3QYXA

Crystal structure of mycobacterium tuberculosis espr in complex with a small dna fragment
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
131
structure length
131
Chain Sequence
STTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRSGNRTNPSGATMAALANFFRIKAAYFTDDEYYEKLDKELQWLCTMRDDGVRRIAQRAHGLPSAAQQKVLDRIDELRRAEGIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atypical DNA recognition mechanism used by the EspR virulence regulator of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription/dna
molecule keywords ESX-1 secretion-associated regulator EspR
total genus 33
structure length 131
sequence length 131
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3qyxA00
2LYQA 2XCJA 1RZRA 1L1MA 1PRAA 3BS3A 1QPZA 1OSLA 3GN5B 4YG7B 2LYPA 1IC8A 1ZPQA 3BDNA 2LYSA 2PUDA 2PPXA 1ADRA 2AXVA 4Z5HA 3DNVB 2KEJA 1B0NA 1LLIA 4J1XA 1CJGA 3IVPA 3VK0A 1O4XA 2LCVA 3BD1A 3EUSA 1ZS4A 2HINA 1UXDA 1UTXA 2KZ8A 2PIJA 2GRMA 1LCDA 3KZ3A 4X4GA 4I8TA 2O4AA 3OP9A 4O8BA 1POUA 2AUWA 1ZZ9A 3OQMA 3QF3A 2XSDC 3O9XA 3KXAA 1E3OC 3LISA 2CROA 2LYRA 2MQKA 4IA8A 1WETA 1LMB3 1NERA 3MLFA 1WIZA 3G7DA 2KEKA 1WH8A 1S7EA 2GRLA 2WIUB 4Z59A 1DWKA 4X4DA 3OQOA 3CECA 1BDHA 2KPJA 4X4FA 3QQ6A 1QQAA 2B5AA 3FYMA 3OQNA 2JVLA 2PUFA 3F6WA 3CLCA 2D5VA 2BNNA 2A6CA 3SCFA 4GHJA 1Y9QA 4X4EA 4MCXA 1PRVA 2WUSR 4Y42A 2XIUA 3U3WA 4JCYA 4X4CA 2PE5A 3L1PA 2LYLA 1JWLA 2FJRA 1BDIA 2CSFA 1LQCA 3SCHA 3F51A 3QWGA 2IVQA 1DW9A 2L8NA 2LYKA 2EF8A 1ZZBA 2ICPA 4X4IA 3JXDL 3F52A 2OR1L 1ZZCA 4JQDA 1OCTC 4JCXA 1QP0A 1HF0A 1ZZ7A 4FN3A 4I6RA 3S8QA 1PNRA 3KJXA 2BNMA 3GBFA 3SCGA 2IVGA 3RZZA 3D1NI 2XI8A 4X4BA 1WH6A 5A7LA 4F8DA 3CROL 1PERL 4YBAA 2PUAA 1Y7YA 4IVZA 2AW6A 1SQ8A 4PU3C 3GN5A 2AXUA 1R63A 2L49A 4PU4C 2IU7A 3ZKCA 1XWRA 1UXCA 4J1WA 2LYJA 2PUBA 4OB4A 3OMTA 4YG1A 1JFSA 2H8RA 2GZUA 1ZVVA 1JH9A 1YSEA 4YARA 3JXBC 1RZRD 1NEQA 3QYXA 3UFDA 2AXZA 4Z5DA 4Z5CA 3LFPA 2IVBA 3G5GA 1CQTA 2O49A 4MCTA 1RPEL 1PRUA 4PU7A 2O38A 2IV1A 4PU8A 4X4HA 1RIOA 4IWRA 3JXCL 2JCGA 1AU7A 2EWTA 1X2LA 2HSGA 1ZZ8A 3ZHIA 2PUEA 4Z58A 2R63A 1ZZ6A 1ZAYA 2EBYA 2PUCA 2ICTA 4YG4A 3FMYA 2R1JL 4I6TA 2BNOA 1ZUGA 4I6UA 3FYAA 1QP4A 1VPWA 5K98B 3R1FA 2KEIA 1LCCA 3PXPA 2AWIA 2MEZA 3ZHMA 1X57A 1JFTA 2PUGA 1RZSA 4GQMA 1QQBA 2BJCA 1R69A 2OFYA 2XJ3A 3B7HA 3TRBA 4FBIA 3HZIB 2IUOA 1GT0C 1QP7A 4NDWA 3H5TA 1EFAA
chains in the Genus database with same CATH superfamily
2YBDA 1PRAA 4WVLA 2LYPA 1IC8A 1ZPQA 2PPXA 2AXVA 4Z5HA 3QOXA 3R09A 4EK9A 4EZIA 1UTXA 2GRMA 1POUA 3QF3A 2XSDC 2PXQA 1E3OC 1LMB3 1NERA 2KEKA 4Z59A 2GRLA 2WIUB 1DWKA 4X4FA 3PE5A 1PRVA 5DTMA 4JCYA 4X4CA 1LQCA 3SCHA 3QWGA 2L8NA 1DW9A 3TFLA 2PXKA 2ICPA 4X4IA 3GZCA 2HCNA 1ZZ7A 4I6RA 3KJXA 1U2ZA 3SCGA 3RZZA 4ER7A 2XXPA 4PU4C 2LLWA 2PXUA 4J1WA 2PUBA 2LNMA 3SX0A 4YARA 4ER0A 3GUUA 4EKGA 2IVBA 2PXFA 2J7UA 3SR4A 2EWTA 1ZAYA 4YG4A 5K98B 3R1FA 3PXPA 3DM5A 3OKZA 2MEZA 1X57A 2VEOA 4FBIA 1AU7A 3H5TA 1RZRA 1L1MA 4YG7B 3BDNA 2LYSA 3DNVB 4J1XA 1CJGA 3MEJA 3A9YA 1O4XA 2PXBA 3BD1A 3G0TA 3VWSA 2MXDA 2PIJA 2M4HA 2PXDA 4I8TA 3O9XA 2CROA 3G7DA 2JQEA 1WH8A 3A9XA 2HFZA 2XXAA 3CECA 2JVLA 2BNNA 1Y9QA 4X4EA 3LQXA 1JWLA 2LYLA 3NROA 5DSXA 2FJRA 1BDIA 3F51A 5DTQA 3F52A 1QP0A 3S8QA 4FN3A 3GBFA 2IVGA 3QFIA 2XI8A 4X4BA 5DTRA 4YBAA 5DT2A 4PU3C 1SQ8A 3NZLA 3GN5A 1R63A 2IU7A 2FFHA 4OB4A 1JFSA 2H8RA 1YSEA 3JXBC 3NDBB 4ER5A 3OWQA 4MCTA 4PU7A 4IWRA 4X4HA 3JXCL 2JCGA 2PUEA 2EBYA 3FMYA 2R1JL 4I6TA 1ZUGA 3GZDA 1LCCA 3ZHMA 1JFTA 1RZSA 1QQBA 2LLVA 3HZIB 1GT0C 4ER3A 2OR1L 1QPZA 4NDWA 2LYQA 3UWPA 1NW3A 1OSLA 4Q2JA 1ADRA 3VK0A 1HQ1A 5JUWA 1ZS4A 2HINA 1UXDA 3KL4A 4DE9A 3KZ3A 2O4AA 4O8BA 2AUWA 3OQMA 2HCSA 3LISA 2LYRA 4IA8A 3MLFA 1WIZA 1S7EA 4DE8A 2KPJA 3QQ6A 1QQAA 3OQNA 2PUFA 3F6WA 2D5VA 2WUSR 4Y42A 2XIUA 3U3WA 3L1PA 2CSFA 2V3CC 2LYKA 3JXDL 1ZZCA 4JQDA 1OCTC 4JCXA 3M9LA 1HF0A 2BNMA 3D1NI 1WH6A 3TEPA 1PERL 3TELA 2PUAA 1Y7YA 4IVZA 2AW6A 2L49A 1XWRA 2LYJA 1ZVVA 1RZRD 1NEQA 3QYXA 2AXZA 3LFPA 1CQTA 2L1PA 1RPEL 2IV1A 4PU8A 1RIOA 4EKIA 2HSGA 3ZHIA 3NXHA 2PXLA 2PXPA 2R63A 2ICTA 4ER6A 2BNOA 4I6UA 3FYAA 2KEIA 1QB2A 2PUGA 4GQMA 1MFQC 1DULA 1R69A 2OFYA 2XJ3A 3B7HA 3TRBA 2IUOA 5DRTA 2XCJA 3BS3A 3GN5B 2PUDA 2KEJA 1B0NA 1LLIA 3IVPA 2XXQA 2J7WA 2LCVA 3EUSA 2KZ8A 1LCDA 4X4GA 3OP9A 1ZZ9A 3KXAA 2MQKA 3A9ZA 1WETA 5GAHi 5DRYA 4X4DA 3QOWA 3OQOA 1BDHA 2ODRD 2B5AA 3FYMA 4OBMA 1QZXA 3CLCA 2A6CA 3SCFA 4GHJA 4MCXA 5GAGi 2PE5A 2IVQA 2EF8A 1ZZBA 1PNRA 3GZDC 5A7LA 4F8DA 3CROL 3ME5A 2AXUA 4EQZA 3ZKCA 1UXCA 4YG1A 3OMTA 2GZUA 1JH9A 2PXVA 3UFDA 4HRAA 4Z5DA 4Z5CA 3G5GA 2O49A 1PRUA 2O38A 1X2LA 1ZZ8A 3ZPXA 4Z58A 1ZZ6A 2PUCA 1QP4A 1VPWA 2AWIA 2PXTA 2BJCA 1QP7A 2PXEA 1EFAA
chains in the Genus database with same CATH topology
2LYQA 2XCJA 1RZRA 1L1MA 1PRAA 3BS3A 1QPZA 1OSLA 3GN5B 4YG7B 2LYPA 1IC8A 1ZPQA 3BDNA 2LYSA 2PUDA 2PPXA 1ADRA 2AXVA 4Z5HA 3DNVB 2KEJA 1B0NA 1LLIA 4J1XA 1CJGA 3IVPA 3VK0A 1O4XA 2LCVA 3BD1A 3EUSA 1ZS4A 2HINA 1UXDA 1UTXA 2KZ8A 2PIJA 2GRMA 1LCDA 3KZ3A 4X4GA 4I8TA 2O4AA 3OP9A 4O8BA 1POUA 2AUWA 1ZZ9A 3OQMA 3QF3A 2XSDC 3O9XA 3KXAA 1E3OC 3LISA 2CROA 2LYRA 2MQKA 4IA8A 1WETA 1LMB3 1NERA 3MLFA 1WIZA 3G7DA 2KEKA 1WH8A 1S7EA 2GRLA 2WIUB 4Z59A 1DWKA 4X4DA 3OQOA 3CECA 1BDHA 2KPJA 4X4FA 3QQ6A 1QQAA 2B5AA 3FYMA 3OQNA 2JVLA 2PUFA 3F6WA 3CLCA 2D5VA 2BNNA 2A6CA 3SCFA 4GHJA 1Y9QA 4X4EA 4MCXA 1PRVA 2WUSR 4Y42A 2XIUA 3U3WA 4JCYA 4X4CA 2PE5A 3L1PA 2LYLA 1JWLA 2FJRA 1BDIA 2CSFA 1LQCA 3SCHA 3F51A 3QWGA 2IVQA 1DW9A 2L8NA 2LYKA 2EF8A 1ZZBA 2ICPA 4X4IA 3JXDL 3F52A 2OR1L 1ZZCA 4JQDA 1OCTC 4JCXA 1QP0A 1HF0A 1ZZ7A 4FN3A 4I6RA 3S8QA 1PNRA 3KJXA 2BNMA 3GBFA 3SCGA 2IVGA 3RZZA 3D1NI 2XI8A 4X4BA 1WH6A 5A7LA 4F8DA 3CROL 1PERL 4YBAA 2PUAA 1Y7YA 4IVZA 2AW6A 1SQ8A 4PU3C 3GN5A 2AXUA 1R63A 2L49A 4PU4C 2IU7A 3ZKCA 1XWRA 1UXCA 4J1WA 2LYJA 2PUBA 4OB4A 3OMTA 4YG1A 1JFSA 2H8RA 2GZUA 1ZVVA 1JH9A 1YSEA 4YARA 3JXBC 1RZRD 1NEQA 3QYXA 3UFDA 2AXZA 4Z5DA 4Z5CA 3LFPA 2IVBA 3G5GA 1CQTA 2O49A 4MCTA 1RPEL 1PRUA 4PU7A 2O38A 2IV1A 4PU8A 4X4HA 1RIOA 4IWRA 3JXCL 2JCGA 1AU7A 2EWTA 1X2LA 2HSGA 1ZZ8A 3ZHIA 2PUEA 4Z58A 2R63A 1ZZ6A 1ZAYA 2EBYA 2PUCA 2ICTA 4YG4A 3FMYA 2R1JL 4I6TA 2BNOA 1ZUGA 4I6UA 3FYAA 1QP4A 1VPWA 5K98B 3R1FA 2KEIA 1LCCA 3PXPA 2AWIA 2MEZA 3ZHMA 1X57A 1JFTA 2PUGA 1RZSA 4GQMA 1QQBA 2BJCA 1R69A 2OFYA 2XJ3A 3B7HA 3TRBA 4FBIA 3HZIB 2IUOA 1GT0C 1QP7A 4NDWA 3H5TA 1EFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYQ A;  2XCJ A;  1RZR A;  1L1M A;  1PRA A;  3BS3 A;  1QPZ A;  1OSL A;  3GN5 B;  4YG7 B;  2LYP A;  1IC8 A;  1ZPQ A;  3BDN A;  2LYS A;  2PUD A;  2PPX A;  1ADR A;  2AXV A;  4Z5H A;  3DNV B;  2KEJ A;  1B0N A;  1LLI A;  4J1X A;  1CJG A;  3IVP A;  3VK0 A;  1O4X A;  2LCV A;  3BD1 A;  3EUS A;  1ZS4 A;  2HIN A;  1UXD A;  1UTX A;  2KZ8 A;  2PIJ A;  2GRM A;  1LCD A;  3KZ3 A;  4X4G A;  4I8T A;  2O4A A;  3OP9 A;  4O8B A;  1POU A;  2AUW A;  1ZZ9 A;  3OQM A;  3QF3 A;  2XSD C;  3O9X A;  3KXA A;  1E3O C;  3LIS A;  2CRO A;  2LYR A;  2MQK A;  4IA8 A;  1WET A;  1LMB 3;  1NER A;  3MLF A;  1WIZ A;  3G7D A;  2KEK A;  1WH8 A;  1S7E A;  2GRL A;  2WIU B;  4Z59 A;  1DWK A;  4X4D A;  3OQO A;  3CEC A;  1BDH A;  2KPJ A;  4X4F A;  3QQ6 A;  1QQA A;  2B5A A;  3FYM A;  3OQN A;  2JVL A;  2PUF A;  3F6W A;  3CLC A;  2D5V A;  2BNN A;  2A6C A;  3SCF A;  4GHJ A;  1Y9Q A;  4X4E A;  4MCX A;  1PRV A;  2WUS R;  4Y42 A;  2XIU A;  3U3W A;  4JCY A;  4X4C A;  2PE5 A;  3L1P A;  2LYL A;  1JWL A;  2FJR A;  1BDI A;  2CSF A;  1LQC A;  3SCH A;  3F51 A;  3QWG A;  2IVQ A;  1DW9 A;  2L8N A;  2LYK A;  2EF8 A;  1ZZB A;  2ICP A;  4X4I A;  3JXD L;  3F52 A;  2OR1 L;  1ZZC A;  4JQD A;  1OCT C;  4JCX A;  1QP0 A;  1HF0 A;  1ZZ7 A;  4FN3 A;  4I6R A;  3S8Q A;  1PNR A;  3KJX A;  2BNM A;  3GBF A;  3SCG A;  2IVG A;  3RZZ A;  3D1N I;  2XI8 A;  4X4B A;  1WH6 A;  5A7L A;  4F8D A;  3CRO L;  1PER L;  4YBA A;  2PUA A;  1Y7Y A;  4IVZ A;  2AW6 A;  1SQ8 A;  4PU3 C;  3GN5 A;  2AXU A;  1R63 A;  2L49 A;  4PU4 C;  2IU7 A;  3ZKC A;  1XWR A;  1UXC A;  4J1W A;  2LYJ A;  2PUB A;  4OB4 A;  3OMT A;  4YG1 A;  1JFS A;  2H8R A;  2GZU A;  1ZVV A;  1JH9 A;  1YSE A;  4YAR A;  3JXB C;  1RZR D;  1NEQ A;  3QYX A;  3UFD A;  2AXZ A;  4Z5D A;  4Z5C A;  3LFP A;  2IVB A;  3G5G A;  1CQT A;  2O49 A;  4MCT A;  1RPE L;  1PRU A;  4PU7 A;  2O38 A;  2IV1 A;  4PU8 A;  4X4H A;  1RIO A;  4IWR A;  3JXC L;  2JCG A;  1AU7 A;  2EWT A;  1X2L A;  2HSG A;  1ZZ8 A;  3ZHI A;  2PUE A;  4Z58 A;  2R63 A;  1ZZ6 A;  1ZAY A;  2EBY A;  2PUC A;  2ICT A;  4YG4 A;  3FMY A;  2R1J L;  4I6T A;  2BNO A;  1ZUG A;  4I6U A;  3FYA A;  1QP4 A;  1VPW A;  5K98 B;  3R1F A;  2KEI A;  1LCC A;  3PXP A;  2AWI A;  2MEZ A;  3ZHM A;  1X57 A;  1JFT A;  2PUG A;  1RZS A;  4GQM A;  1QQB A;  2BJC A;  1R69 A;  2OFY A;  2XJ3 A;  3B7H A;  3TRB A;  4FBI A;  3HZI B;  2IUO A;  1GT0 C;  1QP7 A;  4NDW A;  3H5T A;  1EFA A; 
#chains in the Genus database with same CATH topology
 2YBD A;  1PRA A;  4WVL A;  2LYP A;  1IC8 A;  1ZPQ A;  2PPX A;  2AXV A;  4Z5H A;  3QOX A;  3R09 A;  4EK9 A;  4EZI A;  1UTX A;  2GRM A;  1POU A;  3QF3 A;  2XSD C;  2PXQ A;  1E3O C;  1LMB 3;  1NER A;  2KEK A;  4Z59 A;  2GRL A;  2WIU B;  1DWK A;  4X4F A;  3PE5 A;  1PRV A;  5DTM A;  4JCY A;  4X4C A;  1LQC A;  3SCH A;  3QWG A;  2L8N A;  1DW9 A;  3TFL A;  2PXK A;  2ICP A;  4X4I A;  3GZC A;  2HCN A;  1ZZ7 A;  4I6R A;  3KJX A;  1U2Z A;  3SCG A;  3RZZ A;  4ER7 A;  2XXP A;  4PU4 C;  2LLW A;  2PXU A;  4J1W A;  2PUB A;  2LNM A;  3SX0 A;  4YAR A;  4ER0 A;  3GUU A;  4EKG A;  2IVB A;  2PXF A;  2J7U A;  3SR4 A;  2EWT A;  1ZAY A;  4YG4 A;  5K98 B;  3R1F A;  3PXP A;  3DM5 A;  3OKZ A;  2MEZ A;  1X57 A;  2VEO A;  4FBI A;  1AU7 A;  3H5T A;  1RZR A;  1L1M A;  4YG7 B;  3BDN A;  2LYS A;  3DNV B;  4J1X A;  1CJG A;  3MEJ A;  3A9Y A;  1O4X A;  2PXB A;  3BD1 A;  3G0T A;  3VWS A;  2MXD A;  2PIJ A;  2M4H A;  2PXD A;  4I8T A;  3O9X A;  2CRO A;  3G7D A;  2JQE A;  1WH8 A;  3A9X A;  2HFZ A;  2XXA A;  3CEC A;  2JVL A;  2BNN A;  1Y9Q A;  4X4E A;  3LQX A;  1JWL A;  2LYL A;  3NRO A;  5DSX A;  2FJR A;  1BDI A;  3F51 A;  5DTQ A;  3F52 A;  1QP0 A;  3S8Q A;  4FN3 A;  3GBF A;  2IVG A;  3QFI A;  2XI8 A;  4X4B A;  5DTR A;  4YBA A;  5DT2 A;  4PU3 C;  1SQ8 A;  3NZL A;  3GN5 A;  1R63 A;  2IU7 A;  2FFH A;  4OB4 A;  1JFS A;  2H8R A;  1YSE A;  3JXB C;  3NDB B;  4ER5 A;  3OWQ A;  4MCT A;  4PU7 A;  4IWR A;  4X4H A;  3JXC L;  2JCG A;  2PUE A;  2EBY A;  3FMY A;  2R1J L;  4I6T A;  1ZUG A;  3GZD A;  1LCC A;  3ZHM A;  1JFT A;  1RZS A;  1QQB A;  2LLV A;  3HZI B;  1GT0 C;  4ER3 A;  2OR1 L;  1QPZ A;  4NDW A;  2LYQ A;  3UWP A;  1NW3 A;  1OSL A;  4Q2J A;  1ADR A;  3VK0 A;  1HQ1 A;  5JUW A;  1ZS4 A;  2HIN A;  1UXD A;  3KL4 A;  4DE9 A;  3KZ3 A;  2O4A A;  4O8B A;  2AUW A;  3OQM A;  2HCS A;  3LIS A;  2LYR A;  4IA8 A;  3MLF A;  1WIZ A;  1S7E A;  4DE8 A;  2KPJ A;  3QQ6 A;  1QQA A;  3OQN A;  2PUF A;  3F6W A;  2D5V A;  2WUS R;  4Y42 A;  2XIU A;  3U3W A;  3L1P A;  2CSF A;  2V3C C;  2LYK A;  3JXD L;  1ZZC A;  4JQD A;  1OCT C;  4JCX A;  3M9L A;  1HF0 A;  2BNM A;  3D1N I;  1WH6 A;  3TEP A;  1PER L;  3TEL A;  2PUA A;  1Y7Y A;  4IVZ A;  2AW6 A;  2L49 A;  1XWR A;  2LYJ A;  1ZVV A;  1RZR D;  1NEQ A;  3QYX A;  2AXZ A;  3LFP A;  1CQT A;  2L1P A;  1RPE L;  2IV1 A;  4PU8 A;  1RIO A;  4EKI A;  2HSG A;  3ZHI A;  3NXH A;  2PXL A;  2PXP A;  2R63 A;  2ICT A;  4ER6 A;  2BNO A;  4I6U A;  3FYA A;  2KEI A;  1QB2 A;  2PUG A;  4GQM A;  1MFQ C;  1DUL A;  1R69 A;  2OFY A;  2XJ3 A;  3B7H A;  3TRB A;  2IUO A;  5DRT A;  2XCJ A;  3BS3 A;  3GN5 B;  2PUD A;  2KEJ A;  1B0N A;  1LLI A;  3IVP A;  2XXQ A;  2J7W A;  2LCV A;  3EUS A;  2KZ8 A;  1LCD A;  4X4G A;  3OP9 A;  1ZZ9 A;  3KXA A;  2MQK A;  3A9Z A;  1WET A;  5GAH i;  5DRY A;  4X4D A;  3QOW A;  3OQO A;  1BDH A;  2ODR D;  2B5A A;  3FYM A;  4OBM A;  1QZX A;  3CLC A;  2A6C A;  3SCF A;  4GHJ A;  4MCX A;  5GAG i;  2PE5 A;  2IVQ A;  2EF8 A;  1ZZB A;  1PNR A;  3GZD C;  5A7L A;  4F8D A;  3CRO L;  3ME5 A;  2AXU A;  4EQZ A;  3ZKC A;  1UXC A;  4YG1 A;  3OMT A;  2GZU A;  1JH9 A;  2PXV A;  3UFD A;  4HRA A;  4Z5D A;  4Z5C A;  3G5G A;  2O49 A;  1PRU A;  2O38 A;  1X2L A;  1ZZ8 A;  3ZPX A;  4Z58 A;  1ZZ6 A;  2PUC A;  1QP4 A;  1VPW A;  2AWI A;  2PXT A;  2BJC A;  1QP7 A;  2PXE A;  1EFA A; 
#chains in the Genus database with same CATH homology
 2LYQ A;  2XCJ A;  1RZR A;  1L1M A;  1PRA A;  3BS3 A;  1QPZ A;  1OSL A;  3GN5 B;  4YG7 B;  2LYP A;  1IC8 A;  1ZPQ A;  3BDN A;  2LYS A;  2PUD A;  2PPX A;  1ADR A;  2AXV A;  4Z5H A;  3DNV B;  2KEJ A;  1B0N A;  1LLI A;  4J1X A;  1CJG A;  3IVP A;  3VK0 A;  1O4X A;  2LCV A;  3BD1 A;  3EUS A;  1ZS4 A;  2HIN A;  1UXD A;  1UTX A;  2KZ8 A;  2PIJ A;  2GRM A;  1LCD A;  3KZ3 A;  4X4G A;  4I8T A;  2O4A A;  3OP9 A;  4O8B A;  1POU A;  2AUW A;  1ZZ9 A;  3OQM A;  3QF3 A;  2XSD C;  3O9X A;  3KXA A;  1E3O C;  3LIS A;  2CRO A;  2LYR A;  2MQK A;  4IA8 A;  1WET A;  1LMB 3;  1NER A;  3MLF A;  1WIZ A;  3G7D A;  2KEK A;  1WH8 A;  1S7E A;  2GRL A;  2WIU B;  4Z59 A;  1DWK A;  4X4D A;  3OQO A;  3CEC A;  1BDH A;  2KPJ A;  4X4F A;  3QQ6 A;  1QQA A;  2B5A A;  3FYM A;  3OQN A;  2JVL A;  2PUF A;  3F6W A;  3CLC A;  2D5V A;  2BNN A;  2A6C A;  3SCF A;  4GHJ A;  1Y9Q A;  4X4E A;  4MCX A;  1PRV A;  2WUS R;  4Y42 A;  2XIU A;  3U3W A;  4JCY A;  4X4C A;  2PE5 A;  3L1P A;  2LYL A;  1JWL A;  2FJR A;  1BDI A;  2CSF A;  1LQC A;  3SCH A;  3F51 A;  3QWG A;  2IVQ A;  1DW9 A;  2L8N A;  2LYK A;  2EF8 A;  1ZZB A;  2ICP A;  4X4I A;  3JXD L;  3F52 A;  2OR1 L;  1ZZC A;  4JQD A;  1OCT C;  4JCX A;  1QP0 A;  1HF0 A;  1ZZ7 A;  4FN3 A;  4I6R A;  3S8Q A;  1PNR A;  3KJX A;  2BNM A;  3GBF A;  3SCG A;  2IVG A;  3RZZ A;  3D1N I;  2XI8 A;  4X4B A;  1WH6 A;  5A7L A;  4F8D A;  3CRO L;  1PER L;  4YBA A;  2PUA A;  1Y7Y A;  4IVZ A;  2AW6 A;  1SQ8 A;  4PU3 C;  3GN5 A;  2AXU A;  1R63 A;  2L49 A;  4PU4 C;  2IU7 A;  3ZKC A;  1XWR A;  1UXC A;  4J1W A;  2LYJ A;  2PUB A;  4OB4 A;  3OMT A;  4YG1 A;  1JFS A;  2H8R A;  2GZU A;  1ZVV A;  1JH9 A;  1YSE A;  4YAR A;  3JXB C;  1RZR D;  1NEQ A;  3QYX A;  3UFD A;  2AXZ A;  4Z5D A;  4Z5C A;  3LFP A;  2IVB A;  3G5G A;  1CQT A;  2O49 A;  4MCT A;  1RPE L;  1PRU A;  4PU7 A;  2O38 A;  2IV1 A;  4PU8 A;  4X4H A;  1RIO A;  4IWR A;  3JXC L;  2JCG A;  1AU7 A;  2EWT A;  1X2L A;  2HSG A;  1ZZ8 A;  3ZHI A;  2PUE A;  4Z58 A;  2R63 A;  1ZZ6 A;  1ZAY A;  2EBY A;  2PUC A;  2ICT A;  4YG4 A;  3FMY A;  2R1J L;  4I6T A;  2BNO A;  1ZUG A;  4I6U A;  3FYA A;  1QP4 A;  1VPW A;  5K98 B;  3R1F A;  2KEI A;  1LCC A;  3PXP A;  2AWI A;  2MEZ A;  3ZHM A;  1X57 A;  1JFT A;  2PUG A;  1RZS A;  4GQM A;  1QQB A;  2BJC A;  1R69 A;  2OFY A;  2XJ3 A;  3B7H A;  3TRB A;  4FBI A;  3HZI B;  2IUO A;  1GT0 C;  1QP7 A;  4NDW A;  3H5T A;  1EFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...