3QYFA

Crystal structure of the crispr-associated protein sso1393 from sulfolobus solfataricus
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
271
structure length
271
Chain Sequence
FQGMEVHVCSVGTSLLKNSLDDDNVRKEIERLGLKDWDRLKFDDDRQNRIKENFDSLRKMLLKFIRSKGRRASAELDSLFSTFEKLKHNKSEIYVFLYSTNTSNSQLAGEVIRDYLIEEGIRSELVTVKTISSEENFYEGIVDLFDKVIYRILKFKEQDNEVYINATPGLKPESIFLTLAGLLAGADLIYYKYQEFNDVVILPSPPITIRPKYLDWLIRFAISGYTLSEKRAEELGIPVRLLEAKMLVERKGEDAYRLKDWVRKLLGIYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the CRISPR-associated protein SSO1393 from Sulfolobus solfataricus
rcsb
source organism Sulfolobus solfataricus
molecule tags Antiviral protein
molecule keywords CRISPR-ASSOCIATED PROTEIN
total genus 104
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09651 Cas_APE2256 CRISPR-associated protein (Cas_APE2256)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1690 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3qyfA03
1.10.196.30 Mainly Alpha Orthogonal Bundle Regulator of G-protein Signalling 4; domain 1 Regulator of G-protein Signalling 4; domain 1 3qyfA02
3.40.50.10770 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Hypothetical protein VC1899 like domain (Restriction endonuclease-like) 3qyfA01
1XMXA 3QYFA
chains in the Genus database with same CATH superfamily
4FOPA 2RHLA 3FKSD 2XXBA 5EXDA 1EHCA 1SURA 4H3SA 1XUOA 2IHVA 4MS3B 1R4NA 1EUZA 4WZ6A 5DT9A 5HNFA 4A3CJ 3UUWA 4L57A 3A1FA 1O9HA 1D0XA 2IXBA 3DO8A 3HEMA 3E2IA 3O2SB 1P81A 1SC7A 5LUAA 4D4IA 1EVYA 2IPXA 2A30A 3K0CC 1EIWA 2XUHA 5JT1A 1P44A 4ZVSA 1DEAA 3RFXA 1F4KA 3P2OA 5DHRA 4FU0A 4AZWA 5JAUA 3MYRA 4X95A 3LV8A 3PNSA 4HBZA 5D6NA 1BS2A 4G26A 4MUFA 2FU5C 2WUWE 1R50A 2VDMB 2XIQA 4W9RA 5JSYA 1XSVA 1U5TA 4RVGA 3OZCA 4TQAA 3IPRA 3OM9A 3RVDA 3UAWA 3C5VA 1CJKC 2HLPA 3QX9A 4PS1A 3UHOA 3LRPA 3RGWS 4KWEA 3IR5A 1XZMA 2QLMA 3IT2A 3KQTA 4F6LA 4X66B 1UR5A 5IDWA 3KSRA 1JIIA 2KMUA 2BFFA 3QE9Y 3STTA 3MS2A 2FUG1 1LLFA 4KIWA 5DXFA 3WU1B 1L6IA 4H6WA 3SIRA 3T5XA 1LSSA 1ZY2A 2RQPA 2E5WA 4RC9A 1FUUA 1OI7A 4J0HA 3CUQA 1EUDB 2K2QB 5JHHB 1GNSA 2EC5A 2Z58A 4XLTA 3DXFA 2P5KA 5KYGA 4Q9LA 2I9PA 2EZKA 4PC1A 2J1LA 2JHFA 1R0LA 4PO3X 2ZBRA 3NDBB 3CO5A 3GT7A 1M6WA 3GK3A 4RLFA 2WU0A 2FP3A 3P45A 3EQLF 3LBYA 4KT6A 3PJEA 3QIAA 3VM6A 4B76A 3JS5A 2Z8XA 5J1UA 1OFVA 2OK7A 4Q00A 5C8YA 4P81A 4RZSA 4AO8A 4CN8A 2NUPB 3BE8A 4BH9A 1E20A 2Y9PB 3AP3A 3N3BC 3O4FA 3OTHA 4IIGA 3LSKA 4DXDA 4ESVA 2R9VA 4V2UA 3UB2A 4EVQA 1OYVA 3UAZA 1A31A 5J59A 4J90A 2PQ8A 1GD1O 2QSFX 4K9DA 3WA7A 4JUIA 1DUIA 1CS0A 4BUPA 4LWZA 4NZPA 4Y2RA 3RUIA 1GAWA 2DYKA 4RXTA 2GHRA 4MV3A 3NYQA 3FOWA 1SBYA 2ZNZA 2HK8A 3RBAA 1M1UA 1UZCA 1WVGA 1BN5A 3OYMA 4A3IJ 4C29A 4D3XA 3LDAA 4LI0A 1PI3A 2QPAA 4WVFA 1C30A 2J32A 2FK8A 1HQDA 3G8BA 5FT9A 2YNMA 3F74A 2IV7A 3VTZA 4AJ9A 1RR8C 2AFRA 4MRPA 4F9TA 3FLEA 4BGDA 1BA3A 3A9UA 5C3UA 2OQVA 5DTMA 3PFGA 1NG1A 3CEPB 3KL2A 2UYOA 4HWRA 4IEFB 3V7FA 2WFAA 3MKYB 4BP9A 3HXTA 2ZJFA 2P6UA 5FUBA 2ZRIA 4CQLA 1JIQA 5SV2A 5LLDA 2REOA 3HSRA 4V0SA 4DSNA 1C1YA 1RXYA 4F1WA 4TL8A 5E6RB 4PX3A 2C4NA 3K31A 5C37A 3IV9A 4NYIR 3AG3H 3QA3E 1V3UA 5IX8A 1ECLA 4GYIA 5JVDF 1TMOA 2P3QA 1A9PA 1NXXA 2V9ZA 3EZ6A 4WWCA 1XRJA 3BCRA 2G36A 3GFGA 2NXCA 3EA5A 3OE7A 4MW2A 5JMTA 5NULA 2HV8A 1IM8A 3LK6A 4JIMA 5IM4F 2PUGA 1M8GA 4R8HA 4A6PA 1L0OC 2YQ5A 1L3LA 3AM4A 4O4JA 4TZ0A 5BT9A 5E4YA 3QX3A 1G7CA 3BXFA 3N8NA 2QT9A 3KQMA 1B14A 2JIRA 4BLRA 3MPUA 3VHLB 4G3XA 4MS1B 4QREA 1WXXA 1W47A 5JV5A 3EQ6A 4B73A 2RGNA 4YDSA 2V59A 3C0KA 3KE9A 2VP0A 2C3PA 3PWSA 4KFCA 1ZHHA 3QLEA 4U2GA 1UANA 2W90A 2CQXA 2D2FA 3OA2A 1ZUWA 5IP9J 4AJLA 5JS7A 3PFBA 5KC9A 1HUQA 2XAJA 1F0NA 3KZNA 3VPCA 2LF8A 4PJMA 2M32A 4UTNA 3DKPA 1H6AA 1CQTA 5ECWA 3L7YA 4NNPA 4J6EA 3EXHC 2O7NA 3I09A 1OJ7A 2H0RA 1J9GA 2Y1OA 4MYRA 1H9GA 1J2EA 3M1LA 4KI7A 2OB1A 4R83A 5FQNA 1LW6E 2Z83A 4KOEC 4KQHA 5C4JJ 3ZN0A 3RBVA 1IEXA 3LWNA 4K7JA 2O2CA 3RHSA 1R8JA 3TLAA 3W7AA 1GPNA 5DP2A 3UMMA 1BOOA 2B1JA 1EFPA 1PK8A 2HRRA 1ZYUA 3KT3A 3T7SA 5CEFA 3GLRA 2D7CA 1GXQA 4BJ6A 1AOYA 3JSPA 3WNDA 4AQDA 2IOFA 2EZ9A 4Q3EA 3KSDO 4DS3A 1GM5A 2UXDB 1RXCA 3QPSA 4RWEA 4R8SA 3TIVA 3ZCSA 1GDTA 5FOTA 3RARA 1R0CA 4F71A 2Q29A 5GMOA 1RE1A 2XBUA 3K16A 2GQQA 4NBVA 4O5AA 1ES9A 1GP2A 1TWGJ 2DODA 3E6MA 1RC0A 1U98A 4X85A 2X2PA 1I3OA 3SIXA 3C7KB 1D2RA 2EYQA 4DJJA 2EZHA 4XYGA 4KRYA 4R1PA 1AM4D 2BMJA 2OQGA 3LC7O 4Y9TA 1ZINA 5GGXA 2BGUA 4QGSA 1QTNA 3TZ6A 1ZJZA 2WJWA 1BX0A 2GJSA 1NVWQ 3N28A 4P93A 3TRHA 3EPJA 4CM3A 5EUMA 5L40A 4AUXA 5FKKA 1DOHA 2HXGA 2ZJ8A 3EFHA 4BX0A 4ZMRA 3PUBA 3OIFA 1CY8A 3GJSA 4BNWA 3Q9UA 2FUKA 5FROA 3RS9A 4CUKA 3TKLA 1OIXA 1PHPA 2O6LA 4A8JC 3ZJTA 4P1WA 2V6FA 2IUYA 2JGEA 3TGPA 2IEGA 4OQDA 1IY9A 3U4DA 2GM3A 2CBGA 3MHPA 4UBKA 4US0R 5E6UB 4JX6A 1O9GA 3H16A 3UGTA 1DXOA 1NTRA 1ZD9A 2PGXA 3OX2A 4MVCA 5CDYA 3KVVA 3H0DA 1E2LA 2IHZA 3VNUA 1EUDA 1JHYA 5AMXA 2GRAA 4WLNA 3EFOA 5FKLA 1DJOA 5DLQC 2EBIA 4RB2C 2P7IA 1CUWA 4U2DA 2JJMA 4EW3A 2KIUA 4QG7A 2IH4A 1WXQA 1X2EA 4B6SA 2OZEA 3WODF 1W4AA 3MUOA 1P7CA 1SBCA 4EG3A 5JWRA 4BECA 2Q0OA 3FRIA 1SR8A 2DOKA 4WXYB 4K9MA 3ET4A 4UEWA 2COKA 1U2SA 2ZE6A 3I8SA 3N5KA 5AHKA 3LBAA 3OJLA 3PQ2A 5ALIA 3THSA 4C7OA 2KISA 5IK2D 3L9FA 2FOIA 2WW8A 1Q1AA 3KFXA 4NE2A 5EZHA 2WD7B 4LGYA 4EJ0A 4K6CA 2KPOA 4JP0A 5JLWA 4TMZA 5IWAB 3R5KA 5DBOA 3ORSA 1CUCA 4OQEA 5KSYA 1YO5C 3V6MA 2P1DA 3C1AA 4O33A 2GD6A 3OZUA 3CCLI 4B79A 5CFLA 5BQTA 3I2KA 5DTJA 3GB9A 3G5AA 4Y67A 5JG7A 3VUFA 2I87A 4AJHA 3F3YA 1YS2X 4FQ7A 5D7BA 5EAIA 2ADOA 3QITA 4G1VA 4CHUA 3IBYA 4B8ZA 4NBKA 4QXAA 2WIKA 2PAFA 2MA3A 3H1BA 3VGJA 1PGNA 2UUCB 2CYAA 4A16A 4W1UA 2UZKA 3NW9A 2RBEA 5BYJA 1TM5E 2QRLA 1D1PA 3MRTA 1S8AA 1H5UA 4I5GA 1PVOA 2L2QA 3ROTA 3W5BA 1V4RA 2PKYX 4BKUA 4CA0A 1O54A 2H85A 1VJ1A 1Y1TA 2CMKA 3OIOA 2QY6A 5LCXA 1OX5A 2WG1A 1BJRE 5IWCA 1P5HA 1WD5A 1XLWA 1U6IA 3ZKAA 2K7FA 2OVBA 2JRCA 4JLPA 1V1MA 2WHPA 5JCXA 1QRTA 3AFMA 3N2GA 4A6EA 1DEOA 2AX3A 2YXBA 3O26A 3L40A 1BXRA 1TE2A 5DM6F 1DAPA 3ENQA 1SVMA 1XZEA 2YS6A 3GJXC 1ID1A 5K5OA 2WSSA 3TUZC 3TI9A 3UJBA 4CKBB 2PL3A 4FYXA 2QXYA 5K20A 2YSRA 4TXMA 3U3OA 3VYUB 3K2BA 4XLAA 1PN3A 1V3VA 1YWGO 1ZZGA 5DYIA 4RHUA 4QJ3A 4TWAA 5AVXA 4MPJA 5JSQA 3MW8A 2MMCA 2A2ZA 2ZI9A 3EG9B 3EVTA 1OROA 3DBOB 3CZ9A 3P27A 4Y1RA 1RRPA 3CCEI 1MDFA 2KRHA 4POAA 4IMJB 4NICA 5DD4A 1D6MA 4LDJA 2WIAA 1QSGA 2V5UA 3WHKA 4XSGA 3KZYA 3BTLA 2OP1A 3ANLA 1FFBA 1WDMA 2M6RA 2C2BA 1O8CA 1RD4A 2J46A 3G9QA 3IHWA 3TIIA 1TQMA 4MAMA 2J0UA 4DDVA 1Z2NX 3ZMZA 1JHHA 4DDUA 4LCJA 1DHTA 1EFCA 2LW7A 3D6FA 4Q4LA 3TNDA 4A73A 4DV3B 4XWYA 1PDNC 2YWRA 3MRSA 4F5ZA 4OFZA 2GZMA 5FLXZ 1P2VA 5F4ZA 1U0RA 3C3DA 3JV7A 3NHYA 3S27A 4OJYA 4RVSA 1YJXA 4EJVA 2FCAA 1SBIA 1LVKA 2I1VB 1XEWX 2Q3MA 2XZTA 2DU8A 2QMHA 3A3KA 2AI3A 3WGGA 2OO5C 4P5DA 1KJIA 4HYQA 3KU4A 4V0KA 4YRQA 5E6SB 3VNSA 5I7RA 4HAWA 3TOAA 3OX3A 3RSZA 3KZKA 3QMMA 1M34E 1VBMA 3UEOA 3KV1A 2O7QA 2ADMA 5FLMJ 3A4YA 3KJZA 3REQB 1DKNA 1DQSA 2EBZA 1C4WA 3SYMA 5BNGA 2ZRLA 3RSCA 1L1EA 4CNBA 6AT1A 3ZMTA 4N5HX 1MH9A 4Y30A 2Y3IA 4QTXA 4IUDS 1ZAOA 1GY8A 4GZ5A 2A67A 2QW1A 1XTBA 4LECA 4XB2A 4D5GA 3KQQA 3L79A 4CL3A 3ASVA 3ZMUA 2PH1A 3O31A 3Q98A 4UNQA 1S2NA 2Z4RA 2MD5A 3SCZA 1SD4A 4MQ9F 3DNPA 4TROA 4D7AA 4KVAA 1ZIYA 2XW6A 1T4GA 2CWEA 2A6PA 4RACA 4CFYA 4EB6A 3FNFA 4KO1S 3WIBA 5JMWA 1NI5A 1T3GA 1OLUB 3FVRA 4JEUA 5FB3A 2ZJ7A 3VYTB 1KY5A 2QD4A 3PFHA 5F4BA 1DAKA 4AKEA 1B4DA 3T7CA 4HJRA 5IKMA 4KMMA 4PG4A 5ILOA 5JAZA 4RTNA 4RAGA 1SOUA 2A57A 2G07A 2VQFB 5AVOA 4PO1A 4S1VA 3H36A 3W6VA 2O8DA 2VRBA 4XQCA 3H3XA 2IV3A 2OZLB 3GFIA 3NV7A 2XWJI 4JKYA 4MHGA 4KXYA 1NATA 5BQ5A 1SUDA 1T5HX 4E6KG 2DECA 4NMXB 4B4KA 4A0YA 4WINA 3FDYA 4EX6A 1ZK0A 3LVRE 5HS7A 821PA 4I99A 4ADSG 2XDQB 3C3EA 4US2R 1ECJA 4YUXA 3MQ0A 2I3ZA 3KQNA 1AQYA 3WOHA 2B4YA 2NUTB 2X13A 4MIYA 3BICA 3V1MA 3P9IA 1S3FA 3CLTC 3PU6A 1E2GA 2XSZD 5C51B 1P1JA 3C18A 3WTYC 2QD1A 2BBSA 1RAAA 3AV3A 2FUG6 5F35A 1QIHA 3K9QO 2CNBA 4U5QA 2V3CC 3GL9A 4NONA 3ANNA 2PFSA 1JL3A 2Y1KA 1DXYA 2OV4A 5BR1A 1AHPA 3LTNC 1RQ2A 5LU9A 2XYQA 3PKZA 3VDRA 3NEPX 3IUYA 1GPDG 1TWHJ 1YR3A 2W2PA 3GUVA 3R75A 3TUJC 2NS8A 1OY1A 2A7XA 2R47A 1NBMD 2VYCA 3FPLA 3RYRA 4MI3A 4Y6PA 2GAUA 1IDOA 2B30A 2X19A 3L0PA 4XPIB 1SC4A 3ZQLA 3HVHA 4QSMA 4QFBA 4S3MA 2HWUA 2FKAA 4MVJM 4TXHA 3EQ7A 3F97A 1O8BA 3OS1A 3H19A 1I7SB 3VSKA 4EM2A 2DUWA 1PW7A 1G20E 2NPIA 2NU7A 1JUSA 1JT9A 2X8BA 3KOOA 3GEDA 4LVCA 5BMZA 3I0NA 1FP4A 1TFRA 2DQ4A 2QLNA 3O4IA 4Y3UA 3W9SA 3ZV4A 6ABPA 1LWOA 4FINA 4X3CA 3WU2C 4PIMA 3LCCA 2UUPA 1UK7A 1P3Y1 3I3OA 3MC1A 3F3MA 3CMMA 1I32A 4RAQA 4FR2A 3OUUA 5IUKC 1OASA 3UMJA 4MDHA 4Q37A 4D4KA 4DUGD 4FR5A 1SVNA 3G59A 3B13B 4KXQA 3OC6A 2A07F 2DBVO 4HB2A 4DLZA 2IOFK 5DS9A 3H1FA 4QXQA 3M8JA 2F3SA 3I6ZA 2IQIA 3WQBA 5CDUA 4J1SA 4BNIA 4IJ5A 1MFZA 2Y1CA 4I4IA 4EI7A 2Z1DA 1DBSA 2JFZA 1KQ8A 1I2MA 3U6BA 5B3KA 1N9ZA 3IP9A 3CH7A 2BFAA 3AB3A 2XODA 4WSOA 3D9QX 4DMRA 1SXGA 4BNFA 1EBUA 3R6WA 3LFHA 1ETYA 3OY2A 2GUWA 5K5EA 1Z6TA 1MX3A 2FX5A 2H31A 5CIQA 4YC7A 2G4LA 5T4FA 1BTOA 5IXYA 2AHQA 4BXXJ 1Q2XA 3RAJA 3O8RA 4TN1A 3HACA 4JYZA 1VHQA 3D7KA 4DSZA 2A14A 3JWHA 1MNEA 6Q21A 2QTHA 1EFRA 1U3CA 1R9MA 2GEFA 1CQXA 2HKXA 1SG9A 3T6KA 4QBFA 9LDBA 1PBTA 5F1RA 1PS9A 3RS2A 4WFQA 1G2HA 3LA7A 4LC1A 3RYIB 5E3IA 4WK4B 4AURA 1KYYA 1XTSA 4J94A 2WT4A 1HFEL 5HDQA 1ONNA 3IESA 4H18A 2P0EA 2P8TA 3LE8A 3KZCA 3MUEA 3UGQA 5DMHA 1Y7LA 4L4ZA 4ZT7A 2R751 3CQ9A 1QJCA 3ICVA 4BNUA 3PRHA 5A1TA 1X9IA 5LEKA 4LZAA 1K86A 3ZTWA 1SUAA 2ZRQA 2PFBA 3BQ9A 3TBKA 4BNTA 4CIVA 4NJMB 1PNQA 5TVKA 4KAJA 3IQIX 4BZZA 2C5AA 2OTLI 1XRPA 3TEDA 2JRLA 2HM7A 3ENZA 3HB7A 2RKWA 4GFBA 2QPLA 1ECGA 4DLWA 2D1YA 1GYRA 2O05A 1SG6A 3E03A 4M86A 3V1YA 2II6A 4BGIA 4PVDA 3MJSA 3ZQ7A 2E2HJ 1HA8A 4LDAA 1AY0A 2QVCA 3P0EA 1K7EB 3DF7A 4QUAA 4BTLA 4UJ3A 3OOHA 4R01A 5GV8A 3K4LA 3W6JB 3K4QA 1GKIA 1OCRH 3GLKA 2EA4A 4Y0VA 4AJOA 1RM5A 2WJJA 1VCOA 3EW9A 3H9CA 2G9QA 3ISVA 4OB7A 4TOIA 4YCMA 2BP7B 4NFLA 3QODA 3A1UA 4M76B 4D4GA 5T3YA 2ZBDA 4N76A 3PVCA 1ZDMA 3W5CA 1CC1S 1VP9A 3OPXA 4AF6A 2OECA 4G8CA 2WWFA 1E0KA 1VRWA 3EXEB 1I1NA 5CTJA 2GF0A 1WQ4A 4MKIA 4YRCA 4DLRA 1ZRSA 5ILUA 3EIHA 3X1XA 3ZDAA 2Q50A 2PRYA 5AWFC 5LA6B 3WLAA 1N33B 3PNKA 4C22A 2KIQA 3PCTA 2QVXX 3DR5A 4IH4A 4UFPA 5KHAA 1E1YA 5ALOA 4MI6A 4FC7A 5K0SA 5EWMB 1WHTB 4YIFA 1WU7A 1XTUA 1L5YA 4EYEA 3V1KA 2PSHA 4UU8A 3BY6A 3NVKI 521PA 3RODA 2O8DB 3OETA 1W36C 1U0GA 4FTWA 4QOIA 3T38A 4P7KA 4RKFA 1NT2A 1RWNA 1P4SA 3N74A 1FLVA 3KZIC 2HIAA 2E4AA 1IY8A 1IPHA 4NAHA 4HYTA 4ZVVA 4CU5A 3BGVA 5AVZA 2HHHB 3A6JA 2AR9A 3FF1A 4IJAA 1EX7A 3D1NI 4XKJA 5ARCA 3R7WB 4BMSA 1L4LA 4D9FA 1Z9CA 4EFMA 1W5AA 2EQ5A 4UM5A 5FLKA 1YDEA 4RA6A 4JFRA 2GJKA 1THZA 2QAGB 1JECA 1XL1A 1W0KD 2BGLA 2ZWPA 4L8VA 3WLNA 2BLLA 4CYCB 1JDPA 3IDAA 3MTDA 3TVYA 1M1NB 2JARA 5D86A 4KO2S 4GMGA 3DM5A 1C7QA 1NVFA 5JFOA 1LFDB 4NCBA 3Q1KA 4HDUA 3E8XA 1IZZA 2AHRA 4HPJB 4BRWA 4Y9SA 3TM5A 5ECYA 5JSZB 3SF8B 3DLTA 1TWCJ 1ADYA 4GT1A 1QHXA 5FUWA 2O3RA 4XLCA 4A3DJ 2NVWA 4HZGA 3FWPA 2HBRA 3COYA 4HFJA 1WUJS 5LZ7A 5IVHA 2ZYSA 1DO2A 2IIVA 2BBYA 3NS7A 4TVBA 1Z7YA 3QVWA 1RXEA 4C1BA 3IAS2 2QMUA 2PEYA 2WWYA 1G8AA 3NB0A 1TTYA 2MSDB 3CRQA 4MJXA 4WERA 3WHBA 1C4XA 2VHWA 2VF5X 4ON9A 2MG4A 2GIZA 1CHDA 4LV8B 3UPUA 4R8VA 2PEZA 4TM8A 1KU7A 1YMUA 4CKCA 1NMYA 2W8BB 4HZIA 4XD7D 1EFLA 4LIUA 4FEYA 3KE8A 2LWIA 4QC2A 4XPZA 1KYQA 1VOTA 3HKCA 1P3JA 2HSDA 2RONA 2A9PA 1FU8A 3P2MA 4JFAA 4OHCA 4XLEA 4PYNA 3VSEA 4AC9A 3IH2A 2R6R1 3TWOA 1SQ5A 3B9RA 3USCS 1WKBA 2NO4A 2Z5FA 2JJ7A 3JALA 1KA9H 3L6BA 2R8PA 1BW9A 5AP9A 1PLJA 3U7RA 2VONA 5DLYA 1T9AA 1FW6A 1W88B 2GN4A 1LPOA 3BFJA 4YO8A 2IWHA 2H8GA 2RV8A 4LB6B 1SM4A 1I10A 1JIJA 1U9NA 1LVHA 2VOPA 1X7ZB 1XHEA 4X20A 3ABTA 2FZ4A 2ZIXB 2WTEA 2AE1A 2WWWA 2C8JA 1CEQA 3PQEA 4I9FA 4N65A 1SRRA 5C1IA 4BBZA 4D9HA 1LY1A 3GVXA 3HBMA 1ISHA 3NHPA 1FBUA 2PMHA 3QYPA 5F73A 5I7AA 4NOKA 1XXHB 5HF5A 3ZOKA 4IO1A 2WA0A 1LTHR 1NZDA 2VH1A 3FCEA 3OOWA 4L5AA 4YJHA 5AYVA 4E30A 3E3MA 5AKIA 2CS3A 4ZT2A 3L8MA 4PGFA 4AG5A 2P2GA 3IUQA 1O0BA 5E3OA 1S72I 2HO5A 1TYAE 2HRZA 3FYDA 3GUHA 4U0YA 3KHUA 3KZOA 3SDSA 4B45A 5HRCA 1Q1NA 2VXDA 5KCMA 2E82A 1DWOA 1NWHA 1ZJJA 2HWWA 4B7AA 4MWSA 2GKOA 2X2FA 3DDZX 4QJIA 3SP1A 1T4MA 1OFUX 4PHFA 3MJRA 3IAHA 1UBFA 3G0GA 2ZSFA 2R1TB 1N92A 1XN4A 2HIHA 3H84A 3ECHA 3WY9A 1D2HA 4HDOB 1SCKA 2BM1A 3NNSA 3EEFA 5CAEA 4XX1A 2LKXA 2CUJA 5FJ8J 2WUEA 1K66A 1UBKS 2QG6A 5F04A 3DZJA 4DILA 2NAZA 3ILHA 1MJBA 2WU1A 3BORA 1Q21A 5CJ9A 1EZTA 2C4HA 2YJGA 1Z3XA 1J39A 4HDMB 1IN7A 4MWTA 4KNYA 3KXKA 4PSDA 5LN1A 3QU7A 4WMLA 4M9SA 3AJ8A 2O0YA 1RYMA 5J5AA 5JARA 1WXHA 1ISGA 5J6XA 2BEVB 3ROZA 4HZUA 2GUGA 4EHHA 2EW8A 2I3GA 3UWSA 3HXKA 3VPFA 4P82A 1GCAA 1NURA 5TISC 1X2BA 2WD7A 2Q6VA 3LNTA 2EP7A 3NPMA 1I2DA 3OLZA 4NBWA 1JJ8C 2RHJA 3O6VA 2ODEB 1SVUA 2AG5A 1U9YA 3BG6A 2GO7A 4JLBA 4N7RA 4YIKA 3ZYZA 3H2ZA 1UELB 1LK0A 4H7KA 4JJ6A 4EEFG 4XDHA 2OZ6A 2FMKA 4IFTA 2FW9A 4WOKA 3FR7A 5IKOA 3F6CA 2XJ9A 4ZEXA 3RYHA 1TMGE 2ZT5A 3D5QA 4MVWA 2PLRA 3U2RA 3OYJA 3E84A 3V7WA 4EJTA 1E64A 1NQXA 3DUWA 5KOJA 4Q16A 5K3AA 1Z0XA 4WBNB 1WQ3A 3KL4A 2MMGA 3CUOA 4URHA 3G2OA 2FNAA 1VQ8I 5B1HA 2DKOA 3JCZA 2WB1N 1NYRA 4EG4A 3L8DA 5KYWA 3REFA 4MA5A 1XEAA 5D84A 4IIVA 3RSHA 3SXUB 1OA0A 4UNSA 2Q4TA 4L8YA 3GGJA 5CDFA 4DTCA 2G8LA 3N0XA 4ENQA 4LHYA 4MZDA 4EK9A 2M45A 6ADHA 4D8VA 4LFBB 3KPHA 1P31A 1DKQA 3Q1LA 5B6IA 3F3SA 2G63A 1UM8A 1S7CA 2C5BA 4GYKA 4LYJA 5CGZA 3WGMA 2XGJA 3S2IA 2EU8A 5EZGA 4DJAA 2I1LA 4Y2GA 3FXMA 1O3YA 2KL4A 2PZAA 4WEOA 4ZI5A 4EQ6B 4WOCA 4GX5A 5L4NA 2RGUA 5GIOE 2CQKA 2EEPA 5CDTA 1O5OA 2P9QA 2WD8A 1P0FA 3CWCA 3N2EA 4U9HS 1U5TC 1U9CA 2EOAA 1TAHA 2IPAB 5HE9A 5PNTA 3VZSA 4OO3A 4TRRA 4D3ZA 1Z33A 1W0TA 2ZIFA 3PL1A 3RPUD 3DU5A 5EEGA 4JJ8A 1ST3A 4JB3A 2BOLA 4O25A 4UMFA 1RVV1 5L51A 2PKWA 3B5JA 3EGOA 4JB0A 2BHZA 3AGQA 1JR2A 1VJ5A 1KJ9A 5DI9A 3PIIA 5B3LA 3RI3A 2QW0X 1VE9A 3ASUA 2FZEA 3PUZA 3IV7A 3AHJA 4KIJA 4QDZA 2IEZA 4XM1A 3STUA 4RBNA 3CUWA 4X6LA 2RDPA 2R8OA 4I66A 2IOHA 1Q0LA 2R93J 1XQ9A 1Z29A 1FZPB 3HSFA 2OBXA 1U80A 3J80K 2XUAA 4GEGA 2MH2A 4FBGA 3NHSA 3FA2A 1HORA 4HNVA 3MGCA 2RI6A 4QASA 3QFTA 2HRQA 3GFJA 2R1VA 3OEED 2ACKA 2OF7A 1CF7B 2B7LA 1PDOA 3DHNA 3OFVA 5JXJA 2AN9A 3BT9A 4QECA 4BGUA 5ITWA 4FX4A 4K1XA 1UG0A 5KYXA 2V7QA 4M0UA 3U1VA 4DYDA 3HO8A 4EFNA 1B1CA 2EYUA 4KG7A 3FYSA 4RPJA 3JSOA 1P2TA 1XZJA 3F8BA 2AFHE 3NKLA 4KDFA 4PFKA 1YR9A 3OS0A 3BHNA 4E46A 4XBFA 3I2FA 5DX8A 2ZPUA 2E3JA 3AM3A 1JYSA 2HDNB 2YY7A 1HG0A 4EYQA 2FZCA 1QIDA 2ZYWX 3PUVA 3T5BA 2HK6A 2Y1DA 4WLFA 4FP9A 3RC8A 4FZVA 1VHDA 4K28A 5JVDB 2IDJA 2X0DA 4MR9A 1AS0A 5D3MB 3MJVA 5BV8A 1F8YA 4IGFA 1E6EA 1V45E 1B26A 3LX6A 4HYYA 3ZRGA 2RC4A 2CGPA 2C4TA 3P9QA 4FGKA 3D8NA 4BMNA 3AM5A 3RIRA 1YRWA 4WHMA 3LSHA 3UWPA 1I1HA 2DBRA 1XQ6A 1LE8B 4I09A 1FBQA 5M5WJ 1QO9A 1ZOLA 3R09A 3PK0A 4FFOA 3TB4A 1FXUA 2FCRA 3T94A 3V9AA 4MQ6A 5CB4A 1IHPA 5HW0A 1MHTA 2PI0A 5GADJ 1IY2A 2I6QA 3L06A 4FT2A 4R0VA 2ZYTX 2OOKA 4B3XA 4N5IX 4MHOA 1R6XA 4W97A 4QO7A 2G9NA 1EP9A 4UUOA 3V7NA 1Z5OA 1V95A 3BTOA 4F91B 1PBNA 1PJ4A 2OV7A 5DM1A 2BF4A 2WSIA 5C7IO 4CLEA 1XPRA 1L5FA 1RYYA 4B6OA 1DS6A 1A6IA 1R0KA 3D2AA 5BW5A 3C7DB 3IP8A 3NYRA 2ZMEB 1AXRA 1W94A 4FXPA 4QU0A 3SR4A 2A58A 2Q62A 3PD0A 4R8KA 1B72B 3BJEA 2GBYA 1HA3A 2C77A 4GAEA 2DHQA 1M5TA 3EZLA 3SXYA 4GH5A 1HDEA 2C7VA 1W4ZA 2MGQA 1CQIB 1U0NA 1Y63A 2O2HA 2V6EA 1HBJA 5CCEA 5BSHA 4OGLA 1P0QA 1XMQB 3NTXA 3DE1X 3B1JA 2EFNA 3ECOA 3HSKA 4EFDA 1YR6A 4OVKA 1XU7A 3FBGA 4IDHA 4RW0A 4QAQA 3PDIA 4PHCA 3LSMA 4CCLA 2B63J 5JSUA 2DJIA 2HLDD 4N7BA 3I8XA 2R4UA 2VTVA 3CT6A 2VXBA 3NM5A 3NEUA 5E2BA 5F7OA 4BMYA 4RHCA 3KQLA 2ZXIA 2XWBF 2X0EA 3K09C 3WL3A 4Q03A 4ZQIA 3V8QA 2C1ZA 3CX6A 2FA9A 2O03A 3K1MA 3AJAA 4HQOA 4C7MA 4E5VA 4ND7A 2ZXUA 2NMVA 1XZDA 2HN9A 4LD5A 5FUYA 2ZE7A 3OQIA 4M1OA 3V4RA 3RIXA 5TY0A 3HJNA 4S0XA 5CBPB 3TKYA 3V4GA 2HQRA 4ZIRB 3PSAA 2WAQA 4K2EA 4MRNA 4JI1B 5DZSA 3GEHA 4PYQA 2BW3A 2EBWA 2Q9AA 4X92A 1JHZA 4PC7A 3L4SO 3E7PA 4DCMA 5JCPA 4KLRA 1HLPA 1JKJB 5BNTA 1G1MA 4HB4A 2E60A 2ZJ1A 4G5SA 2JPDA 2NUAA 4LZJA 3OZEA 3TF5A 2I9KA 3CX4A 2MR6A 5EQTA 3GGOA 4L4XA 1XX6A 1RMQA 2V7UA 3AUJB 1GPYA 4GWKA 1KZ1A 1ZM4A 4JLDA 3ZE1B 4OMFG 4FYWA 2F4NA 2YYYA 3OQ6A 1YB7A 3AZQA 1VG8A 3VU9B 3V3TA 2OCXA 1QBJA 9LDTA 4PJJA 3S0JA 4X60A 3EOAI 2PBRA 3RBXA 1DRVA 2QUIA 2Z30A 4KE9A 4L50A 1TT7A 4BV2A 2ZI5A 3JSXA 4RAFA 3C2BA 4YREA 3HDDA 1VA5A 5EMHA 3USZA 5B4TA 5HE8A 1Z2AA 4LISA 3UT6A 1JBQA 3AQIA 4M55A 5DH9A 5A2GA 3BWGA 3W06A 1MR3F 2GD2A 1RI4A 3DMFA 4I7EA 2PWPA 3P0RA 2XUOA 5ALNA 2P27A 1PLLA 1W35A 4B4WA 1TPYA 2W85A 1UT8A 1P2GA 2Z98A 2NRAC 3FNGA 3HXMA 1U9ZA 1E5TA 3HYLA 1XDZA 1KFBB 4L18B 3I5MA 1MIHA 3H35A 5J63A 5ELLA 1Z4PX 3BL8A 4XRRA 1RHKA 2F59A 2AF0A 2CMGA 4JBAA 1AV6A 4TKVB 3CSUA 4KICA 5TQVA 2XITA 3FM5A 1XTRA 5FHRA 4ZK2A 4DR4B 1OYWA 2Y66A 4A3LJ 4GM4A 3KD2A 5EKUA 4FB4A 2QUJA 3AF3A 5EJ9A 5IG2A 4I0AA 1W49A 3QIVA 3LCUA 2ZRCA 4CPDA 1X92A 1EF4A 1PFWA 2B8NA 2Y76A 3P32A 4RGBA 3FWHA 1JXAA 3IULA 4URVR 4CNQA 3I1JA 3IH3A 2VZEA 1XK6A 4DCVA 4XJVA 2O5CA 2NM0A 7REQB 3FCOA 1FBSA 1XNJA 3SLGA 1U2QA 3C6KA 3PR3A 1YTYA 2BGKA 5EL0A 3V32A 3OMXA 3ROUA 1RAIA 3DPUA 2BE9A 2Z57A 1RXIA 4HNGA 1BVRA 1W2HA 3QJYA 3SBEA 3TVTA 3L0BA 2CG4A 2Y0SA 2AG1A 3IEPA 1VYVA 4M9QA 3NT5A 4QICA 5K0FA 4UBOA 4OHXA 4I1VA 2AMFA 2G70A 2XBMA 3N05A 3EC1A 1C41A 2C5SA 2E4YA 3IXQA 4B43A 1E5VA 1FTSA 3B6KA 1J22A 4S0ZA 1YI0A 4KMFA 1EJ2A 3FM3A 1P4JA 2ZUCA 4PRKA 4DLLA 3GJ7A 4AU7A 2C7BA 2FFQA 4L9RA 5MGBA 4QTTB 1M0WA 1Z4JA 3TIGA 1P80A 4II3A 1WVRA 1D8AA 3AZPA 5F64A 2SHKA 3G9UA 3OHSX 4QGFA 1SUCA 4FISA 1YASA 2B9EA 4ZFNA 1ENYA 4ZYAA 5KSWB 2HVSA 2D1QA 2JFYA 2HMSA 3K4PA 4FYHA 4YONB 5BNFA 5JECA 1WB5A 1NG7A 2BELA 2EZIA 2IZ0A 2H8RA 2QX6A 2VF7A 5BPDA 3PIPF 2O4UX 3DG9A 3FJOA 5A03A 3ABKH 3ZN2A 4R3NA 4QXOA 4KDPA 2JGLA 3JTGA 3EIQA 3ZU6A 3O8BA 3RSQA 1NZFA 1U7ZA 2HYIC 4OTZA 1CRWG 4ANFA 1EM8B 3HU3A 3KHTA 5K6AA 2PO7A 4G25A 3ZIAA 4CQMB 1XTQA 4NWIA 4TS3A 1Q1ZA 2OO7A 5AVSA 1R5JA 4C30A 3PGVA 3A6LA 3FAKA 5E3MA 2PLNA 3UGKA 4ENWA 2IZ6A 4DIEA 5HFAA 3A01B 1SCUA 2K3FA 3IALA 3G2PA 2FW7A 4J2HA 5K2MA 4CM9A 4EJ6A 3MBKA 5AW3A 1EDZA 4BVHA 5LL6P 3PR1A 3QW2A 4QGGA 4D3YA 2QDKA 3L7CA 3GHHA 3A1YA 1Z5NA 4PAQA 4HNAA 2ZRGA 1IDN1 1Q1EA 1SUBA 3AY6A 1E7YA 2VDQB 3C3CA 3EEBA 3NHBA 4FN5A 4GLJA 4MQEA 4UU0A 3DVRX 4YP0A 1N7IA 3OFJA 3FK6A 1JAXA 4Y2XA 1S5LC 2PTGA 3RU9A 1ECPA 2QN3A 4CCWA 1U9OA 1BH2A 4AIIA 4NC8A 1C2YA 1HMPA 1S2OA 4MPRA 5JD4A 5I6DA 1KONA 3QU5A 3CP8A 2K4JA 3DXZA 4NV3A 2CMDA 5IAOA 4EQQA 4BX3A 2F17A 1M34B 2OCPA 1C9NA 4GKAA 3WIEA 3U61B 1L5GB 4EDHA 1A6QA 3Q0UA 2C2XA 4IXAA 1AS3A 2FN4A 2QNBA 5B3JC 2H07A 2WV1A 1D8KA 1QR2A 2LRHA 4FD2A 4XW2A 3RTBA 1K9VF 1MJ5A 3KZXA 1Z68A 1HM5A 2JNUA 3I6YA 1FYVA 3GDOA 4R2WA 5HK9A 1A7AA 1TLTA 3NHZA 3TLJA 5JFGA 2F8LA 4Q9NA 3FMSA 1UJMA 2G1AA 4RZXA 5JS6A 4RL4A 3CF5F 2AGVA 2MSWA 3O73A 3DULA 1SHZA 5D5UB 4TSKA 5EMNA 3WWYA 5AVKA 4BCCA 1RWBA 3T61A 3DM9B 3QLUA 4BPRA 3FROA 3QPHA 1V96A 1R4MB 3FGPA 4QEDA 5HWSA 2X85A 2H06A 2YV5A 5L4SA 1AUPA 2UYQA 4XLPF 2P2NA 3O8NA 1ICEA 5BNZA 1V39A 2W2KB 4O0LA 4TTVA 3HPQA 2JGJA 2GZWA 4KO8A 1GEGA 5DM60 1GUBA 4M73A 4OAZA 1YNSA 1JLLB 2RKBA 2BKUA 2BEJA 5J40A 2PD4A 4HAIA 4MQMA 3C7LA 3OZXA 3AWDA 1SCAA 4I55F 2B7EA 3NP7A 1US8A 2JI7A 1O03A 2IYXA 4MFDA 2OOSA 2RB4A 3GAAA 2ZDGA 4HEJA 5L53A 4I46A 1AH2A 5G53C 1JILA 1K63A 2OCDA 4CG1A 1UBUS 5HLGA 1U0FA 2IRWA 3DPIA 3QQ5A 3STVA 4AJJA 4CM9D 1DC4A 1EEXB 4ABTA 2ZLBA 3WOVA 1MQSA 1G291 2JUCA 3BMQA 4RQAA 4X64B 4PV7A 3DE5X 4C08A 2BFBB 2GPJA 3WLLA 3OJFA 1WHSB 5H80A 1GZDA 1Y5NA 4PEVA 5FEMA 1ZOIA 3RVJA 4XVCA 1DADA 3D0KA 2JVGA 3OYNA 2D1SA 5E95A 4ZU6X 1CW2B 1K6YA 2AOUB 3BZ6A 3CJNA 2BZTA 5HS8A 3MZHA 1HKUA 2WT8A 3FXUA 2X23A 3DR3A 3I4CA 3CNLA 1UXHA 2O0HA 3QVSA 4HR7A 4KXUA 4OU0A 3RKYA 4NPAA 4UREA 2VH5R 4H60A 4X8MA 2RE8A 4Q3CA 2PMBA 1N8NA 4A8PA 4BLUA 3OQOA 1FDTA 5FULA 3SLRA 5JD3A 3QELB 1V54H 4KMRA 2OHFA 2GPYA 2AFHB 2GAFA 4MEYF 2W43A 2C04A 4HWKA 1Z77A 2YYAA 4YYEA 1HGXA 5AW7A 1RQGA 1K75A 1U0TA 1UWCA 4EKDA 3DH0A 4QVGA 3PC4A 4YDRA 3TZEA 1Z3YA 1UM9B 2XV4S 1VGVA 1JH8A 4L9WA 1HDOA 2W2LD 3ZWPA 2JIMA 2XRLA 3DV0B 3LC1O 2JDIA 2OKCA 1EG2A 3RJZA 2HBQA 4MGYR 3O83A 3JRGA 2V1DA 1R3UA 3NEYA 3QYFA 2AEEA 2VP2A 2AEJA 2NQTA 2BVMA 1T4CA 3AOEA 3BG9A 3QHAA 4QDXA 2DH6A 1RI5A 2YIMA 3OWXA 4RQUA 3C8DA 5LIPA 2ZKLA 5JD6A 4PN7A 1I3QJ 2Z8YM 3A3OA 3OJ0A 4PC6A 4PSUA 1SIWA 4Q1BA 3ZR4B 1CETA 4EEZA 2PRZA 4QEKA 3S2UA 2BDEA 5C31A 2V8OA 2CD9A 3O7WA 4FGLA 4CTJA 5JQGB 2DG2A 2R7SA 2HDWA 4D26A 1EEHA 2IC5A 4IWNA 1ZMRA 3AF0A 1ZRDA 4YJ3B 3U6KA 5EIHA 2GHTA 3HLKA 2AC2A 2BFEA 2A94A 4TL6A 1N25A 4OUKX 5EA2A 5C7YA 3IDZA 3U0BA 5KJ6A 4JQFA 3HCPA 5JNVA 2VNSA 5FOXA 2NT3A 3QNMA 4EJ2A 2ECBA 2N1MA 2NGRA 5TMPA 1F14A 3CMAI 3IMFA 4BJ6C 3BDAA 2XQJA 5LZ5A 3KDAA 4EQ6A 3ESBA 1VI5A 2M0MA 4XR9A 1Z9BA 3A6PC 3FWYA 2R62A 4AJNA 5J2TB 3CP2A 1JXOA 2BFDB 2EGUA 4QAJA 3VR2D 3VPBA 2EJWA 5KNDA 4U7BA 1X3LA 3M6WA 5DGIA 5KB3A 4W5NA 3R23A 1RAGA 1JAYA 4MRAA 3DOIA 1GNTA 4R2HA 2F7SA 2QXTA 3V8BA 2YJTD 3CIFA 1Y4DE 2C00A 1C7JA 2ZSHB 3DTTA 4EG7A 3GLLA 3PIOF 1HYEA 1XZGA 4HB0A 3EVAA 1USIA 3KXIA 3O3NB 3A4NA 1AN0A 1VBNA 2JI8A 2XMCA 5EZ6B 1YI2I 4AN1A 1IG3A 5LYYA 4JV5B 3CF4G 4KQFA 3W7BA 2ZJQF 3ZXUB 3D7MA 4QM7A 2X4DA 2I29A 4KWCA 4OQFA 7MDHA 3RYHB 5F2EA 3CLKA 4A2QA 4MKGA 2V45A 1VFCA 1Y33E 2EKBA 4LJSA 3ZLBA 2IYLD 3G13A 5TARA 1GRNA 1YE8A 5J4YA 1D6NA 4AP5A 1X86B 2WJAA 1TP4A 1NW7A 1YRQA 2J45A 3BVPA 3ILVA 4MWEA 3TL2A 2UYCA 4YFKF 5KS2A 2NADA 1Z6QA 3UCEA 3FDXA 1KQPA 5KYXB 1D3YA 5LHGA 1J07A 3LK7A 1FMJA 3NNNA 4YWJA 2N9UA 2Q3BA 3EETA 3D0SA 1SKYE 4LWPA 4JYMA 2PFGA 1OIWA 2Z4SA 3DAHA 3WGYA 5JWOA 3NYIA 3VZRA 4K6MA 4D4JA 5ALHA 3BHIA 2H7CA 1KY3A 3WAJA 3HTSB 4TVOA 4HLNA 3K2EA 4FX2A 2IU0A 4AJ2A 1U9IC 2QWWA 5J5CA 3S1NJ 1VE6A 4W63A 2ZEJA 3H42B 1ORKA 1D1BA 1NLZA 4RHTA 7YASA 5K51A 4X65B 1YJCA 4FCWA 2XKPA 4ARIA 4NZMA 3EGDA 2EERA 3Q11A 4P3NA 4YALA 2LKCA 4EMUA 1P39A 4LKRA 4PC2A 4MITA 4XIFA 1NVVQ 1K3FA 3EEIA 4LSGA 3X1JA 1JA9A 5DYNA 3ZNQA 2VJLA 2KJBA 3T3DA 3OCXA 2ZTUA 3Q3EA 3HUUA 4IJMA 4MYTA 5FORA 2XPUA 1RWXA 2ZVDA 3TP3A 3E70C 3WYFA 2KI5A 4CZ2A 3IAFA 1FA9A 3S32A 2CXSA 3EVCA 1LDKB 1AT1A 1XXHE 4A26A 4YRSA 5J2TF 1ZWLA 1S2GA 3ID6C 2ZAMA 1ISMA 2J9XB 4YP5A 1S6LA 4HLDA 1Y8RB 1ODJA 1O58A 1Q3HA 1U0EA 2VDWA 1DFHA 2QGZA 2QHXA 3DUFA 3JWGA 3LLCA 1JYEA 4G2NA 4V0NA 3TTYA 2R6FA 4KQ9A 1SD2A 4JJ4A 1UPUA 3UUFA 4DQDA 3KTFA 3BL6A 4HVAA 3FBWA 3GX4X 3HFJA 3R7SA 3O4HA 1CJVC 2C3YA 3LGSA 4P5PA 4HAYA 3CNOA 1USUA 3KTDA 3WYGA 1AKHB 3ER9A 1DPFA 1TQ6A 2VJIA 1ECCA 4IDOA 1FJXA 1NUQA 4W5TA 3F6PA 1VIDA 2CL5A 1DXHA 1GFWA 3IT0A 5J4LA 2VZ0A 1JUMA 1P61B 5I8PA 1POXA 2IOYA 3LS2A 4B6FA 3PHCA 4TTAA 2C9ZA 4ARZB 2G1JA 4CDNA 1QGUA 1IUOA 2DLVA 1EVJA 4U88A 3OZAA 4X24A 5EUBA 3ZOZA 1QZEA 4Q19A 3KP7A 1WSUA 1PK7A 2P9EA 2ZDHA 3AEQA 5ADVA 1JSXA 3SEQA 1YE9A 4JYAB 2D8MA 1YOBA 5CLFA 1U6KA 3IBCA 4JVOA 3LX8A 4FEAA 2ACJA 3DNFA 4BVEA 3H13A 4DLUA 4LZWA 5COBA 1FX0B 4RXMA 4PS0A 4RV9A 2F1JA 4FHEA 4Q4AB 3P26A 3I9V1 3U1TA 2V5AA 5BWOA 3SDGA 1WFXA 1VTNC 3OIQA 1SD5A 3QXXA 1Z2PX 5J43A 2P65A 2ECFA 2TMDA 1NX9A 4TZTA 3L5OA 1E8DA 4HV4A 4ENSA 1IG0A 4MPPA 1AC5A 4WBNF 5DWQA 2AVNA 5BN1A 1Y4UA 3BD6A 3D8RA 3ZNNA 1MF7A 2HTEA 1RKWA 3GBGA 3C43A 2AQEA 3TYXA 2QL5A 3U37A 1VSTA 3L4BA 2OXIA 3TTXA 3P8ZA 4I1RA 4LYYA 4D3DA 4RJLA 4HO1X 4B8WA 1XZKA 3GWZA 2FW8A 4K05A 3TEFA 3S44A 4CCNA 4L85A 1Y34E 4LWOA 5HOEA 3OYIA 4EJWA 2M8EA 1HMYA 1CJUC 3ITEA 5CDHA 5E4JA 1JT2A 1Z22A 2YZ7A 2ZMEA 5LA6A 2V6JA 3DZKA 2R66A 2H5EA 1XTTA 5GPAA 1NXQA 2DB3A 3U7GA 2D7JA 4D5CA 3EXEA 3CBQA 2XNDD 2OY0A 2ATVA 1CRQA 3DSRA 5JMPA 4DTIA 4CIYA 1ZG3A 4KQEA 4LOJA 3FHCB 1ZI9A 3UR3C 1SZCA 1TGVA 2NG1A 3VSAA 1D04A 4FHCA 1B8OA 4J7AA 2P3OA 4C07A 3GEEA 4DWWA 5FADA 4LTDA 3V2UA 1HZJA 3JZMA 1Y89A 1SHJA 4I1PA 3ODGA 1WNTA 3NGXA 3IMKA 4Q1VA 4YRIA 2IY8A 3FXOA 5D8KB 3Q3CA 4WD3A 2BGCA 1TWFJ 3GFOA 4GMKA 4NPHA 3VC3A 3NBUA 1P18A 5EKXA 2L9NA 1NBMA 3MWKA 1I5EA 3LYAA 5FBWB 4M74A 4HF1A 3HUTA 1QVTA 1XCPA 4KB5A 2I8CA 3V8PA 5D4SA 4Y7DA 4NDNE 5F6FA 4ZAVA 7AT1A 4HPXB 4IEJA 1FLAA 3H9BA 2YWGA 3ND9A 3HJEA 1M6YA 1RYEA 2J4FA 4PLVA 1RUOA 3JQAD 2AN5A 3QBJA 5K99A 1VQ1A 3DWFA 3M8KA 4EIWA 1YI8A 4M87A 3TW4A 4GKKB 1E0AA 2E55A 3ZDXB 3R4KA 3HJBA 2J6BA 1QAOA 2WFLB 4RVUA 3HDVA 4EB0A 4TL7A 3L4KA 1WKCA 3M6VA 4D57A 1FBNA 3WXBA 3I0TA 1FQJA 4GBJA 1WPRA 5TXGA 2PA0A 5DLDA 3JARA 4EYSA 1ZGHA 5B2FA 1OX4B 1D2NA 1Y7IA 1NPDA 4Y3OA 3AONB 4OI2A 4DLVA 5BOSA 5TMBA 3KT6A 2ZULA 3HHEA 4WDRA 1E17A 1AXGA 1OU4A 2D1TA 4W1RA 3FHOA 1CIJA 2HCRA 3G2NA 5IT3A 3V1NA 3M8FA 5C3MA 2B0JA 1DBIA 1HDCA 1JMVA 2QR2A 3PUIA 4U1RA 4KXWA 3ZHXA 1ZVMA 5FBQB 4ASUA 4XIJA 2CZQA 1CULC 4EKYA 1FP1D 4PINA 2DDAA 3MCAA 5EHQA 1XZIA 3EF1A 3KD3A 4AMUA 2KSQA 4PZPA 3IRRA 3EVDA 4I8XA 4YK7A 3CLRD 5JHUA 3AINA 2FBKA 5TJJA 2WD9A 3I6BA 1J1UA 4U7TB 1PEAA 4CIXA 3BE6A 2H16A 4O1IA 4ND1A 4X20B 2YH2A 1Y3DE 1RZ3A 2G09A 1DC8A 2H5JA 3HY4A 3FX2A 2E4XA 4CHTA 5DB4A 5DCWA 1PFQA 2QRUA 3Q8KA 4G5OA 4UV9A 1B74A 2J3DA 4KYVA 4B3AA 1A8QA 1HV8A 1FLIA 1OGIA 2YUTA 1OKRA 4OXXA 3II6X 4UHBA 5IN5A 3ACDA 3WIOA 1VZ0A 4YMLA 1M2KA 1XT6A 3QKSB 4C6SA 1QF6A 4ENTA 4D81A 3HCDA 5G40A 2VWHA 3HVIA 2R5ZB 2O2XA 3CEHA 3TPCA 2LH9A 1TC1A 4UM9D 3K9FC 4HX5A 3JYHA 1WZ2A 1ZJ6A 3JQDA 3BFXA 3BZCA 4XSZF 3QLVA 4E5MA 1KJYA 3S8YA 5KK1A 1JDUA 4AJ4A 2XHKA 3A0HC 4GRIA 1T36B 2ZBVA 3B1FA 3DWIA 2K9MA 4JLAA 4PYRA 3BRWA 3QFHA 5HKAA 3T1YB 1ZP6A 4AL4A 2J3MA 1E4EA 3EPZA 2ZJ3A 2NU6A 4FFNA 1KI1A 2AE2A 2F48A 2XOKA 4M4SA 3K4KA 2WVGA 2ZW9A 1NM5C 3H75A 1TQ2A 3C4QA 2QRVB 4G5HA 1SD7A 5E6SA 4HEA2 1G8JA 4LNAA 2A3SA 1IB6A 5HIJA 3AR3A 3EVFA 1U0HC 1QK3A 4IKPA 4FE7A 2KB0A 1E7SA 2MYUA 3DAFA 3M1AA 1FVFA 2ZOSA 4KJXA 5GIPE 4GHWA 4Q9HA 4ZV9A 1N6HA 5EYPB 4HV6A 1QCCA 4FPXA 5AUNB 1JHQA 1CV2A 2ZB9A 1RYBA 3AHIA 3ZGNA 1E3TA 1NMSA 1D3AA 4XEUA 2CK3D 1QTIA 1TM4E 1RIOH 3VO9A 3ZQ4A 1T2EA 4ZA2A 5G0TA 4CE6A 5CNKA 4C7XA 1A8HA 3VR0A 1ZXBA 4ZCTA 4JOCA 2VA8A 5IF3A 2Q5JA 4ZT6A 3D1JA 4PQYA 4WFJA 2NSHA 1IRFA 4NCJA 3CLRC 1MQ9A 2FEPA 1YBVA 2WJIA 3F7TA 3FLBA 3LQ1A 1M1ZA 2I55A 1P75A 3BE4A 1WTCA 5BV0A 3LUKA 3ONEA 1FPQA 2W4MA 1J9IA 1QVZA 2JGMA 1RJFA 2ZJ6A 3AI7A 3GXOA 1PYDA 1E3PA 3QYAA 4KDRA 3I2JA 4WXRA 1S4MA 1SCQA 1T34A 5AVJA 4CQMD 4ZDKA 5FKMA 1DX6A 4CV0A 2LF7A 3KSMA 2ATCA 3B3JA 2ZB8A 3QBEA 4OBEA 5T3UA 3QY9A 1K7CA 1KU2A 1NFFA 3FCCA 2BMDA 5JQWA 4XLFA 4MW9A 1MORA 4MLOA 3LP6A 1QV7A 2QN1A 1T5DX 1STZA 4OI4A 1TCBA 2CJXA 4FNAA 4I6JA 4NK4A 4NZYA 2G17A 2CL6X 4OK5A 4RMGA 1SUPA 3VU8A 4C14A 3R3ZA 4I1OA 3RVOA 1BQ4A 2OYSA 4OU5A 2OFFA 3GLGB 2PUAA 4KPUB 2HQAA 4RKQA 2P5TB 2JPCA 2VJJA 4AJIA 2PTHA 1BDIA 3VDMA 2R6DA 3S4YA 3WV4A 5CA1A 3IE1A 3UK0A 3GLQA 4OIQF 1ML4A 2J5PA 1NRJB 2WNHA 3D8SA 3F8WA 1EFTA 3O94A 5DCMA 1R74A 1LPBB 2CMFA 1UG2A 3O1IC 4K40A 4AF8A 5AW4A 3S2WA 3SZOA 1EX9A 3HDGA 3FXRA 2J33A 3VR5A 1U02A 1X77A 4HGZA 3UYLA 3IS3A 4DCUA 1QH8A 3NRVA 4HQEA 2PSDA 4FFDA 4NBSA 5L45A 3C3WA 4ZOLF 1UBHS 1XJWA 2NXWA 3KX2A 1BE6A 3A05A 3SX4A 1EXMA 2QG4A 1FLNA 4G36A 1G1AA 4ND4A 5DASA 3ME5A 5DN6A 4ZAZA 5HMMA 1J2TA 4D1YA 3AJEA 2XDWA 3ISJA 3SBDA 1N9KA 2AJBA 4O08A 4FOTA 1ZS9A 2M2EA 1FTQA 4MKRA 5GWXA 5LQCA 5F51A 5A7HA 3OYBA 4RHEA 2RC5A 1KL7A 3M1EA 3BS4A 4PNZA 2PCJA 4F55A 4FR0A 4G0QA 1F6BA 1HLFA 5JO9A 5JBIA 3T4XA 4J3JA 1EBBA 3DVAB 3ONWA 4C2BA 1YZFA 2QD2A 2VQSA 4X0GA 3DT9A 4HN4B 2Q6LA 4Q7JB 3T8YA 2WAAA 4V0MA 2WTAA 3A4VA 3NYWA 1GZ7A 1H4QA 1LB2A 4BLVA 2COEA 4E13A 5HCIA 3PFIA 2VNHA 5ED0A 4B3FX 1GAJA 5ALSA 3SKYA 2CJYA 2XYPA 4PCVA 4HF2A 2RGNC 3WGHA 4PRLA 4NQWA 1PNTA 3JVUA 2UYYA 4I55A 4B35A 1OZ0A 4MRSA 5TR9A 1SBQA 2C2OA 2AXEA 4FFPA 4YXWA 4BUZA 3OMYA 4WPGA 3WK6A 5HP4A 1UJ5A 5TGZA 1OQYA 3ICWA 4U3JA 3WAGA 4Z5XA 4KPYA 1T1SA 2FOWA 3B48A 1YJWI 1VLVA 2PX5A 1RESA 3TO6A 4BMZA 3ZTYA 1A7UA 1V7CA 2ZYUX 1H42A 4HLUA 5E4TA 1WA5A 4QGBA 3OPYI 4JVNA 3TCXB 5K6RA 4GXTA 2HDDA 3JRFA 1E2NA 4PQRA 5TMEA 2P6SA 4XUDA 5HLHA 4KXNA 4IIHA 4PYKA 2ISZA 2CMPA 2X6OA 4GGMX 4GQIA 3QKSA 1D7AA 2Y0CA 4JA0A 4Q1FA 2YJ5A 5AXBA 1YRHA 4RV4A 1V7ZA 2G6BA 4ZJZA 4ARVA 5C2JB 4B7ZA 5JADA 1P1HA 3H92A 1ORHA 3IQFA 4KODA 4PG5A 1DK8A 2YIDA 2IODA 3L84A 3I5YA 1U4NA 3UOAB 1I27A 2ZJOA 1C80A 1E7WA 2ZYHA 2HUPA 3QXGA 1UQUA 5IYDJ 4B3DA 2HA6A 3K4CA 1JEAA 1ODTC 4DMCA 3TP0A 4HRVA 4OAYA 5CX1B 2WJGA 1TVMA 3QUBA 1ADJA 1NSYA 3HV2A 3Q0IA 2ILTA 4LDNA 1OKKD 2DI3A 4G24A 5EWLB 1WWKA 3RVBA 1ON1A 4MUIA 4NESA 1E58A 5EJAA 1RAHA 1W5CC 1GR1A 1SEVA 2X5NA 3JQFA 4JWKA 4R3UC 1GGJA 5A3JA 3K8YA 4RABA 1GPBA 1R18A 4K8RB 1QG6A 1G20A 1X39A 2D0IA 3GTKJ 2YFQA 3B89A 3QI7A 1XROA 2IELA 2ID9A 3Q7SA 4TZKA 4TV8B 4DIDA 3HYSA 4I0WB 4DE5A 1D03A 4QLBA 2OVFA 3CNNA 1QPIA 1COWA 1XMXA 1CF2O 3G1LA 1K6OA 2VSOA 3H5NA 4LDPA 3TJRA 1OFUA 2FTKE 5DEOA 1EZ4A 5MFZA 3TKAA 3OWHA 2P9FA 3W3AA 2ZATA 5LD2B 5B1BH 3INYA 2QQEA 2Q2EA 4E4YA 2HMUA 2RJ3A 4BVAA 4EA7A 1I1QB 4JROA 2HU2A 5KTYA 1SQ6A 2PG3A 2VHVA 5EC8A 2MSNA 3IB3A 4BQRA 1O7FA 2A86A 3L1UA 5EPEA 1E6KA 1UJNA 4CEIA 1QH1A 1BHSA 4IJUA 1UBEA 3IMGA 1BN6A 1C9MA 1Q1BA 2B9SA 2FPWA 3HG7A 4HNHA 3V4LA 3LT2A 4JUCA 3DJYA 4BP8A 4OG2A 3OIYA 4GS5A 2W25A 4PQGA 1S0UA 4OXKA 4D4HA 4TTJA 2RHHA 4QYSA 3GTQJ 2DM6A 2E34A 1M10A 5EE9A 2R7ZJ 4UAVA 5K3EA 3BJOA 2JJQA 4DADA 3FDFA 3PX2A 2CK3A 4X9XA 5K3FB 4Z4QA 4N5DA 4WA8A 5G2OA 3KQOA 5EGSA 5AVUA 5K3OA 2E37A 4D0SA 1KMCA 4R1QA 1ULHA 1BC7C 4MNTA 5KWSA 4CI9A 3DCNA 2VG8A 4E7JA 4KN7X 3FNBA 5AJTA 5DHSA 2NP6A 4NARA 4WCGA 1EE9A 1QONA 3HXPA 1WDLA 3INGA 4G4IA 4H1UA 1VSBA 1S3GA 3OZTA 3M9AA 5P21A 4POOA 5LHHA 3WGOA 4BVGA 2W2XA 3WTWC 1MOQA 1P9RA 4IINA 1G18A 3ICOA 5KHLB 3WJAA 3GUCA 2WWXA 4ZARA 4Q5SF 5CFRA 3D2LA 2K40A 6YASA 1J2YA 2E9SA 2YJ4A 3BSYA 1CQZA 4KHZA 4UEKA 4DEXA 3HCNA 3QXJA 1WJ5A 3D1VA 4GGPA 4GPEA 4F86A 2VSQA 3QBDA 3J7ZI 1OHHA 1YAHA 3ISPA 3GP5A 4GNKA 2X6TA 1N2OA 2ZSBA 4OM8A 4P3KA 5GY7A 2RH4A 5F1PA 1W34A 5L3ZA 4Z9AA 5IC6A 1Y9AA 4JA2A 1VPTA 4JJEA 3HJFA 1V6SA 3N8DA 4NENB 5JBNA 2GLOA 4I1YA 4JOBA 5FI0B 1Z7UA 3ILSA 2MH9A 1RWKA 2E1MC 4Q82A 3H65A 1DQNA 5LQDA 2DGDA 2P5LC 3QVLA 3R9XB 1IJEA 3K0AB 3JRIA 3T7EA 2ZI7A 1OLXB 4HSEA 3O03A 3JZDA 4R1SA 1UJ6A 1CY1A 4XR4A 3FCAA 1JTEA 3QYJA 5HQ3A 2WDZA 4OP2A 5EFZA 1ETKA 1Z25A 3CLSD 2GM5A 4RGXA 4EG0A 4COKA 1K08A 1FYDA 1AKQA 2GXUA 1E3WB 8ATCA 1T0IA 2PR2A 4R4JA 3TJMA 2GLXA 3WA6A 3NBFA 4RYLA 3BIXA 4IBOA 1P7WA 2EP8A 1WI3A 2GTPA 4M8LA 4UUBA 5K0LA 2OYRA 5IY5H 3FUUA 2O1SA 2CV2A 2XDAA 4OXIA 3GJQA 1AHDP 3QVGB 4RPGA 1FLDA 2G06A 3A4IA 3V8NA 4ARAA 3BJMA 3A1VA 1GA4A 3IPYA 3PDWA 3P9KA 1WULS 3JTMA 3PS9A 4DMHA 1J70A 1LEBA 1TVCA 2GK6A 2QSUA 4NNOA 4QOGA 5BN4A 4I5DA 1AKYA 1UPTA 1A2KC 1VCMA 2CVHA 2WV9A 4REQA 2O2YA 4CFSA 5JLXA 1KRHA 3ZJYA 4EAQA 2XUZA 1XRMA 4GBMA 3WLJA 4CEHB 3I37X 1GNLA 3UJAA 3HEBA 3OURA 1W4BA 2RGWA 4JEIA 1X1PA 2VE9A 3K9BA 5HILA 1P74A 4U3JB 4WY2A 1AK1A 3CUUA 1P3DA 1PSDA 1UBLS 1M9NA 2YMLA 4JLOA 5AM4A 4ESHA 4DUZB 2W4QA 3CCVI 1FRVA 4A69C 5LPNA 3JAWB 1CJCA 1OKKA 2GCEA 3COPA 4OXYA 1N2HA 3W4KA 5IOYA 5AI6A 2DFVA 3T1NA 1UFVA 3PNOA 4YDQA 4B8XA 3AF1A 1FRZA 1Y3IA 2PGDA 4IZOA 1E8NA 4Q3BA 3CO6C 4CFZA 1I6MA 3OIVA 1W5EA 4LK2A 1E6MA 5HF6A 4BO5A 5CX4A 4PSXA 1A5BB 2HDOA 3AJRA 4FETA 4L72A 1UMKA 4W6QA 5CX1A 4HP8A 2EV0A 4EUSA 3PPWA 4FEGA 4BTVA 6PAXA 2QN2A 2J0VA 3RT9A 1OMIA 4J19A 1IXZA 1T9BA 1YJQA 4Y0AA 3ZLUA 3PT9A 4QHYA 3MEXA 4U7JA 1BCSA 3HQ4O 5ERYA 3E2PA 4N0MA 1I6WA 4KKVA 5JASA 5LXTA 1JMYA 2V6CA 4JODA 2O23A 1FF9A 3LGAA 4MO9A 4G1EB 4DAEA 4PE5B 1Y7TA 2E5FA 2VPTA 1PE0A 3S55A 1KAHA 3O4VA 1DRUA 3PWZA 1DDIA 3BCUA 4GG1A 3REQA 5KPDA 3M7IA 1GUZA 5CD1A 1F12A 2RH8A 1LUAA 3PYLA 1T24A 1FBTA 3ZK8A 4M1MA 2YVUA 4CKEA 1E3JA 2PR7A 2SBTA 5CU7A 4D74A 4P4SA 3QWAA 5TMDA 1QHNA 1OX4A 3ZY4A 1DQUA 4GI1A 1V25A 4JUAA 3ZQIA 4FX5A 4ZT3A 5IAEA 3FKIJ 2OHGA 5KC8A 1VG0B 2FSVC 1NRXA 3DPSA 3EBLA 5GZ3A 3PLRA 3PPVA 2QJFA 4PVCA 1X0VA 3DBVO 4GI2A 4E6EA 3H97A 4RFLA 4XTRA 2NZJA 2QAIA 4KXFB 2CY0A 5I7UA 2Z6AA 2QWXA 2VXZA 2AHOA 4X1EA 4LOIA 4AZ3B 1U3EM 1R4MA 4XASA 4Z7JA 2NVXJ 2QS9A 5EHZA 3O8DA 1HT3A 1NC1A 3AF4A 2C95A 1QO0A 1XALA 2X9LA 1KYZA 1RC9A 2DZDA 2F2EA 2FMYA 3IAS6 3NC0C 3M0EA 3OT4A 4RADA 5H0IA 3TLBA 1B3BA 3I9NA 2QTNA 4IOMA 4JIGA 4BO1A 2GFQA 2ZT6A 1P2SA 4ZYWA 2IA2A 2YS9A 1V48A 1W19A 1BC8C 3KYLA 1TF2A 2MT9A 2C58A 2W6NA 3RKRA 1RW4A 2VPLA 2QROA 2CSUA 3KHSA 4UHCA 1VLLA 3F4BA 3ZS8A 1QR6A 1B0UA 3MK31 5HM8A 1X42A 2WY7Q 2VJOA 3ZBTA 3TECE 2C3MA 5AUQA 3BUSA 3H2HA 5M2QA 4CR6A 3J7YJ 3QSYA 4YAWA 1JJ7A 2O3QA 5GP1A 6PFKA 4ZT4A 1RLMA 3K9CA 2OLKA 1DUSA 3LUAA 3SMQA 5DO9A 4RVNA 4L9VA 2YQZA 4HCJA 4ROSA 2JCGA 4JNKA 4UCQA 2GZSA 5J47A 1U8ZA 3HDQA 3HR7A 2ZRHA 1DCTA 3U40A 1DBRA 3JQGB 1FPMA 1II8B 3IE0A 4NPCA 3UAYA 3L9WA 2W1OA 4N0BA 1WH7A 2VQLA 5K5QA 2OHHA 5B37A 5B6PA 2VYFA 1JLSA 1OCZH 2A1TR 1EYZA 2PCLA 3RTEA 2W83A 2WF9A 4GI5A 5DIZA 4PNEA 5LRSA 1CIPA 5I48A 5EMLA 5KX5B 1GG8A 1WJEA 2OBLA 4TUYA 3ZK7A 1OLXA 1U2EA 1KJZA 3KZVA 2ABWA 2MDTA 2Q4OA 3NPAA 3UXHA 4JBYA 4C9BA 2K27A 5KNBH 5DLEA 4DMUB 3TMYA 2Q0SA 2V65A 2X9DA 3RQ4A 3E7LA 1G5PA 1SHLA 3EW7A 2H6EA 4H0CA 3DQVC 3I12A 1YZYA 2AN4A 4RTMA 3VYVA 2B94A 2XAHA 5BSVA 3HUGA 1MNAA 1DPUA 4BWYA 4DT1B 4I50A 4JP1A 3NP9A 2H63A 4M0LA 4RS4A 4DZRA 5FL3A 5AFSA 1PD0A 4QATA 3P52A 1DFIA 4IFEA 1FDUA 1FNDA 1Q22A 2WINI 1IUFA 3AG5A 3QEJA 3DOJA 4PTLA 1OFCX 3B1KA 3TLCA 1Y9JA 5EZ5A 4MINA 3G1MA 4NHOA 3MS7A 1N7GA 3GZ5A 3BIWA 1NVGA 1X9HA 1EE1A 5TQ2B 3TOSA 1XNGA 5CB4B 3Q6IA 2P2ZA 5JY1A 3R8XA 3EPKA 3W2VA 4Z4HA 1NZJA 2WPDD 4MPTA 3JQRA 4CUZA 1KARA 5G41A 1W75A 2D74A 5GPCA 5CM2Z 5A4IS 4LMBA 3RUDA 5E38A 1JTFA 1FXWF 4FSDA 5I4BA 2JLAA 3WLKX 4QODA 1KZ4A 3NBXX 3T8TA 1O6GA 2F3PA 4G4SP 4RU1A 5DNAA 4E7PA 1XVLA 2I2WA 2PGIA 3D5SC 5F08A 1V16A 3K20A 5J3LA 2OBMA 3STHA 1ZN9A 1YOVA 2FP4A 4RK7A 2IRFG 3DDWA 2EPFA 2A5JA 1G21A 2ZXJA 2KLOA 1SUEA 1X7WB 2EW1A 3MIIA 4ITRC 2AZXA 2HRBA 3BN3A 3EY4A 2Y48A 5ALUA 1JDNA 4H59A 4OHOA 3C3AA 1VDZA 3UMRA 2PJRB 5FCDA 3VZBA 4DW6A 3OZWA 4JU9A 5K05A 3LFKA 1FX1A 2PX9A 1N2CA 2JIZD 3LBNA 2GM9A 2ERXA 4MH0R 2DMQA 1PHRA 2BI8A 1BWQA 4Q3AA 1EDEA 1GN8A 2C4KA 2OFXA 4FKMA 1RPJA 2FSPA 4DA4A 2VKHA 1OOEA 3OECA 5ESXA 3FI0A 1NNEA 3DMGA 2JK3A 2B8EA 3SR0A 1Q15A 4ETMA 4MDFA 2HQ1A 2OCGA 3L4BC 1LPSA 2Q2QA 1KPHA 3MTBA 2X6YA 3N07A 1WIWA 1JUPA 4XN3A 4JLVA 4F5EA 3A4LA 2GTIA 3IQZA 3V5NA 1RLTA 4ZC1A 3NOQA 3AIKA 4LK3A 3QKRA 5JFRA 3DMTA 4XL9A 4YFNF 1XKXA 1IULA 3JZFA 4HQNA 4JXJA 3OM0A 4TXJA 4UHEA 1WY5A 4C5AA 2PVCA 1OFHA 1PFUA 3ZD9A 5C1BA 1YFLA 1YBFA 1XQ1A 3MFYA 4CTMA 1ZBQA 3DAPA 4W8GA 2ZIUB 4IG9A 5LQMA 4LA4A 4X84A 5EZYF 1QGZA 2VC0A 1VKRA 1PJTA 4X8HA 4B8YA 4E21A 1LDGA 1AF7A 3NT4A 5K6TA 3CN9A 2BY2A 3DMTC 1YO6A 1PGOA 3CVXA 1KA8A 5HYVA 1ZXLA 3PX3A 3VU0A 5CB4F 1YDFA 5J3JA 3IJEB 3TRFA 4BCDA 2PH3A 2P11A 1H23A 3IMEA 1EBFA 1WS6A 1YDHA 1M2VA 2F9FA 3K1JA 4HH1A 2IZ7A 3AG2H 3OVMA 3Q88A 4R7GA 1SIOA 3OHPA 3FPEA 4ZC3A 4NG4A 2DC1A 2C84A 3BRQA 1DKLA 2YYZA 1LPAB 4QELA 1NTOA 4UATA 4XIYA 4YRFA 5CQEA 1DQZA 3I52A 1CUSA 2E1CA 3F6EX 4V0QA 3LYLA 4PSKA 4PJNA 2LOOA 2FE1A 3L2OB 3GW8A 4I9GA 1FNNA 1FYKA 3M5WA 4G1CA 5TSDA 4REOA 3EGDB 2EBHX 1MMGA 4O8CA 3HOWJ 2JFXA 3I30X 2O54A 1RIIA 2DCMA 2XZDA 3RG2A 5IT0A 4RM2A 1W29A 2GFIA 2ACEA 4D92A 1O6ZA 1KI6B 1O95C 3ZD8A 3OPMA 1EFHA 3RTRA 3N59A 3PPYA 2DK8A 4TMVA 3VC1A 3Q3JB 4OUDB 2XGDA 1XWFA 3F2IA 1MMFB 1NXWA 1V7QA 5HDKA 1BXZA 2EARA 2VYNA 2Z43A 4PFQA 3ZE2B 2GD1O 4S1NA 1M83A 2WLSA 3MINB 5G0VA 3MKWB 2O7RA 3M33A 2H65A 3NHUA 5GM2A 4EOGA 5E3LA 1U78A 2BGGA 2PUHA 1QP4A 3N4MA 1XRLA 4LRYA 3ASNH 5LRRA 1YB1A 1Z38A 4GI7A 4ZQHA 5CA1F 3F5DA 4HDAA 5LA6F 2J41A 1XYVA 2ZJRF 2VXCA 2VODA 4BNZA 1F0KA 4M1ZA 4AYTA 1LDJA 1PUFA 1XDDA 1A2BA 2P9YA 5HKKA 1KH2A 1MH1A 3NRJA 1TW3A 5KTNA 4D9IA 3GAMA 1JI8A 3PGXA 4FDVA 2IV2X 4B6QA 5ITSA 2J0SA 1QK5A 2IYQA 2VFAA 4AKHA 1ENOA 1FP6A 3QYBA 3S40A 1N8TA 3SM9A 5HDGA 1G5QA 2ZSJA 3OKCA 4XTCS 4DGQA 1TUBA 2FX2A 2JDID 2OXEA 4G85A 1BE1A 4YV0A 2EX1A 1T29A 3FPBA 2Q5OA 3N5CA 1PV2A 3R24A 4G6ZA 4LRSB 4UM7A 2Z2JA 4WK2B 2X3UA 2RHOA 3EVEA 2GLTA 4MA0A 2X1VA 3RYFA 4EHBA 2C9YA 3KYDA 3JR9A 2AN1A 4I3FA 4IIYA 1TI7A 3FOAA 3NNDA 4KUMA 4N47A 3OLVA 3N2GB 5DRYA 2XBLA 3QV1A 1I4OA 1W4LA 2GK3A 2WPDA 1JDZA 1U99A 4IF6A 4R1NA 4D46A 2FSSA 4QYTA 4WCDA 1XC7A 4G7HF 4XCXA 1VHTA 2P3LA 3B2QA 2CBXA 3JQ8B 4N03A 4N49A 3I54A 1TM1E 4MFEA 5L8VA 2OORC 1N4DA 3SAJA 2HQNA 1QYRA 2H54A 2UUBB 2EKZA 2C4VA 5E2IA 1C8KA 3M2PA 1E9RA 2EIXA 2NVUA 5FTMA 3ZJ4A 5B7PA 4EL5A 1VPWA 4CF6A 1B1BA 1XO1A 2JAPA 1JR3D 4CV3A 4OATA 1FTZA 2G9VA 2Q1ZB 1E1MA 2NVYJ 2IUFA 3Q4GA 3R0ZA 4M6WB 3W8NA 3ZV3A 3TTTA 1KP2A 3NASA 4ZMSA 1F2TB 3F73A 3A9VA 3AF5A 1U1FA 1RP7A 3DEWA 4OFWA 5EESA 4C3ZA 1SU8A 2QKLB 1DO0A 3NBZC 2OBYA 1OSNA 1K5GA 2FDCA 2BTEA 1FMWA 1K7FB 3BREA 4LNHA 4TKZA 5FBZA 1ONOA 2ZCUA 3TZQA 1NPYA 2UAGA 1MDBA 1VE5A 5IP6A 1EB8A 3SS9X 4EW6A 2A4MA 2XF5A 3GTGJ 1U8CB 3Q3SA 2BONA 5ADUS 1XGSA 4XRSG 4Z4FA 1IV6A 1TNDA 3QM1A 1PWXA 5LQRA 2C2WA 1HE3A 1I13A 4XAQA 4Q01A 3RC2A 1QLHA 2CUKA 3H0KA 3KKQA 3PKJA 2PMFA 2E1MB 2Y75A 1L5NA 3OTOB 5JTTA 1TWAJ 1COZA 1KI6A 5ILSA 2LY2A 1P60A 2QENA 1NP6A 1Z2CA 5FV7A 4E5KA 1CS4C 3EYAA 1QS0B 2PSFA 4YAFA 3AK4A 2A8YA 3PNQA 1FIPA 3A6DA 2BCEA 3M5DA 5DHFA 1TZLA 4A2CA 1ZJWA 1NR5A 1Y8ZA 2X0IA 2EFGA 3D3JA 3GYGA 3N0VA 3UXYA 3PNPA 3OOPA 1O4XA 1IMJA 3P5JA 1ZNYA 2L19A 2O4CA 2QL6A 2VSNA 3QSGA 3QLJA 4HWSA 3WJ2A 2UZ1A 5JYBA 2HA2A 1MD9A 2V7TA 3DZBA 3ORQA 1K8RA 3KTAB 4LJ4A 1EP1B 4BEVA 1WBJB 1XP5A 3VR6H 2CFOA 4PLYA 1TF7A 1PWHA 3RRJA 2FW6A 4L4UA 2BJVA 1F4LA 4R5HA 4HGPA 4DLPA 3VHXB 3FIUA 4KDEA 2VBYA 1J8YF 5A05A 1VKOA 2O3UA 3HE3A 4ZI7B 5F27A 3K0LA 4KC0A 3PNTA 3EIFA 3GFLA 2HI3A 2ADFA 2CXXA 1A8IA 3AVTA 1CUDA 3DW3X 2GF9A 3F0TA 4Y2VA 5JAMA 1ZGAA 1R9GA 3ZW7A 3HJUA 5IAJA 3CWQA 4PFSA 3R3UA 1LJLA 4EHDA 2JGRA 3DOOA 1QLWA 3DL4A 5EJEA 1C7EA 5BUQA 4FCYA 3F7NA 3UVEA 3HTUA 1A2OA 3C3KA 3QENA 3IBTA 4XORA 1YRBA 3OESA 5DHUA 1MIOB 1S29A 3E4DA 3GLTA 4JR2A 1WD7A 3LQRA 3K4NA 1J2RA 2OL4A 5H59A 5A6VA 3RADC 1GSHA 2Q3EA 2EFPA 3L8FA 1T0JB 5GVSA 1SCIA 4FILA 4G1FA 3RI4A 4G0VA 4XIDA 4L76A 2QIPA 1SK9A 2ZSEA 3DEYX 3F9RA 1KO1A 3BTIA 1H9CA 5ICGA 2PMDA 3AF2A 5IDVA 4KREA 2PZGA 1YB6A 1Q7CA 4DV0B 5EPOA 1SCBA 2V7XA 2ZRNA 1EESA 1B2LA 3D7NA 5FD8A 4RE5A 1F9EA 2ET6A 2RG1A 3ECSA 3Q7PA 4BZXA 3BG3A 4WXHA 4DMLA 2PNFA 1G3RA 1HCRA 3ETJA 3PXAA 2YDYA 5AM3A 1DGWY 4PDKA 3CH5A 3LWZA 4XGKA 4GMFA 1PT7A 3TW0A 3V4OA 3PZRA 4Q05A 1LSJA 3H7IA 3LSGA 3WXMA 5A5FA 2M9HA 4R1UA 1HF0A 2N42A 4F9EA 1Q1HA 2C83A 2PMWB 5CFQA 1D0IA 4UVCA 3OYHA 2B1QA 4M53A 5FFMA 2CMHA 1KXJA 4PBSA 1YCDA 3BJRA 5GVRA 4CEIB 2Q8NA 4XZ3A 1T36A 3IIEA 4MLPA 1CEYA 1C0IA 2GTPC 3C45A 3LVQE 1FZQA 3DOHA 4Q24A 4RIIA 4ER0A 1A76A 2H11A 3DXXA 3VTFA 3C98A 1A8PA 4INOA 5AI9A 4MI9A 5K03A 2IH5A 2FMLA 2MR5A 1ABFA 3ABRB 3B3FA 3F67A 5L7TA 3HB4X 2XEXA 2ZJZA 4N0EA 5CT4A 3L1PA 4DDHA 3AHHA 1CYDA 4QNRA 5DEIA 5DYTA 2H4YA 2R7NA 1SWVA 3BHMA 4CMGA 3QLUC 4L0ZB 2J3EA 3K1ZA 3Q9NA 4TLDA 4MPDA 1EDDA 3W6PA 4OX9Y 1C3VA 2D0PB 3S8MA 4R2MA 5BSUA 3ZK9A 2VJBA 1P0IA 1ZVQA 2XUFA 3W6OA 2E87A 1J23A 2WICA 5ALTA 3ZU4A 3ZJVA 5H1YA 3QY0A 2EWVA 3I53A 1D8JA 5E2AA 2F64A 4EQZA 2GCOB 4EHLA 3SHQA 1PQPA 4OPMA 5AIAA 1Z67A 4DC1A 1MT3A 2GBLC 3WNVA 4BKQA 3JRHA 3KZ1E 2YFYA 5B3JA 4QT4A 4Q39A 5H82A 3G8CA 2JI9A 1D4AA 4GYYA 5FEUA 3ZQGA 4YMTA 1D0SA 3DEHA 3KAPA 4HQFA 5JJ5A 5D87A 1WDTA 3HBAA 3K0HA 2AH5A 2BGJA 2ZVJA 3RRZA 1DDNA 3S5UA 3V8MA 5ITZA 2ZIAA 3AH8A 3M4YA 3W6NA 3U7HB 2QRZA 1YZHA 1XGOA 2OV2A 3K0KA 4M8KA 2E36A 1KFKB 3OL4A 3D64A 2FWRA 4P98A 3UPDA 4YV7A 1TDJA 4Y4RA 2H00A 2Z2YA 3D4LA 2F3QA 3OQ1A 4OQLA 5EMMA 1OH7A 1WPKA 1IZ9A 1DAFA 3B20A 2OV1A 4JJGA 1YZKA 4NHJA 3O5AA 5I01A 4Z53A 1QWSA 3DC7A 1B16A 2TYSB 3MGKA 1E2QA 4JQCA 4RENA 4RMIA 4ENRA 5J23A 1DKRA 4CMCA 2FXIA 1WXIA 3H11B 3P4UA 4PCAA 2GNAA 4UHTA 4WW0A 4BWGA 1J97A 1YZ3A 2GH1A 4L6IA 1CQJB 1VG9B 1Z0FA 4XLZA 3THRA 3T5TA 3DEKA 4AO6A 2UU9B 4ZXFA 2WYIA 1S2LA 1JU9A 1BA2A 2IDMA 1XZPA 5LR6A 5D5WB 1N1EA 5GTDA 4NMMA 3H2IA 2C92A 4FFLA 1DRWA 3E1GA 3QOEA 3LKVA 4I4TA 1EA3A 5AQ1A 5IZ4A 3EXAA 1DC6A 4DCCA 2CT8A 2W2LA 1GCOA 5BSRA 3H4VA 3D3WA 3LUHA 3EOZA 1TCUA 2POQX 1N8SA 2G67A 2ZJ4A 4IMRA 1PZFA 4YJFA 4ZCSA 3RFVA 4Q9DA 3CTAA 2NYXA 1LUJB 2WSBA 4OAPA 5HKLA 4DVGA 2QTAA 3B6ZA 2VTBA 2JK0A 3SQOA 4M0MA 4NG5A 2H6BA 1WZUA 1XCLA 1HYBA 2CWDA 2OILA 3HJRA 1N2CE 4KMUX 2GPBA 5AH0A 3OQIB 5DP1A 3U1BA 5TPZA 1W85A 2GRJA 5LNK6 2GYUA 3WLSA 4AUMA 3RFCA 2COMA 1GPKA 3PUYA 1X7YA 4GFDA 1G9XA 2O1EA 3G7NA 4MMYB 4ZYYA 4IDDA 3ZD7A 2BW3B 3FX3A 1W36D 1FYMA 4X63A 3E4CA 4FFBA 1C50A 4MB6A 2JRMA 2KPMA 4TWRA 1QC5B 4UCFA 4D96A 4U7GA 4AP9A 3TPFA 1H6CA 1ACJA 1UZNA 1UFMA 4YG2F 1JLKA 4BHBA 3HRKA 3GT3A 4A2UA 1SEUA 4HRYA 4J16C 2PMCA 4PZAA 5TQJA 3DZIA 3T3HA 4A03A 2X51A 1JR4A 4BJ1A 1FYWA 3TO9A 3DLLF 1XB2A 3WDMA 1RKTA 4J0JA 5KPJA 2CFSA 1IHXA 4N5LA 2WUFA 1LH0A 4G0OA 3VSDA 1YL5A 3IHUA 5HOOA 2OP0A 3QE3A 4I1SA 4RK5A 2IBDA 2BHTA 2M6SA 4XDYA 5FOVA 1IZ7A 1T0UA 3CW8X 2WSLA 3E58A 4M60A 3F8TA 3KIPA 2XE4A 3MUFA 4EG1A 3R0AA 1M33A 3N0WA 3V1LA 4ZYDA 2W57A 2R7AA 1EQUA 2JAOA 4FJ1A 3DKKA 3I71A 4F2GA 2EILH 5KWEA 1T2AA 3A3PA 5BWCA 5MFPA 1WF3A 4GGGA 2IHJA 2ID3A 1AHNA 1YAJA 3LD9A 1USGA 4GIBA 2VAXA 3OM8A 2JFFA 3IVGA 4Y0NA 3M7GA 2FZLA 2GEJA 2CUFA 5IKPA 2CFIA 2JIOA 2PXCA 2PNJA 3UJ3X 1J1IA 2LIVA 5HFNA 5H16A 3FBTA 2RCYA 1II8A 1M66A 3TNLA 3AKCA 1U3TA 3R3WA 4XM2A 1KE2A 4C4RA 2XKKA 4RXUA 2JEOA 3EYYA 3G2LA 3TEMA 4OHYA 4V2IA 2EHJA 3WWZA 5BYKA 2HU9A 2P0AA 2VAPA 4G5RA 3S14J 4EARA 1YDGA 2GJAA 2EFWA 3AL0C 1H89C 2QK4A 3IQXA 3PQ5A 4RZ2A 1T2UA 3IOCA 4YP1A 4DNQA 2M7BA 4RGRA 2HK9A 4MJ3A 5TPWA 2QYOA 2Y30A 4LQ4A 5HXAA 1Z62A 3EZXA 3KU1A 5TS2A 4OFBA 1FMTA 2IPMA 1GXSA 1IE3A 2EKLA 5AVQA 2YICA 4S2UA 2X6RA 3HL0A 3HB9A 3NTQA 3NWEA 5HOQA 3AETB 1K27A 2XB5A 3JQEA 1BE8A 2X86A 1JYFA 2EIJH 4O4HA 1E99A 1T5IA 4FFVA 2EIKH 3JALB 4WJKB 3RIMA 1SD6A 1I39A 1P2FA 1MNQA 4M3EA 1NUUA 3V7SA 5EZYA 4CEJB 2GJ9A 3UO8B 3VH1A 4B0OA 4Z7QB 2W0SA 1XSEA 1CDDA 4BNMA 1KU6A 3TNJA 1UDBA 1J90A 2JFWA 5ALEA 4QQKA 1CZUA 4LXIA 2X6WA 5F21A 2FW0A 2ZXWH 3WGVA 3QVMA 1A4IA 4AD8A 1MXHA 3IPXA 2J5OA 2Z2XA 1P1CA 2AZMA 2DY1A 3ON5A 1JQJC 3LWDA 2NTJA 2VYVD 1Z75A 2C3OA 4MZXA 4G7ZF 3C6XA 4GRDA 3QRFF