3QYFA

Crystal structure of the crispr-associated protein sso1393 from sulfolobus solfataricus
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
271
structure length
271
Chain Sequence
FQGMEVHVCSVGTSLLKNSLDDDNVRKEIERLGLKDWDRLKFDDDRQNRIKENFDSLRKMLLKFIRSKGRRASAELDSLFSTFEKLKHNKSEIYVFLYSTNTSNSQLAGEVIRDYLIEEGIRSELVTVKTISSEENFYEGIVDLFDKVIYRILKFKEQDNEVYINATPGLKPESIFLTLAGLLAGADLIYYKYQEFNDVVILPSPPITIRPKYLDWLIRFAISGYTLSEKRAEELGIPVRLLEAKMLVERKGEDAYRLKDWVRKLLGIYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the CRISPR-associated protein SSO1393 from Sulfolobus solfataricus
rcsb
source organism Sulfolobus solfataricus
molecule tags Antiviral protein
molecule keywords CRISPR-ASSOCIATED PROTEIN
total genus 104
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09651 Cas_APE2256 CRISPR-associated protein (Cas_APE2256)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1690 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3qyfA03
1.10.196.30 Mainly Alpha Orthogonal Bundle Regulator of G-protein Signalling 4; domain 1 Regulator of G-protein Signalling 4; domain 1 3qyfA02
3.40.50.10770 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Hypothetical protein VC1899 like domain (Restriction endonuclease-like) 3qyfA01
3QYFA 1XMXA
chains in the Genus database with same CATH superfamily
3TLGB 5KCMA 3C1AA 1ZS9A 3G1TA 1UADA 3KOXA 2BVMA 3PBKA 4EGSA 3L82B 4ZT3A 2QUJA 4BMOB 1JKXA 3G1MA 1G5PA 2BP7B 1AHHA 2L69A 3QFHA 1JKFA 3DWGA 3ROXA 3WS7A 3ZK8A 5KU7A 3DEWA 5JZBA 3K2AA 1J0AA 3AIOA 5IN4A 4O4HB 3IJEB 4TTQA 4NBUA 1L8AA 5JMTA 3UXHA 5JD6A 2XNDD 1SRRA 2VPXA 3C3BA 5FBWB 2J41A 1SUCA 3DONA 1YQ9A 1IFXA 2PFKA 4MVJI 3W5CA 1JI0A 1ZHFA 3IOEA 4ZZLA 3W8NA 4EM0B 3BTSA 3G3EA 3ZU5A 1M8KA 2IOYA 4M89A 3LFUA 2PS1A 2R66A 4MP8A 3TL2A 3VTAA 3IE2A 1E59A 1EJ6A 3W6ZA 5LOVB 5DCLA 1ZIOA 2I03A 4EPTA 2L54A 4AWXA 2ATEA 3H8WA 4KPGA 4I6JA 5E6SB 1SMKA 5HKOA 1PHRA 1ZGZA 3WK4A 3QFRA 2XQVA 4CPDA 1CZRA 3KFXA 2XKOA 2MABA 1KQFA 1TZLA 1DQRA 3RJPA 2ZSAA 3IDZA 3PRHA 3Q0IA 5LCXA 4I3FA 2AEEA 2DDBA 3QQ5A 1SHLA 1NQTA 4EIWA 3TECE 1K6JA 2ECFA 3BMNB 1N34B 3TVTA 1JLMA 1JPVA 2A9OA 1T0IA 3D3QA 2E1CA 1C29B 1DDIA 1MD9A 1Z15A 2I2BA 3A11A 3K94A 3NTLA 2ZI7A 2FPIA 2N47A 2ZEJA 2OHXA 3PHIA 1MJFA 4ARCA 1QAQA 1P2TA 5M7EA 2V9CA 4KWIA 3C74A 1M3SA 4EJOA 2H54A 1XGMA 1M9NA 1V1MB 3BFKA 4U6QA 2GAAA 5DXJA 3UXYA 2YU3A 4PDKA 1V11B 1C14A 1WCYA 2GTPA 2O6LA 2XE6A 4W5JA 3PFBA 3EPKA 1IZ1A 2J48A 3HJTA 4E5MA 1XEXB 2EFGA 5EKDA 5DCMA 1BKSB 1I0IA 4FHGA 1FJLA 3L0ZA 3TGLA 1DKPA 3ND8A 4BKXA 3LC0A 2WV1A 4HMQA 4RGBA 5J4HA 1H8ED 3A06A 1Y4ZA 3DLLF 3BG5A 1OFUA 3EFOB 2KJBA 3KV1A 4GZ5A 1RLUA 2X5OA 3MINB 4MUIA 5JY1A 1IN5A 2FUKA 2QP3A 1PYGA 2Q62A 3WLJA 2ACEA 4XH9B 4TYMA 2J5RA 4I1SA 1Q7EA 3LWFA 2LZ0A 1IMOA 5REQB 3H1BA 4H0NA 3HEAA 1LBHA 1OLXA 3F3KA 4IIDA 4TKMA 1KFEB 1OWNA 1YB7A 1HT1E 4HZIA 3K1PA 4RYLA 4Y6RA 1GADO 2HJWA 1BWRA 3M3HA 4AZVA 2COKA 1ZLXA 1JMVA 1YZTA 1RQ7A 1GGNA 1PVDA 2L82A 2IUEA 3ZK9A 3ZJTA 4LJ8A 3QPLA 1W85B 1PKEA 1UMBA 2ZZMA 3DEIA 3LGXA 4PIPA 2F9FA 2ANCA 5EHXA 3VR0A 2FZ5A 3OIUA 1TM3E 5EI5A 4AZTA 3ZW9A 3QX7A 3UH1A 1PFQA 3TTYA 5HYVA 1YV9A 4YAFA 2CK3A 3VPXA 2FR8A 3M9WA 1XALA 4CHUA 2P9JA 4DEVA 1Z83A 4XOTA 3IMKA 5C8XA 3KKLA 3V32A 5IUJC 2OAGA 3ZWNA 4YUZA 3FWPA 2HTEA 3D3EA 3ZWDA 2GM9A 3WLTA 5GVSA 3EQ8A 5E6UA 5I7UA 4QWQA 4UCWA 5EFOA 2ZETA 3D5TA 5ER6A 5CJ2A 5AP9A 2F64A 1E1LA 3FYUA 2XKKA 4JA2A 1AH2A 5LLQA 1I2CA 1XDUA 1IRGA 2ANBA 1J49A 1V35A 1DEHA 2BGMA 2F8TA 3MERA 1C7FA 1CRWG 2NNWB 4I5DA 4R9UC 3N28A 2PCJA 1AQIA 1TTPB 1XZJA 3KHKA 4QPPA 5TXGA 2CE2X 2PUEA 1XQ1A 2GPTA 4O5AA 3RPUA 4AJEA 4ARUA 2EZLA 4GI2A 4BNCA 1GPLA 2HSEA 4W8HA 3A9SA 3ZV7A 4BAZA 5K8TA 5SICE 3EYAA 4N9IA 5D6FA 1RPJA 3W8FA 1OX4B 2ZT8A 1AF7A 1FXUA 4ALKA 4CQLA 5TLSA 3LHKA 2ZROA 3TQQA 4N0QA 2HMUA 3ZE8A 5JS1A 3ZQIA 3QUSA 4ZAGA 3HCDA 4AY3A 3B12A 4EVSA 1CD5A 1IB6A 2QZPA 3K9NA 2NU6A 4X41A 3C98A 2MFZA 4ZO4A 4DRXA 4MJ7A 4QDKA 121PA 3GJ5A 2QN8A 3IP9A 4N9WA 3RIRA 2QRKA 2X2EA 5SZKB 5B36A 4HN2A 1UHSA 2ZWVA 4CEHA 1B16A 2B1QA 2PEZA 2OFWA 3JYQA 1Z6AA 3V4PB 4C0AC 1ETWA 4X1YB 1PS0A 1SNYA 3OYKA 3HMQA 3QEBZ 1V25A 3IJPA 5CVCA 2I7TA 4JZKA 5BYJA 1T9DA 2F5DA 5ESXA 2YU9J 2BAGA 2M2EA 4FFPA 4N7RA 2YYAA 2ID4A 3VNQA 1DTWB 5C8DA 2XITA 5EXTA 3UUWA 3CCUI 1RAGA 2HW8A 1T9GR 4R1MA 2PUBA 4AK9A 5FWAA 4RQAA 2ETHA 4DOMA 2Q7DA 4OHKA 2R11A 3K1AB 1MHTA 1I2ZA 4ZK6A 5HDNA 2PJPA 4II2A 2H0RA 2P4QA 3PF9A 3CMCO 4V3BA 5I9IA 3AG4H 4GNRA 4ZPXA 3O4HA 3R9IA 1MX1A 4PLCA 1GQOA 3HYRA 1WCWA 3H75A 4ENVA 1B8NA 3A9CA 5FPTA 4G0VA 5A4AA 5JD4A 2YWGA 3S81A 3PQ6A 2QA5A 2C77A 2B1IA 3G5LA 2D2FA 5FLVA 4GT1A 1MA0A 4QFMA 5HQ3B 2OHVA 4K7JA 2XOEA 4OBWA 3W8DA 2W4QA 3OBBA 1EQ2A 4F5DA 2H1CA 3NHRA 4B6PA 4UAGA 1CX9B 1LEAA 1C3EA 2YY6A 4JEIA 1QIIA 4POOA 3QU7A 5IUNC 5CLSA 1KFKB 1MQ8B 5F5XA 4D42A 1W7AA 3CLOA 1MD0A 1Q83A 1B8VA 2HS5A 1S3JA 1JL3A 4NNPA 4UHHA 5HG0A 2ZE8A 1LI7A 1NYTA 2VJOA 3M3PA 2ECBA 1D8AA 5C35A 3QJGA 5G0TA 1N7IA 5L3SA 2IHKA 1QLJA 3NQOA 4MIOA 2DFDA 2WE8A 1FYKA 1A7JA 2FE1A 2OENG 2PHZA 2WM2A 3L0BA 5TR9A 2JI6A 5KTNA 3E2PA 3ICEA 4DKXA 3B7GA 4TUYB 3LGSA 1ETYA 3BOQA 3KVOA 3WA6A 3ZK7A 3CO7C 5BVGA 2W5UA 3PNYA 3ENNA 3ZHTA 1RT9A 3I42A 3N8GA 4WOKA 2VVTA 2CXOA 4R69A 4UD6A 3GLFE 4ZKEA 1EFHA 1IK4A 1PYOA 3BL8A 3VWBA 1AOXA 4FFOA 3H5OA 3TQIA 3I61A 2CJXA 4R8RA 2NSYA 3GOHA 1W5TA 3UK1A 3AP1A 1U0RA 3H7IA 4RDCA 5E6RB 5EFZA 4EY8A 3W5VA 2JFVA 5K01A 1BMDA 4QM6A 4X00A 3KVNA 4H27A 4E5UA 1C0KA 2G6BA 2B7CA 2IY8A 3K70B 2OD5A 3E6CC 1NU8A 2QEQA 1P81A 1YZHA 3BP8A 4PYLA 4RVHA 4PNEA 3DDNA 1JKIA 4Y2PA 2B6HA 5B1DA 4LDRA 4OYLA 3SXUB 2C8KA 3B36A 3ELDA 3WISA 3ZWQA 3ZXUB 1KEZA 1NY5A 3AIKA 1BXKA 4KQFA 4PQYA 5EP2A 4DPLA 4ZV4A 3JREA 3D59A 1RRFA 5EAIA 4E5NA 5EYPA 3D3WA 1NJSA 2R1ZA 9ATCA 1W0TA 1Y6FA 3BR1A 1QDUA 3MVPA 1L5SA 4K9SA 3P26A 4N5MA 2R7QA 3OE1A 5C1IA 3FAZA 3SYLA 3IE1A 2POQX 3BGWA 1LPQA 2UUPA 4LFUA 4GI3A 2VBFA 4Q48A 2W2MA 3FIUA 3GFRA 3PNBA 3UTDA 4DQ2A 1PW7A 3DE0X 4OVKA 1RJFA 2ZXJA 5G4KA 2UYYA 4KPFC 3TOXA 4CF5A 2PMHA 5BS6A 4MV5A 2ZSDA 5AW7A 1J20A 4I6GA 3MLAA 2XHEA 2GTIA 5JSHA 4LJRA 4MQ6A 1NUTA 1OY1A 2IEGA 1U3EM 2R5ZA 3LW8A 5E2AA 3CMMA 4HX9A 2FG7C 5JZOA 2VHEA 5AKZA 3UUGA 1O8CA 2V5UA 4O4LF 2BZSA 3VHRA 3K6SB 1T33A 1R6BX 4BNMA 2FLVA 4CIVA 3VVMA 1FFHA 2M32A 1UFMA 1UDCA 3DFZA 4RSMA 4FEEA 3V80A 4URVR 5B66C 2ODAA 4J0IA 4Q6WA 4WUTA 3CKKA 5I8ZA 3SCZA 4DT1B 1XJ0A 4UUVA 4TWRA 1WE2A 2BE5F 4B81A 1VHQA 1THMA 4OHYA 2BGUA 2GK7A 3ZZ0A 2GCIA 3V1UA 3GGCA 4JL5A 4MR9B 1Z2PX 3BXZA 5CJPA 5HF5A 5JYBA 2SECE 4WN3A 2UUOA 3ODGA 4R7ZA 1CBUA 2HXSA 2ISSD 2ZCUA 4U2EA 4WADA 2O52A 4Z49A 4Z4IA 5AI6A 1SEVA 2XIQA 3OMWA 1JFLA 4PGHA 2QNRA 3EEBA 3EDYA 1ZR4A 1PR0A 1S3IA 2ZJ8A 2HC9A 2IYVA 5B1HA 4BGEA 2IIPA 3WX0A 5HIAA 3LAJA 5IDWA 4EA7A 3WYFA 3OPXA 2I33A 2MSNA 1KAHA 2QXTA 3MQ2A 4ZOLB 3TMKA 4YPOA 2EFDB 2DCEA 1G59A 1JT2A 2GZSA 2Y2VA 1QYWA 3CEAA 3DF9A 3LDAA 4S35A 2Z6QA 2ICWG 1MJ9A 5L9AA 3HNOA 3C0KA 5DX1A 1PFKA 3SG0A 3NYQA 2V96A 4HZUA 3NHUA 5CM8B 3UNXA 3MAGA 1V8FA 2VWGA 4LBYA 3HJNA 5DASA 1BA3A 2G4LA 3DE6X 3IHKA 3PNMA 2OQVA 5KC8A 1FTGA 4L5YA 3CO0S 1WUKS 5CR9A 2X0DA 3JAMK 4TVBA 4W1QA 2CY0A 3QWIA 2GAOA 4Q3LA 4Y3UA 3NHYA 3VNSA 3L9FA 1XTUA 3DXXA 1B3BA 2ORIA 2EBIA 4LFBB 4FN4A 3JPYA 1D0SA 3H2BA 3NBZC 4PLGA 2PRIA 2EOAA 2JIOA 1K8RA 2PZEA 2FZLA 3E7FA 2GLOA 4TZTA 3TFQA 5CFOA 2VSNA 2NUTB 1RQ2A 1FUKA 3BQNB 2Q4BA 1EFPA 1WIWA 2DQ4A 2FUG6 4BKOA 4P80A 4KPUB 2PSJA 1PK8A 4ZQIA 2FZGA 2G28A 3FXOA 2PJRB 2IUTA 5J1SB 1E4YA 1EP2B 1NUQA 2OWIA 4AIIA 3GLIA 5FKOA 1IJBA 4OH7A 3UWOA 3ZJYA 3L1KA 4BO7A 5BRAA 2YFKA 4EAAA 2VPLA 1NN1A 5LZ4A 2I7CA 2I2XB 2QTLA 3AG6A 2NVYJ 5EN4A 5JHHB 3DNFA 4JV5B 4ZDWA 1PZFA 1JEDA 4C4ZA 1VQKI 2A0YA 3KHTA 1EU1A 1R5BA 1EFLA 2X76A 3BX1A 4NIMA 5CXSA 2OV1A 3HTUA 2O0MA 2QMQA 3GJXC 1ZHHA 1ZA2A 3OPMA 4RPKA 5BW5A 2VKHA 3KUUA 3RVNA 2AF3C 1FDTA 5U1PA 1RPTA 2AN3A 4QGBA 1XQVA 1VNDA 3NV7A 1EGQA 1JHFA 3PXDA 1ZN7A 2Y0SA 2GNPA 3JX9A 5C8YF 5FULA 2QLMA 4PCLA 3C5VA 4Z0HO 1OB2A 2JJ2A 2ZJOA 3M1LA 1CUDA 1Z16A 2HDDA 3BDAA 1GGVA 1T29A 1XXHB 5ILVA 2B7EA 3EVAA 3PF8A 3QVTA 4YRLA 3BAFA 1J1IA 1NMSA 3OSGA 5E7IA 5ECGC 2XJ4A 2DQRA 3FZVA 1H0SA 3EMDA 4IYJA 1ZBQA 2WYWA 3J80A 1M1EB 1NN3A 4YRNA 4TYWA 2ZYRA 4OG2A 3TAUA 3PM1A 4TWAA 5LQCA 1RESA 4BO6A 3HHHA 4CU5A 1QZZA 2OHOA 2DY1A 3PQCA 4YRAA 4JWKA 4M49A 4OLJA 4PG6A 3C48A 3QVOA 3A4MA 3GNSA 5DRTA 4AKIA 1NQAO 2VN2A 2LNDA 2NXWA 1GXQA 3LCUA 3VNRA 1ZUD1 5FLYA 5CCXA 3FBWA 1QQBA 2P6MA 2Q3CA 3HJCA 1RKXA 3IC5A 2JD2A 4K9DA 1FP2A 3OT1A 4PLZA 5T8KA 1ISHA 2EILH 2OV8A 2YOHA 4JFRA 1DJQA 4CKCA 5C7IO 4P83A 4H1HA 2XB4A 5I47A 3WBBA 3UAOA 3RQIA 5IVPA 4C1BA 3A05A 3HWX1 2UUCB 1ZAOA 3IBYA 4FB4A 4TXNA 2QTZA 2M7AA 1SOMA 1SUSA 4QE3A 3MKYB 2FWBA 3CG4A 3OPQA 4HEJA 1QTQA 3BK7A 3H1AA 1HQDA 5SV2A 2KBFA 2YWHA 3IAEA 5F04A 2AFIE 1SFOJ 4IDPA 4OU0A 1VLHA 3FMFA 5SZJA 4H77A 1ZIYA 4KXQA 5F5LA 3Q0WA 3OTOB 3U60B 2QD3A 1Z5NA 1RHKA 2H51A 1EM8B 3QOWA 1HNWB 3NH9A 5E6RA 1THTA 1ZD3A 2P3SA 2Z2ZA 3CX7A 3WYAA 3OYGA 1SQ0A 4RFLA 4BFZA 5L51A 3QX3A 4HWRA 2VUHB 1RRVA 1GL3A 1GT0C 3CXRA 4NXMB 2PZAA 2YX1A 3I1IA 5K3AA 2C5EA 4Z4QA 1FJXA 3AFHA 1OH8A 1J0DA 1LLDA 3IQZA 4FWBA 1YB5A 1FT9A 3HFGA 3T35A 2VP9A 2J1LA 3FKQA 4KBYA 4FP9A 4WGGA 2HYGD 3OG9A 5EGSA 2E6UX 3ENVA 3B85A 4C0WA 3SYTA 4DQUA 3RBZA 4EI9A 5K0TA 5DDIP 2INGX 1DIBA 1FUEA 1ZD5A 3IQHX 1G9SA 4F7ZA 2DAPA 4EZIA 2IW3A 1XX6A 1H2EA 3MZHA 3Q1LA 5BUQA 4HQFA 2YHIA 1M6HA 5LRRA 1QNLA 3GDGA 5F2KA 4I7HA 2YJTD 2CLCX 2ZWPA 4BXFA 3DVSX 3KUDA 1NR5A 3TKYA 1PQYA 1MC4A 3ZDEA 5DK6A 3AP3A 1GARA 3P2YA 1VG9B 4LTMA 3VC7A 2IPQX 4FCWA 2QLNA 1Y0NA 2P6RA 1KVSA 1ZUHA 4J0FA 2ZPUA 5FNVB 1TQ6A 5KX5B 4ZTZB 5LQNA 3A1SA 3HNPA 4REQB 3QXXA 3EXFA 1U2ZA 1X2MA 1QFYA 3ANXA 3S2GA 3NS7A 2O7RA 3L3BA 1EF4A 5EWMB 1EUCA 4DQVA 3B6AA 2ZYAA 4NC6A 4GLFA 3E9MA 3PUVA 2FWJA 2X6WA 4BDSA 1JBKA 1TLHB 1KO8A 3HA2A 3KAQA 4MX8A 4X92A 5K8LA 3ILHA 1SXPA 4XUCA 2VJ5A 5CFZA 5DOVA 3ZOZA 2QLBA 2A07F 1O94A 4M9RA 1VE6A 4YRFA 1HYHA 4MGEA 4O4IF 4FJ0A 4JMPA 1XUOA 2FSPA 5LGUA 3GTOJ 2VZEA 3HYSA 1KP9A 3ISVA 3OQ6A 4BNYA 3JD3A 1UB9A 3HOXJ 2FEOA 2KPMA 2X8LA 2EK5A 1Z17A 2RV8A 3P97A 4OAOA 1OZFA 4JKIA 4RPCA 2YHUA 1MV8A 4K8RB 1X7HA 3WL7A 2P27A 4CLHA 3L8GA 2CKMA 2R8OA 3B82A 1R8JA 4C2UA 1V71A 4DYDA 4BX2A 4AYTA 1N77A 3AM5A 5JZ9A 2UUZA 1CF7B 4H60A 4FXOA 2O5VA 1JIIA 2PH3A 1JJAA 3V4VB 4OP1A 4MEXF 1UPTA 4PO1A 4RGUA 1N6OA 2EF1A 3QF4A 2WJJA 1J8YF 1EP1B 1GTL1 3FROA 4JBIA 3IS3A 4J0CA 1PT8A 4LZJA 2NGRA 4MEJA 4TRNA 5ALHA 1YR7A 4Q5IA 1PZGA 3LHSA 2HX1A 4HKTA 2O8EB 5DD4A 3R40A 1Y3AA 4XRGA 1OKRA 2HTJA 1U5TA 2WT8A 3SKYA 1NVAA 4RTPA 1SA0B 3DZJA 2I4LA 2Y0EA 5C4MA 5KNCA 1VTNC 5CIQA 2L9SA 5LQUA 3RVQA 3MWKA 3R7DA 4ARBA 3CIOA 2OA0A 1WDMA 3V7UA 3KUXA 2LD4A 2QMEA 2VHUA 4G1FA 4JLNA 5I8PA 5JCPA 3GLGA 1IN6A 4O2BF 1QZ3A 1EIZA 2V5VA 4Y2RA 3CUYA 3EZ9A 2DTZA 4FCYA 4OHPA 2JZYA 1GV1A 1YLFA 1EKXA 1RR8C 3HBLA 1L3CA 1PZMA 2J09A 2H48A 2RAFA 4QVGA 4WNCA 1FRNA 3OEWA 3VRHA 1H8EA 2O2IA 1YBAA 5DW3A 4IRGA 2FE4A 4DE5A 1F48A 1RVDA 4GX0A 2QAGB 3T7TA 4WJLA 4OJNA 1BFDA 4MPTA 2Q5FA 1ML4A 1QXSA 1OSNA 2LKPA 2ZJ5A 3AOEA 3H2SA 5IKMA 5BNFA 2CUNA 1H88C 1D5WA 4CR6A 4I1OA 1BU8A 5JLXA 2G1UA 4FEAA 1ZRCA 5B3KA 2VF2A 3ISTA 3ZHZA 2LCQA 4YCSA 1HDDC 1GNQA 3U2QA 2GESA 1E9RA 2DBBA 1HGXA 1TF7A 1N8KA 2W2KA 3FR8A 5EZQA 3K6RA 3RGWS 3C8UA 3E3MA 1P9QC 2PRJA 5KYUB 2VL7A 3VU8A 4AQ7A 1G3IA 3EZFA 3N87A 3W9BA 4E11A 4GL2A 2BY4A 4AP6A 4QDJA 2ZRAA 1EH5A 5HKKD 5K1YA 4WAUA 3ZKWB 2RSLA 3ED5A 1EZYA 2FBIA 1E9AA 3GZTB 4HQRA 4B0PA 4ETNA 4RWZA 3X1YA 5BSGA 3K4KA 1TU0A 3HA3A 2H85A 4KO4S 4P58A 4PRYA 4U7WA 1CRLA 4QXRA 3IAM6 4U3JB 1OYOA 3KYIB 3NNNA 3PJDA 1PI3A 3C2QA 1IXKA 3PI6A 4UFNA 5DYWA 4D80A 5ALTA 4XL9A 4JI0B 1U3VA 4CFSA 1GL6A 3B02A 4EX6A 3CF2A 2OCCH 5FI1B 3ZQQA 3K4NA 5CQEA 1NNUA 3DTNA 1BBYA 1JLKA 5CVRA 2DCMA 2HCFA 2QAGA 3KJFA 4RXUA 5DX0A 3RS4A 4QASA 1MG0A 1TQ2A 4U2DA 3SBXA 1JEQB 4ZRNA 4XYEA 3UHAA 2ZBRA 4PX5A 4I6ZA 2RHCA 4BMZA 3OQJA 4DF3A 1K78B 4XX0A 4LJLA 4RVFA 4TT8A 4CKWA 1YS6A 1PF7E 3GLHE 2DERA 3AR9A 3NYIA 4EELA 4AJ2A 3RPUD 3HM9A 4FDMA 2I6TA 2ZXFA 5LSAA 5IK2A 1WOMA 2H2DA 4Y2JA 5GM2A 1IZ7A 3OS2A 1O2DA 2FMFA 1TD9A 3MCWA 2IZOA 5H83A 4YI5A 3ADBA 2KSQA 3FOEC 1XA4A 1MB3A 3G2IA 4IICA 2EX1A 2QBYB 3ZY6A 2JFZA 5TQJA 1YZKA 4DIKA 3TG8A 2D5BA 5DI3A 1JDJA 3T3EA 3KE2A 3N2LA 4DL9A 1HMYA 2WJHA 3NETA 4Q3BA 3URKA 5HOQA 3WHLA 4ZDJA 3DP7A 3HBNA 5LYYA 1RIFA 1DX9A 3A8TA 4DCCA 3HVUA 2E1PA 1VM6A 4IDFA 5KOHA 2D74A 4IMRA 1D4OA 3A4CA 2IHZA 2WB1N 3RS8A 1QLHA 1WXQA 2Y0DA 3HJGA 4YAWA 4DSUA 1RWMA 1FRQA 1KOJA 1M6EX 3ESDA 1QVAA 2BFAA 1MPXA 4FU0A 4IZHA 4M71A 2C7GA 4HVLA 3CCFA 4X0GA 2ZSIB 3CZCA 4IHJB 2WWWA 2XWJI 5B7QA 2DRIA 5IU6A 1XZMA 5LXTF 2FMTA 3F3XA 4BFCA 1IOLA 2JA8J 4GBGA 3RAEC 3RRJA 3UHFA 2KJCA 5GZ3A 4N41A 1UJCA 2HLDA 3G5TA 4IIJB 3ZS9A 4J2HA 1AHPA 4CQNA 1NONA 4CEIA 3ZTTA 2VF7A 4F91B 1TU3A 4ZYLA 5BW4A 1MJ5A 3U7GA 4C3UA 3A36A 4TLBA 1U80A 2B2XA 2B35A 2PGLA 2Q2OA 2XA2A 3PD7A 3VDNB 1P2VA 1JXAA 1P1CA 3BL5A 3IWFA 3K4QA 1M1YA 1YCHA 2O23A 2A94A 5JDCC 4TT3D 3TO6A 1L8QA 1ONSA 2D2XA 4XARA 1S3FA 1G55A 4G3XA 4QECA 1QFMA 2SKCA 5ALPA 2FSGA 2GUGA 3IILA 2BELA 3M70A 4ITVA 3GQVA 2BPOA 2ZIUB 4EA8A 3IEUA 1EXWA 4KVFA 2SICE 2ZB2A 2FJ0A 1QH8B 5HP4A 5BPDA 3A1TA 3NR2A 1RWWA 5ARCA 3QZUA 4FETA 5DLYA 1DX4A 3TIVA 4RD0A 4H1VA 1SVLA 5ULLA 1D6MA 1IPHA 4QYMA 5SZIA 2H27A 4UXIA 4E5DA 1SAXA 4YJ2F 1E2FA 3C5CA 2XUQA 2I1QA 5AJZA 4Y67A 3GW2A 2IIQA 2HLNA 5YASA 2COEA 3A7EA 4LA4A 4U7GA 1LLFA 3UJ8A 3KEFA 5H6QA 2VDNB 3BE4A 3FHLA 2QX4A 4MIMA 3H9UA 4J4HA 3G5AA 3AFGA 1M10A 1OA1A 1ZISA 2W4IA 3BTOA 3E7XA 2HQNA 3HSSA 4ND7A 3RUFA 2CRPA 2M6RA 3QUQA 3ZDCA 2HU7A 5DN6D 3N0WA 4DC9A 1I3AA 2R7XA 1H9BA 3QPTA 2B1GA 4IX9A 4N03A 4PGAA 5JRJA 5ETJA 3OZWA 1ZN2A 1NVTA 3SM3A 3OYDA 2C1XA 3AHHA 4PNZA 1CTQA 3Q8LA 1D6SA 4BHPA 1FNMA 1HC7A 1SXJD 2AFHB 2G40A 2PKYX 3O92A 2YV3A 2YXNA 3R4VA 5DTJA 3WWOA 4BZXA 1KQPA 4F7WA 1KRXA 3A32A 5AW6A 1V6AA 3QP6A 2ERXA 3Q0UA 4OMZA 1IBSA 3CCLI 2JAOA 2DF8A 3D7RA 5LB2A 4DCJA 1ADJA 2SKDA 2FG6C 1QK5A 1YHQI 3OIQA 3RKQA 1AURA 3FB1A 4MICA 3VI3B 4A8JB 4C06A 4D0GA 2VH1A 4E15A 2IV7A 2BYTA 5BO5A 2RK4A 2V6GA 2C1ZA 3UANA 1PJBA 4JJZA 1CUAA 2QUZA 1LSJA 3QVUA 2ORYA 2PWPA 2PA3A 3GMTA 5D3ZA 4YP9A 1DUVG 4X8MA 1NVDA 1V5IA 1T3SA 4I50A 2Q9AA 2C7RA 1TT5B 1IRFA 3F6VA 2OXEA 3DD5A 3WGIA 3FCXA 4GPEA 4UPDA 4Y18A 3WZLA 3ZE0B 1T8IA 4PJNA 5HM8A 1F43A 3R9XB 1N0UA 3PUYA 3EWIA 1ABFA 4LGWA 3O90A 5F5NA 3R7AA 5DO9A 2XYPA 1MSFC 1Z22A 4TV9A 1SVKA 1YCGA 1CDOA 1FVOA 1XEWY 1ZMTA 3DKVA 1ON2A 3GGPA 2BBYA 4Q4LA 1UJ4A 1HLVA 1BJAA 5NLLA 3GZ5A 2I6QA 2I6FA 3NQ41 4RMJA 1U8BA 3ZXSA 2P68A 3N75A 1W5SA 4PO9A 2WD8A 5LZ2A 4ARIA 5LMUB 3B6JA 3KKOA 4MIYA 2DPLA 1ZXLA 1Q11A 3QYEA 1U1GA 2GT1A 2EIMH 1LC0A 4IGEA 4UV9A 4F4HA 4JLAA 1SBCA 4EY7A 1XWWA 3WNVA 3RM3A 2QW8A 5CB4A 2R8ZA 3M34A 3W3AD 4E3ZA 2R7NA 3FISA 1CP2A 1RQLA 3HVIA 4IDEA 2VLAA 4YQYA 4BV3A 5AESA 5H5JA 1OLUA 3JAKB 3AERB 1DAKA 1FMJA 1HYBA 1UXJA 1VYUA 3AAFA 3I09A 1VSVA 1P0FA 2I1WA 3O2QB 2OA4A 4W1PA 2NYVA 4B6SA 3RYFA 4E51A 1PJCA 3IUNA 4DM7A 4B32A 1TTQB 2W2QA 1AQNA 3EIQA 5DEOA 4IGIA 2V4ZA 4UNIA 4GQAA 3G9XA 3O8RA 4PG5A 2J7PD 2JGDB 2ZR0A 2Q2EA 1BKDR 3WWZA 2XDQA 2PM8A 4U87A 1R9TJ 3M2TA 1DP4A 1KQGA 3JCUC 5IAOA 3H5AA 1QH9A 1XD2B 2HWKA 3PKZA 2YNMC 4TLAA 2WA2A 5JRDS 1VL1A 1W7PA 2DA3A 3IL2A 3LY7A 1DQSA 3PS9A 3DTIA 4GP7A 3GK3A 2V45A 1RBYA 2NVBA 3EIUA 4OXXA 4A3BJ 1JDTA 1Z29A 5BOXA 3GP3A 4W9NC 4PSKA 4EG8A 4NY1A 3RTEA 2E1NA 3ZGLA 3PUFA 4LK2A 1H4QA 4NCJA 4FT2A 5DP1A 2PKRA 4LYJA 4MTLA 1T8RA 3HBFA 3PC8C 4IHJA 4QARA 4CF6A 3J7TA 4MV7A 1PDWA 4RZ3A 4ER0A 4MDEA 1PV2A 4XOUA 5U4XA 1LBSA 4A7PA 3VR6A 1WHTA 4HNTA 1JXOA 1A2KC 4EUFA 2FJPA 2IK8B 1I32A 4RY0A 5E7MA 1OLSA 4XN0A 1W19A 3R3VA 3RVSA 3U1TA 3ZDQA 3JSXA 3FTEA 6ABPA 3C70A 1R3UA 2YV1A 4GP9A 3QXHA 4ZQHA 2BOLA 1D5VA 1PZEA 2DBQA 5CMLA 3WQRA 4B3BA 3GN1A 2O7NA 1WTAA 3TSCA 2VZ8A 4RK1A 4PRKA 3KB6A 5JT1A 4BV2A 1BD3A 1K86A 4JT9A 3OUUA 4CDRA 1K5HA 4WY5A 4YXWD 2DU8A 3ROKA 3W9YA 3WGNA 1OLXB 2VQSA 4TMYA 5LKAA 3WTBA 2Z09A 3KZCA 3MWEA 3O4FA 4NSNA 2FLKA 3OEHA 4GPTA 3LLMA 3ETGA 4MQMA 3ZNNA 3I3SR 3A58B 1AUQA 4MYUA 3SLRA 3RC2A 2ZYSA 4Y2XA 1Z4NA 1MCZA 2W6JA 2ENUA 1HFEL 3MS7A 2UZ1B 1WJ5A 4J4BA 4Z3DA 5CG1A 4XUGB 4ASUA 1H4TA 3W5BA 3I62A 5DYIA 4YNBA 3SXUA 3EDPA 1TBXA 1WUHS 3BWXA 3C1DA 1SHZA 3CNHA 3EGXB 2Q3DA 2O8CB 2YYYA 2YBDA 1RIIA 1POGA 3UAWA 3PSHA 4W6QA 2NUBA 2ZLBA 1FX0B 2OXRA 3E5RA 3K0FA 1NZFA 3QTLA 4AKTA 4B4VA 4LNHA 3OJCA 1O0SA 5DH9A 3KOOA 3VUEA 2XEDA 3CJRB 3FZYA 4YO7A 3SU8A 3MWYW 1VHLA 2NU7B 2OY0A 3HFJA 3P0EA 3P9SA 5IX8A 2NTJA 4H7KA 5FUMA 1VMIA 1YO6A 2VBGA 5FQNA 4LBWA 2BDEA 1KIFA 2HJGA 2H1LA 3UK2A 4DAEA 2ZRIA 4CIWA 3OYHA 2BM8A 2HCRA 4QYIA 4IMPA 5M3BA 3GVXA 4IHXA 1ZOOA 2LIVA 2R1VB 2AMLA 4Z8YA 1OB5A 2XMZA 1V4RA 2XX3A 2FBKA 1XMXA 1JJIA 1WCV1 2W6CX 1S2GA 3C4QA 5EWJA 3QXJA 2FDRA 3LYLA 3AI1A 1R36A 3P2JA 1J5PA 1OF1A 2Q3HA 1U8AA 2B3DA 1PFYA 2IA0A 1G6OA 3F8SA 3QH4A 4L6CA 5FXMA 5M29A 5IYBJ 5FKLA 2JRLA 2YRFA 2Z83A 3A2MA 3KFLA 5LU9A 1QRTA 3DV2A 3V1NA 2PBIA 1JHZA 1SUFA 1CY2A 1PL0A 4GGMX 3BMOB 4WFKA 2OMEA 1R74A 2JFXA 3B6IA 4FCTA 4XDHA 4P31A 4D4LA 4YAUA 1TVKB 1O0BA 4CM3A 2J5KA 2YZKA 4CYCB 4AYBN 3O95A 3QU9A 4L0CA 4NFYA 4ZGWA 3KSBC 4OSPA 1ELOA 3F8WA 1DIAA 4OGWA 2R2AA 1OQAA 1C4WA 3EXEB 1G2HA 2PEYA 4RF3A 3LOCA 2DUUA 4OKSA 4WJZA 4ZEOA 1QX4A 3MPOA 4V0MA 5IKXA 3D1VA 2EZUA 4F4UA 3KSAC 2XCIA 1C0PA 3KQSA 4IZIA 4DNFA 2O57A 2Z4SA 4RS8A 2AB0A 4JI1B 1X9HA 1HA8A 3Q7RA 1H1LA 1NYLA 1R0CA 1XU9A 4M21A 1BDJA 3AKEA 4A6EA 2K4BA 1EWTA 3ORFA 4HFNA 1SU7A 1QQIA 1G2PA 3PR3A 4HAXA 2G5TA 1D1AA 5THXA 4EJFA 1XSVA 4MUFA 3ILVA 4ZO6A 3WLRA 1P4WA 3BCBA 1WPRA 4N4OB 1R18A 3ND9A 5B1SA 2IWRA 3UWPA 1C0IA 1EB9A 2QVCA 2XMDA 4NI5A 3T52A 1EUZA 1PLLA 3ZI4A 2XF5A 4KBGA 4Y2SA 3RTDA 3AVWA 3D02A 4IFBA 1V8OA 1HI9A 1ZH2A 4KGVA 5DM4A 5K8CA 4PR3A 5FUVA 1XZQA 2Y1EA 1FIUA 2WWGA 2ZSHB 3EODA 3TQFA 1WF6A 3LLSA 3U3XA 2P5VA 2PLAA 1UMCA 2DCUA 4IF6A 5AVXA 4AYXA 3KPHA 4BO4A 5H1YA 1KK2A 3H5WA 3WJ1A 4ZAFA 2NO1A 1H23A 3GELA 3BWDD 3T3IA 3TZBA 4ZGBA 3NHLA 2XMPA 4RD3A 1ORTA 3S4YA 3TRJA 2PUVA 1UBLS 3D4BA 3CLSC 4PVCA 5JLWA 1RYZA 5AIPA 4LVNA 4LTDA 2B1RA 1NXTA 2WYUA 1ARZA 5TRTA 4BUJA 5BOSB 4ZH4F 3A9WA 3IYLW 4IXMA 4U2CA 5B6IA 3C6KA 2HGCA 5KIAA 3DF8A 4EO4A 2ZJPF 3GJYA 3W2AA 2XB0X 5LHIA 1V2GA 3LS2A 3A4YA 3QOEA 3JR9A 4LVOA 2MBFA 4RORA 4TGLA 1IW7F 4WDRA 4C3VA 5JFOA 3OPYI 4QZVA 1COWA 4DA0A 3KR1A 1FBSA 3JYNA 5CBPA 2JK0A 3UICA 3ZBTA 2B61A 3KC2A 1F2VA 1LVGA 1WWKA 1NASA 3NBUA 4PRZA 3OS1A 4IF4A 3WGTA 5F51A 4C22A 3FSRA 1GPWB 3L7AA 2PJRA 2DO7A 4TXJA 2ZO4A 5A4FS 3P2OA 4TZ0A 1J56A 1RMYA 5AW2A 2VDMB 3P0HA 3EUHA 1KRHA 4HNGA 2CBGA 1YI8A 4DV0B 5FUQA 2ZFUA 1TE2A 2V7BA 3QKWA 1IHDA 3RSCA 3WP0A 1RJ9B 3LC1O 3KYDA 2PR7A 3E3LA 2FEMA 3NYWA 3VC2A 2VIXA 3M0EA 1TYEB 2JGDA 4ZCRA 2IELA 1RI5A 4V02A 3I6ZA 1MORA 3BXGA 3TLCA 2PH7A 1UM9A 1QWSA 1JYSA 2QUIA 4JIMA 5CAEB 2G7MC 1T24A 3ZHQA 2QCOA 1NFFA 1QH1B 1REQB 1Z0ZA 2JA1A 2NAFA 2PDAA 3ZBQA 4BX8A 2GZAA 3CPJB 3O4JA 4JEUA 5JSKA 2YCBA 5JXJA 2ZBKA 4B17A 2QYOA 3H1EA 3H35A 3QHAA 1OXKB 4FLEA 4CMBA 2D6FA 4E7KA 2ZG6A 2WY8Q 1PN3A 3F6PA 1KJJA 1LE8B 2HU2A 5BSKA 2PO7A 1Y5RA 3V8RA 3N1UA 5IJWA 2PJDA 4MGYR 2NO4A 2BHYA 1UK8A 1T6YA 2F6CA 1XKQA 1H42A 3CQ9A 3QEJA 4IRMA 1CUHA 3MWMA 1ECLA 4J91A 5IAGA 4QSHA 1Z8NA 2CZGA 2W6OA 5EF6A 3U40A 1NJ2A 3FYCA 4XM0A 1CWUA 3TQCA 3M6UA 1B6SA 4FLMA 1RTTA 2ZW9A 4ESJA 1DFHA 4K6FA 3NEPX 5DM7F 4HDRA 5EZYB 5CRIA 3QVGA 2AR9A 1MH1A 1QNFA 2XKAA 4O2RA 3NWSA 4BEBA 1R9MA 3JRNA 2R1VA 2VRCD 5I9LA 1EFUA 2F4IA 1SOWA 3RKXA 2GM5A 5CVUA 3NKLA 3SSNA 3IEIA 2WAOA 4QT0A 5L3FA 3WIUA 1JA1A 2NZWA 3Q3HA 3RF7A 4KICA 2YWEA 4G0OA 3KTDA 3STTA 3ADKA 4D8WA 3K10A 1UMDA 2HZ7A 2ZRQA 3C2GA 1EWYA 3BJRA 3C7JA 1FQIA 2RHLA 3R41A 5E3HA 2BRUA 1HMPA 4CBVA 2KLHA 4LSWA 4MMYB 4ZJYA 2J4CA 3HJUA 3WXBA 4EARA 4QLOA 1R58A 5IVHA 5HODA 1F60A 2F9LA 2J3DA 4PZ9A 4B6FA 4C7OB 5CJ9A 4PQFA 1WB6A 4JHXA 4F0JA 1HOMA 4G1VA 4M83A 4BNNA 4P96A 1U8ZA 2WHYA 2XOXA 4XKJA 1QCCA 2BIFA 2QTAA 3K9WA 3OEED 4NX2A 4UEOA 1VMKA 1JE1A 2P30A 2LRHA 2WYHA 4TX1A 4UE2A 5A04A 4FD3A 4DILA 3FRHA 4UOZA 1QGOA 4ZAWA 3RASA 4ER6A 4CGYA 2WV7A 3D6AA 3OIYA 4JCOA 1O4WA 4JXXA 3ZMSA 3N7UA 5EYRA 2WM8A 2Z43A 4S05A 2H11A 3GL9A 1K5DA 2A68F 2L01A 4XN3A 1A2OA 1VKHA 2ODEB 3IO3A 2VTBB 1DKNA 4L75A 3T1QA 5K3OA 4EHAA 1YRYE 3S2HJ 1A5AB 1BH6A 1N6NA 2CFXA 2KRFA 4RM2A 3R0XA 3TSWA 4DG9A 5LOVA 3LPNA 2ZKIA 3RKYA 1U4OA 5E0KB 4LJ7A 1GPH1 1DBWA 3UKGA 3HP4A 2ERYA 1XD8A 2C29D 3I0TA 5IOYA 2O6HA 5M3FJ 2W42A 3E48A 3ONVA 3KDSE 4N8EA 2FAXA 4RK6A 3VOAA 1YZQA 2CNOA 1NVVR 3NAZA 2K9MA 4II3A 1KA9H 2I55A 3OO1A 1J42A 1E3QA 2EQRA 1Q7BA 4CE6A 5BMVF 3W4IA 3WHBA 1ZVJA 2GCEA 4UU0A 4EMSA 4H3HB 3EXHC 1YUNA 4ZFNA 1U1DA 3IRQA 1CJTC 2YX4A 4KNYA 4J2TA 4L4SA 2ZRFA 4BCDA 4B34A 1GU1A 3OIGA 3P5BA 2BW0A 5BV7A 1UK9A 5HSGA 1XGSA 3GUCA 4BNHA 1E0AA 5EIHA 4F5EA 2X5NA 2GR9A 2KM1A 3FMOB 1P9RA 1W48A 1DUXC 2AOTB 1Z82A 3GZJA 3IPCA 4M3NA 5TX7A 5LP6B 5ILUA 1ESEA 3SYNA 2QL9A 2CSXA 2N3ZA 4ROSA 3L8ZA 3D6TB 3PK0A 4C2TA 1TC3C 4E7LA 1O58A 1PJSA 3AG5A 3GG2A 4FFVA 3U4GA 2IHNA 4IIFA 4WOJA 4HOYA 5SY4A 2CFSA 4IPAA 1XNQB 3IEXA 4L9TA 1F6DA 3DO6A 1XTAA 4GWGA 4PAGA 4YJFB 4LG0A 5H9VA 3GUUA 1XNJA 4BLOA 2CKDA 4JGIA 3W3ZB 4RPIA 4BQFA 4YWHA 3U62A 4YAGA 1JWAB 1L8OA 3B8HA 3RR2A 1UBFA 4IVPA 1IMJA 3SQXA 3AVYA 3X1JA 4LJSA 4Y13A 1DCMA 1L4GA 2AO9A 4MQ4A 4E5SA 1O54A 2E4ZA 1QB7A 4LY3A 1YVEI 2LFBA 1Y89A 4OXIA 4TYPA 2G04A 1TQ4A 4FD2A 1LY1A 4MUJA 4KAAA 4HPQA 3LFHA 5B1AH 3S3MA 2A0KA 1I4LD 1VQ5I 1F8XA 1X1QA 1YZYA 2AZDA 2J6IA 1G5RA 4GBED 4RVNA 1T56A 2YSRA 4DGQA 1T6SA 4GXOA 2BE7A 3N76A 2HU9A 1YU9A 3SEQA 1YJAA 2OAQ1 4WCFA 4F4FA 5EP4A 1PP7U 1M8GA 3COAC 2LR0A 2NU9A 3OZUA 3R6LA 2TMGA 3N59A 1YGYA 3KZNA 4EQ6A 3W5AA 1NVEA 2VE9A 3PUKA 1I3QJ 1SOAA 4DZTA 3HVJA 2AN9A 3VZCA 1TC2A 2QRJA 3BGDA 2ZE5A 3O0DA 1FUUA 1PNQA 4O63O 3VC1A 2C1EA 4W1RA 4QDZA 1LC3A 1TK3A 3EJWA 4QL3A 2Z33A 2ZJ1A 4ID9A 4M53A 5FROA 3EISA 1SCQA 1VECA 2AHOA 2E4YA 1BN6A 1WDWB 2VTVA 1MEEA 2BI8A 4G8JA 1U5TC 3ML6A 2NQ2C 2GXUA 1R4NB 2XGCA 4BFUA 5T67A 4LOLA 1TRHA 4HFMA 4Z51A 1Z6PA 4CEIB 3HUUA 1GV0A 4GRDA 1W2WB 3EGEA 1M2EA 3UV7A 1DEKA 4AJIA 1UBTS 1G1AA 4XORA 2Z2KA 2JARA 4RTKA 2FPGB 4DMUB 4DV5B 1M6YA 3SZGA 1OJ7A 1FS6A 2A4MA 3L1HA 4XA8A 5C8ZA 2CJPA 1YL6A 3GA0A 4F9TA 1Y3HA 2W6PA 4R41A 2PMUA 1JHXA 3HNRA 3PRYA 2WF8A 3FKSA 1LBIA 4IHJF 4AS3A 1WMFA 3LBIA 4JQCA 10MHA 3NAMA 3MCVA 3C3CA 3OZCA 3QVVA 5T3UA 1T2DA 2ZAOA 1DDNA 2Y1XA 3TGNA 4F45A 2WSMA 4P35A 4ZVPA 1Z39A 2I80A 3EOZA 5CVJA 1XRMA 4QYXA 4TKZA 4U2FA 3U7IA 4DMMA 4F21A 1UMKA 2VOPA 1GV2A 2BGRA 3BR3A 5A7GA 1AB5A 4QG3A 1H3FA 5COQA 4JX8A 1MTZA 3ECSA 2IUUA 3SJUA 5IDQA 2FSVA 4OMDA 3BJ6A 1P29A 4CL0A 5EUBA 1WS6A 4RENA 5J2TA 4DCMA 4TOIA 1HT3A 2A9PA 2XQIA 1XAIA 4IIGA 3H3XA 4M1OA 1T0FC 1KEWA 4KI0A 4FT8A 2P1DA 1DU6A 4MMXB 2XQGA 5DHAA 2V7FA 1YTYA 1OV6A 4HAWA 4XYBA 5LYJA 5LLTA 4JVSB 3G2BA 3BG6A 2RCYA 2DR0A 4IDGA 1JHDA 2E6KA 2W93A 5L45A 1Y8QB 3IALA 3FB4A 4QYSA 2WB1A 5JZSA 2RK6A 2NMVA 3OU2A 3RS9A 1RXIA 1EFTA 1JEQA 1QR2A 3Q0EA 4KW7A 4XFJA 4DDVA 2PEXA 3A1DA 4KIBA 2LCFA 2VYND 3A6ZA 4UTVA 1RC9A 4GZMA 2QYSA 2HWYA 2XPVA 4KDRA 4LXXA 4NECA 5BSUA 4DZPA 3UMJA 1T3TA 4FUQA 1PX2A 2Q1TA 3H92A 1Y8AA 3JQEA 2KI5A 1X3LA 3PQ2A 2QM3A 4E7IA 2VP4A 2VP6A 4EVRA 1M7GA 2BY0A 1ZMRA 1S9HA 2BHRA 3DE4X 3VKHA 5F08A 4MAAA 3VFDA 3FYSA 2OM6A 2BDTA 2RGDA 3D4LA 1JKJA 4U0WA 4CETA 1VL0A 1Y5NA 1C30A 3L1JA 4MVJA 2CVZA 1NA5A 1E9BA 4LQCA 3REQB 4BWVA 3LAPA 5IKEA 3GLVA 3OCYA 1XRJA 1XZEA 4EKIA 3BZ6A 2QMZA 3LYUA 4L08A 4LDZA 4M0CA 5FEMA 1Q2XA 1OZHA 1POWA 1ZKMA 2HB6A 1U5CA 3ANSA 3DE1X 3FPCA 2FEXA 4B2IA 5K3EA 2CGPA 4Q19A 1JTXA 3SS7X 3A4NA 2P6OA 1F8YA 2R9VA 4UVIA 5H3CA 1DFGA 2B0JA 2WAFA 4K9OA 3WWPA 4B7XA 4DNXA 1JX6A 1EGMB 4QREA 2PFSA 1RETA 4UZFA 4NOMA 5AKXA 3UA3A 4XJXA 5JOQA 1OOEA 2M6SA 1NLZA 2AZMA 2X0JA 5AT1A 4W4TA 3R9WA 1WJAA 2JASA 3NM5A 2JAXA 2R5YA 1TM5E 3HN7A 4TSKA 4D9IA 3F5DA 4YJ2B 3IAAA 5F3WB 4UHTA 5A2QA 1FMWA 1B72B 4WASA 4V0KA 5DM1A 1NWHA 1D2AA 1ESMA 3HIFA 1JW9B 1KQ8A 2IPAB 4Z0PA 1YUBA 3FRIA 2Y0PA 4ENRA 4FC7A 1I33A 1RVV1 1E4EA 2Q0XA 3W3CA 2IHBB 3ND6A 4HLCA 4J0HA 1OHHA 1RM0A 3HCEA 2XODA 3Q7EA 1F8FA 4K2HA 4PYKA 1KOLA 5H8WA 4J1TC 4FC6A 1TT0A 4H7DA 4YRRA 5HFNA 1ZKGA 3F71A 1T2UA 4O2BB 4LGVA 1T3HA 4FX5A 2G9NA 3THXB 3JQBA 3RU3A 1SH7A 1T0JB 4G0MA 1E79A 5HR5A 2V4ZB 2O5CA 1N2OA 1E79D 2VYCA 1MG5A 3COWA 4H15A 2R8PA 4AKSA 3DVRX 1DAGA 1QGZA 3KJHA 3QBVA 2NUAA 3M4XA 4YCNA 3DH0A 1Z3YA 1AB6A 1ZSVA 5EPUA 4TROA 3LO8A 2P9YA 2YWJA 2R5NA 4LB6B 2WWVD 1BDMA 1YBVA 3OUZA 3MTAA 4JLJA 3IESA 1N8TA 2X5XA 1F3OA 5AOCA 5TVKA 3OV8A 3PX2A 1QUEA 3T5BA 1IZ8A 2H4HA 3BQMB 4X9XA 3DBHB 1H6BA 2IIVA 2WYVA 2HM7A 2BY2A 1O08A 2HXOA 4DLZA 3DL4A 1UELB 2FSWA 3MOSA 1RYYA 4GKJB 1E89A 1PGPA 4I08A 3ERMA 4OQQA 3BZUA 4Q1FA 1MAAA 3R7WA 4FZVA 3IOYA 4AM8A 2C3PA 1W4LA 5C46F 4MEBA 1NLYA 5FOWA 2XQFA 3N53A 1SEUA 2OO3A 4ED9A 1O6CA 1PR4A 2H1FA 4MV4A 3AGPA 5EC8A 1L5QA 2GD2A 2P2ZA 2QKLB 4TS3A 1SMTA 1NFQA 3GEHA 4IL5A 2E48A 4BHTA 1T5DX 1LJLA 3IKJA 3FHJA 3VNBA 2P62A 3CMAI 1ULZA 1JDBB 1TO2E 3GMSA 2WG1A 1HOTA 1E3LA 1G2OA 3ROGA 4ISCA 3ABTA 2QVGA 4B6OA 1ZDMA 4J3JA 3ER9A 1YKFA 3TD9A 1Q14A 2G80A 5EXEA 5C7OO 3NYRA 4C89A 2EFOA 2XPUA 1W581 4ON0A 1X94A 2CS3A 2HMTA 4H4CA 5IEBA 5TSDA 2CJWA 2PN1A 4P08A 3AR7A 2QZ8A 3GGJA 4RVCA 2UZ0A 2EFEB 4BDZA 2I7DA 1UMBB 4HQMA 4HCJA 1GRRA 4WLFA 3WKAA 4TS4A 2JL1A 3M5CA 1PFUA 1U0LA 3PHHA 1CCWA 4FGKA 2LUOA 4XR9A 4YBRA 3LM8A 4JBWA 4XYGA 5IJXA 1C3OA 2A86A 4LNUB 4O4LB 2HEIA 5BT8A 2MD5A 2QGFA 3LY9A 3NBQA 4HS4A 3VO8A 4JI4B 1KWGA 1F2TA 2VSFA 4OMYA 4J94A 5FFFA 3WADA 2FMYA 5KI6A 4AJJA 4WK8F 2QU7A 3DYIA 2X1DA 2PGJA 3K7AJ 4HJXA 4OYRA 4C3OB 1L5MA 4O1MA 4ZIRA 4PNPA 2GJ9A 5GAEJ 1JIVA 2OK8A 2YZMA 3G17A 1S7OA 4CKEB 2FXIA 4HWKA 1HZJA 4MZDA 1B7GO 2NVUA 3W3AA 4YP5A 3M6FA 1YS1X 2VODA 3M3YJ 1UDBA 2X7HA 3D8HA 3O4IA 4IYRA 1BI2A 2VJAA 4D8XA 1OTXA 2P5UA 3MRSA 2QTNA 4OQFA 1LDKB 1KMNA 1EAMA 3MMZA 1SM4A 4KXWA 4MVJP 4V0QA 5A6VA 3IPXA 3KTAB 1OX6A 1NHAA 2HLHA 3AINA 4NZZA 4E7JA 3DA8A 5J1TB 3U1VA 2GD0A 3KQTA 4ZI7F 4QIHA 3FWYA 2AOWA 2JCYA 2Y1DA 3L8MA 4YR7A 3NRVA 4MO7A 1I7DA 3CG0A 2C07A 3C43A 4WY8A 5G2OA 3KU4A 1M6VA 2J3HA 3I0NA 4EHNA 1UIRA 3TL6A 5KVRA 1ZD4A 2JFBA 3ZQCA 2AIRA 3KSRA 2R7FA 3W5IA 4CCWA 4PJJA 2IEZA 3A4IA 2CJFA 4RFVA 4NQRA 4J49A 1A8UA 3RBAA 3CTAA 1Y8ZA 2OORC 5EZSA 4B85A 6GPBA 4X5OA 3Q9VA 1XMSA 5ILSA 1WU8A 1YCFA 4X3CA 1VIYA 3GT4A 3AY7A 3QV1A 5F78A 2WAQN 1XVLA 5FADA 5DM60 3E9RA 3RJMA 4EKEA 1UBRS 3M83A 2A5GA 3GWZA 1ZK3A 2W8ZA 2Y2UA 4N6GA 2H2FA 5AJVB 3C41J 4REOA 3KQLA 1VJDA 1CY6A 3EBLA 3ERED 3BGVA 1Q0QA 1RAHA 3NJ4A 4R1PA 4D9NA 2XZLA 2PGAA 2JGEA 2AQHA 4HEA6 3J7ZI 1TVKA 2NVOA 4YASA 4ENPA 4J7XA 3O6VA 3F78A 2QWWA 3NGMA 1ZZGA 5LMCA 4KMUX 4RTRA 1CYEA 5LHGA 2JLBA 2X9GA 2HSZA 4RHXA 3AFNA 1AHDP 1QFZA 2RBGA 5DLDA 3FPGA 4ABYA 3HLKA 4MR8A 1JFVA 1RI4A 3H2HA 2DKFA 4NULA 4UM8B 3AEYA 5EG5A 1R0YA 5AI5A 4EYGA 2RGCA 1E64A 5KZMB 1QF9A 1YOVB 1RMTA 3OMLA 1L9KA 4HWSA 5DNUA 4PHCA 5CDSA 1AK9A 1EZTA 3UB4A 4CF4A 2JTVA 2O1XA 1QP4A 4YFKF 4LRQA 1TP4A 3JVVA 2ID3A 1J99A 1FU8A 2FSHA 3CH6A 5KAIC 2E1MC 1GO2A 3CT4A 3OE7D 1KI9A 1N1GA 3BG7A 3OCZA 4FKMA 5E1OA 3A9UA 3E23A 4NV3A 3WLKX 1L2TA 2G08A 5EERA 3F96A 4RK5A 1RRMA 2PGXA 1VIDA 1K78A 3E9YA 4XX0B 5CYOA 1HDGO 2X0FA 2XYHA 4AVYA 3ZCUA 3F22A 4PR0A 5L95A 3ETHA 5FYDA 3FFAA 3WTCA 4KITB 4ZYEA 2JJ1A 2DLLA 2DQKA 2HWWA 3DNMA 3DO5A 2D5LA 3LA8A 4WZBA 4YP6A 1CY7A 4KR3A 4CKWB 4J1SA 4RB0A 1NDQA 1IEQA 4TKUB 2VJCA 2WOJA 1DIOB 1VGQA 2PKEA 2OBNA 4Z9XA 2ZXWH 3H6KA 3HN6A 5CT5A 3EH2A 4PZYA 5BMVA 5FOXA 5L40A 4HQLA 1VXRA 3SMQA 4GVLA 3LHDA 1JKOC 3JALB 4D0NA 2Q8NA 3PZRA 4MUAA 4J1TA 4HWGA 3WNQA 2QUHA 4D8UA 2D5AA 1VL5A 1XYYA 3DZIA 1AK1A 2A30A 5B1EA 2EJCA 3DMPA 3BXOA 4MYRA 4PSVA 3CNNA 3REOA 4PEVA 3MCAA 4BP3A 2YUSA 2HV9A 3KP5A 2WIJA 3UHOA 4ZCMA 3LSHA 2VXZA 2NSHA 4PFJA 4EG5A 5IASA 1BVYF 1JSXA 2K6GA 2JAHA 1XAHA 3NIGB 1K7EB 3UWSA 3K0AB 4I1IA 1FW6A 5AM5A 3ZY5A 1JR3D 3BGIA 2AQKA 2F3QA 1IONA 4UOQA 3RFFA 1KAOA 4MJ3A 2YJGA 1J70A 2VP3A 3L77A 3TPCA 3K7EA 3RUDA 1DXYA 1LV8A 1XCBA 2R7OA 1QK3A 2CD7A 4HZUB 1YKGA 3U3KA 2HRZA 3CCJI 2JDIA 4Y15A 4JI7B 1Z1DA 1VLVA 1WV1A 2CMGA 3H4MA 3ITEA 5KVQA 2L9VA 3R4CA 4FZ5A 1L3BA 5BN5B 4F2WA 2Z99A 4LX8A 2KRHA 1Z4PX 1JJVA 3R6DA 1DAOA 3ICCA 1QZEA 4J29A 4B0OA 4BRUA 1H2HA 1ODSA 4L8VA 3CD6I 5F76A 3KJQA 1QZXA 2RH8A 2O8DB 1T8PA 2XW6A 3DMFA 5EIAA 4Z7QB 4AP9A 4YFVA 1R7JA 2EW1A 4R8HA 1QX3A 2WSYB 3PNKA 4D9FA 5BQ3A 3DNPA 5L4LA 2GSWA 3CLSD 2C4UA 3NXSA 4PE5B 1G20A 5H02A 4RBNA 3WYGA 3VAYA 2OCYC 1ZK8A 1WV0A 3IR6A 1SXQA 4ZEVA 2V9PA 2WSIA 2YV5A 2R7SA 3K6GA 1MLDA 3BA1A 3JWJA 5DGHA 3FMQA 5K8IA 3IAM2 1ACMA 4OFWA 2DJIA 2H5JA 3R5TA 1WSDA 3DDCA 3AT1A 3PDHA 2YXBA 4MVCA 2XGSA 1DBVO 3CCEI 3ER6A 2A5LA 4J16C 4BNWA 1UEIA 4W9NA 4RK4A 2EHDA 3VVLA 5FV7A 1I3KA 2FJUA 3E9EA 3HUFA 2DWCA 2HSDA 2VPRA 4LJ6A 4CT4B 4YIHA 4M99A 1N2EA 3NVKI 2WU3A 3HBJA 1U5BB 1ORKA 2J85A 3E4CA 4Z99A 5JHGB 3G2QA 2WMDA 2XCRB 2FFJA 3ID6C 2VBYA 1E3DA 1JU3A 2C5SA 3FR7A 3IBTA 4FEGA 3MPUA 1WXDA 1JHYA 1NW6A 2WWFA 2IRWA 3FFBA 4JYMA 1JIKA 5C5DA 3FPHA 1MQSA 1E69A 5ALIA 4BE0A 1VE5A 2J5BA 3ZOBA 4EB3A 5LD2C 1V8DA 2A1TS 2PTGA 2QMUA 3PNQA 1XLTC 3LCJA 4XCQA 4Q3KA 2H8RA 4LF7B 2E21A 2J31A 1LQ1A 2GO1A 2Q0QA 2F62A 3HY4A 3L7BA 5TQ0B 3SHWA 3TLGA 4CMIB 1BGVA 2GN6A 3RCBA 4KACA 2AFHA 4IMJB 4JJGA 4LLGF 2OBLA 4EHDA 4IX7A 5AKHA 4ALNA 3BB1A 4Z9FA 4IBOA 4KNVA 5LHHA 3CA8A 2JFNA 1P3Y1 3NBFA 3OJWA 1NMXA 1E4VA 2B7BA 4KAXA 4B83A 1JLSA 3OR1C 2YFHA 3P7NA 1DOZA 2GILA 2PA0A 4CMEA 5JNUA 1TEHA 1LSOA 3OM9A 4Y2GA 4MUGA 4ZHQA 3PYXA 2QTVA 5KTRA 4O3FA 3N0RA 5F21A 2KQRA 1OILA 5K8VA 1E2EA 1A4UA 4AWAA 3BT7A 1TD1A 1MAUA 1EMDA 2C04A 4S24A 4V2IA 2OZLB 4PPFA 2QQ0A 2IXGA 2WP8J 5J2TF 1J90A 4EGYA 2NTNA 1Z45A 3KHUA 5B5SA 4JDUA 4G9GA 5A02A 1WTCA 3F97A 4GI1A 4AO7A 3ROMA 5TIIA 2QDXA 2FMHA 1KSHA 1J0RA 2KIQA 3KUKA 3EZ6A 1L7RA 2JJMA 1QG0A 4D1QA 1WEHA 2ZBEA 4A3KJ 4DQXA 2E82A 4TQGA 2DA5A 1HBXG 1HDPA 2VS1A 4ISBA 3KZZA 2ZXIA 2VRCA 2HVRA 1TM1E 4IY1A 3RRZA 5IDXA 3AVXA 4HWTA 2MSWA 2XF8A 1KBOA 4F3QA 4HBGA 4F86A 4UVHA 4R2WA 3CZ5A 3OOYA 3G8CA 4WXHA 3IVGA 1T38A 5CEJA 4ENNA 3WA7A 3MCUA 4XVRA 4KZPA 3CJQB 3MIIA 2RN7A 2JI7A 1OFHA 2GXGA 1BIFA 1HYGA 3QFTA 1LUAA 4QU9A 1RBZA 2XPCA 5FL7A 1TVMA 3ROQA 4RU1A 4ZYHA 2UU9B 3DDZX 4GLLA 4XRRA 4LHYA 4DWVA 1FY2A 3ESCA 3OTQA 1ZVKA 4OQDA 3DVLA 4Z5XA 2OVBA 2C00A 3RB8A 3WK6A 5BWMA 3K1YA 4GXQA 3D8BA 3KYLA 4ARZB 5K5OA 1ORVA 1Y1TA 5KOIA 1SD4A 5A4KA 4P4GA 1XX5A 3B1XA 4ETSA 5EMKA 1L5HA 1CRPA 1PHPA 2X2FA 4OHOA 5HF8A 1ONOA 5LVAA 4MI6A 4GE0A 2V3WA 3D6FA 3PDWA 1H2RS 5KHDA 2XYRA 3FJ1A 4YDRA 1DO0A 2RG7A 1YG2A 4X61A 3NZEA 4I3HA 3JPWA 4EMBA 3IERA 3ADOA 3ZWXA 1LBQA 2JJQA 3C7CB 2I6SA 1PDOA 4IQGA 4G7HF 3VHQA 4BBZA 5FLXA 2COMA 2VNKA 3SDBA 1GGJA 1E7RA 5C18A 3NC1C 2NNLD 5CNMA 5TB5A 5B3JA 4LCEA 2RHWA 6ADHA 3MHTA 5LDGA 4OOIA 5DEQA 1G6KA 4CQMA 1NTOA 1T08B 2PCLA 4Y9UA 2I62A 5AH0A 2PKWA 5LEKA 1MJBA 1KVUA 4L5BA 4BVLA 4D4MA 5JFTA 1R10A 2XUBA 3L18A 4UEJA 1MH4A 3TZLA 1SU8A 4JQSA 5AUOB 1A9OA 1RAAA 3VC3A 1X1AA 2C3OA 1BJRE 1JAXA 3FLMA 3A37A 2R0QC 4ND1A 3C5EA 3ZOKA 4AMUA 5DE3A 3HJBA 1QHYA 2BFCA 3GPCA 4P98A 4B4OA 1EP9A 4CKEA 4MW2A 1TLTA 3L7OA 3BIWA 1NBMA 4Z4GA 2ZJFA 4N5LA 3PR2B 5K0GA 1NBMD 3ZW7A 3PWSA 2IX9A 1B9NA 2D62A 4BJHB 4DCSA 1F38A 1Q0PA 1JIQA 3AV0B 4LRWA 1CUEA 3V9PA 2I6XA 3MEQA 3ANYB 4KVAA 1B4AA 5TDHA 4I01A 1PWEA 3IAFA 5EZGA 1RPAA 4YUVA 1O77A 3SJBA 3KJZA 2XHKA 1G3UA 3WNDA 2FKNA 3B1FA 1Q1GA 5I51A 4UM5A 1OWLA 1TUEA 1A9SA 4M3GA 1Z7BA 4HEHA 3ZEAA 1EHCA 2PMBA 4R6XA 2OCGA 3O8BA 4RGXA 1E3EA 4EWLA 3I5YA 4YHHB 2W84A 3AUYA 1LTQA 1A1SA 3KJGA 3LXRA 1CYDA 4GZLA 2Z9OA 2L0KA 4LIVA 3FNRA 4R2XA 4HQNA 1XRPA 3WRWA 2V7EA 5CT4A 3DKYA 2ZI4A 2K02A 2A58A 4OM7A 5JZVA 3SVLA 3LQRA 3DAHA 3UJAA 4ND8B 4F1WA 1QE5A 1GVJA 3K1JA 3NEJA 3T8RA 5FUBA 4ZTBA 4PFOA 3SVTA 4B3CA 3TBKA 3PWKA 3BTJA 2VBIA 2VCYA 2ZBVA 5DYTA 4CL2A 4ESFA 1EX9A 3TEFA 5A5FA 3L1IA 4N5DA 1O7LA 3ETCA 3NRCA 2V79A 3VDMA 3PRKE 1K6IA 2H52A 4DAOA 5HRAA 5H9WA 1A1VA 3O83A 2GN9A 5C5CA 1FNDA 1KK1A 4EJUA 3S2ZA 1XWIA 2CXNA 2D7JA 4OGFA 4UZSA 3SIWA 3H0DA 1YZVA 4HH1A 1F7VA 1FFXA 1SIOA 3OZGA 3LWNA 1V43A 4R7TA 1PLJA 2FZWA 5A5GA 4BJ5A 4IFEA 5KKCA 3U7RA 2Q3FA 1G5HA 4P7GA 4UMEA 4L2IA 2XOKA 1B8OA 1WRBA 3AUKA 1T4GA 4UTZA 1DAIA 4NMWA 3G7NA 1G3MA 4BMPB 1QU2A 1S5PA 4C5CA 3P9CA 4CA0A 5DHTA 4C0SA 1TCCA 2YHSA 4P1WA 1QDLB 2XTJA 5CBKA 1CUWA 2KJQA 4WCFB 1IL0A 3C45A 2PX0A 1S6YA 3LNQA 2AMYA 2DDAA 2V1DA 4MV3A 2ZE7A 2EPFA 3T8YA 3V8VA 1FFSA 2NVUB 2A78A 3LSTA 3FOCA 3MILA 3R77A 4NCNA 2J3KA 3TOCA 5LJLA 1BR1A 3DLPX 4XQ9A 4A8JC 1MMFB 1U2DC 4G81A 1KEEA 4F3YA 5KTYA 2R5FA 2OU2A 1IC6A 4MKIA 3CR3C 2W82A 5KMGB 2IT0A 5LMNB 1HNXB 2H4WA 3UYKA 4JUCA 1K88A 4FKBA 3UJBA 1JMKC 1V7ZA 4DLKA 4L95C 5T6BA 4DTIA 1GTG1 1IOVA 3SEAA 4DNQA 4Z2YA 4ENSA 5IKPA 2BCEA 2NP7A 1RQRA 3HYNA 3U4IA 2RGEA 2X2PA 2I5PO 4O25A 2XE8A 3SDGA 1IIBA 5FA6A 4BMSA 1XB2A 2HMSA 3LSJA 1TQIA 3F6BX 1Q2UA 2D2IA 3SLKA 2AI2A 1P1JA 1XMJA 2ZR8A 4N54A 4CNBA 1R6XA 5AVYA 4H0EA 1GILA 4ZYWA 3EPLA 3HTXA 4AVZA 2C4NA 4BVJA 3KNZA 4XQEA 3HRUA 3GTMJ 3MNFA 1DARA 3U5ZB 1EGAA 3RFUA 4RKWA 5E1DA 1OFTA 3QF4B 4TTSA 1Z73A 1GNPA 1GRCA 3OP1A 2XBMA 2O8NA 2VSQA 3DBVO 2PH1A 3F8CA 5ARDA 3L09A 4DLRA 2W57A 2FOXA 4KVZA 3GFIA 4IO9F 4DWJA 4II7A 5JAMA 1YFLA 1G21E 3MD0A 4A0QA 4BJTA 4D4HA 3QWHA 4BLSA 1T2EA 1RABA 2V55B 1H9TA 2H8KA 2WFLA 4M74A 2Y6UA 5BXQC 2GCOA 4NPAA 1DP3A 5ELLA 4YMWA 1LH0A 5HE9A 2BTQA 2UKDA 3K09A 4IPTA 2EFHB 4LF5B 3UF0A 2J0UB 3G0IA 1E99A 3PVCA 3HXKA 3K8YA 4UAJA 3S0JA 3Q3GE 5KNCH 3QU4A 2LCIA 2NV6A 2BN4A 2FP3A 2WJPA 3JU3A 2UVPB 1PQPA 3MBIA 3OFVA 1VKOA 3BIOA 1SVIA 2PUJA 3ET5A 3TD2A 1XG5A 2IXTA 4ND3A 2WJWA 1SK8A 1NN5A 1SWWA 1Z5ZA 3EDOA 2PZJA 4BJ3A 4DBLE 3Q7QA 4YAKA 5FPKA 3GA7A 4KNWA 5CG2A 4HPWA 3R3HA 3HI4A 2PBLA 4OQLA 4CT5A 1D1CA 4AZWA 4A3LJ 2W2NA 4XIYA 2XGDA 3K8ZA 1SCUB 4XQGA 2EJUA 1FQOA 1SBHA 2WF5A 2B4RO 1P7ZA 5GADl 1MBGA 1KY4A 4NJEA 1GAWA 1PJZA 1E2GA 4YALA 4FVTA 1DMRA 3PB3A 4AJ9A 2HXGA 4PY2A 5LGNA 2VSYA 2WWIA 3M8FA 1XZFA 4QODA 4TV8A 4U5QA 5CDHA 1Y6ZA 3MMSA 5JFGA 1TF2A 2RI6A 1B8IA 3AG3H 1AKEA 1ECBA 2P2CA 3HU1A 2MW8A 3OIDA 4UASA 2R8YA 4UVEA 3RKSA 3WGYA 1YYVA 2OCXA 4JUIA 4OY3A 4BXOB 4MHGA 2REQA 4NCIA 2ZMEA 3L0CA 3KOUA 3DYBA 4FYYA 4U7JA 3LLCA 4OAPA 1K92A 5I9MA 2G0NA 1K79A 3U4CA 4BECA 3FPFA 2XKPA 4RB3C 1PTKA 4Y2QA 1RP7A 2EFNA 1B6AA 3WL3A 2R84A 4QTZA 2BGTA 2P2GA 2Z16A 3L5OA 4BZQA 3SFZA 2KLBA 4RZIA 1APBA 1V6CA 2XUAA 5AKIA 3BUSA 4UXHA 4LD5A 2O2EA 1VPWA 2HUNA 5IT4A 3FA2A 3TI7A 5AVTA 2C99A 4Q4ZF 3E6AA 3P20A 3GC6A 3PFGA 4JQFA 4E2XA 4NBWA 4YV1A 2BR5A 4P3PA 3TJMA 4X64B 1Z6YA 3H3UA 2E2IJ 4F6RA 5IULC 5I01A 1KI4A 2OP1A 5K0CA 1U6IA 4FDTA 1U0EA 1XTVA 3OEHD 1BJZA 1WW8A 3N0VA 3G88A 5EE5B 4YUYA 3W5UA 4P4NA 1XNGA 2R6HA 3UB3A 5KX5F 3O84A 5CB4F 2XNKA 3C39A 5G1PA 2QLFA 4JB0A 3ELKA 2UZ4A 4KTVE 1NXPA 5M34A 3H36A 1E1DA 4ZU3A 3FUUA 1SQGA 1I9GA 2FMKA 2XWSA 3HDYA 4WIAA 4DDKA 3JTHA 4KR6A 1W5CC 4KC0A 1ZPDA 3PDIA 5CW2A 4DLPA 2KHMA 3VHLB 5EYPB 4M6VA 3SNKA 1DTWA 1XS9A 3RKRA 4E2YA 5JARA 2ZZNA 4F55A 1Y37A 1XMIA 3CE6A 4U7PB 4KQ1A 2H1HA 3WGJA 4KPEC 3HKEA 1XRSB 2G88A 2XE7A 2GEVA 3MJHA 4DPMA 3MRTA 1GTRA 4RSHA 3DHYA 2D5VA 2ELKA 1EVJA 1YQTA 1Z8DA 2NSDA 3ENKA 2J08A 2VC2B 4RACA 3Q7IA 4Q37A 4PZEA 2QUAA 4Z2AA 1GZVA 2ZBPA 1ZQ3P 1GA1A 2MGQA 4U9IS 2WIKA 4I55A 4YFNF 3O82A 5ALZA 1HQKA 2VBCA 1NF8A 3GP8A 3H2KA 1N5DA 4FI3C 4N3GA 2O8FB 2A5WA 5HQJA 2CHFA 3IDFA 2RB5A 4EG3A 4CF7A 1MC8A 1RJWA 1V1RA 1IIRA 5T5QA 4Q66C 1SG0A 4TT3A 3FHZA 1W5AA 1A2QA 3ZV6A 4S2EA 4YCDA 1D0ZA 4DY4A 13PKA 1EUDA 4HJRA 1RQXA 3WNZA 3ZJUA 1UP4A 2BGLA 1KZYC 2ADFA 3JSPA 1OZGA 1SXJA 2A7XA 4LN1A 4MV6A 3CSUA 1VBMA 5CFQA 2HDHA 5L3VA 1H2XA 3QU3A 3Q3IA 1J0EA 1LEHA 2WI8A 3AONB 3GDWA 4I0WB 3TMYA 3W6JB 3DEAA 2HPVA 3NIDB 4KB5A 2ZIAA 2CHUA 2L2QA 2I29A 1JHOA 4KAFA 4L51A 1FBUA 3I32A 2PT9A 4LVCA 3ESWB 4RA6B 1V3VA 1R23A 3CEJA 1DBRA 1Z7WA 1OCCH 1VMAA 4LRTB 3WSTA 4B2YA 4D8TA 2R7KA 1JEOA 3LTEA 3D3JA 3QTBA 4QYTA 3ROZA 3VU1A 4IM7A 4D8VA 5KK1A 5ADWA 1X86B 1RRJA 1LPAB 3MWDB 4JHLA 4JLBA 4WZAB 5FPHA 3AJDA 5EKTA 4MV1A 2Y9ZA 3ZDAA 2Z5UA 1QMPA 1VJTA 4RD1A 5CK5A 4ERNA 1R0XA 2I8DA 1MJGA 3NJRA 3OETA 1PSZA 3LKDA 3Q3JB 1RM3A 1G8YA 5KJ1A 3VSAA 3UVEA 1I1OA 4MS3B 4UNRA 1OTYA 1PQ4A 5DTDA 4F96A 4J6FA 1N92A 3QI2A 2WBLC 3VR5H 3Q41A 2QQFA 1A9XB 5EZ6B 1P9OA 4HB2A 3H2YA 4DPKA 4XWYA 3JYOA 4HSTA 1AKQA 1E6WA 2IBDA 1X4OA 3GW8A 3MXTA 4Y6LA 1X19A 1ETQA 2HL6A 3QVXA 1KVTA 1NI4A 1ZCZA 4KDPA 5BYBA 3L7WA 4A6PA 1FYEA 4HRYA 4YUXA 2ST1A 1K4MA 5KWJA 2J87A 3W7AA 1TW3A 2QTTA 1ZINA 4X6LA 3LG2A 3L7KA 4PG7A 1FDSA 5TRDA 1KQ3A 3FSJX 2FSUA 3G71I 5P8WA 3GQBB 3N86A 3NHZA 4BZWA 2HLDD 1PGQA 1PCXA 2OYSA 2H9IA 3SC2B 4M8KA 3BR0A 1G0NA 2PD4A 2IZZA 4IJMA 5CH3A 3MJFA 5D7BA 1GG9A 5AR1A 16PKA 2XXBA 3IMEA 4PLYA 2M87A 4MO2A 5CD1A 2LBFA 2VQLA 3L0OA 2QW1A 3MJRA 3QIAA 5EE3A 4M4SA 3UC5A 4JT2A 1BI1A 2UXXA 1ZEMA 2AD1A 3HM2A 2LH9A 3FKJA 3F2IA 1Q5PA 3A7DA 4G86A 1NJ8A 3ULKA 2IKSA 5G0SA 3OL3A 1SZCA 2H2GA 1KC1A 3LJKA 4A26A 1ZNQO 3SHTA 4E4TA 2C3UA 3ZJ4A 3VAZA 1KI3A 4UD2A 3OM8A 3A2NA 3MCZA 4L2IB 4WRRA 4XSHA 1E2IA 1KSJA 1VBKA 5FTLA 1E6MA 3THRA 4PQGA 4EEXA 1V11A 2HA5A 2Q3EA 3K0AA 3KSMA 4GOOD 4QRDA 1UMDB 3TIIA 2FQWA 5KSWB 1GUUA 1Z0JA 1W52X 3QE2A 3GN2A 4EBBA 2DMNA 2E5NA 2F5CA 1IUOA 1EXNA 1ML3A 3T3MB 3SYRA 4M0UA 2GETA 1G64A 3GXBA 2I3GA 2ZI9A 4NYJR 5LUBA 1KR2A 4ZT6A 2RJNA 1UPFA 1I3LA 4E32A 1TADA 1YI0A 4IH4A 3SZTA 4HHEA 4RFSB 4YJDA 3RAGA 3T7JA 1YB4A 5A4IS 3MZ0A 4L6AA 3MK31 2FV8A 1SUEA 1C9DB 2WT9A 3B6ZA 1B0UA 3HJHA 3JCZA 4WBXC 3TUJC 2FPIB 2VWQA 4TRMA 3BMQA 1YGPA 4FUTA 3V2GA 2EEZA 4ZI7B 2RGNA 5AO9A 1PVEA 2R5ZB 4S1VA 1NV9A 3S40A 2Q46A 3KZMA 2OM2A 4ML3A 3GCMA 1CUXA 2GEJA 4N48A 3T3PB 2WLSA 4L8WB 1PJTA 1QC5B 2CLHB 4IHQA 3DBLA 3IVAA 3CIFA 3SQLA 3V2HA 3VYSB 4Q4JA 4R9NA 5EKXA 5EJMA 5KVVA 2C7PA 1NPYA 2FWMX 3K9LA 4BLQA 3AF5A 1I1QB 4BYMA 3UOAB 1TZCA 2JFYA 1JUPA 2P3OA 4O2LA 3HMKA 1KAMA 1IQ0A 2FB9A 4TLDA 1T2CA 4ETIA 2N75A 3ZLTA 3C18A 1P6XA 2ZJRF 2J9FB 1NVFA 2YL2A 3CC4I 1KZ6A 2Y1WA 3FBTA 5EP3A 5KNBH 1U9IC 2C5BA 2H4FA 1J2TA 4FMDF 2JGJA 5F0CA 1FW8A 1K0UA 4DS3A 1MHPA 3TAXA 2JFPA 3HRSA 4HW0A 1VL8A 3WLFA 4ANFA 2VA8A 1N36B 3ENZA 2DN0A 1U7UA 1FMTA 1G6HA 2HV8A 3ESZA 3HYLA 4OUKX 1JQEA 4E33A 2A4KA 2E5FA 3TTVA 1FOWA 3ZD8A 1VQ6I 1KETA 1PJQA 2IXAA 3M49A 4ZQCB 3FBGA 4M98A 2NU8B 2EWNA 3WRXC 1L8LA 4DLLA 3EETA 1UKCA 1RYDA 2WZCA 2M45A 3U09A 2QW0X 1JSZA 3OLWA 1YIOA 3N97A 1PTJA 2AX3A 4L0QA 4MRRA 4XSXF 4UBJA 2O7OA 5ER9A 1H2WA 1VMEA 1WJEA 4A3EJ 1SOUA 1XP5A 1WMAA 2CHEA 3AB3A 3CNEA 1YE9A 4QIWN 3CYFA 4KEAA 3STWA 3ZE1B 3ZPLA 2PSDA 1CU1A 2XVAA 2EV5A 1YB2A 2FHSA 4JXKA 3TOVA 2CYYA 2WFMA 3ZI0A 1X8XA 5A1TA 1FYVA 1QONA 5J58A 3VNVA 3ASUA 3C7KA 1ISRA 2IUYA 2WHQA 2IT1A 4GYYA 2EZIA 3M7IA 2JIQA 3AU9A 1G0OA 1GVHA 1F4KA 4CKBB 4X71A 1E3WA 5E1MA 3SQMA 4EGAA 1XZAA 4HYYA 3E22B 1T4CB 4JY7A 4RO0A 1XMVA 1ZN8A 1UG2A 1FJ2A 2J0VA 4ND4A 4C6RA 2ZANA 1I39A 1VE3A 3AETB 2RH4A 4LXHA 5EUCA 1Q84A 3VH1A 3N4MA 2M2IA 2CQXA 1W94A 2DSTA 4OJTA 5JVGF 1UODA 3B5JA 1LPOA 2F4MB 5HBGA 2O5EA 3BMNA 3IP8A 3NVAA 3HOSA 2GFHA 3QOYA 3GFOA 4P4SA 3M5DA 3VPAA 1BMFA 1JS1X 3VVCA 4BTVA 1AM4D 3HEFA 1FBQA 5J43A 4BO2A 2X0IA 2PZ8A 4ZT7A 1FUIA 2R6CA 2MYPA 1E1CA 4YYEA 3PR1A 4BV8A 2VA9A 1VC2A 1V1RB 2KX7A 4OAQA 4P3XA 1DC8A 4TRRA 3V8JA 3OR2C 2APJA 4DOZA 2GCGA 2IF0A 1E1QD 1BMQA 5DPMA 4C04A 1R64A 3KOZA 1Z0KA 3PFWO 2R8RA 4DA4A 4JC0A 1ADBA 4BQIA 1BGWA 1SXIA 1EVEA 5JHFA 2ID6A 4EGCB 4XRSG 3BTCA 1D1PA 2ZR7A 3K70C 1K3UB 1DZIA 4QLCU 1SD7A 1AGXA 4L3OA 1FQKB 1T95A 2ISQA 1LVAA 2L7MP 1NVXQ 2GN1A 1JV2B 4MPJA 3IH3A 1HBJA 2R48A 4Q4AB 1OX4A 4L5EA 4RAOA 3TNYA 1EB8A 3HPHA 4CICA 4OL0A 2I5UA 4UE3S 3TSAA 3VR1A 3FGNA 1L7BA 4M7RA 2GBGA 3K2ZA 3CCQI 3F1KA 4BS9A 1XZHA 3AR3A 3E22A 1R22A 4LNUA 2H3HA 4M6YA 4O4LA 4OGGA 1GUBA 1H1DA 3CX3A 2CVOA 2FX5A 2O19A 5LQRA 1WBDA 1N7HA 4PX3A 4PV7A 4MPDA 1H89C 3GLHB 2YJ3A 3BRSA 4X1YA 1KP3A 1R6UA 4HNHA 2OILA 2OCLA 5LIRA 5LQMA 1KVRA 4WQMA 1L4LA 5IJ9A 1OYWA 1G21A 1UEXC 3BIFA 1YX5A 3GT3A 4BRZA 1VHDA 3E1SA 3KXKA 3DBIA 3RYIB 4UARA 4B3DA 5E8GA 1LZKA 1GL7A 3FTQA 3VOSA 2Y48A 2QY9A 4AN4A 4A2WA 1T3LA 4GM1A 2VJMB 4CVNA 3JD2A 3QBEA 2JA7J 1LWNA 1TCUA 3OP4A 1WQ2A 4KDCA 2YNMA 2HZBA 3H9GA 1JQDA 2BHTA 1G6Q1 4QUJA 4WESB 4AJNA 1H65A 3KOMA 1U0GA 3ZHSA 2E36A 3DPLC 1CXZA 4BDTA 2KRCA 3PQDA 4E12A 3OX4A 4LI3X 5KNCD 3MTJA 1VQ8I 1MOSA 2ASVA 1UWVA 1SB8A 2B34A 4DCGA 1WW2A 3GUVA 3Q5DA 4QHSA 2BMWA 3PC8A 3V3TA 3FY4A 5F1PA 2JA6J 3WAJA 4ESVA 2EV6A 2Z2SB 2E89A 5B4UA 3DR5A 3D1LA 5H59A 2VJQA 2DX7A 1A31A 5EKSA 4DR3B 2B0CA 2YHAA 3MOIA 4BXOA 2PVCA 4JSRA 2ZIFA 2BFBB 3NT4A 4KCGA 1H66A 3L6DA 3X2EA 5AVWA 1AKMA 1GG5A 4TKUA 4BXXJ 4X7RA 2REQB 3OOJA 4ZOBA 3G2LA 4MR7B 2Q1XA 2CMDA 2CO5A 2WA0A 2VDLB 4FGLA 3DBLB 3ZQHA 3GTJJ 4GDFA 3CDLA 2FW9A 2X22A 3P96A 1X74A 3INRA 2R7VA 1YDWA 3NWBA 2IH4A 4IRIA 5KJFA 2WJVA 3NRBA 4KO8A 2XT9A 4DIEA 1CGPA 4F60A 1T1EA 4X6XA 4IJQA 2CL6X 4AYBA 3JQGB 4H6VA 4KL8S 3K72B 1JLLA 1U65A 4PLFA 1F0YA 3W04A 3WGQA 3ZBPA 4AAYA 3RSHA 4JUFA 3SJCA 1EFDN 2WAQA 5F0HA 5K0FA 3NANA 3GFJA 3WIEA 2XLBA 1SFRA 2CW5A 3LDHA 4Z9BA 3PDJA 4RIFA 2FU5C 4RGRA 1BTOA 2P7HA 4QFBA 4X20A 5D84A 4H1TA 3LOPA 4H0CA 4GS5A 2ADOA 2YXLA 3KG2A 4HX2A 4IMIB 4NE7A 3I01A 4OJQA 1QGYA 4C76A 1KGDA 3EUAA 1EDBA 1OZAA 2ZVDA 3FNIA 3MB8A 3NOVA 4V2UA 2G1KA 1XDDA 2WTNA 5JCOA 3NKFA 5K3DA 4AXBA 4BFYA 4B3RB 3EIHA 3BGSA 1NJGA 1PNOA 1IVSA 3R2JA 1GPAA 3D8SA 3GYGA 2HD4A 2BVLA 1HA3A 4FOSA 5JCOC 4RC9A 1R7RA 1DU0A 4PANA 1Q1BA 4NBQA 4LF6B 3JZIA 2VZ0A 2V7VA 3IKTA 4DJ5X 1XMQB 3OC0A 4A3GJ 5TISC 2ZIXA 1MZBA 1G3RA 4N1AA 3VR2A 1KPIA 2PXHA 4TL9A 3F9IA 3TXXA 1X0XA 1Y3FE 1RXEA 4ZTUB 1DKQA 3MD9A 2BV6A 2F3UA 4K6CA 2BM9A 2QJOA 5BQTA 3EIOA 5JQWA 2X4HA 4NYIQ 1U6KA 4U2KA 4OXYA 1U6GA 3EXG1 4J3FA 2LNBA 2AXNA 1BGXT 1QS0B 3KKNA 4BAGA 1WSBA 4ZC8A 2YUTA 3IIJA 2F3TA 2NO6A 4X20B 3WB1A 1J07A 3P9KA 4LE2A 3GAFA 2B25A 3UMVA 4YCMA 3HJAA 1A8PA 5JSZB 4TYYA 3HP7A 3SOZA 5JAUA 1OX5A 4J9UE 1JYEA 2VOOA 4FYJA 5T64A 3Q9SA 5K4HA