3RTQA 3BEWA 5EULV 3WE6B 1G7LA 3C2AH 5EIQA 5BQ7A 4PJHE 3BIKA 3HMWH 5T5NF 1X5KA 5FK9A 2R2BB 3PQYB 4KAQH 5JXEC 2PW1A 2YN3A 5BV7C 5EU6A 1MJ8L 5KG9A 3EJZD 1ZLUK 1HWGB 2A74B 2IPKB 3QIBC 4KI5D 1ND0A 4R7NB 3WLWD 1CU4H 3WCYA 4JE4B 3U82B 1FJ1B 2A83B 1EO5A 2YD3A 3RHWF 4MX7B 5ADPL 1R6VA 2AJXL 2R4RL 4G8EB 4QRQA 4UV7L 4JFXB 3BP5A 4NZRH 1NSNH 3BKJL 2N1KA 1RUKL 1QFWI 1UWEL 2G75A 4JZNB 3LKPB 2NNAA 3ZTNH 4YGVB 3H9SD 1CT8A 3BT2H 5HI4D 5IBLC 3WBDA 2JLLA 3PV7A 5CMAB 2DDQH 1IEBB 2ZSWA 4QXGH 3C2AL 3VFGL 4BSJA 1Z0NA 3IFOA 2EDXA 3HMWL 4B50A 1ED3A 1QO3A 3VXSA 2IAMC 3NCYP 1NGZA 4XBGA 5DD0H 1UH3A 5CP7A 2H6PA 1B6DA 5IHUH 2H8PB 1N6QH 3JZ7A 2YC1B 1CU4L 4X6FA 4LAQL 4LCIH 5HYJB 4R6UA 5C0CD 2G2RB 3DX8B 4HIEB 1MI5D 4KI5E 4U2YA 4XVUC 1HYRC 4QTHB 1F3JB 1Y18B 3DROA 3RUGA 5J57B 1JPGB 1NSNL 3IU3B 3MOQA 3K3QA 1RZ7H 3HTLX 2VDRL 3OKKB 4KROB 3G08A 5GRZA 2IMNA 2NY5H 4ODHH 1BPVA 5EDXA 1FZJB 1JNHA 3E6HA 3QFDB 5GS3A 1G7HB 5FV1L 4XPBH 3WKMH 4QXGL 3KPNA 4Z7WE 5J6GB 3RGVD 5I71C 2J88H 3OHXA 3ORJA 2WP3O 1NCNA 4NQXB 4EVNA 3LKQB 3O6FC 1TZGH 4KJPC 4FQJL 4PG9B 3HR6A 3CPLB 2YSSB 3AFLA 4LRNL 2YPKB 2FJGA 3AY4C 3ULUL 2Y6SC 1OD7A 5D72H 1S7WB 4HWZA 1B0RB 4FN0A 5JUEH 4EI5D 3QJHB 1AD0B 3P4OB 3CMOL 3ABZA 1JPFB 2O5ZH 4PP1C 1AIFB 1JWSB 5C0CE 2WIIB 5HSFA 2CKNA 5DEZA 1MI5E 1YUHB 3TFKC 3ZHKA 1VFBA 2PTTB 1EPFA 2CRIA 1AR2A 4KMQA 1NGWB 1CDYA 1T66C 1Q8MA 4CN4A 4P46D 3DRTB 3UTSD 1BFOB 2NY5L 2HLFC 1RUAH 4Q6IC 2BNQD 4CMHC 5CINH 4XPBL 4NC2B 2ZG2A 5GS2H 1QKZL 3OXRA 3FQXB 3KLDA 5E03A 1X9QA 4JJHA 4U1GB 1QRND 3VFSA 3F7YB 5C0DB 1PDKA 5LKNA 3GMLA 4MNHA 1EEYA 1NUGA 5FYKL 1LDPH 5GSRA 4WI5A 1UWXH 4WFEE 3S8WA 1MRCH 4S1QL 1PYWA 4WHTB 5D72L 3RKDC 5JORA 5IFJA 1UJ3B 2FLBT 3B3IB 5JUEL 3ROOB 4HKJA 3BWAA 1PVHA 2F53D 1ITBB 2O5ZL 2ADJB 4Y5YB 1UZ6E 5D96B 4NO0B 1JBJA 1M7DB 2NPLX 4NKIL 3RAJH 4QCIB 2CLZB 4OD2B 1TETL 1FIGH 4FFZH 2EDBA 3DSFH 4Y4HD 3KJ4B 3NA9L 4X4XA 3KPQB 3B8YA 3GMPB 2NCMA 4JFOB 4AEHL 4ZFZB 4G8GB 4AEIH 3OGOE 4Y19D 3MRPA 1L6XA 4NQCA 5KSAB 1MJJA 5CINL 3QWQB 1KENL 1RIVL 2ZCKH 4R90L 1EAPA 1IGCH 5F88B 4JRYA 3QIUB 4LLAA 3UTSE 5BRZA 1I1AA 2XKSA 2BNQE 1PX4A 5FHAL 1PD6A 2YK1H 2MKWA 5ACLA 4Y5VA 5JXED 4NOBA 5KZCB 2QV2A 4G9FD 3QIBD 5SWSD 1WV7T 4OM1L 4XWOC 3VD4A 1WBYB 1I4FB 3MJ8A 4JZJB 1X5IA 4OTXH 4PJ9A 4N9GA 5DQJB 3EGSA 4ODVH 1LP9F 3HZMB 3QUYB 2MJWA 4WHYH 4NRYA 2F53E 3JVGC 1BQHA 2ARJA 3KYKH 2CXKA 3RY6A 3GSWA 1CZ8H 4IEFB 3D0LB 2X09A 4AG4H 4JKPH 2FEEL 2OCFD 4Y2OA 1I9RH 4H0IA 1JGLH 1H8OA 3TVMA 1IGCL 2VZUA 4JO3H 2GCYB 4Y4KB 1UCBH 1TLKA 4Z76A 2QHRL 7FABH 1T0NB 2DMCA 4Y19E 1VA9A 3BW9A 4R97B 1EIBA 3N06B 4O00A 4KVNH 4O2EB 1WAAF 2X4SB 5F89B 2R15A 1Y6KR 3TT3H 1JWUA 2IAMD 3O4LE 5F1OB 4NUGH 5ISZB 1LO0L 2BSRA 1IM3B 4LGRB 4H88H 3VFWA 3AVEA 2QHLA 2FO4B 2HVKB 4RCAA 1SHMA 2G60H 4LSQL 4W68A 3SDAB 3HFMH 4OTXL 2WUBL 3HPLA 5D1ZC 5JW3L 4WU5B 5FM4A 1SYVA 5SWSE 5GS1C 4XVUD 5DEGB 4OLZH 4BH8A 4P3DB 3W11C 3KYKL 4UBDC 2I27N 5DFWH 1CZ8L 3FQTA 4AG4L 4Y1AD 3WFEH 4XBPA 3KXFE 3BGFB 4JFED 4OLYH 4YHKL 1FFQA 1ORSB 1JGLL 1UM4H 5L0QC 1J7VR 5TF1H 2A6KA 5DD5H 4X6BA 4LQ1A 3JSSA 2VL5B 4PYGA 1GOFA 1BX2A 3PWLA 4AIOA 2ZUYA 3FRPA 1UXWA 4MQXC 2DKUA 4KVNL 4F37K 2DLEA 2VOTA 1OL0A 2P8PB 1YEDA 1CDBA 1AFVH 3O6FD 4LSUH 4NUGL 1JUFA 3EOAB 4KJPD 5IVXE 3V95A 3RTQB 1I9IL 1QPXA 3WFHA 1UC6A 1P53A 4OZHF 3D85A 4OBSA 4YK4C 2Y6SD 3GSOA 1BIIB 2VN7A 5E8NA 4G3YH 4G7VL 3HFML 3OF6A 2WP3T 1KLGA 1PG7H 4UQ2A 2F5BH 4F57L 2R1XA 5KG9B 2C4FU 4JVWA 3X12B 5F9JB 4OLZL 4PP1D 4LL9A 5FDWB 1MPAL 3BN3B 3GMRB 1ZA3B 4PTTA 2APXA 2JCCF 4NNYA 3TFKD 4XPHH 3QP3A 4OKDA 3CDFA 2HKHH 3T2QA 1P7QD 4X0KB 4AENB 4ZNCD 1NGYB 3WFEL 1NEZA 2R2EB 4JHWL 3PNWA 3MRLA 4GW5B 1T66D 1UKSA 1UM4L 4LSVL 1J9CT 1OAQH 1N59B 5DD5L 2HLFD 3VXME 4U1NA 4Y1AE 4PV9A 2G75B 2ZPKH 3MZGB 4JFEE 4F37F 1EMTL 1MVUB 2NNAB 1NCWL 4ZS6C 4BELD 4A2LA 4TRPH 4NQED 1CVSC 4AEFA 3ULUC 4GKSB 2VERN 4MDJA 4WW2C 1W8OA 4IOSD 1NFIA 1AFVL 2CDGB 4LSUL 4EBQL 3HE6A 4HUUA 4PJFE 4XNZB 5EU4B 5FA4A 1XIWD 5C0FA 3IFOB 2FIRT 3RKDD 1HKFA 1ED3B 2J3SA 1T0PB 4MZ2A 1G0YR 3X11B 4OZFH 5C08D 5KOMC 3BGAA 5BCAA 6CGTA 4ODSH 2F5BL 4XBGB 3FMGH 2OQJA 3WNLA 3ARSA 4ZXBA 5DXWA 1SM3L 2VDKH 2R1YA 5I8OL 3C6SB 4X6FB 2ZNXA 1A5FH 3H9SA 5ITBL 4IRZL 4XPHL 3SOBH 4QGYA 4HV8B 2HKHL 4D3CH 5B39A 4AIZA 4A6YA 3QXTA 3H9YA 4YZFF 1BOYA 2F5AL 4FNLL 4NSKB 4ONHA 3O2DH 2ZPKL 1TJHH 2L4OA 1L0YA 4JZOB 3TYGH 2BVOB 3G08B 4HPOL 1U9KA 4KKLC 1GGBH 3EJYC 3NH7H 3VFTB 1CFBA 3C9NA 5KVGH 5HHNA 3E6HB 2B4CH 5KAQF 4LNRB 1AGFB 5C0CA 3UROR 4C83A 1E4KC 4NQEE 2B0SH 1NCBL 2FECL 1NKRA 5ACMA 3OHXB 4JDTH 4POZC 1XH3B 4PGJA 2GW5A 2MTPA 5F7FA 4XWOD 3FMGL 4GO6B 3JTSA 5D2LE 5CLWA 5LBSH 3GBMH 5DYOA 4G8IB 1CYGA 5C08E 3CSYA 4HWZB 4MHHI 3SOBL 2H2PC 1JZ5A 2HRPH 4D3CL 5DEFA 5IESL 1RMFH 2HH0H 3TIDA 1IGML 1CDGA 5K9KB 3RGVA 2VKWA 5C6WH 2YMXH 1ZKAA 2Y07L 1NUFA 4KKCC 5D5MF 3O2DL 1M7IA 2DD8L 2V7HA 1XF5A 3N1PC 3BZFB 4HAFA 4K8RH 5IP4A 3MRGB 2J8UB 4U49A 3K4AA 1GGBL 1YYMH 3FB7B 3OKOA 3HI1A 3NH7L 1CR9L 3WDJA 5D7JC 1G7QA 2B4CL 3QDGA 3OBAA 2BOCB 4X99A 4YHMH 1SYSA 4EI5A 2VLKD 4DTGL 2CMRH 2BMKA 3OXRB 1SEQH 2B0SL 1A4JA 3RWJA 3VFSB 3FB8B 2E9JA 4Z0XB 5BMFL 1OAYL 4OZFG 3B6SB 4MNHB 4QKXB 1EEYB 4G8FA 5GSRB 4OCLC 3N85H 4JG1L 1ZOXA 3CCHA 3BISA 4M6OL 2ZCLH 3GBML 5D1ZD 4JFDD 5JORB 4Q9RL 4HFUH 5MERA 4K23L 4HWUA 4AJ0A 3HAEH 1KFAL 4LCCA 3L5XH 3FRUB 1DBMH 4UBDD 1P5UA 1RMFL 5E5UB 1DLHA 3ALXA 2HH0L 1RURH 3SCMC 2DQFB 1QRNA 3CLEH 2BC4A 4QWWC 1C5BH 1R5VA 2W0LA 1K6QH 2XWBA 2DI9A 3SDDB 3QBTB 4GG8A 4X4XB 3PP3H 4WO4A 4XHJC 2CIKA 4S1SH 4X9GA 3BAEH 5F7UA 4MQXD 2EKSA 1C16B 4LMQI 4M7JH 2Z8WC 1EAPB 1HZHL 2CMRL 4R2GB 5EZJA 3QEUA 1MAJA 5TQ0H 5FA3B 1D5ZA 1MOEA 3QG7H 2VLKE 2C9AA 4RZCB 1GIGL 2CO7B 2VWEC 2OX5A 5GRJL 5TGBA 4P2QD 3RNKA 3DIFA 1ZHLA 4Y4HA 5IROC 5DQDH 3WXVH 4HFUL 4IRSC 5J9PB 1P7HL 1B6UA 4G6AC 1C08A 3L3KA 2OZ4A 5IV2A 1YMHA 1PG7X 3L5XL 4PJ9B 4N9GB 3U7AA 1BD2E 4ZO9A 4HWEH 4E0RB 5IT2L 3CLEL 4NRYB 4F7CB 5K59F 3ARDD 1BQHB 1C5BL 2ARJB 4EUPH 5ILTH 5C1MB 2Y25A 2FWOA 2D7MA 2XOTA 1N8ZA 1TVHB 3UTPE 1JNLL 4S1SL 4ZDHA 3ZE0F 1BFTA 1ETZB 4ZS6D 4G9FA 4L3AA 1QBMH 1JGUH 3QIBA 5SWSA 3RDTB 3ULUD 2NY4B 4R9HA 3P30H 3BSZH 2ITCA 2NTFB 2RGSA 3R8BB 5HHPB 5EC1A 3VFOA 4O5LH 5DQDL 3WXVL 5D2NC 2DAVA 3HAEG 1VENA 2BSRB 4Z5RB 3VFWB 3RVXC 4RAVA 3HPLB 4ZOCA 4HS6B 5IVXA 5HYEA 5TE7H 4GRLB 2IH3A 5IW1B 4I2XA 4UINL 3TEUA 1I7TA 5GHWH 4ELME 1AQKL 5F8QC 3HRPA 4N8VA 4WWKA 1N2RB 3FQTB 5FCUL 3U7YH 5FYKD 1JTTA 1A6PA 4UT9H 4PRNB 5TE6L 1ZK9A 4K7PL 4KKLD 1ZHNA 3DYMA 2YD5A 3L3JA 5INDB 3PWLB 1EO8L 1T4KA 4BQ9A 2EDKA 4I18B 3ULUE 1YEIH 1EEZA 4LMQE 3C5SA 4YBLC 3LIZL 4O5LL 3WNOA 1MY5A 3T0XA 1TQCB 2XWJA 2EXWC 4Y1AA 2OR7A 5C70A 2CLRA 1N7MH 2E7BA 2R1WB 3UMTA 4P5TC 3VH8G 2FJFA 3WEXB 5IOPB 1KLGB 2B1HH 2R1XB 1XGUA 4N0YH 3VDCA 3B43A 5E7FA 3BVNB 3AU1B 3DVGB 4XNYH 2DLFL 3MYJA 4EUPG 5TE7L 4FTVD 2I9LA 5GS2D 4NDMB 5FYJU 3AAZA 4NNYB 2UZYB 3QG6B 1OM3L 4KKCD 3B9KC 3ESVF 3V7MA 1FHGA 1NC4A 1NEZB 3BKCH 5FGBC 1ZT4B 2FYYB 3NZ8A 3MV11 4JREB 4F2MA 4ZUUB 1S5HA 3LQZA 3CFIC 4U1NB 1MJ7H 3GSVA 5FYKE 3CJJA 4S0SD 3SKUD 2DQHL 4QOKD 2IC2A 5MI0C 1RHHA 2ED8A 1TVBB 1K4DA 1UADC 5C2UB 4LSTH 1AD9A 5JHDD 4XH2A 3W81A 1SVCP 1HEZA 5FA4B 5C0FB 3TBVB 2EXYC 3IDXH 4CBPA 1F45A 1YQVL 2NY1C 5BXFB 4WFGD 1N7ML 1MCIA 3CK0H 3VI3E 3MRHB 3IDYB 3VW3H 1XMWA 1OT1A 4D9LH 3NACH 4Q6IA 3TZVA 4N0YL 4Z95L 5B8CC 4P5KA 4QXUH 5DD1H 3NCJH 1PKQE 3PDGA 4Y5XC 3SCMD 4G6KH 1CE6A 1N5YH 1NBYB 1FC1A 4D9RD 2QSTA 1WWBX 4IOIB 2R0WL 5DQ9B 1GPOL 4QWWD 5B39B 4AIZB 5GJSH 2B4CC 4FTVE 1A7NH 2OL3L 3O9WA 4A6YB 3MLVH 3V52H 4XHJD 1XIWA 5ESVA 1VGEL 4C58B 5TE4L 2FSEA 1MJ7L 4H0GA 1OD9A 1VACB 4LSPL 1T0MA 3V7AE 3MNZB 5SWQB 3SPVA 4M9PA 1TENA 5LGJB 1B0WA 1ZTXL 2EDQA 3FQRB 5DJ6A 3ULVH 1F4XH 5DJZA 1TJIH 2NY6C 1MWAL 4Y2DA 4LSTL 4C83B 3I6KA 4JN1H 4HQQH 5M94B 4JVUA 1WISA 2R56H 2VTFA 4IRSD 1MFBH 2VLJA 1BJMA 2Y9RT 4G6AD 4Y8AA 5JHDE 1YEFL 3TN0B 3VW3L 1XF4A 3UJJH 1L0XA 5C8JA 3K0WA 2AV7A 3JTSB 4WFGE 2Q8BH 4G6KL 1CG9A 3B4NA 5CJOL 3FL7A 5KANG 5DEFB 4UTBL 5GJSL 3W0WE 1KTDB 3DNKA 1YC7A 25C8L 4N5UA 4D9RE 1AI1L 2FD6H 3AC0A 4J4PC 2GTWA 1KJ3L 2DRUA 3NGBB 2V7HB 1QSFD 1XF5B 4JVPA 5CBEA 4ZFGH 4KRMB 4P2CG 4YBQC 3ULVL 3LKNA 1F4XL 3QDGB 1TJIL 3HA0A 2W60B 4IOFC 4X99B 3W9DA 2PR4H 4XHQA 5EA0L 2DLIA 2BMKB 4HQQL 3UYRH 2XXMB 1A4JB 2W38A 4GXVH 5GXBB 1RV6X 3E2HC 3I6GA 3K80A 3QXAB 2VWEE 4WFHD 4YDJA 4G8FB 2WMPA 1B4JL 2JB5L 1S7UB 1YEEL 3MLUH 3KLSA 4XNMB 3RVXD 3UJJL 4KY1L 4WGWB 3VCLB 4L8BB 5KVMC 4GBXC 1L9MA 4JG0H 3T2PA 4IRJB 2OR8A 2QQQA 3MV8A 4JPVL 4GAJH 3C8HA 3DYOA 4R7DA 5I8EB 5C0EA 2RCSH 1T1YB 2VLKA 4ACPA 4Q97A 4LEXL 3C6LA 4YPGB 3ZDYF 3O3AB 3OKYA 4GG8B 4ZNEA 4WO4B 3ET9F 3K2UL 1RZIA 2V5TA 1QQDA 1KIQB 4JFDA 5JTWA 2EKSB 3CFEA 4NCDA 1EVUA 1I3VA 1QSFE 4OZ4B 4QHNB 1T83A 1K4CA 1J88A 4KTDL 4NRXA 3QEUB 5GIRB 4P48A 4XXDA 4MJ5A 1EHNA 3MV7D 4M48H 4PJ7A 3KPLA 1H3PH 2EXWD 2J8UF 5DJ8A 2KDGA 3CDYA 5EOCL 1IGYA 1KLFA 2HG5B 2V2XA 3MLUL 4Z6AT 5ACZA 3DIFB 4XNUH 4OV5A 4YAQA 4P5TD 3E8UL 5D2NE 5BVJA 4JG0L 4LCUB 4GAJL 2JB6A 1C08B 4JFHD 5IV2B 3BIAX 2GJ6D 1T1XA 4JR9H 5EZOH 1YNKH 3B9KD 4ZPTA 1MAKA 2FX9H 1ZHBB 5IF0B 3FN9A 3V79C 1ZGLP 3VRJA 4P2QA 2R8SL 1DL7H 1DE4B 2FWOB 4PLOB 5H35A 3S88H 1JFQH 5HYSG 2OXGA 4I5BA 3I9GH 4ZDHB 1D6EA 4GUPA 3HG1D 4NC0B 1ORQA 1OHQA 1CTOA 5HVHB 2YPLD 2DYPD 1E4JA 1XF2A 4JFZL 4H5SA 3DUHA 1OVZA 5EUKA 4OIBA 4OF6A 2ITCB 4M48L 5FHBH 4OD3H 4M93B 1H3PL 4BUGA 4DW2H 3O4OC 4EOWL 2EXYD 3GMOA 5T3XL 3VU2A 2Q76A 2NY1D 2EE2A 3ARDA 1A02N 5DJYA 1N4XH 4TVPL 3QHZL 2R23A 4RIRA 3OKLB 4JY6B 1HHHA 3D48R 3OG6B 5I1EH 1NPUA 1U8KB 5HHVH 3NPSB 4H8WH 2OXHA 1OCWH 1I3UA 5HHME 4JR9L 4ZOBA 4UIKH 4WW2A 3KR3L 5IB3B 2DTMH 1UM6H 3KPSD 2GJ6E 3GIZL 3QR2A 5EZLA 2IH3B 1TCRA 1JNNH 1N0XL 5EBWA 5FF6A 3EYVA 4K3EL 2NR6C 4PJGE 43C9A 4N8VB 5EC2A 4WWKB 3S88L 4NM8L 1AGEA 1XGQB 3I9GL 3MA7A 1VFOA 5IWLC 4P3WA 4X4YA 4RMUA 4KKNA 3LH2L 3HG1E 2NY6D 4RWYH 4J2XA 1T4KB 5FHBL 2P5EB 5CJXC 2KQMA 4GH7B 4DW2L 5J11B 4U1IB 3BH9A 3X3FL 1LILA 4RGNC 2BVPA 4GS7B 4L3EE 5I1HH 2FO1A 4S2SA 1QR1B 3VGGA 2KUTA 3NFPB 5I1EL 1RI8A 2CJUH 2DOCA 3QEGL 4QT5B 1H3GA 3RWCB 2HJFB 1MNUH 2OTPA 1EHAA 2FJFB 4RBPH 3ARBB 1TIUA 4UU9B 3KYNA 4MVBC 4UIKL 1XGUB 5IJVA 2DTML 3ZT7A 1JVKA 1W2KT 3MYJB 5GGVY 1E4KA 5ESAB 5GRYA 1I8LA 4OF8A 1J8HB 4J4PD 4N0UA 5E8EB 4X98B 2EC9T 2M1KA 3KPSE 4OUOA 1DDHB 5F7NC 1LO2L 3RWHA 1RAMA 3NZ8B 4F2MB 1G6RH 2FLRT 4YBQD 3MUHL 3HZKA 3G6JE 4WDIA 3DVIA 1MRDL 3GSVB 5DGQA 3QUMA 4IOFD 5E6IC 2FH8A 5H8DA 5T1LB 1ZWIB 1U0QA 4XCFH 5DJAA 4QHKI 5HJ3A 2BNRD 1U2HA 5FM8A 5I1HL 1PSKH 3R0NA 4XH2B 2FGWH 5E7BA 4GBXD 2YZ1A 2XACC 3SDXB 4G43A 1MNUL 3OJMB 1QSEB 3QULA 5FFLA 2DKSA 2FR4A 4DGVL 5GGUB 3RZCB 3TZVB 2NXYC 5FO9A 4QOKA 4N5EC 1I3RA 5KVFH 5CEYA 5J56B 4HFWB 1NFDB 5FYLL 1XGTB 4EI6A 5IMKA 4F7MB 3GI9L 3FT4A 3FHAA 3ULVC 4Z0BH 3W9EB 3O9WB 1AR1C 1ZV5A 2V9RA 2DS4A 2YN5A 3TJHC 1U95A 3P9MA 1IAIM 1S3KL 3D25A 2W9DH 3DGGA 1RFDL 2Z35B 3I2CL 4RQQA 1T0MB 4U4BA 3I50L 4NJAL 2NW3B 3WJLC 3M07A 5DJZB 3PWJA 4Y2DB 1LEIB 4PJAE 3I6KB 4GKOA 1GOGA 4KK8D 3IVKA 3M1BA 4TVSa 2BNRE 1HH6A 3QDMA 1HXYB 2AQ1A 2VLJB 3PHSA 3QEHA 2JJSC 1FNEB 1XF4B 2VIRA 5MHSD 2WUCH 3IDMB 3M8OL 2AV7B 3FT3A 1EGJA 2XPGA 4Z7UA 4YH6A 1CL7H 3OSKA 2P5WB 5IJKA 5D7IB 1JK8B 32C2A 1JZ4A 4Z0BL 4H26B 3ZYIA 1A7OH 1NCCH 2WZPD 4OZIB 2YOCA 3DUUB 3UPRA 2ORBH 3WDHA 5KN5A 2EDTA 3CU1A 4PY7A 4U6YA 3NZHL 3VFRB 5IR1A 1AHWB 3FZUC 4RAHA 4XMPL 3WN5C 3C5ZA 4JPKH 3LHPH 4L4JA 4BK5A 1MH5B 2F9BT 1AKJD 2Z4QA 1R3HB 3SJVE 3W9DB 2IBZX 5L8KB 4XCCH 3SGDH 4OLEA 3EYQC 3OAZK 3LV3A 5B4MC 5IQ9A 3L3DA 4U1SB 3I6GB 4XI5C 1D5XA 4DAGL 5DMJB 5ECJE 1NC2B 1ZA6A 2H3NA 2MQCA 5GSVA 3MV8B 2ZCHL 4DJMA 3QA3B 5HGAB 4R7DB 3U4BH 1INEL 5MHSE 2C3HA 1BQUA 3QWRD 1XZ0A 2KZ1B 5LQBH 4YHNA 3IJHA 4OZGB 5C0EB 3MJ6A 1P6AB 5FCSH 3EFFB 1AXTH 1RJZA 1A7OL 4QY8B 4V1DD 1NCCL 1HE7A 1WZKA 4LHUB 4HXBL 1EV2E 1YYLH 1KCSL 3T0AA 2Z91B 4G7YH 4GW4B 3RBSA 3LHPL 2GK0A 1MFDH 1RZIB 3ZLQC 3CVHA 4APQA 1AGDA 1LO3H 4KXZI 4R0LB 4XPAH 1QFHA 2B1AH 4W4OC 4HAGA 2E27L 4ZAKA 2NLJB 2W65B 4RGND 4PJ7B 5DSCA 3VXNB 5DJ8B 3MA9L 4MAUH 3QEQA 4OV5B 2VN4A 4YAQB 5DS8A 3U36A 1BZ7B 1FIEA 1P9MC 1SJEA 4C4KO 4MVBD 2GHWB 5ICXB 5ANMB 3QQ3A 4JM2C 4J7RA 2JB6B 3BPCB 3U4BL 5E8PB 4JY5H 1HILA 3SO3B 4XP4H 4K07A 1NANI 3BDBA 3T77A 2R39A 3L95B 3MV7A 4U2ZA 3M45A 1IAMA 3EDEA 3DRQB 2VXUH 2IANA 3IDIB 5TJWK 2AP2A 4NPYA 4HUVA 4V1DE 1A21A 3LQAH 1YYLL 1I85C 4L4TA 5TH2A 1PAMA 5H35B 4BUHA 1MFDL 1R5IB 5E6ID 2IQAB 1Q9KB 4N8CL 3MOBL 3FQWA 4NO3A 5D7LE 3CC5B 3TO4D 1XF2B 1F97A 4GLRI 4H5SB 1AJ7H 3MLXH 1JP5A 2P24A 4NBXB 1IAII 3QDJA 3B9KA 1SY6H 4KDVA 5C9JB 2CXGA 4XAKD 4XCNA 5FGBA 2X4OA 1GXEA 1XCQA 1A22B 4BFGA 4U6VH 5IK3A 4RGNE 3EFDH 2XN9D 1OAUH 1CFQB 4NNXB 4YQXL 4LVOC 1MHEA 5EU5A 2B8OT 1KPVB 4P9MH 5DK0A 5HDQL 1HHHB 2NXYD 5LG1A 1K3ZA 3HG1A 1FVEA 4S10A 2OMNA 1EO7A 2YPLA 4XP4L 3NAAL 1FVCA 3HNVH 3ULVD 5CD3B 4OGXH 4MXVF 2Q6WA 2D7TL 2GYSA 3TJHD 1FDLH 1YEKL 5EC2B 5F70A 4PJIA 2VDMH 2IF7A 3MA7B 2AK4A 3RU8H 2UUDH 3S9DB 2OR9L 4W81A 3P9LB 3ETBF 5AD0B 3T0EC 1FRGH 4X4YB 4KTEH 1BZQK 4ODWA 5E2TH 5F7DA 3MLXL 4KRPB 1WUNT 3O6ML 5D7KD 1MQKL 2VQ1A 4N68A 1EHLH 2BSTA 1WBXA 4KK5C 5D93C 2P44B 2H9GB 4IDJH 3EFDL 5C0BB 3L1OL 4MJIE 1C5CH 3CFKA 3NCYS 2HA1A 3S98A 4XAKE 1LO5A 4P9ML 2C5DC 3S6CA 3QXDA 1D9KA 2XN9E 5L2KB 4HUKB 5C0JB 2AXGA 1Z6JT 3UAJC 1FAIL 3ARZA 3RWFA 1G9NH 3KYNB 3HNVL 4YHOL 5JQHC 4QHUA 2WQRA 1FDLL 1KC5L 5L7XL 3BP6A 3ULVE 5ICYA 1BHGA 1Y6MR 3GSRB 4CVZA 2VDML 3FZUD 2BVYA 3QYCA 1WFNA 3RU8L 3LRSB 1HINH 5TDNA 1CF8H 5DVNA 3MV9D 5F9WB 1FRGL 3HZKB 4KTEL 3IFLH 3EDKA 5J4MA 2LVEA 5IGXH 2RJMA 1QLEL 1ZMYA 5GQBA 2VYRE 3QUMB 4ONGH 3J8F7 2CPCA 3EYQD 1CGUA 5B4MD 4GG6E 5HJ3B 3LEYH 4MQ7B 1QBLH 2JJUA 3OMZA 2QSQA 4XI5D 3D3VD 2XTJC 5I30H 1L9NA 4WNQB 1A6VH 4PLJC 1CI5A 3V9FA 4U1MB 1I1YA 3IJSB 5J6HB 1DQJA 4ZYKA 2AAVA 2FR4B 5HHOD 4OCMC 1X4XA 3TT1H 1G9NL 1NMCB 4E42B 1H5BB 1I8KA 5EPMB 1KB9J 2QADD 2E9BA 1LE5A 1A3RH 2BVQB 4PJAA 5IIEA 4EI6B 5E2WH 3OJDA 1UB6A 4M6ML 3V6FA 1YEGH 1Q0YL 1MCEA 1BLNA 2E7HA 2CKBH 5AZEH 5T3XD 3MBED 5GJTH 3MRNA 3U0TB 4GBXA 2PNDA 3IFLL 3DGGB 2UWEB 1LNUA 4TVPD 2H26B 4HPYL 4F9PA 3MV9E 3UBXA 5HVGB 3TA3B 4TPRH 2R69H 1CN4A 3Q3GA 1YPZE 5DURD 3KPPA 1QBLL 3TBWA 3PWJB 2ZJSL 2DF3A 5I30L 5JW4R 4WI7A 3DGCR 5DZOA 4P57A 3QDMB 3MNWB 3QUKA 4JM2D 4LPCA 3BZDA 2R0KL 2R2HA 5LVEA 2VIRB 1FCCA 3HS0A 1U3HC 3MODL 4NKDB 2XPGB 2E6PA 2YD2A 1GGIL 2QKIA 3DXAA 5HHOE 5FO8A 4RX4A 4P9HH 4C4KT 4LCYB 3SDXF 4BZ1H 3FN0L 5EUOA 4MXQD 1HNGA 3UX9B 1S9WA 2CKBL 4O2FB 3S37H 5GJTL 1NBVH 3TM6A 2I5YH 4HS8H 5F6HJ 4FFVC 1ITCA 4U6YB 1NFDF 5EO9B 4XCEB 1DQLL 3U4EB 5TPWH 3H7BA 4XB8A 1EFQA 4XP1L 3STZA 1KCVH 3ELAT 1P1ZB 1B0GA 2C3VB 4TVPE 3P0YL 1FO0B 1MCOH 5BW7A 1P2CA 3C60C 1IBGH 2CO6B 3UJIH 4ALAL 5IQ9B 1UKTA 5EO1A 1HKLL 1NGPH 2LAAA 3CGTA 2X4PA 3JUYA 3ZE2E 4LDOB 2JE8A 3CMGA 3QNXA 4PJCE 4R4FL 5GZNC 3O2WH 4LPUA 3HNSL 4JRXD 4I1NB 5FUOL 4PRPB 5GSVB 4J3OC 1AXIB 4IMKA 5D6CA 4C56B 1KLUA 2I60L 2XFXB 5JZ7C 2V5YA 4P9HL 4BZ1L 1S7RA 4I13B 4YHNB 4TQEL 3KG5A 4LLUA 3WS6A 5DFVC 3OX8A 3QCTH 4AT6A 1RJZB 5D70H 3GK8H 1NBVL 1OARH 2Y1VA 3MRQA 1PKOA 4HS8L 2RR3A 2R29L 2YPVH 2ESVB 4H1LA 4DCQA 3SGEH 3HC3L 4PJ5D 3T0ED 5LAXA 2V17H 5D7IF 4M1GH 5TPWL 5L9DH 5I16B 2WSKA 2GK0B 4BFIA 1KCVL 4QO1A 5KTEL 4WI2A 1GHFH 1OP5H 3CVHB 2AJSH 4J23A 4QRPD 4KK5D 4BQ8A 1I7RA 5DHYB 2OP4H 2RFXA 3VWJC 5FYLD 1FNGA 4NN5B 4JDVA 3PUCA 3U1SL 3K46A 5BO1L 1JHKL 5IWLA 3MRBA 5DS8B 3MLWL 3UAJD 5A2FA 4JHAL 3CLFH 3QQ3B 4QF1A 1A6ZA 2D03H 5KAQG 1J18A 2EIZB 2ATKA 4PRBB 5JIHA 1HILB 4JRXE 1R5WA 4GT7A 4M00A 3QCTL 4LPVA 2AEQH 4HXAH 1OARL 1JF5A 3MUGA 2IANB 4HLJA 2VLRE 4PG2A 3ZL4H 4HUVB 4M1GL 4P2RB 3FONA 4KGJA 4M3KB 3V0VA 5SX5H 2AJSL 3T0EE 2B5IB 2G9HA 1H3TA 1S7QB 1RK1B 3U83A 3MCG1 5I15L 4Z7VE 1QYGH 2MCG1 3TO2A 1AGCA 3MLTB 1U8IA 5DRXB 5E99L 2XTJD 1A1OB 4PPTA 4PLJD 2A2QT 4XVSH 3BXNA 4WFFD 4XCNB 2X4OB 5GGQH 4YFEA 5ALBH 3ZHLA 3FO1B 5I1AB 5FYLE 4TULH 2A6JA 3I6LE 4J6RH 3FOMB 1A6WL 1MHEB 1HHJA 1D6VL 3BQUB 2WBJC 5E6IA 3P9WB 1YMMA 4JO1L 5FGCB 2NXZB 1XGRB 4U33A 4PJ7F 4GW1B 1CLZH 4HK0A 4R4BA 1N64H 3TO4A 2A38A 4HXAL 1MFEL 1CFSB 4M43H 5TQ2H 1FVCB 4LK4A 4M1DL 4O9HL 1IGFH 2Q6WB 3VWKC 3ZL4L 4ETQA 4K71B 4R8WL 1FZMA 5DHVB 1OP9A 2XN9A 1JZ6A 5I17A 1FSKC 3V8OA 1YNLL 1FGVH 1QYGL 3QUZC 4KK9D 2V7NA 4IS6B 1OGTA 5J0BA 5IEKA 4PV8B 3NN8B 4TTGA 1G9NC 2PN5A 5GGQL 4X6CB 3P0GB 4NQDD 1FN4A 3MRFB 4TULL 1FH5H 4JM4L 1JHLL 2XTJE 2EECA 2Q7YB 1T7ZA 3QRGH 4WFFE 3WS3A 3CFDB 1U3HD 1ZVHA 5E0QA 3H3PL 1JTPA 3IDGB 2EE9A 4WY7H 1D9KB 2IADA 3BD4A 2D0GA 4N1HB 1I75A 3WJLA 3W5NA 5CHNA 4WCYL 3FJTA 3DURB 4QHUB 3KPOA 3EDDA 4PJHB 3CFJB 4OFIA 4URTB 5MEND 4FFVD 1BVLA 1LK2B 4GOSA 3S37X 4H25B 4X7TA 4WI3A 4X6EA 2JJSA 1IFHL 4NKMB 2IALA 4C54A 5TDNB 2ARJQ 1KCUH 2H32H 3TV3H 1FGVL 1KXVC 1T20A 4HC1L 3C60D 3LD8C 3HI5H 4O2CA 1HSAB 1KYOJ 2DLGA 4S1DC 3ARFC 1NGQH 3EO9H 2Y23A 5IMOA 5IB5A 2AEWA 3MCKA 3O0RH 3WIHL 3QRGL 5GZND 2FBOJ 2J8HA 4X80H 2EDNA 4LU5H 1IGTB 1W72A 4WY7L 1J05A 4JHZA 5CAYB 5JZ7D 2AJYL 5E70A 2Q1EA 3GSNB 3QHTC 1KELL 1YPZA 1I8KB 3WL9A 2LE9A 5CEZL 2BY0A 2DMBA 2DQTL 3GMNA 4JY4A 5IIEB 3PWUA 4GMSH 3OJDB 3V4UH 1UB6B 2CDFA 4BH7A 1LWRA 3HR5A 4B53A 2V5MA 1E4XL 1TZHA 1AO7D 3O8XA 3D3VA 3MRNB 5IW6B 3S96A 1KCUL 4PRAB 2VDOH 3TV3L 4UAOB 1BMGA 3B9DA 4FXLA 1XFPA 4XZUA 5E2UL 3QJFA 3UBXB 1KJ2A 4P2OA 1CE1L 3VWJD 1RPQA 2X4QA 2NY3B 1G7IA 4IMLB 4XWGH 2DIAA 4Z8FL 3ZTJH 4HUWA 5I1CL 2X4NB 2IWGA 5I8KL 4AQ1B 4P9HC 1C1EH 3KYMA 1Q9OA 4P57B 4LRIC 3MBEA 1ZXQA 4KJQC 4HBCH 2Y36H 1A6UH 2OSLB 3BE1H 5DTFB 3GDBA 3X3GH 5GRWA 5A2LH 4Z7WB 4DVRH 2DQCH 2QKIB 2N56A 2XZQL 3MREB 4LPYA 4NO2A 4IBLT 1YNTB 3HI6L 5L8JB 1WBZB 2Z8RA 2W0FA 5IG7B 5DMKB 4ORZC 2Q8AH 2VB5A 4OLVL 3BD3A 1UXSB 1I9JH 3DV6B 2J6EL 2BY1A 3HMXL 3GEWB 1AO7E 1NAMA 1MAMH 5SWZD 3IXTA 1G6VK 4NRZA 4E41D 3NIGF 5F44A 1LEGA 4YHPA 1RZFL 1H3UA 5JOEA 3D1MC 1B0GB 5C6TH 3AREA 2Z8VC 4XWGL 2VE6B 4L1DA 4OQTH 1P2CB 4FQLH 5E94B 2XA8H 4M3JA 4NKOA 3MJ9A 4HKBA 1JCKA 1I85A 5IQ7H 5EO1B 3DVFA 4DKEH 2WBJD 1CICB 5IFHH 1A6UL 3BE1L 3BGMB 1K2DA 4X6DB 3LMJH 3X3GL 1NMBH 3GHBH 2DQCL 2PYED 3EO0B 5IMMB 1GC1H 1CLOL 1DP0A 2Z31A 3GI8L 4YXHH 1U8JB 3IAQA 2BFVH 3SY0A 2GK2A 4OKVA 5C0AE 3VWKD 2HKFH 4YR6A 1EEUA 2A77L 3SGKC 2XT1B 4XPTL 5AUMB 1BBJB 3OX8B 3IRZA 3FFDA 2Q8AL 4NFBA 4RGMC 1EK3A 3PHQB 5HPMB 3DX7A 4BFEA 2GTZA 4Z7UF 1ZLSH 1LP9E 2IBGA 4O51B 4DCQB 5LAXB 1BP3B 3Q6FA 1MLCB 4JN2A 3VFNA 1J0IA 1KGCD 3QUZD 1IILE 3EOTL 4JRXA 3ZTJG 2R0ZH 4XTRC 1FO0H 5SWZE 4GRWH 3VG9B 2VQTA 1KN2H 3BP7A 4J8RA 3AS1A 5AEAA 3ZYJA 2YRZA 3BPLB 2PW2B 5AZ2L 5IQ7L 4NZTL 4RAUA 4JDVB 1T5XA 1FL6B 4DKEL 5IFHL 4DEPC 3QZWB 4M7ZB 4LFHG 5T1KB 4AM0A 4NUJA 3LMJL 1WZ1H 1BBDL 1WAAE 1MF2L 4PJ5A 4PRHA 5SX4I 3UTSB 1RK0B 3VE0A 4G42A 4FQ2H 3T8XA 1E28B 4OF3A 2BFVL 2WIMA 5T3ZL 1KF9B 4Q0XH 2PYEE 2BCKB 4DGIH 4QRPA 2YA0A 4Z7NF 5DVOA 2Z8SA 4XP5H 1J0YA 4HDIB 1ZHKA 5KW9H 4I0PC 2BRQA 1OOAA 3MUGB 3QB7C 1ZLSL 3U30B 1P4IL 1DBJH 5DA4A 4RMVA 4HUMB 3FONB 3WKNA 1IKNC 2FX8L 1AXSA 1JGVH 4Y16B 1MCHA 5D71H 4PREB 2D0FA 3AM8C 3CUPA 5HY9B 5H2BB 1I8IB 2VAAA 4S1DD 3HRZA 1BEYH 4MA8H 1SJXA 4Y5YC 2FHFA 5D96C 1RZGB 4G6FB 1QBBA 4AYFA 3LN5B 4FQIH 4XGZA 4ZODA 1SBSL 35C8H 3QI9D 3MGTB 3F12A 3AGVA 1WZ1L 2QJDA 4DN4H 2ZUVA 5DC4B 1QA9B 4PLKC 4Y19B 2DQJL 1HHJB 4LLWA 3G6DH 1YMMB 3O2VH 4KV5E 5KSAC 3GO1L 4OZHE 5MP6H 4DGIL 3GJEB 2JIXD 4HK0B 3O4LB 4D2NA 2NQCA 2CLVA 4HHAB 3S36X 3U0PA 1CLCA 5D8JH 4D0CB 4G6ML 3V6OA 1DBJL 4MQTB 4ETQB 4KQ4L 5BV7B 2FZ3A 4ENED 2JCCE 1JGVL 4X7SH 5D71L 5I17B 1JRHL 3A6OA 5B38A 5K9JL 4JZJC 4M5ZH 3FB5A 3MLYH 5D6DA 4DKDC 1BEYL 3NIDF 4LAJH 5CCKH 2MSPA 1BREA 2L0DA 5IEKB 3KXFB 2D7OA 2OBGA 1NLBL 4K3DH 1BVZA 3BZEA 4UUJB 2VXTL 1CFTB 1QG3A 2XZCH 4KJQD 2DKMA 4DN4L 1FN4B 4NZUH 3QFJA 2ICWJ 4XVTH 4OGYH 3DETC 5FB8A 3HUJA 3O2VL 5AG9A 3RQ3A 3MGAA 3PJSA 4ZUWB 1EHXA 5GRUL 3BDYH 5MP6L 2IADB 4Y4KC 1A6TA 1H8SA 1BZ9A 2AK1H 1MREH 1B2WH 4WV1A 2E9WA 2WANA 5CHNB 4NQSA 2J12B 3X14A 4R97C 4LARH 4F7TA 1PY9A 5D8JL 2YUZA 3KPOB 5JA8B 5I1KH 4NQDA 3BMWA 1EA9C 3W2DH 1TITA 4O4YH 3K1KC 5C7XL 5FDYA 4ZFOA 2OS7A 1U3HA 3VXRA 5EU7C 4M5ZL 5HYJD 3TBSA 2ARWA 1QFPA 4WJ5A 4YZFE 1H0DA 3ZHDA 5TF0A 3ARGA 3PL6A 3VGDA 3ZYZA 4PJIF 4NM4H 5I1GH 3OTTA 4KMTH 2EYRA 1DR9A 3VXMB 4JPIA 4NZUL 4ZOEA 2A9NL 5CIPB 5IB5B 3QQNA 4JFEB 5MENA 1KNOA 3MCKB 2X10A 3V6ZB 3WUWG 5DJDA 4BSVA 4L5FL 4OCRL 4MDIB 3OWEA 4U3HA 5IB1B 1J05B 3CXDL 4AH2B 1VSCA 4OLXH 3RIFK 4PIRF 3E0GA 1B2WL 4PJFB 2SEBB 4X6CF 1F4WH 4YO0A 4LARL 1S9YB 4M4PA 2EZ0C 1KB5B 1RJLA 1VKXB 3GMNB 4JY4B 3O6FB 1BECA 4PJEA 4NJ9H 1NJ9A 4R26H 4KI1A 1OTUC 1FBIL 4BH7B 4CMMA 1TZIA 2LAGB 3RTQC 3THMH 1HI6A 1CXIA 3MLRL 1I7ZA 3O8XB 1A4KB 4ERSL 3S96B 5DVMA 1CD0A 1QFOA 3O3BA 4JJ5A 3HB3C 1L6ZA 4XTRD 3MLPA 2DJUA 5E5MA 4PJHF 4BKLB 5D5ME 4XZUB 3QJFB 1KJ2B 5HYJE 1HIML 5I1GL 5CILH 4X4ME 4KMTL 1ZANL 2LU7A 2F15A 4YEFA 2QQLH 3GGWB 3VXQB 2O5YH 5C3TA 1Z9SA 4DFHA 3RIFF 3ILQC 3AMKA 4CMHB 2CSPA 4K3GA 4OLXL 5MEQB 4K9EH 1HHKA 1FL5B 2OTWB 4KTYA 3GSNH 5I1JH 2ZUQC 4YNYA 2BXZA 4HG4J 1DTUA 1HQRA 4U1KA 1S9KC 4NJ9L 4I0PD 1H3VA 3VWJA 3PGCB 3EOBB 12E8H 5E56A 3RFZC 2GT9A 1IL1B 1CD8A 4XNZC 1IC1A 1MHPL 1RIHL 2L7JA 3LS4L 4POYA 4LGPB 5JIIA 1J0ZA 5D2LB 4TTDC 3S34L 3VMPA 3MACH 3GJFB 1R3LB 1Q9WB 1WFOA 3FAXA 1KJVB 2UYLA 3AS3A 4WEUD 5I0ZA 1EFXA 3RNQA 1NL0L 5CILL 4OCXL 4OI7A 3PABA 3BPOB 3AREB 5GGSA 2COQA 2P7TA 3D2UA 3RI5K 4BZ2H 5E8OA 1YEJH 3OG4B 3QH3A 4G80A 4TUKL 4FQPA 4ZS7L 3QO0B 4ODUA 1LP9A 1IM9B 1E4XI 1NLDH 4PLKD 4HJGA 4YGAB 1UZ8A 2GSGA 3BO8A 3O41A 2FBJH 5KSAD 2VAJA 4MB4A 3HZYA 3MFFB 1OWWA 1WEJH 3JV0A 1I1RA 3QXWA 4P59H 5IEHB 4E41A 2Z31B 1EAJA 1AY1H 2HWZH 4PGBA 4YR6B 3AS2A 4JQIH 3BUTA 5ICZA 1N3NA 2JK5B 4WUKH 4PJXA 1S7TB 4L29A 3TIEB 3FRPG 5KZCD 1KG0A 4AMKH 2GTZB 4AEEA 5FKPA 1FYTA 3DARA 4P4KA 1Q9LA 3CH1A 3Q6FB 5K59E 2I24N 5EUOF 3RI5F 4Q2ZB 3S5LG 1XCTA 1P4BH 2CK2A 1FNAA 3ZE0E 2CIIA 5CEZD 2Q86B 1V8HA 3L5WA 2ATPA 3CSGA 2D3VA 2D7PA 5JOPE 1NLDL 2YS4A 1L7TH 3DETD 5KJRL 2BVEA 4U0RB 2FBJL 4AM0B 1YEHH 1QFWH 2P42B 4PRHB 4Y4KD 4P59L 1FE8H 5E08H 5KSBA 1AY1L 4A6YL 2NY7H 4FZ8H 3G5YB 3O11A 3OAZH 1RZJH 2WNGA 3DMMB 1GVIA 1TPXB 4X6DF 5KS9A 5ISZD 1ZHKB 1KIPB 4OBRA 3L3HB 1SJHA 2PF6A 4ODBD 2X9YA 5ENWA 2Y7QA 1MUJB 5DUPL 1ZGLA 3SDAD 1YN6A 2VQUA 5BS0A 5CJBA 1UG9A 5GS1B 1BD2B 3KDMB 3GSQB 1P4BL 3D0VA 2C4FT 1A6AA 1NMAH 4PJ8B 3HRZB 3LRHA 3DHMA 4JPWH 4JO4L 1W0WB 5CS7A 4RRPG 3VFMA 3DSNA 1Y0LA 3REVB 3CDGB 4KJYB 1IZJA 15C8H 3OKEA 5CEZE 4XC1H 5JR1H 3F12B 5A2KH 1QFWL 3KS0H 2P8LA 3SDDC 1X7QA 3RL1A 3U79A 4OJFH 1TNMA 4LLWB 5E08L 2CK0L 4I48A 5C0IB 2EZ0D 5I8CA 4OV6F 1D5IH 4R2GC 1MCSA 4MB5A 1OTUD 3ZO0A 1I1AC 3RTQD 5DZLA 1YDPA 3U0PB 4Y4FA 4D0BA 5JXAH 3WLBA 3ILPB 1S9VB 3LKRA 3QI9A 3STLB 3SKMA 5ISZE 4WUUA 3HB3D 2GJZA 4HH9B 1Z9OA 4QRRE 4Y5VC 2JKXA 5T5FH 4EN3B 1A0QH 3T4YA 1NCAH 4WHDA 1T2QH 5EU7E 4PUBL 2DQEH 4CU7A 2ZOKB 1GZPB 3E6FB 3LEXB 4GXUN 3PGFH 4OFDA 2EE6A 1DLFL 4ELMB 1A9EB 1UWGL 4PJ9C 4JPWL 4MMZC 2X6MA 1VEMA 3BD5A 1ONQA 3PXHA 3IXAA 4UB0L 5F1IA 4TUOA 5L6YH 15C8L 3WE6A 3BZEB 4XC1L 5D4QA 5JR1L 3VXUB 3IYLW 3ILQD 3RY6C 1ZVYA 2QR0B 4FZEL 2DQUH 3QFJB 3JWDL 3TWCH 1UGNA 3PQYA 4F8TA 1IC4H 3OB0H 4OJFL 1KUMA 4GRMB 4RMTA 4UMGA 2UY7A 1T21A 2XQBH 4GQ9H 1GGCL 2EH8L 3BP4A 2A74A 2C1OA 2IPKA 3NFSL 4HIIA 4R7NA 4YE4H 3RDTC 3MCLH 4HWNA 4MNGE 2NY4C 4WI6A 4FOMA 3MUZ1 1FJ1A 2A83A 4NQSB 4MX7A 2MPAL 2IG2L 4TTDD 1QD0A 4JFXA 5BV7H 2VH5L 5C07A 5T5FL 3LPFA 3HC4L 1A0QL 1NCAL 2F54B 1T2QL 4JZNA 4JLRB 4ZFOB 4OI8A 4YGVA 5JHLH 3WFCH 3TBSB 4UQ3B 3TNNB 1R3JB 1H0DB 3OPZL 1NBQA 1RZKH 1SMAA 1QVOB 2EEDA 5EH1A 3ARGB 3OZ9H 1IEBA 5T3ZD 4GRLC 1CK0H 5J1TC 1IC5H 4JPIB 2DQUL 4NT6B 1J1XH 4UT6L 2OZ4L 1KNOB 5IW3A 1RJYB 1U8HA 5DA0B 5DJDB 4I3SL 4BSVB 2XQBL 2YXFA 4GQ9L 1FGNH 2H8PA 4F9LC 3MRRB 2YC1A 1JRHI 4YE4L 3V0WH 4E9LA 3ZKXB 2DWEB 1T7XA 3IJYA 3DX8A 1MFCH 2UZXB 4LCWA 1RJLB 2WAHA 2FIKB 3JTTB 4QTHA 4MA7H 1F3JA 1NJ9B 1Y18A 1ZEAH 2WLZA 1MCNA 1JPGA 3CH8A 4WHCA 4CMMB 2K7QA 2O5XL 1INQB 2I26N 1RY7B 1TQCC 3DVNB 4FQCH 4WI9A 4RFNB 2Y5TB 3VXSE 1L0QA 3OKKA 3O3BB 3OR6A 4OT1H 4U3XA 5DUBA 3WFCL 1NAKH 4D0DB 5E5MB 1U8QB 1FZJA 1RZKL 4OLUL 1WC7A 1SQ2N 3QFDA 1G7HA 2KBGA 3OZ9L 1M05A 4NP4H 4YDVB 2C3WA 3WXWL 3L7FA 1QTYT 1IC5L 4LSSH 2BJML 4NQXA 1J1XL 1OLZA 3JV5A 3RUGE 1OF2A 3H7LA 3CFBB 4PG9A 3CPLA 2YSSA 3Q6GH 2O61B 2YPKA 3X17A 2B20A 4FXGB 5D7JB 4CADB 3V0WL 1OAXH 1ZSDB 1B0RA 1MFCL 3QJHA 1AD0A 3P4OA 3CAFA 4U1KB 1UACH 1JPFA 5DD3L 1AIFA 1JWSA 1UT9A 2WIIA 4CVUA 1IT9H 5JHDB 5JPNB 3FQUB 5CEXB 1YUHA 3HE6C 3OB8A 2PTTA 3IETB 2B2XL 3RJQB 3EW3B 3RX8A 5F7KC 4DUXA 1KACB 1NGWA 5C2BH 1LVEA 2JJWA 4TSCL 4YDIL 4QRUB 4OT1L 5C6PB 3DRTA 3IDYC 3IAGC 2EDJA 4XP9H 2LABA 2UYLB 1U91B 3ZDYE 5C0RH 1BJ1H 3SCMB 3W0WB 3RNQB 4ZXBC 4NP4L 1N6UA 3L9RA 3UTTB 3FQXA 3O81A 1T22B 1F90H 2P7TB 3F7YA 4I77L 1JYWA 5C0DA 4OCYH 4TSAL 1FZKA 4GAYB 3Q6GL 4ODUB 3SDDD 4WHTA 3GJFK 1OAXL 1UJ3A 2GSGB 3SKJL 3O41B 4NQCD 1BWMA 2D31B 4MA3A 4R2GD 3DTXB 4JRYD 4X5XB 1I1AD 3MZTA 1OAKH 4YHIA 4NO0A 3VH8A 4EEEA 4PGBB 4LDLB 1ERNA 4MD0B 2CLZA 5ICZB 4OD2A 4RGOL 4RISH 1N3NB 5IB4A 4PJXB 1AE6H 4L29B 4PTUA 3QQ4A 2V5RA 4R3SA 3KPQA 4PRIA 1FYTB 4G8GA 4KUZH 4P4KB 4Q74A 3RA7H 5CFHA 3WDIA 3CH1B 3PHOB 5IM7B 3RWEA 2DICA 5KSAA 2VC2L 3GRWH 4PJ9D 2APTA 5F88A 3QIUA 4P5MA 5I18L 4D8PB 4HK3N 2CIIB 2ZSVB 1LK3H 4HC1A 3L5WB 5BJTB 1EEQA 3C08H 4PY8J 2I9TB 1QSFB 1MIEH 3UJTL 3L3GB 3NGBC 1TJGL 5EG6C 3RDTD 5LXGL 2P48B 1WBYA 2NY4D 4JZJA 3TGXA 3CIQA 4NQVA 2QQKH 4MSWB 2AJUL 1OAKL 4M6AA 4NQCE 5KSBB 3HZMA 3QUYA 1XF3B 5CSZA 4ETYA 2JELL 4JRYE 4EI5C 3O11B 5F3BB 4DGYL 3BPNB 5D2NB 1AE6L 3ARQA 4G6JH 3UC0H 1SJHB 4JFQB 1UB5A 3D0LA 5KVDH 2Y7QB 5CZKA 5DRNB 1H8NA 1ZGLB 3NOIA 2X4TB 1F4YH 3UDWA 4HMDA 5GGVL 4KU1A 3JWDC 1K5NB 3QPXH 1WT5A 4GRLD 1EXUB 4O2EA 1CWVA 2X9XA 1SJVA 5F89A 1UM5H 4OB5H 3D9AL 4WTXA 4KH2A 3ROLB 1BFSA 3TLRA 3RL2B 4K3JL 5B21A 5FEBA 3B5HA 4YJZL 2P49B 1IM3A 5FECB 3WNMA 1X7QB 2FO4A 2HVKA 4WO4C 3SDAA 3RL1B 3B5TA 1MJ8H 1LO4L 1A7PL 2M2DA 4WU5A 4I48B 1FPTL 5DEGA 5J89A 5DRWB 1U8LA 2YD8A 4G6JL 1WCBB 1UEYA 4Y4FB 5ADPH 2L7UA 2AJXH 3WFBH 3SKNB 2R4RH 1ORSA 3AB0B 4Y4HC 5HHMB 1RUKH 4PJDB 3B2UC 1NDGB 3FCTA 4KVCL 3DWTA 4LDEB 1UWEH 2OI9B 1PZ5B 2GJ6B 1WICA 2HMID 4N0CC 1LE9B 3HMXA 1HCVA 1OTTC 4PJGB 2P8PA 3QHFH 4OB5L 1J5OL 5E9DA 1FQ9C 3GMMA 5F1IB 4X5WA 4CN6A 9CGTA 2BHUA 3VFGH 3GNMH 2F58L 1HHIA 3PWVB 4WU7B 1BIIA 3RKPA 3JWNC 4OZFB 2YWZA 1PQZA 3F65A 2DYPB 1T21B 4XNXH 3X12A 3BP4B 5F9JA 2C1OB 3NTCL 4HIIB 5FDWA 5DC9B 4YWGL 3LQMA 4LAQH 1AGBB 5AAWA 3GMRA 1ZA3A 4HGWB 4K94L 1Q1JL 3HE6D 4HJ0C 4L3EB 4LLMB 2NW2A 4X0KA 4AENA 1NGYA 1QNZH 1RZKC 4J3UA 1WTLA 3WFBL 2R2EA 4GW5A 3QXUA 3B9EA 3QCUL 5C07B 4LPXA 4CJ1A 1N59A 3RX7A 3TYFA 4MD5B 4M8QA 4Y5XB 4KUCD 3SE4A 4ZXBD 1W0VA 1MVUA 3VFVB 2RAMA 3NPSC 5GRXG 2VDRH 4PGDB 4MNQA 2ADIB 5I6XB 2V2WA 4QXTB 4P3CL 5CKGA 3QHFL 3KPSB 4GKSA 2I25N 1FORL 5JW4N 2CDGA 4DN3L 2VDLL 5EU4A 2BZDA 2AV1B 3GNML 4PGCB 1BM3L 1R3KB 5DMGC 2W92A 2ERJC 4DQOL 3B2VH 4WWKC 3X11A 1U8HB 4FQJH 4MD4A 4ELMF 4YBHA 4X83A 1I1FB 4LRNH 4XNXL 5E00B 2V9QA 3ULUH 1S8DA 3C6SA 5KOVC 3G5XB 1T04A 3IJYB 1EDQA 1GOHA 4HV8A 4LCWB 4U7SA 5FGRA 3CMOH 1QNZL 5J11C 3NPZB 4JQXC 1WQVT 3HUJF 3EO1B 5FAAA 4NSKA 4GS7C 1B9ZA 1F13A 4MHHG 4JZOA 1JWMB 3OR6B 5DUBB 2BVOA 5IHLB 5F21B 1AP2B 3VFTA 4N0RA 1WC7B 3NMEA 4ZD3H 3PF2A 4LNRA 1AGFA 1X4ZA 4BQCA 2XKNB 1M05B 2ZKHL 3H9SE 5CSBA 1QKZH 1V3MA 1IQWL 3DI3B 3FO9B 3L7FB 2ZOLB 4PD4J 1JF1B 2RIKA 1DN0B 1MELA 3B9VA 3B2VL 2D4FA 1XH3A 1IJ9A 5FYKH 3MRJB 3UYOD 1OF2B 2EYSA 4S1QH 4M62L 2A1WL 1II4E 1TQBC 4G8IA 3QDGD 5I76B 1ACYL 1B88A 3HAEB 5F93C 4L4VA 1RUQH 2AABH 5E95B 1T89A 2BNRB 5K9KA 4NKIH 4EIZC 4B7IA 3KPMB 5HGBB 2HFEB 1TETH 3QAZC 3NA9H 3BZFA 3P11L 4IRJD 3MRGA 2J8UA 3TPKA 4KDWA 5DR5L 3T3PE 3FB7A 4AEHH 1FCGA 4PJEF 3TZVC 4ZD3L 5IVOA 1KENH 1RIVH 2BOCA 1U58B 4R90H 3L9RB 5J8OA 2W9EH 3L3OB 4FQHB 4S0TD 3NBNA 2IJ0C 4F3FB 3FB8A 1V3LA 4Z0XA 3B6SA 3TCLB 1VDGA 5FHAH 1FZKB 1XR9B 3O9WC 3CZJA 4DKFL 4WO4D 1XIWC 4EXKA 5IHBA 2W59A 5HGHB 2ED9A 3SJVB 4KHXL 4MA3B 4IHOB 1Y6NR 4I8DA 4OM1H 1RUQL 2AABL 4L3CB 3FRUA 3QDGE 4YHIB 3VH8B 4OI9A 2DQFA 1QFUH 3DX9B 4I0CC 4Y2DC 3BIBX 3B5GA 1P7KB 5IB4B 3UPAA 4EUPB 4JFFA 1T7WA 4PTUB 3QQ4B 3TPUB 3GUTA 1MCRA 4I3GA 3B2UD 3SDDA 4R3SB 3QUML 4XB7A 5K93A 4JKWA 4N0CD 4RFEA 4PRIB 5DWUL 1C16A 4YXKL 3RWEB 5MEPA 4GAGL 1OTTD 4LLVB 4ZMAT 2W9EL 2M26A 4P5MB 3KPRA 5FA3A 2QHRH 3AMLA 4P23B 4LPTA 3PV6A 4WIQA 1JL8A 5DD6B 6FABL 4RZCA 4JANA 1MHHB 4MMXC 1QRNE 4D94A 3K8KA 3BESR 1LO0H 5I1DB 5J9PA 2C4XA 1EGJH 4UILH 1AHWC 1PW3A 4M7LT 1QPPA 2R9HC 3WYRA 1OP3H 3IDNB 4EQ2A 4LSQH 4NQVB 2WUBH 4HJ0D 5JW3H 2CDEB 1QFUL 4LP4A 4E0RA 5CSZB 3MUY1 1FG2B 1F6AB 3P4MB 4F7CA 4NO5A 5HTSA 5EOTB 1AC0A 3VA6A 4JKMA 5KVEL 1M71B 1YN7B 1TVHA 1UB5B 3L7EB 1JZ3A 2OJZL 2VLLA 5F96L 1ULVA 3VD3A 3ARPA 4YHKH 1ETZA 4MXVE 4NCC1 3T0BA 5INCA 2ICCA 3A67L 4PBWD 4PS4L 3RDTA 2PO6B 2FL5B 4PJXF 2HLAA 1OQOA 1JMZA 4KC3B 2E8YA 3BEVB 3V7AG 2NTFA 5DMGD 1QP1A 5HHPA 2Z92B 4WWKD 3MRMB 3C6LC 1I9IH 1I8MB 3I3DA 4K94C 1RU9L 1DSFL 1EGJL 4UILL 5EBGA 4Z5RA 5HI5C 5D7LB 3H9HB 5C9KA 3ZKMC 1YC8A 4YXLL 4G7VH 1F8TH 4DUVA 4G9FE 4NHUB 4F57H 2P5ED 4V2CB 5FO7B 4HS6A 1T83C 1RVFH 4GRLA 1MPAH 1U8LB 3MPCA 5IW1A 2X7LB 1J1OL 2FDBP 1HDMB 1KBGH 1DVFA 4ODXA 1N2RA 5D1QA 1KOAA 2HFTA 1C7TA 4JHWH 2JTDA 4PRNA 1CBVH 2ICEB 4F9LA 5KSBF 3I75A 4LSVH 1A3QA 4GKNB 4XRCA 3FCTB 5C0GA 4LF3A 3DI2B 5INDA 3VI4F 3S35L 5KS9F 1EMTH 1F3RB 1WWAX 5DJCA 4ZQKA 1NCWH 2EIEA 1DEEA 1J8HD 3SO3C 4I18A 5JDSB 3N1MC 4JDZB 5CJ5A 2OJEA 4NN6B 5ESQB 4YHYB 3FQNB 3NCFB 5E9DB 3CXHK 3GMMB 1NC4D 3HC0A 4X5WB 4EBQH 4I2XE 2YZ8A 4XMKL 3U6RB 3BRGC 1HHIB 4LVNB 2IMMA 1R0AH 1KB9K 2VRAA 4PGZA 5CZXC 3N50A 1DN2A 1JHTA 2R1WA 5CZVL 3ZDXF 1F8TL 5T1LD 3WEXA 5IOPA 1PQZB 4S1RL 1N6VA 3BVNA 3AU1A 3BKYH 3DVGA 4DUWA 5F1KC 1SM3H 5J3HC 3H42L 1RVFL 5I8OH 5ITBH 4NDMA 1T7VA 4IRZH 4MJIB 3QG6A 1KBGL 2ZUUA 1S5IL 2NW2B 1G9ML 5CWSB 1ACZA 2BY2A 1BVKA 4NFCA 3LS5L 1ZT4A 2FYYA 3BHBB 1CBVL 4ZUUA 3ARDC 3SQOL 1TNNA 1MEXH 1QSED 1RIUH 3CVHL 2F5AH 4FNLH 2DLHA 4FQQB 3TYFB 4M8QB 3TZVD 3T1FA 4S11A 1W0VB 2C1PB 5GS0L 1DUZB 4HPOH 4MNQB 5DT1L 4PB0L 1TVBA 2V2WB 4IDLA 4OLWH 1ES0B 1MHCB 4DKAA 3O9WD 5DJ0B 2GAZA 4PJDF 1NCBH 1R0AL 3TBVA 1GGYA 2F19L 3DUSA 1JPST 3ISWA 5BXFA 3ZYOA 4K2UH 3MRHA 4MD4B 4PJGF 5DHXB 4NN7C 3BDXA 3BKYL 5FM5M 4GG6B 4LKCB 1S8DB 2W0KA 2DLTA 4OQ1A 1NBYA 5DMIL 1T04B 1P69B 4RMQA 3G04B 3T2NL 4Y2DD 2XA3A 1U8MB 4IOIA 5DQ9A 3VA2C 5HHXH 5IESH 5F7EH 3MO1B 2C7UB 1IGMH 2VLJD 4B0MM 3SDYL 1MEXL 1A14L 1RIUL 2VUYA 2Y07H 2XWTA 3BRFA 4OCSH 3SDXE 1S9XB 1VACA 2DD8H 1F4AA 4L8DA 2VZ3A 3MNZA 5SWQA 2P5WD 5CP3H 4OLWL 5E1HB 5LGJA 4N0FB 1CDJA 1CR9H 5HYSB 3FQRA 4PR5B 2MKLC 3KJ6L 2UZIH 4LLQA 3DX6B 1T1WB 4DTGH 4NCC2 1I8LC 43CAB 3UZQA 3VGFA 5BMFH 1OAYH 1V5JA 4K2UL 4QHMB 4RMRA 3TN0A 3WN5B 2EYSB 2WBKA 4E5XB 3MV9B 2R9HD 3MMEB 4JG1H 4JHBA 4FHBD 5F9WC 5FUZL 4YDLB 4M6OH 4LKXB 1BOGA 4IIQA 4Q9RH 4CVXB 2IBZY 4K23H 2FCBA 3K1DA 1KFAH 5JA9A 3MTRA 4L4VB 5AYUL 5HHXL 5F7EL 1KTDA 3QIWA 2R0LH 5F72S 2YA2A 2XZAL 1NC2D 3CSBA 4OCSL 5DJXA 5EBLB 3QWOA 1J0HA 2CQVA 2VLJE 1N0LA 1AC6A 3MV8D 2N7BA 3WSQL 2RHEA 4HSQA 2F8XC 4JAMB 1NMCC 2UZIL 2W60A 3MJ7B 1HZHH 5D7IE 2X2YA 3JUZA 3C6LD 4YHLL 4JGMA 4MCYB 3QXAA 4LHUD 5HI5D 1GIGH 5GRJH 1GH7A 3IS1X 4F7EB 1S7UA 4RFOL 4PRDB 4XNMA 3VCLA 3ZKMD 4L8BA 3GB7B 3PP3K 5I1IL 1HXMB 4NKQB 5JMOC 5I19H 4IRJA 1T6VN 3CVIL 3NCBB 3P2TA 5I8EA 3OGCB 2P1YA 3TA3C 3LDBB 1T1YA 2R0LL 4KQ3L 2EDFA 1BIHA 4A2MA 5IT2H 1GCFA 4PJCB 4YPGA 2E7MA 3O3AA 4LIQL 4JFFB 1FG9C 3GUTB 5F7LB 3UTQB 5T33H 1GL4B 1JNLH 4RFEB 1KIQA 5E5RB 1E4WL 4OZ4A 4HLZH 4QHNA 5MEPB 5EWIL 1FL3B 3EZ8A 3MV8E 5HDBF 5GIRA 1QSZA 5FYJL 3KPRB 3IF1B 4L9LA 5IJKC 3FN3A 3OAUL 3PV6B 1SY6A 4HIXL 4BQ6A 5AWNL 2NY0B 4JANB 2HG5A 5CZXD 3TJEH 2IPTL 4X8XA 5I19L 4LCUA 1J87A 2Z0BA 1FFOB 4LHQB 5J3HD 4ZNEE 1WIPA 5JPMB 1CDUA 3C5ZC 5F97E 1S7SA 4JFDE 2Y72A 3U46B 1MCJA 3V5KB 3FTGB 2CUMA 4J3XA 2ICWB 4NO5B 1ZHBA 5IF0A 4ORGB 4UINH 4LSRL 4PJ7E 4HULB 4NWTH 1AQKH 1DE4A 2YKLL 3K2MC 5T33L 5FCUH 4Z18A 2VR4A 2VLLB 2QLVB 3BN9D 2FJHB 4MJ6B 5TE6H 3BOVA 4K7PH 2DWDB 5INCB 3LKSB 1CXFA 1PG7W 3RPIB 2HN7A 3MRDB 3IFPB 3Q1SH 1EO8H 4X8JA 2HLAB 2VLRB 3ME0A 3TJEL 3P73A 3GMQB 4LLYB 4YHZH 2ITDB 1IEAB 3T0WA 3LIZH 1YQ2A 3T0EB 4JO2L 4P2QE 3OKLA 4JY6A 1I3GL 4HUXA 1G9MC 1U8KA 3TNMA 1XF1A 3RRQA 3VFPB 4H20H 4KRPD 4BZYA 1KULA 1M1SA 3MLZL 2HVJB 5CGMA 4APQC 5IB3A 2DLFH 5GS0C 4ZAKC 4LLDB 1RULL 5C0BD 1L4IA 4NWTL 5ERWB 4JB9L 1EH9A 5JIPA 4H1LH 1OM3H 4NN5C 1DVFB 4ODXB 1J10A 5JMRA 5D1QB 1PX3A 2A9ML 1XGQA 1VPOL 4XPFL 4HLZG 1G6RB 5L2KD 3HNTH 1CLYH 3I75B 2DI7A 2EYTB 4XRCB 1KYOK 5C0GB 4LF3B 2KH2B 3Q1SL 3KS0J 4OSUH 3VRLF 2DQHH 1BWWA 5DJCB 2P5EA 4ZQKB 1DEEB 4HX1B 2OJEB 4U1IA 1F58L 2XY2A 4JQXA 3Q5OA 4L8SA 4YHZL 3HC0B 5A43C 3I02B 2AS5M 5I73B 3WJJA 1QR1A 1FZOA 3P40A 4NZJA 3NFPA 3PXJA 4QT5A 1YQVH 4OGAD 1JHTB 3RWCA 4H20L 3QSKB 2HJFA 1VGKA 3ARBA 3LSOB 4UU9A 1G84A 1IE5A 2B5IC 2VO5A 4Z95H 4W6WB 5T1MA 4ZSOB 4Q6YA 5ESAA 1J8HA 3EJJX 5A2JH 1MFAL 4MWFA 5E8EA 4X98A 3OKNB 2R0WH 1GPOH 1D5BB 1DDHA 1BVKB 4KJWC 2OL3H 4UT7H 4LGSB 3HNTL 1CLYL 1KN4H 1VGEH 1QRKA 5TE4H 2X70B 4F15B 4J1UB 4LSPH 4OSUL 3B9AA 2CH8A 5T1LA 1ZWIA 3T1FB 5GZOC 2NXZC 3LN9A 3AROA 1HH9B 3BJ91 1ZTXH 3HLAA 3OV6A 4Z9KB 2DQGH 2XICA 1KXTB 3C8KB 4TOYL 1MWAH 5CJ8A 4PLNC 4N0UE 1WK0A 2GAZB 4TSBH 1KPUB 2DBJA 5MEOB 2D0HA 3SDXA 3DUSB 1FC2D 1YEFH 1QSEA 4QTIL 5GGUA 1H15B 3DLQR 3RZCA 3TA3D 2OLDA 1ZS8B 4FQ1H 2AJZB 5H37H 2ADGB 1FVDB 1OAZL 4HFWA 1NFDA 4H1LG 1XGTA 4KXZH 4F7MA 5CJOH 4HH8A 4UTBH 3W9EA 1HQ4A 25C8H 3QDMD 1XGYL 4UT7L 1AI1H 3PDDA 1KN4L 3IDJB 4KK6C 4UNTA 1KJ3H 4MAYA 2XWTB 3PG2A 5FXCH 3QDAA 2LTQB 2Z35A 4FMKA 2Z9TA 4L8DB 1LEKA 3MRKA 2GJJA 1D9KC 1CFVH 2J4WH 2NW3A 1F3DH 3F58L 3W39A 2GSIB 4WEMB 2DQGL 2WWKO 4LLQB 4QOKE 4PGEA 3EIFA 5EA0H 1LEIA 3QUXB 3FT2A 3BH8B 4TSBL 3NIGE 4J3WA 1ZLVH 1HXYA 4R4NC 3HPJB 1B4JH 1TDQA 2JB5H 1FNEA 1YEEH 1CGTA 4KY1H 1UCTA 3C5ZD 3IDMA 4FQ1L 5HYFA 5L8LB 3UCRA 1BOGB 4IIQB 2X4RB 1U8NB 2P5WA 4JPVH 4KFZC 4YFLF 3LVEA 5D7IA 1H9VA 2GFBA 1JK8A 2IH1A 4DWHA 4GLRH 5CD5C 2XNAB 4H26A 2AEPL 3BI9X 4P0DA 2XIDA 5JO5B 4QNPF 4X7EC 3I3EA 3QIWB 3QCVL 4LEXH 4OZIA 1WITA 3DUUA 4GG6F 1FLTX 2DN7A 3ALPA 4I0KA 3RWIB 5DJXB 3VFRA 3QWOB 1AHWA 4Z77B 3D18B 3QDME 2K1MA 4PRPD 4C56D 1CFVL 5DDHA 3K2UH 2J4WL 4TUJB 4K7PX 1MH5A 1R3HA 1DFBH 4Z7UE 4Z78A 3ARTA 3CFCL 4DOHE 4KTDH 2HFGH 1DANU 3MV01 1RJCA 1UA6L 2EH7H 4U1SA 4HCRL 5JNYB 2ESVD 5EOCH 1AO7B 3L5JA 5F3HA 4M7LL 1W72H 5H37G 1NC2A 2PCPB 3E8UH 1KT2B 4UAOC 4APQD 3LAFA 5EN2B 1R3IH 3QA3A 5HGAA 3U9PH 1OB1A 4F9PC 3V4VL 5GS0D 3V4PH 3V6BR 4OZGA 5ETUA 4ZAKD 3WIIL 2PXYA 3HN3A 2NY3C 3EFFA 4QY8A 4OFVA 1IAIL 3T4AB 4DZ8B 1BJ1J 2W91A 3VG0L 2YBRB 4HEPG 4LSDA 1MCWW 2PUQT 3QEQD 4U3CA 2W9LA 3EYSH 3C2SA 4JFYB 4LHUA 5K9OB 5JLZB 2R8SH 2Z91A 1IKFH 4GW4A 4Z7NE 8FABA 1VEOA 2AW2A 3FO2A 4WTZG 5C0AB 4G9DB 2BHYA 2VSDA 3IKCA 1DFBL 4PJBB 4R0LA 1T5WB 2Y06L 2HFGL 4JFZH 2NLJA 2W65A 4L9LB 3CZFB 1JGDB 2EH7L 1Q72H 4BM7A 2IAND 3VXNA 3VJ6A 2X1WL 3KYOA 1JJUA 1U92A 4EOWH 5T3XH 1WIOA 1W72L 3INUL 4L4TD 5BVPL 3L3IA 1OW0A 1P6FA 4KK8C 1BZ7A 4WFHE 3GKWL 4TVPH 5ICXA 3QHZH 1FNSL 5ANMA 5SWZB 3VXTA 1R3IL 1UQSB 3BPCA 2WLYA 3U9PL 5E8PA 3JV6B 3LKOA 4HW6A 3V4PL 2E7LC 2OYPA 1S7SB 4HKXB 1NQBA 5JQ6L 3QDJD 3DPBA 4MA1B 3K8LA 3KR3H 5CUSL 5BW7C 4X7DC 1IEHA 3L95A 3GIZH 3ARXA 4KJWD 4XPGL 3DRQA 3BYTA 3EYSL 3IDIA 1N0XH 2XRAL 4K3EH 2WBJB 1IKFL 1NAMH 3BQUD 5CBAA 4NM8H 1X5XA 3QEQE 1CICC 1R5IA 2IQAA 4FQXA 4IJ3C 1Q9KA 4TN9A 1KJ2L 4U6HA 5GZOD 1CD1B 2NXZD 2BSSB 5EFIB 5F8RC 3ZE2F 4QXWA 3CC5A 5FOBA 4BSWA 1HSBA 1A9BB 4IMKC 4J3TA 3KVQA 1INDL 2HN7B 3LH2H 3T65A 4X8JB 3LPGA 4HIHB 1Q72L 1NBZA 1F42A 5C9JA 3WS6C 1WIUA 4I9WD 3F7PC 4NYLB 5D9SB 3P73B 4MJ2A 1WSST 3MV7E 1JPSH 1KIRB 1NCDL 2P43B 1UVQB 3NIDE 3X3FH 1YECL 2IANE 2AK4D 1NDMB 1CFQA 4NNXA 5E2VH 3SO5A 4UV4H 1KPVA 2VMFA 4L4TE 3QPQC 4HUXB 3QUZB 3TNMB 3QEGH 1CGVA 1OT2A 1OLLA 4JFHE 2PETA 4KKBC 3C09B 3VG9C 4CKVX 5CD3A 4PBXA 3ZZ1A 2K3TA 3ZT6A 3SN6N 4YC2C 5F9OH 3RWGA 3GIVA 5A3IC 4B7LA 3QDJE 4KK6D 4U05A 1X44A 3T2OA 4KKAC 3MRIA 1NAML 1KEGL 4NHCH 1LO2H 5GGTL 4M7ZC 1OGAA 1GYAA 3P9LA 1D9KD 5AD0A 4RBPK 3WFDH 1MRDH 1KPRB 4N1CA 5FGCE 1C12B 1V7NL 1X3DA 1D5MA 2N7AA 2YPLE 3MJ9L 4TNWK 3LCYA 1KJMB 2X41A 2H9GA 1JPSL 4R4ND 2JCCB 5EB9A 4L8SB 5C0BA 5DK2A 4HKZB 5E2VL 3U30C 4I9WE 4UV4L 2WWKT 1FZOB 4PG2C 2DBLL 2HJLB 3S4SG 3UBXI 4PJIE 3HE7A 5L2KA 2AK4E 5C0JA 1UKQA 1VGKB 3LD8B 3UEZA 1DBKL 4DGVH 2K7PA 5CD5D 2WK2A 5D1XB 4PB9H 3ARFB 1A2YA 5T1MB 4U1JB 5F9OL 5FYLH 1NGXB 4MWFB 4MXWL 5FYJD 3GI9H 3U0WL 3G5VA 1H3WM 3GSRA 2CKBB 4NHCL 1KTKE 3LRSA 4ZFFA 1YY8B 3MGOB 1MLBB 1S3KH 3V5HA 1RFDH 3WFDL 3U7WL 4TNWF 3I2CH 5IBUG 1JZ2A 3I50H 4NJAH 4ZOAA 3TO4C 3HLAB 2ZUTA 1GZQA 1P4LA 4K7FA 4MQ7A 4DK6A 5C09A 4CDGC 4WNQA 1A64A 1REIA 2MOVA 4HG4K 2B39A 4U1MA 3IJSA 2IQ9L 5J6HA 1JN6A 5E4EC 3IAPA 4LIQE 4E42A 1H5BA 3LY6A 3M8OH 4PB9L 5EPMA 3QDHA 3AXLB 3GSXB 2NY3D 1Z5LB 3UTZB 2H1PL 2BVQA 2FATH 5JW5B 1CVRA 1FLRL 3LZFL 1A7BA 4YDKH 5F71A 1N5AB 2XYCA 3KHQA 1HQ4B 2JJVA 2BVUA 3WHXA 5FYJE 3U0TA 1DBAL 1IGJA 4MAYB 2UWEA 3NZHH 1ZLUH 1CXKA 1VFMA 2H26A 1IGIH 4XMPH 1LEKB 3MRKB 3TA3A 3DXAD 1S78C 4RX4D 3W39B 2MMXA 3QNZB 4OQTA 3RVTD 4PGEB 4UDUB 1VB9A 3SBWA 1R24B 3F7RA 4PP2B 3FT2B 4KAQL 5ID0B 2DJSA 3MNWA 1Q94A 4DAGH 4J3SA 5D5MB 4M02A 3U9UB 5L2JB 3F7QA 4Y88A 3UZVB 2XG5A 2NTSP 2CRZA 4NKDA 2FEDD 2FATL 2ZCHH 5DC0A 3PIQA 4FFYH 4ZUSA 2GFBB 1INEH 2HFFB 2IH1B 4YDKL 4LCYA 1W0YT 4NZRL 1NUDA 4O2FA 2APVA 2MCPH 5I1LB 4GQPH 3KAAA 1CICD 5T5NG 4KUCF 4M1CC 3ZTNL 5I74B 4Q9QH 1U3ZA 3BT2L 4HXBH 1QOKA 4XCEA 5EO9A 1IGIL 2J5LC 3L6FB 1KCSH 3MRCA 3U4EA 7CGTA 2E3VA 2Z93B 2DDQL 2H2SC 4WI4A 5DDHB 4F7PB 1P1ZA 2C3VA 1YZZA 2A0LC 2F74A 4W70A 1FO0A 1CFNA 4WFED 2BOBB 4Z78B 4RGMB 3KNBB 3DXAE 4W6XB 4JFPB 4R96A 2IPUG 2GITA 2E27H 5EUOE 1FV1A 5DD0L 4ISVB 3WNPA 3PWPA 1I7UB 1S7VB 5IHUL 1N6QL 2X4UB 5F3HB 3QPQD 5F1SA 4JEGB 1Z9MA 3DV4A 3MA9H 5F7WC 3O8XC 4HWBA 4LCIL 3B83A 2FB4H 4X4ZA 4PRPA 4C56A 3ESUF 2EEBA 1GRWA 3VGEA 4KKBD 2XFXA 4FFYL 1OB1B 4ZPVA 3VXOB 4P2OC 1NH6A 5A3ID 1CGXA 5ETUB 2QADC 3O6KH 1Z0MA 2PXYB 1A1MA 4UDTB 4KKAD 2MCPL 4DEPB 5B38G 1RZ7L 5T1KD 4ZFOL 2Q20A 4Z7QF 1SEBB 3ZKNC 4LVHB 2ESVA 4WENB 4Q9QL 5A40E 1EJ6A 4UNUA 4HZLB 4ODHL 5I16A 2X9WA 3MBEC 8FABB 4X6DE 3FO2B 3WKML 2YD1A 2IGFH 3DOSA 3MOBH 4N8CH 5ID1B 4U7KA 3BZ4B 2J88L 3IKCB 3H0TB 4I0PB 1VADA 3CDCA 3VGHA 5DHYA