3QYCA

Structure of a dimeric anti-her2 single domain antibody
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
VQLVESGGGLIKPGGSLRLSCAASGVRLSAYDMAWVRQAPGKGLEWVSAISSSGGSTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTAVYYCVTLPDLCPGDNCTYPDASWGQGTMVTVSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords VH domain of IgG molecule
publication title Crystal Structure of a Human Single Domain Antibody Dimer Formed through V(H)-V(H) Non-Covalent Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qycA00
3B9VA 3I2CH 5EG6C 5AD0B 1RIUH 1P4BH 1VSCA 5F7DA 4O2CB 4LLQA 2A6IB 4KV5F 1G7HB 5ECJE 3NZHL 2W0LA 2VITB 1RZIA 3RKDD 3ME0A 4Z7UE 2X4QB 1NBYB 4OZFH 2AS5M 4I5BB 1AGDB 3A6CH 5JOFA 5AWNL 5DHVA 1DDHB 2HAZA 4LSTL 3S3PA 4P2QD 2XQYG 1PG7X 4NZTH 1X4ZA 4YUEL 4NFBA 2E7LC 4OQ1A 3IFLL 5F1OB 4M7LH 4P5MB 3VFRA 1KCSL 2IPKA 5T5NG 1IEHA 2DQEL 5I8KL 1X5GA 3TJHD 4WW2B 1AGBA 5E6IA 3O6FC 3I85A 3AY4C 5IB4A 3QUZC 3HNTL 2VLLA 4Z7UF 2Y5TB 4P2QE 5CIPH 3N1PC 3HFMH 5EPMB 2UYLB 5GGVL 1FP5A 3DETD 1A7PH 2X40A 5H94B 3O6ML 3D0VA 5GS1B 4WU5B 3MLUL 4IIQA 4PTUB 1AI1L 4F7CB 4R96A 5H2BB 2F54D 2VISB 5FHBH 4LRNH 3ZKNC 3KHQA 3EOBA 4XH2B 2VQ1B 3WEXA 1EHNA 2Z4QA 3QNXB 4OUUA 4CW1B 2WSKA 1YQVH 3D69B 4UDTB 4Y4KB 3I6GA 3WNOA 3IDXH 3UO1H 2F5BL 2V2XB 2IPTH 5D7IA 3ZDYF 4NJAL 2F54E 2YPVL 2ZKHH 4H0HB 2HFGH 5DJ0A 3QR2A 3G5YA 3MUY1 4G43A 5EU4A 4F15C 3NOIA 4EIGB 1WZ1L 4E5XB 4RGMB 3TF7C 5TQ2L 5C3TA 4RAVA 1OAXH 1ZGLM 2YA2A 4PJIA 1I9IL 1I8LC 1NCDL 1INDH 4C55A 4JJ5B 1BM3L 2XNAA 3GI8L 2HWZL 5C86A 2Z92B 1CWVA 4NUGL 4U33A 1KXTB 4PJ9C 1EA9C 5HY9A 4M1CC 5M94B 4ELMF 3EYOB 5JDSA 3RU8H 4J7RA 2BHUA 2JJSC 4UTBL 4KZEL 3LV3B 3P30H 3O0RH 3S5LB 1FIGL 3AB0C 4ZO9A 3JV6B 1XEDA 1RZ8A 2JCCA 4Y5YB 5TQ0H 4D94A 1KJMA 1MVFA 4H25A 5HI4D 3MO1A 5D72L 4PTTA 1CFQB 4OGXL 3K0WA 1KELL 4JO3H 5DK2B 4Z95H 1Z3GL 2AABH 2HMID 1OWRM 3IU4H 1DEDA 1FJ1B 2PW1B 4X98B 3FB8A 3PHQB 3NFSL 5DUBB 1KCVH 5JDJA 3ALWA 1BPVA 3D2UD 1N5AB 5T5FL 4O58H 1CFSB 5FUZL 2R8SL 2DM7A 4JKLA 4GS7B 4Z0XB 3ROOA 5GJSH 4HFUH 2CDFA 4PJ8D 3WIHA 4MMXC 5E8EA 4QCIA 3FB6A 2FZ3B 2WV3A 3L1OH 3U6RB 4ODWA 1XH3A 2FCBA 2I07A 3OXRA 5CJ5A 3MCKB 3AREB 3MNWA 4MWFB 3BW9B 1EMTL 4HX1B 3X3GH 4HKBB 4ELKA 4WGVB 4WWKA 5B39A 3JBG7 4KJYB 4X6DF 4LSPL 1U2CA 3PP3K 4FHBD 4JHWL 5D6CB 4LLDB 3GMNA 5GJTH 3VFMA 1X5ZA 3FRUB 3STBA 4URTB 3WO4C 4R0LC 1BD2A 1KB5A 4RWHA 1QFOA 1NH6A 4OGZA 4IMLB 1DBJL 3MA7B 1YMMA 1DQTA 2XPGB 3UJIL 2J6EH 1CFTB 3QQ4B 3TBWA 3U36A 3LKOB 4P46D 3LKPA 3PHSA 2NY2C 4HZLB 4O2FA 2G9HA 3L3KA 2GSIA 5CBEB 3HNSH 1NGPL 4KHTL 4TVPD 2DQCL 1FVEA 5DUMH 5TH2B 3HZVB 3BGFB 1CN4A 2LQRA 1MHEA 4XMLL 4IRJD 3OKKB 1AXSA 3TN0A 3KXFD 4IM8A 2NW3B 1G9NL 3RWGA 5FA3A 1VDGA 4TVPE 1KEML 1Y0LA 2ZOLA 4MMZC 3O3DA 1ZLSL 1BQLL 4OF5A 2EDEA 1JNNL 4N8CH 5E56A 1N6QL 1S7VB 1YN7B 3U7YH 1LO4H 2MQ0A 2ED9A 4F7EB 3IVKA 3QQNA 4ZSOA 2RIKA 3QWRA 5HDQL 3VI3F 3RZCA 3D39B 5GQBA 4AZ8A 3OJ2C 5TE4L 4DKDC 2OX5A 3O2WL 4PD4K 3BZFA 3VFWA 5ID1A 4OFIA 5ITFA 1TPXC 5T1MB 4MQSB 2GAZA 3FAWA 4O5LH 1E27B 1VFBA 4WHTB 3Q48A 4WUUB 1FSKB 1M4KA 3ALXA 4XWOD 3R1GL 4KFZC 2VUOA 1BREA 3P77A 3BPLB 3EO9H 3SN6N 4QRRD 4YPJA 4EDWH 3RWEB 1OOAA 3DO7A 3LKSA 3DI2B 1E4WL 3DVGA 2FGWL 5HDBE 2ED7A 3JZ7A 2MSPA 1NAMB 1I1YB 2EXYC 4WY7L 5GRVK 1HCVA 3VMPA 2ERJB 2O93L 1JGDA 2QADB 4Z7OF 2CKBB 4LPTA 1A14L 4HV8B 1NDGB 2NXZD 4U2YA 4QRRE 5I8EA 4FQ1L 5HYSA 3UXFA 1WV7T 2I9TB 1CU4H 1NJ9B 4KJPC 3FB7A 3SKMA 5TGBA 2W9DH 4WGWB 5FKAA 4ZD3L 3KPQB 5FDYA 4P3CH 3BJ91 4K3EL 1IQDB 4KAQL 4LVEA 3T3PE 3LH2H 3RWIB 2BDNL 4PRAA 5HPOA 5IW3A 3FZUC 2J8HA 3W81A 4D8PB 1AGCB 1H3XA 1IC7H 3CDFA 5CAYB 4PJDA 2DD8L 4XNXH 5DYOB 5IVZB 5IB2B 4R97B 1WK0A 3PWPD 4W4OA 4OBRA 3N1QC 3PABA 2YKLL 1HHHB 3SCMA 1MHPH 3EFFA 4UOW1 1T1YB 5DK0B 2XZQL 1X9QA 1MRDH 1TVDA 2JE8A 4Q9QL 2CDGA 4P9ML 3T3PF 4MXQD 4LCCB 4P9HH 2DBJA 3BIKA 3P9LB 1XF3A 4M6ML 4Y8DC 3TNMB 4EBQL 3MGTB 1UB5A 1ROWA 3FT4B 2PXYC 4MCYA 2NY4B 1CXLA 1RVFH 3O2VL 4Z7WF 4Y1AB 1QSFB 5DA0B 4JHBA 1ZTXL 3GIVA 4PJAA 5JR1L 5JW4Q 4TN9A 2X4PB 5FHAH 1TNMA 3G08A 3MV8A 5SWSD 4KJQC 2BJMH 4D3CL 3B3IA 1OAZL 1ED3B 3C08L 5F6HJ 5HJ3A 2BXZA 2NXYD 3MXVL 4FMFA 4OZFA 3O9WA 1FNHA 2DQTH 4ZOEA 1F6LL 3CMGA 3TPUB 3MACL 5IV2A 4LNRA 2B1AH 4RGOH 2GJ6E 4QTIL 5D1XD 5SWQA 5IB3B 5SWSE 5J56B 5J06A 1CDJA 3MV9D 1UVQA 3QFJD 3INUL 2IANB 4DN3L 5KS9E 1CR9L 5I74B 4IDLA 2R23A 1A1NB 3DYOA 4YAQB 4OZHB 5CLWA 3H3KA 3IDJB 5GRYA 1N26A 5BRZB 1AO7B 1Y6KR 4JFPA 3ARBB 4DQOH 4Z5RA 2G2RA 1I1CA 3FOLB 1JGLL 3S3SA 4P23B 1DBMH 3MV9E 4JHZA 4PRHB 5CEZD 1F6AB 1IM9D 3QFJE 1VGKA 5HGGS 4FQLH 2AQ2A 1F3JB 1T83C 2D0GA 2XICA 1FDLH 1PJ9A 5EBLA 3TIDB 3VGFA 5BV7H 5KSAB 1DQJA 1JYXA 4J3XA 5DF0A 2XKNA 2W0FA 1LEKB 4QRSA 1J8HD 4L29B 2R0LH 5E1AB 3CGTA 2QJDA 4G7VL 1F4YL 2ZUVA 1OHQA 4FG6D 4LGPB 3HMWL 3MREA 4XMKH 1MQKL 1MCBA 3G5XA 2J5LB 3UZEA 2VIRA 1H0DA 5I16A 4B7LA 4HBCH 4MQ7B 3B5TA 1KN2L 3QDAA 3VFPA 1AP2A 4G5ZH 1J8HE 3U48A 5DFWH 4BUGA 1MREH 2R2CA 3TT3H 1I4FA 1IGCL 1YNTB 3FO9A 4XVTL 4GW1A 2R0WL 3HZMB 2PTUA 1GHFH 2NX5D 2FO4B 5LKNA 3N9GL 2F19L 3T4YA 4AL8H 3C8HA 3V9FA 4U0RB 5DVOA 1JGVL 5FYLH 5DRXA 4ALAL 2W9LA 3G6DL 1H5BA 3NCJL 1Q0YH 1T89A 3HMXH 2FHCA 3OG4B 3U4EB 3H3PH 4D0CB 3AU1A 3B8YA 4LKCB 3ZKXB 1R3JA 5EUOB 3ULUF 5ICYA 3OZ9L 1ES0B 4DW2L 1HHGA 3DX7A 4S0SD 1LE5A 1GH7A 2W91A 1L4IA 3QEUA 2Z9TA 1EO8L 1T03L 1HSBA 5DJ8A 3C5ZA 4NQCA 4YNYA 4XPBH 3WXVL 3QBTB 4ONFL 3BVNB 1INQB 4JAMB 4NDMA 3IXTB 1KC5H 4LP4A 1W0WA 3LB6C 4XP9L 4MJ2A 2JKXA 4ZDHB 3N50A 3NCBB 5FECA 2P46B 2R0ZH 2UUDK 1FZMB 3TA3A 1U3YA 1I8IA 3QIBD 3CCHB 3SKOA 4X0KA 4NO0A 1NGYB 1KG0B 4V1DD 2DWDB 1UKSA 5ENWA 1OGAB 3OKNA 4ESKA 2WIMA 3CK0H 4YHPA 5GGRY 3OXSB 1PD6A 4NQSB 4JM4H 4RX4A 2OTUA 4HUVA 1TENA 2DL9A 1R5WA 4OGYL 3RNKB 3MRLB 4V1DE 1ACYL 4YXKL 1FVCA 1WFUA 3S96A 1D5IH 1QPXA 1N64L 1JNLH 2BSTA 1KIQB 4HWNA 3V6BR 3U4BL 2NY3C 3JWOH 4YFEA 1JRHL 2OMNA 1CTOA 3RVUC 1UJ3A 4L4JA 2KBGA 5I0ZA 3BDBA 2KKQA 4MNGE 1WLHA 2IBZX 3T0ED 1GOFA 4ODUB 2XWTA 1XGQA 1K8IB 1P84J 1T5WA 2AXGA 4RWYH 1V3KA 3RGHA 4ZNEE 5E2JA 3NCYS 2OBGA 3FMGH 4LRIC 2YPKA 5F70A 1N2RB 5DR5H 4BFGA 1PY4A 1AIFA 1S9XA 2P8LA 2GHWB 4UU9B 2G5BB 4PJXF 4QRUA 4HIIA 1AKJA 5EOQH 2NZ9C 4PLOB 1KN4H 3KVQA 3T0EE 5EO1B 3DYPA 5DQDL 3V7MA 4ONGL 3FO0H 3SE8L 5B8CC 4KI5D 1WQVT 2YRPA 5IMOB 1TCMA 4OCMC 4ZTOL 12E8L 2JLLA 4P3DA 1JPTH 5HVFB 1BJ1H 5IMMA 3MROA 3VWKA 1UXSB 1I3VA 1X5YA 1AY1L 3I6KB 1KJ3L 2ESVA 4M61A 2OP4H 5ESAB 2D2OA 4EN3C 3MRJB 3IETB 4HJ0D 5DRWA 2VDPH 4KI5E 4KH2A 3EYUH 3LS4H 2UY6A 2EDQA 4R90H 2NZIA 1GZPB 3LPWA 5EU3B 2YPLA 1MFEL 1DLHA 1XGTB 1VB9A 5F9OH 3L9RB 4YE4H 2B0SH 1RURH 1I9RH 1QR1B 1CGYA 4RA3A 4JFZL 4HS6A 3S4SA 1DBBL 3ARZA 1FV1A 3HRZB 3FQWB 1B0GA 4NQXB 4OI8A 4IJ3B 5DGRA 4P0DA 3WNMA 4ERSL 3P0VL 4P5KA 4PV9A 4FNLH 5IGXL 3MLTB 1O7VA 4ZXBC 1MJ7L 4Q9RH 4OIIH 3VXNB 2QTEA 1FFRA 1F42A 5KJRH 1MJJB 1LP9E 5JIHA 1EJ6A 1A9BA 3BJLA 4MA8H 5ALCL 4WO4C 3D2UB 2YR3A 5CJXA 3RKDC 3UTSE 1ZHLA 5GRUH 1A7RL 1B4JL 2IAMD 4JPWH 3WDHA 1FAIH 4ZUSA 4OAWB 4H8WH 3AS3A 1A1MA 3C9NB 1WICA 4R2GC 1AD0A 5FKPA 5FCUL 1NEZB 1YUHB 1DBKH 1LP9F 4PJ5D 4LARH 3TJHC 2IALB 4GBXB 4M8QB 3F5WB 4IEFB 3HRPA 3H9ZA 4Y5XB 3M45A 5K59E 4R3SA 5DJDA 4YDKH 3KLAB 1IEAA 2Q8AL 1IFHH 1HHJB 1CDIA 4U49A 3G6JB 5ALBH 6CGTA 1X44A 3DETC 1DVFB 2EE9A 4Y4FD 3OR6A 2OR8A 2XFXA 4OLVH 4PJ5E 1ORQA 2EC9T 1FYTD 2L4OA 1ZLUK 3CAFA 5I1DA 3VFVA 4AH2B 3GI9H 2GCYA 2E7LA 2DTML 3K4AA 3I50L 4RAUB 1FIEA 4TSAH 4UAOC 4IOFD 3VFUB 4P46B 3V5KA 1ZEAL 1N59A 3WFHB 3O6FA 1BGXL 1TETL 3AY4A 3BKMH 4LVHC 4K8RL 2MKLC 4OFYD 4OSUL 1UYWL 1FYTE 3V5DB 1ND0A 3MGAA 2VDRH 3RY5A 3LS5L 2VE6A 4C83A 4J1UB 5FGSA 4XNQA 5MHSD 1P53A 4IRJB 5E4EC 2AV7A 1JUFB 1II4E 3KXFB 5DUPL 5FYJH 4X5XA 2FSEB 1XIWD 2PYEA 5D1ZD 5CD5D 2DMCA 4XAWL 2A6DA 1MCRA 5C8JB 1QR4A 1DE4A 2W65B 1OM3H 4M5ZH 3RTQD 4IS6A 4NO2B 2R9HD 4NRZB 2P5ED 1YDPB 4PRPD 5E99L 3CSYB 3JTSB 5MHSE 5BCAA 4IRZL 5JIIA 5IR1A 1T80A 3ARGD 5IFJB 1R0AL 5T33L 2BY3A 5C0DA 4MJ5A 3SGJA 4DN4H 3L7EB 3WV0A 2LU4A 2CLZB 4OUOA 2CKBH 5I71C 2P5EE 3CFJB 4DCQA 3P0YH 4MZ3A 4PRPE 2OZ4H 2UZIL 1G7QA 3QA3B 1HZHH 1T1WB 5HYQA 2MHAB 5KSVB 5HI4C 3UBXG 1MCPL 3IDMB 2CJUL 5I76B 1FO0A 2VR5A 4OLEA 1J1PH 3BX7C 5K9OB 2FR4B 3WHXA 2Y7QB 4HWEL 4N5UA 1QFWI 5HHOA 5E00B 4KUCF 3MUZ1 4PJ9A 2H32A 4POZD 4F58H 5HVWA 3VDCA 2C4FT 5JPNB 3QEQA 5IVXE 5IHUH 1WZKA 4PG9A 2JJSA 5D5MA 2R2HB 2BCKA 5CWSB 2Z93B 4PJ8C 2X4OA 4XPGH 2YA0A 3QRGL 2GITB 4MNQA 1HQ4A 4FQHA 3KPRA 5E95B 4PJHB 5ESVA 4MNHB 3P3YA 2L0DA 4P2RA 5GGQL 3GMLB 3TO4C 1WF5A 1GGIL 3MRHB 3N0PB 1XR8A 2O5YH 3HMXA 2ITCB 3WIIL 4BKLB 1JZ8A 3MV01 2CGRH 3RHWF 1X6LA 1S7TB 1NLBH 4JFEA 4F37K 2M26A 3DYMA 3PWPB 1NBYA 3TIEB 2DJUA 3MRPA 3PQYE 1DDHA 2BNRD 2DYPB 2V7HB 1IKFL 3QISA 3GSNL 4P5MA 4M43L 1I8KA 3CVHA 4LMQE 3D25B 3B8SA 3MLYL 4NRXB 4Q2ZA 1J10A 2P43B 4YHIB 2B1HL 4UDUB 1L0YA 1QRKA 3OJDB 2X9YA 4WEUD 1PG7H 5CKAA 5ITBL 1F4AA 2Y5TA 2BNRE 1DN0B 5EPMA 3BDYH 4JG0L 3D1MC 4QWWD 5C0EB 4WU5A 5GGTH 4R8WL 2NXYB 4PTUA 4F7CA 2AJUL 4YBQC 5TDOB 4BH8A 4TSCH 4FZEH 2VISA 3NA9L 1MRFL 4Y5VC 2OL3B 4LLVB 3GJEB 4YWGL 4MCZB 4BQ8A 5F7EH 2VDNH 3MR9A 3OBAA 1YPZB 5JW3L 4H20H 3WLWD 4Y4KA 5D1XB 5TE7L 5IF0A 1W2KT 3IJHB 3MV9B 4MHHI 4MA1C 1MAJA 3MZGB 2EDTA 2VXTH 1CGUA 4GRLD 4M93B 1DLFH 2P44B 1QBBA 8FABB 3SGDI 2J8UE 4FXGB 1MCJA 2L7JA 5F9JB 1AH1A 1WSST 3MODH 1QSED 4AENB 3NIDE 1IM9B 2Q86A 3R0MA 1N0LA 1AJ7L 3MLSH 4N90D 3O8XD 3QFDB 4XP1L 4KMTL 4XWOC 3QUYB 2VL5A 4HIJA 1TJGL 3CSPA 4TQEH 1OAKL 4JJ5A 4NUJA 1MWAL 5D93B 4I8DA 5B38A 2XOTA 3BGAA 2Z92A 1HKLL 5JA9A 1M7XA 4PGBA 5E5RB 2Q7YB 1GC1C 2VTFA 2J8UF 1QSEE 4Z7NE 3OKMB 5JQ6H 2CRMA 4N90E 4OF0A 2HJLA 4HUXB 2HLFD 5EBWB 4UINL 3LCYA 5MEQB 4Y5YA 2NXZC 4PJCE 1GSMA 4RNRB 4MDJB 3HE6D 3OHXB 1CTNA 1NCCH 4P3WA 2CIIA 1CFQA 5DJAA 4E41D 2AK1H 4R26H 2RJMA 1G0YR 1U8KB 5HBBA 2DMBA 4Y89A 4LHUA 2VDMH 2RAMA 1FJ1A 1F6FB 2PW1A 2NX5B 4K9EL 1DFBH 4MD5A 4X98A 3B83A 4HWUA 4UT6L 3AAZB 3VG9B 1YEGL 3LRGA 5EOCH 1MIEL 2H26B 5DQ9A 4PUBH 3GHBH 1N5YH 4C54A 4FQJL 1KULA 4E41E 3VD4A 1WZMA 5F1NA 4ENEC 4PGCA 1Q72H 1I7ZB 2SEBB 3U6RA 2L7UA 3VXSE 1WCQA 3I9GL 3MCKA 3AREA 1X4YA 3O41B 4MXQC 4CU8A 4NQVB 3BW9A 1UJTA 4HX1A 1LMKA 4GG6B 3RUGB 4OLXH 4JPVL 4OCRH 1S7SB 2VUYA 4KJYA 2EDLA 1WEJL 5D6CA 4KK6D 4NNXB 4OTXL 3FRUA 4FFWD 4UB0H 1TZIB 3STLB 1MCKA 4RMSA 3TT1H 3L5JA 3B2VH 4JN1L 3VCLB 1MNUH 3DTXB 3PDGA 4HS3B 3DX8B 4YDLC 4H1LH 1NGQH 4IMLA 2QQNL 3MA7A 3GB7B 2XPGA 1CFTA 2N7AA 4M48L 2NY5H 4N9GB 2H9GB 1BBDH 4K2UL 2PXYA 3V4UH 4BSWB 5D4QA 3RY6A 5KSBF 3QXVA 2HT4D 3T3ME 5B4MD 4PRBB 4JDZB 2Q1EA 3ULUL 4MX7B 5C92A 2OSLB 3VG0L 4X9IA 3HLAB 2BOCB 3DSNA 5FB8A 3QXAB 3UJTH 1GPOH 1AXTH 1QPPA 1NGWB 3VXMA 3Q1SL 2VXSL 4MD4B 1QNZL 5FO9A 3HZYB 4L9DA 1A02N 4L4TD 1A4JB 1B6DA 1YN7A 2VZ3A 4OIAA 5EC2A 5LG1A 1KCRL 1F3DH 2HTLD 1OTUD 4QGTA 2WZPD 2FH6A 1L7IH 1TTFA 2NMSA 4X7DC 1QKZL 4OCXH 3H7BB 2APTA 3D39A 3QPXH 4FG6C 2I60H 2GI7A 4XP4L 3UTPD 4U7KA 4XPTH 1OLLA 3U2SB 3DARA 4L4TE 3T0EB 1NQBA 1S5IH 3IDIB 3VWJD 2A77H 4ZPTB 4RFEB 3UYPA 2D0HA 4LEXL 4HF5L 1OD9A 3PIQA 4AT6B 3BP5B 1E27A 2OI9B 4KZDL 4JJHA 1VEPA 4L9LB 4MJ6B 1UM4L 1G6RH 5FV1L 1NFIB 2GSGB 4HK3N 4N0YH 4X6CF 4TUOA 1BIHA 1MIMH 3FAXA 4UBDD 5I1LB 5CINH 3UEZA 2VR4A 2UWEF 5IJVB 1SHMA 1I1FA 4ONHA 3L5WB 5KVGL 1CT8A 4X6FB 1ZLVH 3VXTA 1NAMA 1I1YA 4PGEA 2ICWJ 2AXFB 4P59H 1K5NB 4NZDA 3HZKA 3T8XB 4OFDA 5EZOL 4X4XB 3WSQH 1IQWL 2NNAA 2X7LA 2CKBA 4NKIL 4NOFA 1RU9L 4Q7DA 3P9MB 1G9MC 5IQ7L 4PPTA 5EFIB 2XRAL 5C09B 4EUPG 4YHOL 4ZO6A 4GRWH 3VW3H 1IQDA 4LK4A 5F93C 4LL9A 1UENA 1VGEL 4D8PA 1AGCA 3U9UA 4NYLB 5DYOA 4N8VA 2WAHA 1TTGA 4FS0A 5DGQA 2CRZA 2AERT 1T1YA 3K4ZA 5DK0A 4K07A 4WFHE 1LO5B 3B9KD 4MXWH 1S7XB 3FRPA 3EYQD 2IGFL 2J2ZA 3FQRA 3QDMD 4K55A 1KIPB 3H9HA 1ZOXA 4FXLA 4LCCA 4PREB 3QIBC 3P9LA 4LFHG 1CDUA 4PRDB 4J3WA 1F4WH 3FT4A 3U46B 2VDOL 4D9LH 1A4KB 2FEDC 4PJ7B 5F3HB 1ADQA 3QDME 35C8L 4GJTB 3JTTB 4TNWK 2VDLL 5C6TH 4P2OD 3TYFA 1J1OH 4PJ5B 1Z0MA 4KK8C 4F8QA 3TPUA 5JHDA 5I66B 3VXRA 4UIKH 4KKLC 4LF3B 3HAEH 1O5DT 4QOKD 2C5DC 1CD0A 4QNPE 1BECA 5IHLB 2HJFB 4ZFOL 5I19L 4J6RH 2IANA 2ZUSA 1P4LB 2J4WL 1NBVH 3OAUH 1A1NA 1K3ZA 4I2XB 1Q9LB 2XWJB 4Y4FB 5ADPL 2Q7NA 3MRCA 1OPGH 4XI5D 3KPOB 3M8OL 1FYTB 1U8PA 5BRZA 3X3FL 2XZAL 5I1AB 1AO7A 3O81A 5C71A 3OKDA 3SDYL 3F12B 3JWNC 3CLFL 1RZGA 3BKCL 2BVTA 3FOLA 2DBLL 3F58L 4NP4H 4P23A 4QOKE 4LCUB 4PRHA 4XMPL 2OI9C 1TCRA 5GGTA 1A6ZA 1F3JA 3LRHA 2PF6A 4QNPF 3TIDA 1MF2L 5F88B 2MJWA 4L3EE 3REVA 3O6LL 1ITCA 2DDQL 4NBXB 5HGBA 3HG1B 1LEKA 1FQ9C 4L29A 5E1AA 4DTGL 4OD3H 1XF5A 5CJOL 5F7LB 4XVSL 4KI5C 5ANMB 1I9JH 1CLYH 1FPTH 2YK1H 1T21A 4YHKL 1U3HD 3RTQB 3UYRL 4JQIH 1NLDL 2DQFB 5EU5B 1HH6B 1D5ZB 2JB6B 3IDYB 3U0PA 5IG7B 3ZMRA 4CNIB 4LSVH 4HJ0C 3UTZB 5AEAA 1GIGL 2O5ZH 1S5HB 1QQDA 3D85B 3LKQB 4PJEB 4LCIL 1I3UA 3HZMA 1CFVL 3FFCB 4HK0B 3LZFL 4HT1L 5GGSA 5D9SA 2FJFB 3G6AB 3GSRB 3O2DA 4JG1L 3TM6A 4G9FD 2O26U 4KK9C 5FUOL 5ICZA 3MJ9L 1U92A 1ZT7B 2E9BA 4GQ9H 4KROC 5C9JB 5DHYB 2ENSA 3IU3B 4D0CA 1QHPA 2P24B 3W9DB 1KLUA 1ZVHA 4RFOL 5E0QA 1IGML 5EUOA 5I1IL 1ES0A 4G9FE 1BJ8A 2ICEB 3BAEH 4AQ1B 5FYKH 3ULSB 4FABH 4NO3B 1YN6B 1IGIH 5D1QB 4F8TA 2PN5A 4NFCA 1HIML 1DQDL 2F53D 5GHWH 2IAMC 4G6KL 1CGSH 5FOJA 5A3ID 4UT9H 2I26N 5T1LD 1OL0A 4GRMB 1INQA 4ZXBA 3IXTA 3KPSB 3KWWA 2WP3T 2V5RA 1M7IB 3MRRA 3PWJB 1RY7B 4FFYL 3DIFB 5J1SC 2AJXH 1FZMA 1KCKA 4GAYB 2F53E 2A6JA 5DFVD 4ZYKB 1JFQH 3FCTB 1VA9A 4HH9A 1NGYA 2JF1A 1EJOH 5T1KB 1HK6A 3IAGC 3S37X 4XCEB 2KUTA 2OL3H 2FRGP 2CD0A 4OZIB 3TBTB 3OXSA 2HKHL 4CADA 1NFDF 4KVCH 2FJGB 1DQMH 2BNRB 4NQSA 2WBJC 4DVRH 4FFVD 4WUKL 3LMJH 5D7LD 4IOFC 4XCFH 4XC1L 3RNKA 7FABH 1B0RA 4R7DA 3KPMB 4JQXA 4L3AA 2F58H 4U6VH 2IWGA 5EORH 2Z0BA 4ZOBA 4CVXB 4N0RA 1KIQA 3TZVD 3WJJC 3KJ4B 1BFOB 3C60D 4HWZA 3SDCD 3SKJL 1JN6B 25C8H 1PY9A 4J3TA 5D7LE 2Z31D 3BPNB 4X7TB 5D7KD 4NGHH 4OLWH 1AR2A 1IAII 1MCOL 5CEZH 3V7AG 1XIWC 5D1ZC 5I1GL 3O4LD 2F54A 1K8IA 3RTQC 5FF6A 2Y36L 2R9HC 5JW4N 4OQTL 1CIUA 3TH2T 1SEQL 4BZ2H 1N2RA 5D7KE 4Y19D 4DUWA 4QHMB 1U8MA 1SVZA 2P8PB 2R1WB 2B4CL 2AXJA 4A6YL 3ARGC 3O4LE 5D2NE 5EO1A 2Z8SA 1E6OH 1T0NA 3HC3H 4GRLB 3QI9B 2GT9A 1GGYA 4HBQA 5EZLA 3IRPX 3EDFA 1E28B 1HEZB 4MLSA 1FFOB 4Y2OA 3MLWL 4WRLA 5E8NB 3S36H 4Y19E 2VERN 3UPAA 3MCLH 3ULVF 4M3KB 2A9MH 5A40E 5F6IC 2IH3A 1E0OB 2J8OA 3GMRA 5DFTA 3DXAB 4NJ9H 3DMMB 2PCPB 5C9KA 3MLZL 5ESAA 3MRJA 2EIZB 3IETA 4Y88A 4K3GA 3BRGC 1RZJC 5IJKA 1A6TB 2WIIB 1FH5H 1GZPA 4HJJH 4PJCB 5C2BH 1T1ZB 3WNKA 5CBAB 3CH8A 3L9RA 4POZC 1QA9A 1QR1A 1Q1JL 32C2B 1WWWX 4ORGB 4K7PL 4O00A 2ATKA 3HRZA 1GZQB 1A7QL 1BF8A 4NQXA 4XP5L 2V2WB 4HUUB 2WANA 4F7TB 2VLKD 3MLTA 3NZHH 4P4KB 2EXWC 5I0DA 2VLRB 5C07D 4E41B 4L8SC 5AWNH 1I1AB 4LSTH 1Z5LB 3RI5K 1I7RA 4YUEH 3IFLH 1VFMA 4OT1L 1KCSH 2DQEH 5I8KH 4FQXD 1R5VB 3D2UA 5ACZA 2VLKE 3B4NA 4NN5B 2UVFA 5C07E 3HNTH 4HKXA 1T0MB 2FIRT 4XRCB 4PJ8A 4MQTB 1TVHA 4G7YL 1KJVB 2RGSA 4QTHB 2CKNA 4K23L 4DVBB 1U8OB 5GGVH 1UXWB 3O6MH 1QO3A 1PEWA 4FMKA 1WBXB 1A5FL 3MLUH 4XVUC 4L1DA 1AI1H 4Y5XA 5D8JL 3SBWC 4HFWB 3KYOB 1J0KA 2VN4A 5GSRB 2JK5A 4NC2B 4PBVC 1HHJA 3LPGA 1KPVB 3MGOB 1CFNB 3BSZL 3DBXB 1IMHC 2F5BH 4H0IA 1DUZA 5D7IF 4NJAH 4WJ5B 4B53A 2YPVH 4RAUA 1WGOA 4M7ZB 5DTFB 4P46A 4HH8A 3UDWC 2HKFL 3SY0B 3BN9D 3ZHLA 4WTZA 2E9JA 4JY6B 5HGHA 3WLWC 3QPQD 1PSKL 3R0NA 1WZ1H 3L6FA 3V5DA 5L7XL 4PB9L 5JA8B 1JMXA 5TQ2H 4J1UA 2BNQB 1I9IH 2JCCE 4PJIF 1SEBB 4IRJA 5GRZA 2DQDL 4DZ8B 1NCDH 1HYSD 3MXWL 3KXFA 1BM3H 1CL7L 3GI8H 1J88A 2HWZH 4HGMA 4NHCL 3LKRB 4PGJA 4NUGH 1HI6A 4NO2A 2OK0L 2WQRA 3CSBA 2R29L 2C7UA 5FV2A 1ULVA 1YDPA 3O8XC 1K2DA 3JTSA 4UTBH 4KZEH 1FIGH 2MWCA 1Z0NA 2JCCF 5IFJA 5C0JA 1R5IB 3UBXB 3BT2L 2CLZA 5D72H 4ODXA 3MLRL 4OGXH 5HHVL 5E8OB 4ZUWB 1KELH 1N6VA 3CFJA 2ITDB 1Z3GH 2MQ3A 5KVEL 5AZ2L 5LBSL 2B5IB 4RMQA 1BD2D 1MFNA 1T1WA 3AVEA 4ODBD 3NFSH 5I9QB 5KSVA 3HE6C 5T5FH 1IAOA 5FUZH 3KNBB 2R8SH 3BO8A 1K4DB 1S7RA 1TQCB 3PWVB 2V7NB 3IDMA 1EIBA 1C08A 5I76A 3W0WD 4QRRA 5K9OA 1IAKA 3LD8C 1FFQA 2O61A 1Q9WB 5ERWB 1EAPB 4LHJB 1BD2E 5AUMB 1RK1B 4YXHL 2EEBA 5C0FB 2HRPL 4HWBA 2CXGA 2FGZA 4RRPA 3EOTL 1EMTH 4GKZA 3PG2A 1JWMB 1R3IL 2A9NL 4WEMB 1T22A 3HA0A 1JGUL 4LSPH 5CWSA 3LSOA 3W0WE 2GITA 4JHWH 4DEPB 3VDBA 1OSZB 5DS8B 3AROA 4PJHA 4MA7L 4MNHA 5BMFL 2C3XA 1W72L 1EHLL 4OCYL 3FT2B 1FFNA 3MRHA 4Y16B 3EYVA 3W5NA 1NMBL 2ITCA 1BVLB 1VADB 5DJ6A 3K80A 2PO6B 1DBJH 43CAA 4GAJL 3Q3GB 3S3JA 3UJIH 1S7TA 4CGTA 3PWPA 1DQLL 3TIEA 1NGPH 4KHTH 4ELMB 4H26A 2DQCH 3F7QA 5EOTB 4GSDL 3B9KB 2O5XL 2ZSVB 1S8DB 5DO2D 3GBNL 3EIFA 4XMLH 4NRXA 3NIFE 4LLMA 3BH9B 1LNUA 5DMIL 1KT2B 3T08A 1G9NH 4UDUA 5HHQB 4ZFZB 1QSVA 2X1WL 1KEMH 3CXDL 1BQLH 5DT1L 4LAJH 2WW8A 1JNNH 4PYGA 1N6QH 1G7IB 3MOQA 3EUUA 1L0XA 4RMTA 4OJFL 5SWSA 3KPNB 5C0EA 4U6HA 4YK4C 4Q58C 5C70A 5KS9A 3NIFF 5HDQH 4P2OB 4F3FB 5IROC 4LLVA 3GJEA 5TE4H 3O2WH 1D9KB 3S7GA 2E7CA 4PRID 3U83A 1YPZA 3JWDL 2HTLC 2B2XL 3EYFA 1OTUC 5D1XA 5LCVL 1EGJA 1MI5D 1MRCL 5D2LE 3MFGB 3MV9A 4KQ3L 1YYMH 1R3KB 3SE9L 1KCUL 4X6DB 3H42L 4QHUB 3OGCA 3R1GH 5I6XB 2AJSH 8FABA 4PRIE 3FO1A 4X8XA 1NC2D 3H0TB 3R8BB 3QQ3B 2NYYD 3VWJC 4XNMB 2VLJD 3SCMD 1AGEB 1MI5E 3GMMA 1E4WH 2ICWA 1IM9A 2VH5L 3RJDA 3SDDB 3QUKB 4JRXD 4QT5A 2QHLA 4WY7H 5D2LF 4BK5A 3ZO0A 1UQSB 3IT8D 4MHHG 4MS8C 1OGTB 5CUSL 4LLUA 1A14H 2APWA 4UBDC 4FQ1H 1J8HA 3W2DL 3WIFA 2VLJE 4JLRA 4OZ4B 4RGND 3B6SB 4HCRL 3ARDD 4YXLL 3OKMA 4JRXE 4IHOB 2D03L 5DURD 3T0DA 4AY0A 4WTXA 1JPGA 4O02L 4ZD3H 3O45B 3GMPA 2YRZA 4K3EH 4KAQH 4U1GB 5EBWA 2BDNH 1NGXA 3AS0A 2XXMB 2EECA 1YEFL 5T3XL 4DEPC 1FZKA 4RNRA 4HDIB 2OCFD 4MDJA 2DD8H 4PJDF 3OHXA 4RGNE 5GZOD 1TMCB 2IADA 3EFDL 2YKLH 2JJTA 1U8KA 5I1JL 4I18C 4HXBL 2XZQH 3MV8E 1HXYB 3CC5B 3F6IA 4QKXB 2NX5A 5MERB 1GJIA 3BKYL 3MUGB 1QUNA 4Q9QH 2N7BA 3AAZA 4P9MH 3HI1A 4RZCB 3RP1A 4PP2B 3ZLQC 5DEGB 4BQBA 3MNZB 4M6MH 1CDBA 5SX5H 1U3ZA 5J89A 1ERNA 2IFGA 4B0MM 3O2VH 3EYQC 4WV1B 1ZTXH 4HG4K 5JR1H 4PJAF 3MRFB 2BVPB 4G3YL 4D3CH 1OAZH 2CIKB 3C08H 4NQVA 4J3OC 3MXVH 4G6JL 1RZ7L 5GGUB 3GJFH 3VD9A 1I9EA 3QIWD 5GRXG 2H8PA 3RX8A 3MACH 1I7TA 2F53B 4X99B 4AG4L 4QTIH 3GGWB 2X4RB 5T1LB 3DTXA 4HS3A 1JF1B 1NBZA 3DX8A 3INUH 4DN3H 2BSSA 1CR9H 4FTVB 2PW2B 4GW5B 3GB7A 3GK8L 2VZSA 4LVNC 3QIBA 2H9GA 3SGKC 15C8L 1JGLH 1LDPL 2R1YB 3SJVD 4V1DA 3BUYA 4BSWA 4P49A 3GFUA 1MAML 4PRBA 4JDZA 1QVOB 5EZIL 4HULB 2XTJD 4U6XB 2OQJB 3TO2B 2OSLA 3P9WB 3ZDXE 2KZ1B 3HLAA 3GSOB 4FQIL 2BOCA 1CG9A 3PWNB 4F37F 2DL2A 5JIKA 4G7VH 4WTWA 1F4YH 4JDVB 5BJTB 3SJVE 3HMWH 1ZLVK 4KRNA 5DVLA 1G9EA 5C0AD 3CH1B 3FONA 3QH3A 3PDDA 4FZ8L 1JHKL 1MCWM 4ZNEA 1NCWL 2XTJE 2EDRA 1EZVY 3QYCA 3TZVB 1IGYB 3IFPB 4P57B 1KN2H 3SDCB 3TJEL 1LD9B 1C7TA 4IMKC 43C9B 3QG7L 3O11B 4Z7WB 2DQUL 1IGCH 3C5ZD 5C0AE 4XVTH 5SWZD 3T0EA 1CD1A 1T2QL 3HKFA 5HVHB 1U3HC 2R0WH 4NKMA 1EFXB 1KPUA 3HUJE 3WDIA 3N9GH 5GS0L 2F19H 5DJCB 5MEND 4L9LA 1VERA 5H35B 4G80B 3ZL4L 3MJ8B 1JGVH 1FZOB 2GSGA 1YC7A 4ALAH 1RFDL 1KOAA 5SWZE 3NCJH 3SPVB 5I1LA 3JSSA 3DROB 3EZJB 5IQ9B 3C09C 4EUPB 3L5WA 3N85L 4N1CA 4X6FA 3HR5A 3LRSB 2NY0D 1JGEB 4R6UA 3OZ9H 3HI5L 4DW2H 4YGVA 3T8XA 4RX4D 3MRMA 1EO8H 2BX5A 4HPOL 2D9CA 3P9MA 6FABL 5EFIA 1IKNC 2Y9RT 3T77B 5GRJL 3WXVH 2RFXB 3T65A 2FX8L 4PD4J 4ONFH 5C7XL 4GO6B 4XP9H 2DQIL 1BOGB 2EYSB 5SX4I 4EI5D 4OI7A 1J18A 4DKFL 2ARWA 4NYLA 2YZ8A 3QXTA 4CDGC 5KVFL 1FLRL 1ZV5A 3ZYOA 1NL0L 5A3IC 4S1DC 5D96C 2VLKB 1LO5A 2QLVB 1RQ5A 1S7XA 2WWMD 3OKLA 4LGRB 5DMJB 2P1YA 3F7VB 5TF0A 5JNYB 3PDOB 4EI6A 4OM1L 4PV8B 1D6EB 1MFAL 4PREA 3ULVL 4JKWA 4OGYH 3U46A 1J5OL 1T04B 1NCTA 5F3HA 1ACYH 4YXKH 3MRNB 5JO5B 3CMOL 1J8KA 1N64H 2IAMA 2QL1A 2Y23A 4YZFE 5CD3B 3JTTA 5K9JL 3CFKA 1MJUL 3U4BH 4JFFD 3IXAB 4FFVC 1K4CB 1HH9A 1CXKA 1FNEB 1JRHH 5A43C 1NUDA 1PYWA 5JIPA 1EPFA 3KPLA 4PJ5A 1HWGB 1OSPH 2UY7A 1WJ3A 5TF1L 2EE6A 1SYSB 1DQQA 1IC5L 5T3ZL 1GGBL 5MP6L 4LF3A 4HPYL 1A3LL 3C60C 4JFFE 1RZKC 1KNOB 2CQVA 3QXDA 2Z31C 4Z7VE 3CFBA 4Y4FA 2XWJA 3PL6B 3IKCA 1NCAL 5LGHL 3KPOA 1MH5B 2XYCA 1FYTA 5I1AA 5AAWA 5D2NC 2X6MA 4LU5L 5DQDH 4ONGH 4GXUN 3SE8H 5J6HB 4LCUA 3X13A 4PGZA 4JY4B 2OS7A 4GUPA 2GK2A 4ZTOH 3V6FA 2XWBB 3I02B 5F88A 2VLMD 1IAIL 1SM3L 4OFYA 3WJJA 1IGJA 1MJ8L 5D7SL 1AY1H 1MAKA 1AGFB 4Y2DD 5FK9B 3RBSA 5HHPA 3V5HA 3QXUA 1L7TL 4K7PX 5ANMA 1WT5C 4BYHA 1K6QL 3IJSA 1REIA 4TRPL 4OBSA 1XIWA 5D1ZA 2GTWB 3AMLA 1MFEH 4JPKL 4N1EA 5HVGB 5MI0C 5EU6B 4EKXA 3RTQA 1EXUB 2DQFA 3DV4B 5EU5A 2W60B 3WFEL 4JFZH 1HH6A 1D5ZA 2JB6A 4PRPA 3RWJB 1ZT1B 2DQJL 4ONOA 1S5HA 5FO7B 1EHAA 4ERSH 3P0VH 3OKOB 3ARGA 1TJIL 5IGXH 2VXUL 2YBRA 1MJ7H 4HK0A 1CLOL 4MAUL 3G6AA 2R2EB 1N0XL 2JIXD 4LEOA 4ETQB 3PNWA 3REWB 4I13B 1BZ9B 5GGVY 4IIQC 5ALCH 1ZT7A 5B21A 5FDWA 2X4UB 5IVXA 5FCSH 4CVZB 1A7RH 1DZBA 1B4JH 4WIQA 4KY1L 3W9DA 1Y18A 4XTRD 2ZUTA 5C0BD 4Q6IB 2ICEA 5FCUH 4PJXB 5HYJB 5DJ2B 2AV1A 4NO3A 1YN6A 2PETA 4FQXC 5CCKL 2YD9A 4NNPL 2IQ9L 1C5DB 1WIUA 3X12B 3VXQB 4YPGA 4FRWA 4AQOA 4JGJA 4LP5A 4Q0XL 2W9EL 4I3RL 5C0BE 2Q8AH 3ARSA 5K9KB 3QJFA 2QHRL 4GRMA 1M7IA 3PWJA 1X5LA 2AI0L 1CQKA 1IL1B 5HPMB 2DTMH 2X70A 4ZYKA 3I50H 5IWLC 3MLVL 1SYVB 4KRLB 1ZEAH 3EKCA 4XCEA 1BGXH 1TETH 1RIVL 4K8RH 2VR9A 1K85A 3WIHL 3SOBL 1NCBL 3TBTA 2OMBA 4OSUH 1UYWH 2FJGA 4Z78A 2BNRA 3SDXE 1TQBB 2MOVA 2Y06L 4H0GA 2QV2A 3DVFA 3LS5H 3QUMA 1CLCA 3IFOA 2AGJL 2RQ8A 4JREC 3NH7L 2CDEB 5DUPH 5IEHA 3ALPA 4PGDB 5DDHB 4ZFOB 2NW2B 4XAWH 5INDB 5GGRB 3QPQC 1MFBL 4GAFB 4CVXA 1D5MA 4CN4A 1T7XA 3SBWA 1Q0XH 2WUBL 1Q9KB 5CZKA 1WBYA 3BWAB 3BEWA 1MCNA 2FBJH 5J12C 5HHOD 5HI3D 1TZHB 3MRGB 5E99H 2B20A 2EO1A 3FHQA 4L8DB 3S6CA 1KB5L 1YNKL 1F2QA 1ORSB 1CICD 4L5FL 1JYWA 1HYSC 2GFBA 3QDJD 4J3UA 4IRZH 2R0KL 5C08D 5IUSA 1R0AH 2DIAA 5T33H 5I8CB 3BQUB 3MRDB 1AQDA 1VPOL 1BLNB 5HHOE 5E4IA 3KLDA 3L3JA 4ISVA 4LPXA 3LKNA 5FYLD 5KZCB 2BSRB 4W81A 4HIEA 2D7MA 4NO5A 2FB4L 3CDGA 2R1WA 3G5ZB 3QDJE 4FQCL 5C08E 3U30C 4WWKC 1ZHKB 2D31A 2Z35B 3STZA 4GRLA 1MCPH 4G6FB 5IB1B 2E6QA 2CJUH 2P5WB 3UJJL 1WFOA 3TWCL 5GIRB 3SKNB 1E28A 1NC2B 3H7LA 5J3HD 1H3GA 4WDIB 5HI5D 4M4PA 5FYLE 3LQAL 2VLJB 4HWEH 5C6WH 4EXKA 3O6KL 1PKQB 4JRXB 4X9GA 3O8XA 1X5KA 5FA4B 5EA0L 5D5MF 5IW6A 1K8DA 3GM0A 1Z6JT 2WIIA 4PJCA 5HD8D 3QRGH 4M62L 1T1ZA 3FB5A 4WCYL 2RBLA 3HS0B 3H9SB 4Z76B 4E42A 3ARDB 3O3BA 5GGQH 32C2A 4ORGA 1NDMB 1GGIH 1PLGL 3NZ8B 3WIIH 4ZAKD 4X7SL 1GZQA 4GG8B 5GSVA 4X4YA 5JW5B 2A2QT 4HUUA 1TZGL 4PR5A 1R3HA 1DEEB 1MPAL 5DD5L 4E41A 2G75A 3PGFL 5INCA 1H15B 5L0QC 1XZ0B 1Z5LA 3O3UN 1IKFH 4N0CD 3BPOB 4M43H 1BWWA 4GMTL 1W8NA 4YHYB 3MLYH 3RZCC 1KB9J 3QHZL 5E24E 2B1HH 1ONQB 2YXFA 4LVOC 5CIPB 5GXBB 4XRCA 5ITBH 3A67L 1KJVA 5DO2C 1BBJB 4DVBA 5D70L 4OKDA 4JG0H 1UXWA 5JLZB 3LQMA 3LHPL 1WBXA 4NPYA 3VFOA 4MAYB 4R8WH 2IH1B 2AJUH 3ARFB 2PR4L 2AKRB 1RI8A 1A21A 4HFWA 3NA9H 1E4JA 1MRFH 3KYOA 1ODAA 4UOW0 4YWGH 3QIWB 1JWSB 2DN7A 4I3GA 2JTDA 5GSRA 5IW1A 3GO1L 4Y4HD 5JW3H 3FQTB 4YDJB 2OTWB 3OX8B 4OI9A 3MGOA 4RFNC 5TE7H 2A83B 4QXGL 1QZ1A 3DBXA 2ZPKL 5CEXA 1R24B 2CUHA 4N8PA 3SQOL 4WJ5A 2EEDA 1IRAY 2I9LA 2W07A 4WU7B 3R06A 3VFSB 4GXUM 2C3HA 4U2ZA 4JY6A 5F89B 1IE5A 3HN3A 4TUJB 2R69H 1CK0H 4NM8L 1AJ7H 5B39G 5IHZA 1HINL 3MBXL 4XP1H 2FNBA 5I17B 4KMTH 4X5WA 1SEBA 5HHNB 1TJGH 4DZ8A 1OAKH 2DMKA 1MWAH 2ZNXA 1OAQL 3O4OC 4W4OC 1NC4D 2NYYC 3SKUD 4N0UB 3GSVB 1EAJA 3SCMC 2NY1B 1HKLH 5C0GB 4RDQF 2GKIA 4CMMA 3BGMB 1M71B 4K3JL 4XPFL 5C0AB 4L4TA 1D5BA 2ZCLL 2H41A 4LLYA 4QRTA 4BSJA 1QLEL 4UINH 4GKSB 4HMEA 5EC1B 4EUPH 1ZSDB 5LWYL 3QIUD 1R5IA 2EDKA 4JZNB 4RGNC 2HVJA 2J7LA 1G7MB 3ARDC 5E8OA 3QCTL 1FG2B 1GAFL 2ITDA 2AJ3B 4X7CC 4UQ2A 3VWJA 4LHQB 2VOTA 4N1HB 4K9EH 2AEQH 3LN4B 5E8PA 3D5OF 4UT6H 5GZND 3JXAA 1YEGH 5MENB 1MIEH 5KN5A 4QRPB 1GL4B 2C3WA 1I75A 1K4DA 2V7NA 4FQJH 2IPUG 3D0LB 4YDVB 1Q9WA 5ERWA 3DUHA 1CE1L 5D7JB 2C1PB 1EEYB 1VFUA 3F7RA 3J7HA 4XVJL 1DN2A 3D18B 3QO1B 5AUMA 3I9GH 3KAAA 3GMOB 2E27L 3QNZA 4ZUTB 3WS6A 4ETYA 1RHHB 1J05B 5IVNA 2A74B 3T4AB 4JPVH 1MCHA 4JFYB 1WEJH 4U31A 5BVJB 1OSZA 1U0QA 1AD9B 1FN4B 4OTXH 2C9AA 3FT2A 4YO0A 3OSKA 1OAXL 2AJVL 4JN1H 3DX6B 4I18A 1BVLA 2QQNH 1YJDL 4HKZB 2BC4B 3CFIC 3Q3GA 4EI5B 2B8OT 4M48H 4AIZB 4RIRB 1CXHA 2EYTB 3KS0J 2YWYA 1MSPA 4XB7A 2G5RA 2K7QA 4K2UH 1KXQE 1T1XB 2BVQB 3J8F7 4D9QD 4I9WD 5EOTA 3B9KA 4EEEA 2ZSVA 1S8DA 1N3NA 4Z7QE 3QDMA 5FYJD 1EDQA 3ULUH 4WUUD 1HQRB 3VG0H 3ZE2E 1KT2A 4EOWL 5HHQA 4ZFZA 3VD3A 2FWOA 4XPAL 5EO9B 4D9QE 3Q1SH 2W38A 1HHKA 2VXSH 4I9WE 1QNZH 5I1KL 4XNZC 1G7IA 2CR3A 3RI5F 3BD3A 1KCRH 1KCVL 5FYJE 2XTJC 4WUUE 1N8ZA 1QKZH 4P2OA 2QADD 3ZE2F 2EKSB 3RWHB 3GDBA 1U2HA 5J7CC 1T89C 5CGYD 4XP4H 3P4NA 4XBGB 5F9WC 3DVNB 3E6HB 4DJMA 5C6PB 4L4VD 4UNVA 4LEXH 4HF5H 3QEHA 2X89D 4KZDH 2I25N 1BEYL 1UM4H 5I18L 3C2SA 2D7OA 3C5ZC 3KPPB 3TV3L 3W9EB 1FVDB 3H0TA 3QQ3A 3CIQA 5E94A 3U79A 4L4VE 5GISL 4HQQL 1AGEA 5KVGH 1JHTB 1DP0A 1M6OB 4OZFG 3I75B 5CGTA 4ZUUB 2Y1VA 1UQSA 5EZOH 5SX5K 4KDWA 3OB0K 1I8MB 4MB5A 1IQWH 4KXZI 5DSCA 4FFZL 4Y2DB 3VH8A 2EZ0C 1F8TL 3QCVL 4NKIH 1RU9H 1PQZB 4MQXD 3VXUD 2VWEE 5IQ7H 3BIAX 3TBYB 3X11A 4S0TD 2XRAH 2NY4D 4YHOH 5LJYH 2ADFL 4L8BB 5I8OH 5KSBB 4Y1AD 1QSFD 2HLAB 2IBGA 3QG6B 2NY0C 1ZA6B 1E4XL 3O45A 1U3HA 2GTZB 4ZO7A 1VFAB 1KLGA 1VGEH 1TVBA 3L3IA 3NCCB 4HDIA 3VXUE 2NY6D 3L3GA 1GGUA 2J88L 1QSFE 4P99A 4Y1AE 2MKWA 4S2SB 1KSRA 3GSUA 1WWCA 1NFKA 4Z77A 3DGGA 4R4NC 3WO3B 4GLRI 3CC5A 4CJ0A 5MERA 2IGFH 4LSDA 1RUQL 1C8PA 3HC0B 4PP2A 4UTAL 5E7BA 3ECBB 4HW6A 5F1KC 3N1GC 4J3SA 2VDOH 1W72B 2NLJB 2YD8A 2YMXL 3ARBD 5E03A 2F8XC 2C1OB 3P0GB 1BOYA 2WWMC 4WV1A 1G7PA 3MRFA 4PRHD 35C8H 1CDHA 2VDLH 2PUQT 2CIKA 4DZBA 3WXWL 5KSAD 4OZHE 3EJZD 1BQHB 4N9OB 2VNCA 2IMMA 3TEUA 1JYVA 4KKNA 4XBPB 4QRQA 1XGPB 5A2LH 2UWEB 1R3LB 5E2TL 2F53A 4PRHE 4BSVB 1ZWIB 4YHZL 1QG3A 1QEWB 2COQA 2X4RA 4U1MB 1X5HA 5T1LA 4B50A 3K3QA 5I19H 1JF1A 4FTVA 2CR6A 1KUMA 2J4WH 5J13C 1KTRL 5M7QA 5FYJU 2CK0L 4OD2A 5ADPH 4IOIA 2XTLA 3MRBB 4OZHF 1HOCA 5CSBA 4XX1G 3M8OH 3X3FH 2XZAH 4HSQA 3CLFH 1GOGA 4JM2D 3AS2A 3BKCH 3D3VB 2DBLH 3F58H 3W11D 1I3RB 4LSUL 4XT1C 3U7WL 4AM0A 1QLFA 4XMPH 3UTQB 1SBSL 3K1DA 3VXOB 1QVOA 1MF2H 4LQFL 3DV6B 1IC7L 1HYRC 3O6LH 2OQJA 3TO2A 2DDQH 4XNXL 5DMGD 3VD7A 4K71C 4PYHA 1IGTB 1NMCC 2LU7A 1P5VA 3GMQB 4MD0B 4LCYB 4DTGH 1CQYA 2GUOB 1MHPL 3LOWA 1RUAL 4JFOB 4LIQL 5CJOH 2HFFA 2MCG1 4XVSH 3MOBL 4OKVA 4CL7A 3CH1A 3MMEB 2ZG3A 2E9IA 1T20B 4YHKH 2DI8A 3WNNA 4N0FA 2XN9B 3M1BB 3TZVA 3UYRH 1FL6B 1IGYA 1NLDH 3IFPA 3Q5YA 2PYFB 4X6EB 4P57A 5DRZB 5C0IB 3C60A 3SDCA 1OAYL 3KR3L 4GT7A 1KYOJ 1LD9A 4OIBA 2Z31A 3VGAC 43C9A 1MUJA 3FHAA 3O11A 1CICB 4JFHD 3L95B 1A6WL 5CJXC 1JYNA 1D3CA 3QDJB 2ZUUA 3QNYB 1CE6B 3O4LA 1FORH 5MEPB 1QP1A 1S9WB 4LCIH 4MA3B 4W6WB 1CFVH 1A7BA 5I1CL 4HT1H 3LZFH 3MJ7A 5EUOE 3VRJA 5I2IA 1XGUB 1IT9L 1EERB 4HEME 4KDVA 3OAYH 4JG1H 4NT6B 3OG6B 1YY8B 4P5TB 4G80A 4Y19A 3MJ8A 3P4OA 4ODVL 4JFHE 5FUOH 3TVMB 4G8EA 4M7JL 3BP6A 3MJ9H 3ROLA 5AYUL 3SPVA 4WENB 3NPSC 4G8FB 2OJEB 1AFVL 3DROA 4G9DA 4MXVF 4WEBL 3ZKQD 4X9HA 4XGZB 4HGWB 3ZZ1A 1WT5A 1TFHA 3ZE1E 1T2JA 4P9HC 1C16B 1GVIA 3IKKA 4XHJD 2CLRB 1JTTA 1OGAD 4RFOH 1IGMH 2VN7A 5EUOF 2D7PA 1X7QB 1FNGB 3CXHK 4X8JA 5D6DA 3U9PL 1IZJA 2X5PA 3ZTNL 1HIMH 2IF7A 4BH7A 3QSKB 3NGBB 1Q94B 4XTRC 4G6KH 4ACPA 2RHEA 1OGAE 4U1KA 1TITA 1MCWW 4U6TA 1JF6A 1XR9B 3RDTB 2EYSA 1I7UB 4FFYH 4XCCL 3VFNB 3OPZL 1NUNB 3MV7D 4ZAKB 4XMKL 3T2NL 5ELIA 5IMLB 1AHWB 2VLKA 4GW4B 5A16B 4GOSA 5C07A 4F80A 2EE3A 3F7YA 1RULL 1FO0L 5JNYA 2HKHH 3VMOA 5CGMA 3PGDB 4PRNA 4IRSD 2QKIB 5L8KB 4WUKH 3MV7E 5FGBC 4XC1H 4FXKA 5DZOA 4FQXA 3MYJA 3EW3B 3MRNA 5BV7C 3SGJC 4PY7B 3V4PL 5JO5A 2BRRL 5CD3A 3S4SG 5IKCA 1XF4A 1BZ7B 4AEHL 3IXAA 3QDHA 3MCG1 3IDUA 3SKJH 4CMHC 2Z8WC 5CMAA 1FNEA 2AAVA 4I48B 4M7KL 3BH8B 3C6SB 4KKBC 1IJ9A 1MCOH 5CHNA 3MRIA 4NOBA 5F7YC 2QR0B 5I1GH 1HSAB 2NQCA 4W6YB 3HC4L 1JZ4A 1JWUB 4N5ED 3P2TA 5IWLA 2Y36H 4OQTH 3H3BC 5HI3C 4UV4L 4Y4HB 1LEIB 4F2MB 1SEQH 3PGCA 4YC2B 1P2CB 2YEZB 3PL6A 5BZDA 3WL9B 1XT5A 1MH5A 2B4CH 3NVQA 4A6YH 4O4YL 3CVHL 2LU3A 3VXPB 1XMWA 4ZQKB 3C6LD 3RJQB 4JY4A 1UWEL 5KANI 2FYYA 3K7UA 3MLWH 2XWBA 3I02A 1U95B 5ETUB 5IB5B 4G8IA 5FK9A 4U1LA 2VDKL 1LE9B 3MLZH 3I84A 4M03A 1A7OL 4U1HB 5EU7E 5IBUB 2GTWA 5J3HC 4LCWB 5HI5C 1NC4B 4JFXB 4JPIA 2QQLL 1NFDB 3IAQA 1WISA 1EXUA 2DB8A 2DQHL 4LBEB 1MOEA 1XGYL 3DV4A 4LPYA 5FGCB 1Q1JH 5T1DL 2HH0L 4K7PH 5JZ7D 4WW2C 4GBXD 1A7QH 4GRWE 4XP5H 1D5IL 1M05B 3OKOA 3T1WA 3QIUB 1FC2D 3UAJC 3NTCH 3HPLB 3QT2A 2YD7A 1A3QA 1BIIA 3ZYIA 2D9QB 1DVFD 1ZA3B 3REWA 5GS1C 4S1QL 3T0AA 4A2MA 1BZ9A 1G7LA 3K8LA 4XBEH 4OT1H 4KHXL 5GS2H 3T1FB 4M00A 3IFNL 4F57L 3NCFB 2X4UA 1KJ2L 5KOVC 2DKMA 4HC1A 4GAGL 3IF1B 3BPCA 2B7DT 4LASL 4JCMA 3W0WA 2WBWB 3G6JE 4Y4KC 2XZZA 4Q6IA 1ETZA 4K23H 2YC1B 5DA4A 4JRWA 1WAAA 3TP4A 4YJZL 1A5FH 5J1TC 1KTLB 3VXQA 4NQUA 5D8JH 5E1HB 3TFKD 2FX7L 1VACB 4W6XB 2H3NB 4KRPD 1RSFA 5K9KA 2IBBA 3G6JF 1OF2B 5DXWA 2FL5B 3MFFA 2FECI 4RGMC 3BSZH 4XP6L 3NABL 1IL1A 1GXEA 4TULL 2FATL 5E08L 3V4VL 3KXFE 2ZUWA 5JQHC 2HKFH 1SYVA 1YECL 4QO1A 2V5YA 4YE4L 2A0LC 4M02A 5BW7A 3NCMA 1PSKH 5EWIL 4U1NA 5L7XH 4PB9H 1XGRA 2VDQL 5BZWA 3ARUA 4LLQB 2E6PA 4Y5YC 2F8VA 2DQDH 3MXWH 2BRQA 4M1GL 1CL7H 4PGDA 5CJBA 2NW2A 4NHCH 5INDA 5GGRA 5JOFB 2YD6A 2FX9L 2OK0H 3BWAA 2R29H 1VCAA 3ESUF 2ZUQB 5E2UL 5H37G 4GXVL 5EIQA 3T2PA 3WBDA 3VFRB 2OR7A 4MA8L 1S7WB 3MRGA 4L8DA 2CUMA 4YBHA 1SJHA 3VI4E 1ORSA 1KTKE 5D2LA 1AGBB 5E6IB 3SGDH 4NN7B 1A7NL 4NWUL 1Q9OB 4GS7C 2VLLB 5JOPD 3I3DA 3BYYA 5I8CA 3BQUA 2BVOA 3CFDA 5LQBL 3BT2H 5L2KD 3MRDA 2HVKA 3MLRH 4OF8A 2KL6A 5HHVH 3MBED 2X4SB 4PRIA 3LQZB 4XPHL 5A2JH 2V2TA 5KVEH 5AZ2H 4UUJA 3CX5K 1XAUA 5CFHA 3AREC 1F90L 4L4VB 1MI5A 1RZFL 1FL3A 5HDBF 3GRWA 1WBZA 1ZHKA 4NKDA 4KMQA 5JOPE 5EZJB 1SBBA 5MEOA 3BP4A 3EOBB 1WFTA 4V2CB 4APQD 2P5WA 3WEXB 5KVMC 5GIRA 3SKNA 3P11L 1NC2A 3FO2A 2Z4QB 1S7QB 2HJKB 4OUUB 2Y25A 4PJHE 4WDIA 3UC0L 2QSQA 5FYKD 4YX2L 3TPKA 2ADIA 2VLJA 2DYPD 2FHBA 4YXHH 3V52L 5GZNC 2HRPH 1PKQA 4JRXA 5D7IB 5ISZD 5FA4A 3D9AL 3EOTH 4OCWL 4I3SL 1P4IL 3RGVD 1R3IH 2A9NH 2APBA 1U58B 5J1AB 3G5YB 2ICWI 1JGUH 3G04B 1UZ6E 4G43B 4MVBD 5EU4B 3PWPE 5DD6A 3C5SB 3VXUB 5FYKE 4HIXL 1U8LA 4MA7H 4PJHF 5IEKA 5F7MC 5BMFH 1ZHBA 2Q8BL 3ARDA 3RY6C 1W72H 1EHLH 3BGFC 4OCYH 5DD1L 2VAAB 5ISZE 5L6YL 3NZ8A 4RAVB 2QSTA 4PJIB 4DUXA 1NMBH 5HYIA 1MFDL 3GKWL 3DI3B 4GAJH 3JVGC 4W68A 1KBGL 2XNAB 4X9FA 4ZO8A 3FL7A 1DEEA 3BOVA 1OM3L 2NY6B 1VENA 4ZFFB 3UPCA 4GQPH 5TPWH 1DQLH 5HY9B 3QWOB 4HLZG 3HPJA 2K7PA 1MCFA 5JDSB 1H15A 4YGAB 3QHTC 5BO1L 4GSDH 4HAFA 2O5XH 3TBVA 3GBNH 3JUYA 2V5MA 3SO3B 2V9QA 5B38G 1NAML 1RZ8B 3WLBB 4J2XA 1BX2B 3MNVA 5LVEA 9CGTA 4RDQG 3MO1B 5DMIH 4NHUB 5EH1A 3DHMA 1FC1A 4PTTB 3VA2C 1ONQA 3QJHB 5CIPA 1J0ZA 4YH6A 4QXTA 3HE7D 1YPZE 5DK3A 3CXDH 1PZ5B 5IIEB 5DT1H 2H1PL 1UCTA 3GSXB 4XWGL 2VB5A 4H5SA 5JLZA 1UT9A 2YN5A 4OJFH 3UP1A 4XCYA 1FSKC 2EDHA 1A9EA 4P4RB 3UTTD 4JR9L 3QUYD 4GKNB 5KS9F 3BPLC 3X14B 2CDFB 4LHUG 3QIWA 1J1PL 4M4RA 3VRIA 1JWSA 3MA9L 3ELAT 3B5HA 5FM5O 2DM4A 1YPZF 3JWDH 4ODWB 1XH3B 5LGKA 2WQ8A 2B2XH 3OXRB 5LCVH 4C58B 5CEZE 3MNWB 4JB9L 1MRCH 2YSSB 4KQ3H 1FZJB 1EX0A 1QYGL 1ZGLA 2ERJC 2EYRA 3SE9H 1KCUH 3BFOA 1B90A 2W0KA 4F7PB 2QADC 4I0KA 1EZVX 3H42H 1MEXL 3DURB 4HLJA 4XCNB 5CGYC 3GMNB 1HHIA 1DUYB 1UADC 4BZYA 4JM2B 3RWFA 2FO1A 5ICXB 1ADQL 3SJVA 2VH5H 3RIAF 2Y07L 2ZUYA 4BFBD 4JO2L 4NWTL 2ORBL 1YMMB 1MLCA 5I17A 1OP5H 3LKPB 3Q5OA 2AJZB 1U36A 4O2FB 4OQTA 4R97C 5CUSH 5I30L 2GSIB 4QHLA 3QUZD 3GSVA 5B3JE 1S7UA 2VWEC 4PP1D 5CILL 3W2DH 3WN5B 2DLGA 5KTEL 4PJFB 2BK8A 5C0GA 3Q6FA 1FVEB 4HCRH 2FBOJ 3U0TA 5F3BA 4YXLH 4G8GD 5C0AA 2D03H 2NX5E 2YZ1A 5EBGA 1MHEB 3E2HB 2W0PA 3RL1A 4X83A 5DHXB 4O02H 1AXSB 3TN0B 3HUJA 4GKSA 3K1KC 5EC1A 1DANT 2XT1B 4LCCC 1YEFH 4UZGA 5T3XH 4CDHA 3OJMB 3A6BL 4MQXC 4DKAA 4JZNA 2NY4C 1Y0LB 2ZOLB 3PP3H 3O3DB 3VDAA 4JRYD 3EFDH 4LSRL 4G8GE 1RJCA 2GY7B 1UM5L 5SWZA 1FNSL 5FYKU 5I1JH 1RJZB 4HXBH 4MZ2A 1VHPA 3BKYH 5GGTL 3IVKB 4HS8L 5HHXL 4ZSOB 4GG6E 3RUGE 4ZS7L 5MENA 1EBAA 1JZ2A 5JMRA 4JRYE 5ESQB 3BZFB 3IJYB 5ID1B 2UV3A 4OV5A 4YDVA 4QHKI 1C12B 3DSFL 2APVA 1EEYA 1FFPB 2C1PA 3D18A 1YEDB 1VFBB 3QCUL 3FOMA 5I74C 3GMOA 3FTGB 3I3BA 4ZUTA 4PLKD 5BQ7B 4GG6F 1HDMB 4G6JH 1RZ7H 3KYNB 1RJYA 3HB3C 3ARBC 4JFYA 3ZTJH 1PAMA 1HWHB 3BEVB 4FOMA 5BVJA 1A3RL 4P23C 1AD9A 3LKSB 3L3OA 2H6PA 3DVGB 2OXGA 4AG4H 3JV0A 1YEHL 1NSNL 1C7SA 4H1LB 3AMKA 5F9AC 3DX6A 5KSAC 2DJ4A 5I75B 3EJZC 4HKZA 2J6EA 2HYMA 5CJQL 3O2DL 2A73A 3GK8H 4PG2A 4EI5A 5I8EB 4AIZA 4JHAL 2EYTA 2NR6D 3MV7B 15C8H 2F5AL 2Q76B 1LDPH 2BVQA 5I1HL 3MUJA 1L0QA 2J5LC 4Z9KB 5FKAB 3C8KB 3RNQA 4PRAB 1MAMH 5EZIH 5F7UA 3H2WA 4PJDB 2ARJQ 1HQRA 3VFTB 4IRSB 3GNML 4FQIH 1U93A 2R56L 3S36X 5LXGL 2V5TA 2VZVA 4JQVC 1OQOA 2IG2L 1MELA 2LV4A 2CDGB 4FZ8H 1JHKH 1NCWH 4U0RC 2AP2A 4N8VG 4JFFA 1MCDA 1N5YL 3TJEH 1UB5B 4Z7VA 4WHYH 3BMWA 3RWHA 4MCYB 3QG7H 5IOPB 1GGCL 5TJWK 3FRPG 2DQUH 1BJMA 3VRLE 2NTFA 4PJAB 4X4ME 1AC0A 3N1MC 2DI7A 3DVNA 5C09D 4OF7A 1T2QH 4HZAA 1UWXH 2M2DA 3ZKXC 4ZTPL 3ZKSD 3B3IB 3MYZA 5HJ3B 2EH7L 5GS0H 2ZNWA 1SQ2N 3O9WB 1G6RB 5DWUL 1UCBL 5HGDA 5TFSL 4YQXL 3ZL4H 5J57B 2AVGA 1U9KA 3KPPA 1UACL 1RFDH 3V2AR 3W9EA 2GQHA 2HA1A 1FVDA 5C09E 4NZJA 3IGAB 3W39B 5SWQB 5TDPB 5E2WL 3C6LB 3PWUA 1UVQB 5EO0B 4DK3A 4KI5F 1JHTA 3N85H 1JNHB 1M6OA 1OB1A 1KF9B 2R23B 3QP3A 3RA7L 4CBPA 3HI5H 3THML 4PY8J 1WWAX 4OFPA 2BY2A 4JFPB 1JI2A 4Y2DA 4HPOH 4L3CB 3TBYA 2H2PD 6FABH 2HT3D 5EUKA 3WKNA 4GRWB 5GRJH 4B5EA 4NQDD 1VGKB 2HLAA 3BN3B 2FX8H 3ILQD 5EBLB 5C7XH 1JI1A 1DQJB 5L88L 2GTZA 1VFAA 1GCFA 2DQIH 2W0FB 4DKFH 2EH8L 3SE4C 4DWHA 2D7TL 5FUCE 4KTEL 4PJ7E 3MREB 5KVFH 1FLRH 4NQDE 2WLZA 5JORB 4JQXC 1NL0H 3MLXL 2VIRB 3RL2B 1H0DB 1IGFL 1J0YA 1ACZA 2NY5C 4NNYB 1AP2B 4ODHL 4OM1H 2JIXA 3M07A 1RJLB 1MFAH 3ULVH 2UVEA 3QZWB 1J5OH 3UZQA 3EGSB 2YUXA 1A6AB 1S5IL 2YWZA 3ZHDA 5CZXD 4OZGB 1JPSL 3CMOH 2HRLA 5K59F 5K9JH 2EXYD 1MJUH 3DX9A 3QO0B 5C0BA 4I2XE 5DRXB 3V8CA 1BQHA 5EBMB 4U3CA 2LABA 1H5BB 3HG1D 4PS4L 5TF1H 2F74A 1YMHB 1XGPA 1R3LA 1KACB 4JN2A 1IC5H 3HAEB 3AU1B 5T3ZH 4HPYH 4KJPD 4BSVA 1A3LH 1PX3A 1ZWIA 3WUWB 1LQSR 1QEWA 5ICYB 4U1MA 5DJZA 1HHGB 4KRPB 3DUSB 2DLEA 5DHVH 1RHFA 1CZ8L 3HG1E 4XC3L 1NCAH 5LGHH 5DJ8B 4KUZL 3SDXA 4DGYL 1B9ZA 2QEJA 2X4NB 4LU5H 5ANME 4UQ3B 5IJKC 4N5EC 4JFDD 3EDEA 3D85D 5FGBA 4KDTC 4DKEL 2KDGA 3FFCD 3UTQA 4JZOB 1W0WB 4HKJB 4HG4J 2XA8L 4LMQI 5DLML 1IAIH 2VZTA 4J8RB 2RCSL 2N56A 1MJ8H 5D7SH 3TA3B 4L1HA 2ZSWA 3M17B 4JO1L 3GMQA 4AEIL 3SKOB 4IJ3C 4LCYA 4X0KB 4RQQB 5DZNA 1ZE3C 4K7PY 4BK4A 4CU6A 2GUOA 1QBML 4JFOA 3S8WA 1K6QH 4PJEE 5EU7C 3DLQR 4TRPH 2IJ0C 4WI2A 3FFCE 4PLNC 4IDJL 4JPKH 4YHPB 4TPRL 1F3DJ 3GEWB 2HMIC 2CLVA 1IAIM 1F58L 1FL6A 4X6EA 4HUVB 5C0IA 2P7TB 3WFEH 1JTOA 1R5WB 3LDBB 5D1QD 1CICA 1EUTA 1BVKA 1FVCB 3S96B 3QDJA 4MJID 1INEL 2WINA 5C08A 1TJIH 4MA3A 2VXUH 4ZNCD 1UGNA 5L2KB 4D0BA 3U1SL 1CLOH 4MAUH 1XGUA 3MBEB 5DI8A 1E6JL 1N0XH 3KPSD 5JZ7C 4TVPL 4NT6A 3LEXA 1UJ3B 4DK6A 4YEEA 4GBXC 2CSPA 3BZ4A 4L8CA 3SDAD 1WZLA 4OF6A 1QRND 4Y5XC 2UUDH 3CLEL 5AD0A 2XWTB 4G8FA 2OJEA 3QAZB 4JZJB 1XGQB 2AXGB 4O2CA 5IVXF 3EOAB 2A6IA 4XGZA 3RPIB 5T1KD 4APQB 1G7HA 4KY1H 2VITA 1YEKL 2CLRA 3F62A 2X4QA 3KPSE 1DVFC 4I5BA 1AIFB 1AGDA 1S9XB 5AZEL 2P8LB 3NIGE 1JBJA 4QRUB 4HIIB 1AKJB 3HNVL 5CCKH 5ISZB 4LPCA 3VMNA 4KVNL 4LDOB 4NNPH 2IQ9H 2VRAA 5CSGA 3LIZL 4NCC2 4P46C 3RGVB 2DICA 4WW2A 1O7SA 1Q94A 4Q0XH 2W9EH 4P3DB 4MDIB 4I3RH 3BYTA 5IMMB 1DBAL 4OZIE 2QHRH 3FQNB 4ZPVB 3VWKB 3C2AL 1ITBB 2AI0H 3NIGF 2UYLA 4M61B 3PXHA 5IBTL 1OW0A 4IRJC 5IFHL 5H94A 4ZAKA 5GS1A 3RWDB 1Y6MR 4X4ZA 3OR7B 3OKEB 2DKSA 3TYGL 3MLVH 3ORJA 5H2BA 4GW4A 4KRPC 4MGXA 1LILA 3L5XH 1RIVH 4XH2A 2VQ1A 4TUKL 1BF2A 3WIHH 5A2FA 4CW1A 3QNXA 3S4SB 1I85A 3QHFL 3D69A 4UDTA 5IK3B 2Y06H 2QKIA 2EEAA 2GIYA 1GC1L 4HWBL 1UEYA 2AGJH 1PVHA 2AK4D 4PV9B 3NH7H 2V2XA 3QI9D 4PY7A 1FRGL 2FECL 3NN8B 1IM3B 3HE7B 1HXMB 1A9BB 2ICCA 1AQKL 3GM8A 4I48A 4M1DL 4E5XA 1F13A 2AK4E 1M1SA 1YNKH 3C6SA 3WS3B 2E8ZA 3DXAD 3DMMD 3FQXB 2CH8A 1ZHLB 2QR0A 3D48R 3UTTB 1HSAA 2R0KH 3H8NA 3FN0L 4DAGL 4ZUSB 5ACLA 2QSCL 1VPOH 5LAXB 3GBML 1AD0B 4Y4HA 1LEIA 4FABL 5KAQF 1P2CA 2DTSA 1KLFA 2YEZA 4BQ9A 3EYOA 2FB4H 3DXAE 3CX2A 3NIDF 4FQCH 3LV3A 1T0PB 3S5LA 3VXPA 3S88H 2X42A 3JV6A 2HG5B 4XNYL 4PBXA 4ZQKA 5IP4A 5HHMD 3UJJH 3TWCH 4P4KD 1BFVL 1UG9A 3MUHL 2VLRD 1M7DB 3OR6B 3LQAH 2XFXB 5HDLA 3RBGA 1I1AD 1OT1A 1ORQB 2DIBA 5DK2A 3O6KH 1VKXB 5IB5A 4Z7NF 3VFVB 1ZS8B 3PWLB 5DJXB 5F1SA 3PHQA 5IBLD 2ADJB 5EA0H 5DUBA 5TDNB 5HHME 5CZVL 1N5AA 4U1HA 1CFSA 4LCWA 3O6FB 4PJCF 4M62H 1NC4A 2VLRE 3QUZB 3NCYP 4Z0XA 4WCYH 4AMKL 3Q6GH 3WCYA 3EDJA 4LBEA 2Z8RA 5KANG 2WM0A 5HXMA 4G8GB 1RMFL 1H3UA 1PLGH 2FZ3A 2EDBA 1EGJL 3RVUD 3RGVC 1B0WA 4X7SH 3ET9F 4MWFA 5JHLL 4WTZG 4X5XB 3RAJL 2Q87A 4HKBA 1TZGH 3QIUA 1RPQA 1MPAH 5DD5H 3HPLA 3QEGL 4NZRL 2DI9A 4IS6B 4JRYB 3KPTA 3ZYJA 3ZYZA 3PGFH 4I77L 1WFNA 4LLDA 1F4XL 2XIDA 1CIDA 2LTQB 4PB0L 1P6FA 1SMOA 5CEZL 4GMTH 4O9HL 3T1FA 3F65A 2NXYC 1TXKA 2EC8A 5C0DB 4MJ5B 3QHZH 3VJ6B 3QQ4A 4M3JA 3LKOA 3LVEA 4JO4L 4HZLA 4YHLL 3A67H 1IVLA 5DD0L 5D1XC 5CBEA 1G7QB 4M8VA 4AEFA 4JY5L 5D70H 1WTGT 5ACMA 2YC1A 5TH2A 4DGVL 3HZVA 4PJGB 2BP3A 4FQ2L 3LHPH 3V6OE 5SV3A 2BNQD 2JELL 1KTLA 5FOBB 4M93C 3OKKA 1D6VL 1CXEA 3FQUB 2PR4H 4NRYB 3JVGA 2NW3A 3U0WL 1NMAL 1V3MA 4M5YL 2H3NA 3WHXB 3GO1H 4PJ9B 1ZLWH 2A38A 3OGOE 1OF2A 3KYKL 4QXGH 3BHBB 3QEQB 5E9DD 4KMLB 1S7VA 2ZPKH 2BNQE 3QUYC 5D5MB 3BRDA 4F7EA 3SQOH 3T3MF 5CKGA 2BCKB 3AB0B 5D93C 3E8UL 3P4MB 2MCPL 3KPRB 5ESVB 4OD1L 1JPFB 4E0RB 1YNLL 4RRPG 4P2RB 5E9DE 1I3GH 3C87A 4QF1B 1G9ML 4NM8H 3IDNB 1HINH 5T1MA 3MBXH 4A2LA 1S3KL 4H88H 4JFEB 4WO4D 4WHTA 2HP4A 5IM7B 1SJXA 4WUUA 3KS0H 3WD5L 1MCCA 1OAQH 2R4SH 1J12A 1PEZA 3MRPB 3UTPE 1DR9A 2JJTC 3RWEA 4R2GD 1PDKA 3TGXA 5JW4R 4K3JH 4XPFH 2KQNA 1GRWA 1I8KB 3CVHB 1S7WA 2ZCLH 4KKCD 1P7QD 2WMPA 3CFCL 3VG9C 5DMYA 1QLEH 4Q2ZB 1YEEL 4HK3J 1Q9OA 4S1SL 5LWYH 4HMCA 5DRNB 4PP1C 3WJLA 4HV8A 1NDGA 4HUWB 4JFQB 3SO5A 4OCNC 2X4SA 3QCTH 3LQZA 2OZ4A 1GAFH 4JKPL 2W92A 2I9TA 2VC2L 1NJ9A 4L4VA 3WO4B 3TNNB 3ZDYE 4R0LB 5CP7B 4Y16D 1MY5A 4E0RA 3KPQA 4BH8B 2X89A 2E3VA 3RWIA 2PO6D 1T6VN 5EZJA 5F7KC 2X9XA 2F15A 3MR9B 2NY2B 5IVZA 5IB2A 1S7QA 2HJKA 3MRKB 3OJVC 2LTQC 3PF2A 3RIFK 1HN1A 2R2BB 1HHHA 3NMEA 1KENL 5IF0B 3N06B 1CE1H 4XVJH 2E27H 5L8JB 1U58A 5J1AA 4QY8B 3S35L 3MC0A 3G04A 3C5SA 3TNMA 3VXUA 3MGTA 4ELME 3HHRB 4S1RL 2Q86B 4NQDB 1KPRB 4Y1AA 1QSFA 4G42B 1W8OA 2VAAA 2AJVH 1J0IA 2X4PA 4PLKC 3EAKA 3F6LA 1KJ2B 2VL5B 4HIJB 3BI9X 1YJDH 4NUJB 1ED3A 5B38B 1PKOA 4PGBB 4K8RD 4ZFFA 1D9KD 3QWOA 4PLJD 2XACC 4BM7A 2HJLB 1MHCB 2X44D 4WI8A 5IB3A 1TPXB 3VFGL 1SY6H 2ED8A 3WLBA 1BX2A 4NHUA 2NR6C 1CYGA 1FNFA 4YAQA 2CIIB 4OZHA 3QJHA 4EOWH 5DJAB 3IDJA 1UA6L 4XPAH 3T0EC 3ARBA 4LHUB 1PZ5A 5IIEA 1BP3B 5I1KH 5KOMC 4MD5B 3GSXA 4U7MA 1OP5K 4UV7L 1F6AA 1LO3L 3SDDD 4KU1A 3KDMB 3KJ6L 5DQ9B 2VJXA 4X6DE 4L9LC 1ZGLP 3MQIA 4P4RA 5KSAA 4GKNA 4FQQB 3X14A 5F1NB 1JK8B 1NANI 4F9LA 4PGCB 1RK0B 2RB8A 4UNTA 2YSSA 3TO4D 1CBVL 1FZJA 1RUPL 5F72S 4F7PA 1J11A 4DGIL 2Y72A 3DURA 4MQ7A 1BEYH 4XCNA 5I18H 3WFBL 3TV3H 1QOKA 1DUYA 3W5MA 3MRQB 4JM2A 1QTYT 4JFDB 5ICXA 1YNTA 5GISH 4HQQH 1CXFA 3O3EB 1DL7L 2EDDA 4JQVA 1TJHL 1T66D 2FO4A 4PJBB 2AJZA 4FFZH 4GFTB 3QCVH 1F8TH 4POUB 5F96L 1MVUB 4QHKJ 3WN5A 4PJFA 2PXYB 2BMKB 2DLFL 2ADFH 3B9AA 3OF6D 1A8JH 3VGDA 3U4EA 3PJSB 4LKCA 1E4XH 1T6WA 1IILE 3EJJX 3VI3E 4K3DL 5FB8B 3LEVL 4YBQD 3LN9A 2VMFA 5FUCC 2H2PC 3CPLB 3VXMB 2HT3C 1JZ6A 5FO9B 4YR6B 2J88H 4MJIB 3ILQC 4YFLI 5EC2B 4Q97A 1RJZA 5BVPL 3BVNA 1RUQH 1Z9OA 4FTVD 4JAMA 1U8IB 4KWUA 4UTAH 2VO5A 1G1YA 1CD9B 4ZDHA 2XG4A 5ESQA 3IJYA 1LHZA 3SDAB 2ZG1A 1QRNB 8CGTA 2YMXH 2XKUA 3KYMB 3CCHA 1A2YB 3EJYD 1C12A 1KG0A 1YYML 3PIQB 5SX4H 1FFPA 4NKOB 3AXLB 3F7PC 1YEDA 2DWDA 4FTVE 1C5CL 1KCLA 1G9NC 1OGAA 4TNVK 4Z7OE 3FTGA 4Y4FC 3WXWH 1IC4L 3GJFB 2WLYA 5BQ7A 1HDMA 2AJSL 2ZCHL 2KH2B 4M9PA 2IFFL 3KYNA 4TUOB 4XXCC 2FEEI 5L2JB 3SE4A 3BEVA 3NFNB 1MCLA 5CZXC 5E2TH 3K2UL 1NGZB 3MRLA 1I1FB 2CPCA 4ONHB 1CT8B 4PGEB 3VXTB 4YHZH 1R6VA 2VZ1A 4H1LA 3HZKB 2WBKA 3ARYA 2NNAB 2X7LB 3DVIA 2CK0H 3WFCL 3E6FB 4Q9BA 5B3NA 3BZEB 3MV7A 1UWXK 1OLZA 3H9YA 2ZWLT 1JHLL 5F7NC 4XHQA 2Q76A 5CD5C 4RMWA 4NC1E 1NKOA 4LSUH 4Z0BL 3U7WH 4ODUA 1H8OA 3ARWA 4OF3A 3C8KA 1EFXD 4U1SB 1OQXA 1SBSH 3AUVA 1RZJL 1WCBB 4LQFH 3IDYC 3U9UB 1S9VB 3VFTA 1BFTA 4IRSA 4POYA 1LO0L 4N8VB 4UU9A 4Z7WE 3HCVB 2G5BA 4FP8H 1RUAH 2AK4B 1A22B 4LIQH 2X4TB 3MOBH 4ENED 4AK1A 4NQED 2IEPA 2QQKL 3FQRB 5HTSA 4OB5L 1TDQA 2ZJSL 3H9HB 5IMOA 4JKMA 1U8JB 1OAYH 1AR1D 3KR3H 4I0CC 4YFLF 1UXSA 1ZVYA 2JB5L 3VE0B 5IOPA 3WHE0 3I6KA 1A6WH 2BFVL 4KGLA 4NQEE 2GJ6D 4UT7L 2VXVL 5I1CH 1UM6L 2AEPL 2ARJB 5EU3A 4GMSL 5K93A 1IT9H 1KGCD 1XGTA 4KDTA 1G6RA 1CXIA 5D1QC 3GZKA 3TYFB 4DOHB 4ODVH 4KTDL 1YY9D 4M7JH 1PX4A 3MLPA 1L6ZA 2IMNA 5JHDB 3QUML 5AYUH 3FQWA 3VXRB 4LFHD 1LK2B 1AFVH 3IGAA 3W39A 5TDPA 4WEBH 4RMRA 3C6LA 5HHMB 5EO0A 1QFWL 1JNHA 1KGCE 1X6NA 3VXNA 1C1EL 3MRCB 1MJJA 4J23A 4C56B 3SDAC 1U8PB 2D4FA 3U9PH 3OKDB 1J0JA 3ZTNH 2Z91B 1RZGB 4L3CA 3ILPB 1H3PL 4BJLA 1TCRB 5K9QI 1G0XA 1A6ZB 2ZZUT 2E5EA 5J8OA 3REVB 4QHNB 2P45B 4OAWA 1E4KC 2R15A 4MB4A 4EXPX 3C9NA 2NY3B 1HILB 5HGBB 3QB7C 4XCCH 2VZOA 1NEZA 1YUHA 1P7HL 1XF5B 4HIHB 3OPZH 2FJHB 2IALA 4GBXA 4M8QA 4NFDA 2N1KA 3F5WA 5BOPA 3T2NH 5JORA 3IS1X 1LO2L 3QXWA 1T21B 2JJUA 3RL2A 3ULUD 3KJ4C 3KLAA 3VA6A 1RULH 1FO0H 4NNYA 1ZANL 3U0PB 3G6JA 2X10A 1XCQB 3BPNC 4LSSL 1RJLA 1DVFA 4UMGA 3PL6D 2H32H