3QZ3A

The crystal structure of ferritin from vibrio cholerae o1 biovar el tor str. n16961
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
165
structure length
165
Chain Sequence
FMLSQAMVEHLNEQINLEFFSSNLYLQMSAWCEDKGFDGAAEFLRAHAVEEMQHMQRLFTYVSETGALPILGAIAAPRHDFASLGEVFRETYQHEQKITQQINKLAHVAFTSQDYSTFNFLQWYVAEQHEEEKLFKGILDKLELVGEDGKALFFIDKDLAALAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin
publication title The crystal structure of ferritin from Vibrio cholerae O1 biovar El Tor str. N16961
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
total genus 72
structure length 165
sequence length 165
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3qz3A00
1H96A 4CMYV 4E6KA 5FFBA 2F7NA 1MOJA 3AF8X 3KA6A 4ZL5A 5FFCA 3UOFA 1NNQA 3WVVA 4KVSA 1YUXA 3E1LA 2BK6A 4ISPA 1YV1A 3F33A 2V2JA 2IB0A 3F39A 4LQNA 3AJQA 2FHAA 3E6SA 3KWOA 2CF7A 5LBHA 3ERZA 1RCIA 2ZA8A 3GHQA 4RC5A 3UOIA 2ITBA 2ZG8X 3PW8A 3KA9A 1MFRA 4A25A 1HRSA 4CMYA 1F30A 5GU0X 4M34A 3E1QA 3O7RA 2WLUA 5E2DA 4Z5SA 3E1MA 3WNWA 4U3GA 1JTSA 1O9RA 5HJFA 3AF9X 3R2HA 4ETRA 1NF6A 3PVYB 3EGMA 5E1UA 4RC8A 1RYTA 5D8PA 4XKSA 1KRQA 3A9QA 1GWGA 2GS4A 4CVTA 1J30A 1QGHA 1VEQA 4ITWA 1S2ZA 3SIDA 1TKOA 1F33A 3PWFA 1UMNA 5IX6A 1LKMA 3R2OA 1N1QA 4TOBA 4DE6A 1IESA 2W0OA 4EVEA 3IS8A 4KVQA 4TOGA 2XJOA 1BFRA 4MKUA 4ZL6A 3SH6A 3RE7A 5LG2A 2V2PA 4Y08A 3ISFA 3FSEA 1DATA 2OC5A 5LG8A 3KA4A 5FFAA 5GU3X 2UX1A 3HIUA 3F36A 2ZURX 1JGCA 3PVTB 3QHCA 2V2RA 4II4A 4XKTA 1LKOA 1JI4A 5D8QA 3RAVA 5CMRA 2VXIA 3EZ0A 2FL0A 2OH3A 4CYAA 2CEIA 4XGSA 1L8IA 3PWQA 2V2LA 1SQ3A 4IWJA 3O7SA 1TK6A 2CHPA 2HTNA 4AM5A 3PW1B 1BG7A 2FZFA 2Z5PA 4IXKA 3R2KA 5K53A 1RCCA 3KXUA 4TOAA 2XJMA 3QHBA 5J9VA 3Q4NA 4DI0A 5HJHA 3AJOA 1S3QA 3PVRA 3E1NA 5LS9A 4ZMCA 3SHXA 1B71A 5AXSA 5CZUA 2C2UA 5JKLG 2G4HA 4DZ0A 1BCFA 2XGWA 3NP2X 5I4JA 3BVFA 3R2RA 2BKCA 4TOFA 2V2NA 3FVBA 3E2CA 2CN7A 3EZUA 2Z5QA 4RC6A 5D8OA 1RCEA 1LKPA 4MN9A 3F34A 4DYXA 4EVDA 4TOEA 4CY9A 4YKHA 3OGHA 1Z4AA 4ITTA 1JKVA 3PWQC 2V2SA 5JKMA 3ISEA 2WLAA 2ZG7X 5K52A 5JACA 5D8SA 3E1JA 3IS7A 3WVWA 3BVIA 2Z6MA 4RC5B 2GYQA 4OYNA 4LPMA 2FFXJ 1AEWA 4LPNA 1VELA 3T9JA 2Z90A 4EVCA 2V2MA 5ERKA 3RD0A 1Z6OM 2D5KA 2CLUA 4R42A 4DYYA 4CVPA 4TW3A 4DASA 5J93A 4ML5A 4ZKXA 5D8RA 5GN8B 4TOHA 1JIGA 1XZ1A 3BVEA 2X170 5CMQA 4KVRA 1IERA 3E1PA 3IQ1A 5JKMG 4RC7A 3KX9A 4TO9A 2VXXA 2JD60 4EVBA 2CN6A 1FHAA 3AF7X 1YUZA 4M33A 3R2SA 1DPSA 4TOCA 4XKUA 2CHIA 2YJKA 2FG4A 3E6RA 2QQYA 4MY7A 3F38A 3AJPA 3OJ5A 2YJJA 5GU2X 4CVRA 1RCGA 4M35A 4CYBA 2IU2A 4Z3BA 4LQJA 4IWKA 3UNOA 3VNXA 3WVUA 3U90A 4DYUA 4P18A 4PG0A 5FEJA 2FKZA 2VZBA 5HQOA 2WTLA 4II4B 1S30A 3QVDA 2C6RA 2Z5RA 4LYUA 1NFVA 1XZ3A 2FJCA 3AK9A 4TODA 3KA3A 3AK8A 3H7GA 1DVBA 1EUMA 3R2MA 1ZUJA 4DYZA 5C6FA 3F32A 3PVYA 2JD80 3BT5A 3NP0X 2RBDA 1NF4A 4PG1A 3MPSA 5GOUA 4LYXA 2ZG9X 5J8SA 3GE4A 4LPJA 3PZAA 4QUWA 3SE1A 2FG8A 3QD8A 2XJNA 1JI5A 3KA8A 1UVHA 2C2FA 1TJOA 2IY4A 3PVRB 2V2IA 3F35A 4CVSA 3R2LA 2C2JA 1RCDA 3GVYA 4MUDA 3Q4QA 4ISMA 1JYBA 3NOZX 3QZ3A 5D8YA 4MJYA 2C41A 2BJYA 5GN8A 5ERJA 4PGIA 1VJXA 3BKNA 3Q4OA 1VLGA 5GU1X 4LQHA 1QYBA 2ZA7A 3PVTA 3HL1A 3F37A 3BVKA 4RC6B 1L8HA 1SOFA 3RGDA 3FI6A 1R03A 1OTKA 3TA8A 4AM4A 4ZKWA 4ZLWA 1VEIA 4ZTTA 4ERUA 4ZJKA 3PW1A 5FFEA 3Q4RA 3QB9A 2BW1A 1TKPA 4LQVA 1O9IA 2V2OA 5D8XA 3E1OA 2JD70 2GYDA 2ZA6A 3PW8C 2HR5A 5J8WA 2XKQA 2PYBA 1JREA 4REUA 1JKUA 2Y3QA 4ZKHA 2QF9A 3ES3A 1LB3A 2YW7A 2CLBA 4M32A 5JKLA 1Z6OA 3RBCA 2CIHA 4AM2A 4PGKA 5FFDA 2V15A 4RC7B 3BVLA 1ZS3A 2YW6A 3A68A
chains in the Genus database with same CATH superfamily
1H96A 4CMYV 4E6KA 5FFBA 2F7NA 1MOJA 3AF8X 3KA6A 4MXPA 4ZL5A 5FFCA 3UOFA 1NNQA 3WVVA 4KVSA 1YUXA 3E1LA 2WWXB 2BK6A 4ISPA 1YV1A 3F33A 2V2JA 2IB0A 3F39A 4LQNA 3AJQA 2MGYA 2FHAA 3E6SA 3KWOA 2CF7A 5LBHA 3ERZA 3KDQA 1RCIA 2ZA8A 3GHQA 4RC5A 3UOIA 2ITBA 2ZG8X 3PW8A 3KA9A 1MFRA 4A25A 1HRSA 4CMYA 1F30A 5GU0X 4M34A 2V8UA 3E1QA 3O7RA 2WLUA 5E2DA 4Z5SA 3E1MA 3WNWA 3FRSA 4U3GA 1JTSA 1O9RA 2N02A 5HJFA 3AF9X 3R2HA 4ETRA 1NF6A 3PVYB 3EGMA 5E1UA 4RC8A 1RYTA 5D8PA 4XKSA 1KRQA 3A9QA 1GWGA 2GS4A 4CVTA 1J30A 1QGHA 3VV9A 1VEQA 4ITWA 1S2ZA 3SIDA 1TKOA 1F33A 3PWFA 1UMNA 5IX6A 1LKMA 3R2OA 1N1QA 4TOBA 4DE6A 1IESA 2W0OA 4EVEA 3IS8A 4KVQA 4TOGA 2XJOA 1BFRA 4MKUA 4ZL6A 3SH6A 3RE7A 5LG2A 2V2PA 4Y08A 3ISFA 3FSEA 1DATA 2OC5A 5LG8A 3KA4A 5FFAA 5GU3X 2UX1A 3HIUA 3F36A 4E40A 2ZURX 1JGCA 3PVTB 3QHCA 2V2RA 4II4A 4XKTA 1LKOA 1JI4A 5D8QA 3RAVA 5CMRA 2VXIA 3EZ0A 2FL0A 2OH3A 3W54A 4CYAA 2CEIA 4XGSA 1L8IA 2CWLA 3PWQA 2V2LA 2Y44A 1SQ3A 4IWJA 3C21A 3O7SA 1TK6A 2CHPA 2HTNA 4AM5A 3PW1B 1BG7A 2FZFA 2Z5PA 4IXKA 3R2KA 5K53A 1RCCA 3KXUA 4TOAA 2XJMA 3QHBA 5J9VA 3Q4NA 4DI0A 5HJHA 3AJOA 1S3QA 3PVRA 3E1NA 5LS9A 4ZMCA 3SHXA 1B71A 5AXSA 5CZUA 2C2UA 5JKLG 2G4HA 4DZ0A 1BCFA 2XGWA 3NP2X 5I4JA 3C23A 3BVFA 3R2RA 2BKCA 4TOFA 2V2NA 3FVBA 3E2CA 2CN7A 3EZUA 2Z5QA 4RC6A 5D8OA 1RCEA 1LKPA 4MN9A 3F34A 3N6OA 4DYXA 4EVDA 4TOEA 4CY9A 4YKHA 3OGHA 1Z4AA 4ITTA 1JKVA 3PWQC 2V2SA 5JKMA 3ISEA 2WLAA 3VVAA 2ZG7X 5K52A 5JACA 5D8SA 3E1JA 3IS7A 3WVWA 3BVIA 5JDOA 2Z6MA 4RC5B 3JZ9A 3JZAB 2GYQA 4OYNA 4LPMA 2FFXJ 1AEWA 4LPNA 1VELA 3T9JA 4YVZA 2Z90A 4EVCA 2V2MA 5ERKA 3C1ZA 3RD0A 1Z6OM 2D5KA 2CLUA 4YXJA 4R42A 4DYYA 4CVPA 4TW3A 4DASA 5J93A 4ML5A 4ZKXA 5D8RA 5GN8B 3FRRA 4TOHA 3D19A 4X0JA 1JIGA 1XZ1A 3BVEA 2X170 5CMQA 4KVRA 1IERA 3E1PA 3IQ1A 5JKMG 4RC7A 3KX9A 4TO9A 2VXXA 2JD60 4EVBA 2CN6A 1FHAA 3AF7X 1YUZA 4M33A 3R2SA 1DPSA 4TOCA 4XKUA 2CHIA 2YJKA 2FG4A 3E6RA 2QQYA 5HU6D 4MY7A 3F38A 3AJPA 3OJ5A 3DBYA 2YJJA 5GU2X 3V3KB 4CVRA 1RCGA 4M35A 4CYBA 2IU2A 4Z3BA 4LQJA 4IWKA 3UNOA 3VNXA 3WVUA 3U90A 4DYUA 4P18A 4PG0A 5FEJA 2FKZA 2VZBA 5HQOA 2WTLA 4II4B 1S30A 3QVDA 2C6RA 2Z5RA 4KXRB 4LYUA 1NFVA 1XZ3A 2FJCA 3AK9A 4TODA 3KA3A 3AK8A 3H7GA 4W4LB 1DVBA 1EUMA 3R2MA 1ZUJA 4DYZA 5C6FA 3F32A 3PVYA 2JD80 3BT5A 3NP0X 2RBDA 4YXMA 1NF4A 3GGYA 3KHKA 3LKDA 4PG1A 4WJG4 3MPSA 5GOUA 4LYXA 2ZG9X 5J8SA 3GE4A 4LPJA 3PZAA 4QUWA 3L0MA 2FG8A 3QD8A 2XJNA 3SE1A 1JI5A 3KA8A 1UVHA 2C2FA 1TJOA 2IY4A 3PVRB 2V2IA 3F35A 4CVSA 3R2LA 2C2JA 1RCDA 3GVYA 4MUDA 3Q4QA 4ISMA 1JYBA 3NOZX 3QZ3A 5D8YA 4MJYA 2C41A 2BJYA 5GN8A 5ERJA 4PGIA 1VJXA 3BKNA 3Q4OA 1VLGA 5GU1X 3C1YA 4LQHA 1QYBA 2ZA7A 3PVTA 2AR0A 3F37A 3HL1A 3BVKA 4RC6B 1L8HA 2V8TA 1SOFA 3RGDA 3FI6A 1R03A 1OTKA 3TA8A 3UFBA 3GGZA 4AM4A 4ZKWA 3M6JA 4ZLWA 1VEIA 4ZTTA 2OKCA 4ERUA 4ZJKA 2G38B 3PW1A 5FFEA 3Q4RA 5JDOB 4W4KB 3QB9A 2BW1A 1TKPA 4LQVA 1O9IA 2V2OA 5D8XA 3E1OA 2JD70 2GYDA 2ZA6A 3PW8C 2HR5A 5J8WA 2XKQA 2PYBA 1JREA 4REUA 1JKUA 2Y3QA 4ZKHA 2QF9A 3ES3A 1LB3A 2YW7A 2CLBA 4M32A 5JKLA 1Z6OA 3RBCA 2CIHA 4AM2A 4PGKA 5FFDA 2V15A 4RC7B 3BVLA 1ZS3A 2YW6A 3A68A
chains in the Genus database with same CATH topology
1H96A 4CMYV 4E6KA 5FFBA 2F7NA 1MOJA 3AF8X 3KA6A 4MXPA 4ZL5A 5FFCA 3UOFA 1NNQA 3WVVA 4KVSA 1YUXA 3E1LA 2WWXB 2BK6A 4ISPA 1YV1A 3F33A 2V2JA 2IB0A 3F39A 4LQNA 3AJQA 2MGYA 2FHAA 3E6SA 3KWOA 2CF7A 5LBHA 3ERZA 3KDQA 1RCIA 2ZA8A 3GHQA 4RC5A 3UOIA 2ITBA 2ZG8X 3PW8A 3KA9A 1MFRA 4A25A 1HRSA 4CMYA 1F30A 5GU0X 4M34A 2V8UA 3E1QA 3O7RA 2WLUA 5E2DA 4Z5SA 3E1MA 3WNWA 3FRSA 4U3GA 1JTSA 1O9RA 2N02A 5HJFA 3AF9X 3R2HA 4ETRA 1NF6A 3PVYB 3EGMA 5E1UA 4RC8A 1RYTA 5D8PA 4XKSA 1KRQA 3A9QA 1GWGA 2GS4A 4CVTA 1J30A 1QGHA 3VV9A 1VEQA 4ITWA 1S2ZA 3SIDA 1TKOA 1F33A 3PWFA 1UMNA 5IX6A 1LKMA 3R2OA 1N1QA 4TOBA 4DE6A 1IESA 2W0OA 4EVEA 3IS8A 4KVQA 4TOGA 2XJOA 1BFRA 4MKUA 4ZL6A 3SH6A 3RE7A 5LG2A 2V2PA 4Y08A 3ISFA 3FSEA 1DATA 2OC5A 5LG8A 3KA4A 5FFAA 5GU3X 2UX1A 3HIUA 3F36A 4E40A 2ZURX 1JGCA 3PVTB 3QHCA 2V2RA 4II4A 4XKTA 1LKOA 1JI4A 5D8QA 3RAVA 5CMRA 2VXIA 3EZ0A 2FL0A 2OH3A 3W54A 4CYAA 2CEIA 4XGSA 1L8IA 2CWLA 3PWQA 2V2LA 2Y44A 1SQ3A 4IWJA 3C21A 3O7SA 1TK6A 2CHPA 2HTNA 4AM5A 3PW1B 1BG7A 2FZFA 2Z5PA 4IXKA 3R2KA 5K53A 1RCCA 3KXUA 4TOAA 2XJMA 3QHBA 5J9VA 3Q4NA 4DI0A 5HJHA 3AJOA 1S3QA 3PVRA 3E1NA 5LS9A 4ZMCA 3SHXA 1B71A 5AXSA 5CZUA 2C2UA 5JKLG 2G4HA 4DZ0A 1BCFA 2XGWA 3NP2X 5I4JA 3C23A 3BVFA 3R2RA 2BKCA 4TOFA 2V2NA 3FVBA 3E2CA 2CN7A 3EZUA 2Z5QA 4RC6A 5D8OA 1RCEA 1LKPA 4MN9A 3F34A 3N6OA 4DYXA 4EVDA 4TOEA 4CY9A 4YKHA 3OGHA 1Z4AA 4ITTA 1JKVA 3PWQC 2V2SA 5JKMA 3ISEA 2WLAA 3VVAA 2ZG7X 5K52A 5JACA 5D8SA 3E1JA 3IS7A 3WVWA 3BVIA 5JDOA 2Z6MA 4RC5B 3JZ9A 3JZAB 2GYQA 4OYNA 4LPMA 2FFXJ 1AEWA 4LPNA 1VELA 3T9JA 4YVZA 2Z90A 4EVCA 2V2MA 5ERKA 3C1ZA 3RD0A 1Z6OM 2D5KA 2CLUA 4YXJA 4R42A 4DYYA 4CVPA 4TW3A 4DASA 5J93A 4ML5A 4ZKXA 5D8RA 5GN8B 3FRRA 4TOHA 3D19A 4X0JA 1JIGA 1XZ1A 3BVEA 2X170 5CMQA 4KVRA 1IERA 3E1PA 3IQ1A 5JKMG 4RC7A 3KX9A 4TO9A 2VXXA 2JD60 4EVBA 2CN6A 1FHAA 3AF7X 1YUZA 4M33A 3R2SA 1DPSA 4TOCA 4XKUA 2CHIA 2YJKA 2FG4A 3E6RA 2QQYA 5HU6D 4MY7A 3F38A 3AJPA 3OJ5A 3DBYA 2YJJA 5GU2X 3V3KB 4CVRA 1RCGA 4M35A 4CYBA 2IU2A 4Z3BA 4LQJA 4IWKA 3UNOA 3VNXA 3WVUA 3U90A 4DYUA 4P18A 4PG0A 5FEJA 2FKZA 2VZBA 5HQOA 2WTLA 4II4B 1S30A 3QVDA 2C6RA 2Z5RA 4KXRB 4LYUA 1NFVA 1XZ3A 2FJCA 3AK9A 4TODA 3KA3A 3AK8A 3H7GA 4W4LB 1DVBA 1EUMA 3R2MA 1ZUJA 4DYZA 5C6FA 3F32A 3PVYA 2JD80 3BT5A 3NP0X 2RBDA 4YXMA 1NF4A 3GGYA 3KHKA 3LKDA 4PG1A 4WJG4 3MPSA 5GOUA 4LYXA 2ZG9X 5J8SA 3GE4A 4LPJA 3PZAA 4QUWA 3L0MA 2FG8A 3QD8A 2XJNA 3SE1A 1JI5A 3KA8A 1UVHA 2C2FA 1TJOA 2IY4A 3PVRB 2V2IA 3F35A 4CVSA 3R2LA 2C2JA 1RCDA 3GVYA 4MUDA 3Q4QA 4ISMA 1JYBA 3NOZX 3QZ3A 5D8YA 4MJYA 2C41A 2BJYA 5GN8A 5ERJA 4PGIA 1VJXA 3BKNA 3Q4OA 1VLGA 5GU1X 3C1YA 4LQHA 1QYBA 2ZA7A 3PVTA 2AR0A 3F37A 3HL1A 3BVKA 4RC6B 1L8HA 2V8TA 1SOFA 3RGDA 3FI6A 1R03A 1OTKA 3TA8A 3UFBA 3GGZA 4AM4A 4ZKWA 3M6JA 4ZLWA 1VEIA 4ZTTA 2OKCA 4ERUA 4ZJKA 2G38B 3PW1A 5FFEA 3Q4RA 5JDOB 4W4KB 3QB9A 2BW1A 1TKPA 4LQVA 1O9IA 2V2OA 5D8XA 3E1OA 2JD70 2GYDA 2ZA6A 3PW8C 2HR5A 5J8WA 2XKQA 2PYBA 1JREA 4REUA 1JKUA 2Y3QA 4ZKHA 2QF9A 3ES3A 1LB3A 2YW7A 2CLBA 4M32A 5JKLA 1Z6OA 3RBCA 2CIHA 4AM2A 4PGKA 5FFDA 2V15A 4RC7B 3BVLA 1ZS3A 2YW6A 3A68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H96 A;  4CMY V;  4E6K A;  5FFB A;  2F7N A;  1MOJ A;  3AF8 X;  3KA6 A;  4ZL5 A;  5FFC A;  3UOF A;  1NNQ A;  3WVV A;  4KVS A;  1YUX A;  3E1L A;  2BK6 A;  4ISP A;  1YV1 A;  3F33 A;  2V2J A;  2IB0 A;  3F39 A;  4LQN A;  3AJQ A;  2FHA A;  3E6S A;  3KWO A;  2CF7 A;  5LBH A;  3ERZ A;  1RCI A;  2ZA8 A;  3GHQ A;  4RC5 A;  3UOI A;  2ITB A;  2ZG8 X;  3PW8 A;  3KA9 A;  1MFR A;  4A25 A;  1HRS A;  4CMY A;  1F30 A;  5GU0 X;  4M34 A;  3E1Q A;  3O7R A;  2WLU A;  5E2D A;  4Z5S A;  3E1M A;  3WNW A;  4U3G A;  1JTS A;  1O9R A;  5HJF A;  3AF9 X;  3R2H A;  4ETR A;  1NF6 A;  3PVY B;  3EGM A;  5E1U A;  4RC8 A;  1RYT A;  5D8P A;  4XKS A;  1KRQ A;  3A9Q A;  1GWG A;  2GS4 A;  4CVT A;  1J30 A;  1QGH A;  1VEQ A;  4ITW A;  1S2Z A;  3SID A;  1TKO A;  1F33 A;  3PWF A;  1UMN A;  5IX6 A;  1LKM A;  3R2O A;  1N1Q A;  4TOB A;  4DE6 A;  1IES A;  2W0O A;  4EVE A;  3IS8 A;  4KVQ A;  4TOG A;  2XJO A;  1BFR A;  4MKU A;  4ZL6 A;  3SH6 A;  3RE7 A;  5LG2 A;  2V2P A;  4Y08 A;  3ISF A;  3FSE A;  1DAT A;  2OC5 A;  5LG8 A;  3KA4 A;  5FFA A;  5GU3 X;  2UX1 A;  3HIU A;  3F36 A;  2ZUR X;  1JGC A;  3PVT B;  3QHC A;  2V2R A;  4II4 A;  4XKT A;  1LKO A;  1JI4 A;  5D8Q A;  3RAV A;  5CMR A;  2VXI A;  3EZ0 A;  2FL0 A;  2OH3 A;  4CYA A;  2CEI A;  4XGS A;  1L8I A;  3PWQ A;  2V2L A;  1SQ3 A;  4IWJ A;  3O7S A;  1TK6 A;  2CHP A;  2HTN A;  4AM5 A;  3PW1 B;  1BG7 A;  2FZF A;  2Z5P A;  4IXK A;  3R2K A;  5K53 A;  1RCC A;  3KXU A;  4TOA A;  2XJM A;  3QHB A;  5J9V A;  3Q4N A;  4DI0 A;  5HJH A;  3AJO A;  1S3Q A;  3PVR A;  3E1N A;  5LS9 A;  4ZMC A;  3SHX A;  1B71 A;  5AXS A;  5CZU A;  2C2U A;  5JKL G;  2G4H A;  4DZ0 A;  1BCF A;  2XGW A;  3NP2 X;  5I4J A;  3BVF A;  3R2R A;  2BKC A;  4TOF A;  2V2N A;  3FVB A;  3E2C A;  2CN7 A;  3EZU A;  2Z5Q A;  4RC6 A;  5D8O A;  1RCE A;  1LKP A;  4MN9 A;  3F34 A;  4DYX A;  4EVD A;  4TOE A;  4CY9 A;  4YKH A;  3OGH A;  1Z4A A;  4ITT A;  1JKV A;  3PWQ C;  2V2S A;  5JKM A;  3ISE A;  2WLA A;  2ZG7 X;  5K52 A;  5JAC A;  5D8S A;  3E1J A;  3IS7 A;  3WVW A;  3BVI A;  2Z6M A;  4RC5 B;  2GYQ A;  4OYN A;  4LPM A;  2FFX J;  1AEW A;  4LPN A;  1VEL A;  3T9J A;  2Z90 A;  4EVC A;  2V2M A;  5ERK A;  3RD0 A;  1Z6O M;  2D5K A;  2CLU A;  4R42 A;  4DYY A;  4CVP A;  4TW3 A;  4DAS A;  5J93 A;  4ML5 A;  4ZKX A;  5D8R A;  5GN8 B;  4TOH A;  1JIG A;  1XZ1 A;  3BVE A;  2X17 0;  5CMQ A;  4KVR A;  1IER A;  3E1P A;  3IQ1 A;  5JKM G;  4RC7 A;  3KX9 A;  4TO9 A;  2VXX A;  2JD6 0;  4EVB A;  2CN6 A;  1FHA A;  3AF7 X;  1YUZ A;  4M33 A;  3R2S A;  1DPS A;  4TOC A;  4XKU A;  2CHI A;  2YJK A;  2FG4 A;  3E6R A;  2QQY A;  4MY7 A;  3F38 A;  3AJP A;  3OJ5 A;  2YJJ A;  5GU2 X;  4CVR A;  1RCG A;  4M35 A;  4CYB A;  2IU2 A;  4Z3B A;  4LQJ A;  4IWK A;  3UNO A;  3VNX A;  3WVU A;  3U90 A;  4DYU A;  4P18 A;  4PG0 A;  5FEJ A;  2FKZ A;  2VZB A;  5HQO A;  2WTL A;  4II4 B;  1S30 A;  3QVD A;  2C6R A;  2Z5R A;  4LYU A;  1NFV A;  1XZ3 A;  2FJC A;  3AK9 A;  4TOD A;  3KA3 A;  3AK8 A;  3H7G A;  1DVB A;  1EUM A;  3R2M A;  1ZUJ A;  4DYZ A;  5C6F A;  3F32 A;  3PVY A;  2JD8 0;  3BT5 A;  3NP0 X;  2RBD A;  1NF4 A;  4PG1 A;  3MPS A;  5GOU A;  4LYX A;  2ZG9 X;  5J8S A;  3GE4 A;  4LPJ A;  3PZA A;  4QUW A;  3SE1 A;  2FG8 A;  3QD8 A;  2XJN A;  1JI5 A;  3KA8 A;  1UVH A;  2C2F A;  1TJO A;  2IY4 A;  3PVR B;  2V2I A;  3F35 A;  4CVS A;  3R2L A;  2C2J A;  1RCD A;  3GVY A;  4MUD A;  3Q4Q A;  4ISM A;  1JYB A;  3NOZ X;  3QZ3 A;  5D8Y A;  4MJY A;  2C41 A;  2BJY A;  5GN8 A;  5ERJ A;  4PGI A;  1VJX A;  3BKN A;  3Q4O A;  1VLG A;  5GU1 X;  4LQH A;  1QYB A;  2ZA7 A;  3PVT A;  3HL1 A;  3F37 A;  3BVK A;  4RC6 B;  1L8H A;  1SOF A;  3RGD A;  3FI6 A;  1R03 A;  1OTK A;  3TA8 A;  4AM4 A;  4ZKW A;  4ZLW A;  1VEI A;  4ZTT A;  4ERU A;  4ZJK A;  3PW1 A;  5FFE A;  3Q4R A;  3QB9 A;  2BW1 A;  1TKP A;  4LQV A;  1O9I A;  2V2O A;  5D8X A;  3E1O A;  2JD7 0;  2GYD A;  2ZA6 A;  3PW8 C;  2HR5 A;  5J8W A;  2XKQ A;  2PYB A;  1JRE A;  4REU A;  1JKU A;  2Y3Q A;  4ZKH A;  2QF9 A;  3ES3 A;  1LB3 A;  2YW7 A;  2CLB A;  4M32 A;  5JKL A;  1Z6O A;  3RBC A;  2CIH A;  4AM2 A;  4PGK A;  5FFD A;  2V15 A;  4RC7 B;  3BVL A;  1ZS3 A;  2YW6 A;  3A68 A; 
#chains in the Genus database with same CATH topology
 1H96 A;  4CMY V;  4E6K A;  5FFB A;  2F7N A;  1MOJ A;  3AF8 X;  3KA6 A;  4MXP A;  4ZL5 A;  5FFC A;  3UOF A;  1NNQ A;  3WVV A;  4KVS A;  1YUX A;  3E1L A;  2WWX B;  2BK6 A;  4ISP A;  1YV1 A;  3F33 A;  2V2J A;  2IB0 A;  3F39 A;  4LQN A;  3AJQ A;  2MGY A;  2FHA A;  3E6S A;  3KWO A;  2CF7 A;  5LBH A;  3ERZ A;  3KDQ A;  1RCI A;  2ZA8 A;  3GHQ A;  4RC5 A;  3UOI A;  2ITB A;  2ZG8 X;  3PW8 A;  3KA9 A;  1MFR A;  4A25 A;  1HRS A;  4CMY A;  1F30 A;  5GU0 X;  4M34 A;  2V8U A;  3E1Q A;  3O7R A;  2WLU A;  5E2D A;  4Z5S A;  3E1M A;  3WNW A;  3FRS A;  4U3G A;  1JTS A;  1O9R A;  2N02 A;  5HJF A;  3AF9 X;  3R2H A;  4ETR A;  1NF6 A;  3PVY B;  3EGM A;  5E1U A;  4RC8 A;  1RYT A;  5D8P A;  4XKS A;  1KRQ A;  3A9Q A;  1GWG A;  2GS4 A;  4CVT A;  1J30 A;  1QGH A;  3VV9 A;  1VEQ A;  4ITW A;  1S2Z A;  3SID A;  1TKO A;  1F33 A;  3PWF A;  1UMN A;  5IX6 A;  1LKM A;  3R2O A;  1N1Q A;  4TOB A;  4DE6 A;  1IES A;  2W0O A;  4EVE A;  3IS8 A;  4KVQ A;  4TOG A;  2XJO A;  1BFR A;  4MKU A;  4ZL6 A;  3SH6 A;  3RE7 A;  5LG2 A;  2V2P A;  4Y08 A;  3ISF A;  3FSE A;  1DAT A;  2OC5 A;  5LG8 A;  3KA4 A;  5FFA A;  5GU3 X;  2UX1 A;  3HIU A;  3F36 A;  4E40 A;  2ZUR X;  1JGC A;  3PVT B;  3QHC A;  2V2R A;  4II4 A;  4XKT A;  1LKO A;  1JI4 A;  5D8Q A;  3RAV A;  5CMR A;  2VXI A;  3EZ0 A;  2FL0 A;  2OH3 A;  3W54 A;  4CYA A;  2CEI A;  4XGS A;  1L8I A;  2CWL A;  3PWQ A;  2V2L A;  2Y44 A;  1SQ3 A;  4IWJ A;  3C21 A;  3O7S A;  1TK6 A;  2CHP A;  2HTN A;  4AM5 A;  3PW1 B;  1BG7 A;  2FZF A;  2Z5P A;  4IXK A;  3R2K A;  5K53 A;  1RCC A;  3KXU A;  4TOA A;  2XJM A;  3QHB A;  5J9V A;  3Q4N A;  4DI0 A;  5HJH A;  3AJO A;  1S3Q A;  3PVR A;  3E1N A;  5LS9 A;  4ZMC A;  3SHX A;  1B71 A;  5AXS A;  5CZU A;  2C2U A;  5JKL G;  2G4H A;  4DZ0 A;  1BCF A;  2XGW A;  3NP2 X;  5I4J A;  3C23 A;  3BVF A;  3R2R A;  2BKC A;  4TOF A;  2V2N A;  3FVB A;  3E2C A;  2CN7 A;  3EZU A;  2Z5Q A;  4RC6 A;  5D8O A;  1RCE A;  1LKP A;  4MN9 A;  3F34 A;  3N6O A;  4DYX A;  4EVD A;  4TOE A;  4CY9 A;  4YKH A;  3OGH A;  1Z4A A;  4ITT A;  1JKV A;  3PWQ C;  2V2S A;  5JKM A;  3ISE A;  2WLA A;  3VVA A;  2ZG7 X;  5K52 A;  5JAC A;  5D8S A;  3E1J A;  3IS7 A;  3WVW A;  3BVI A;  5JDO A;  2Z6M A;  4RC5 B;  3JZ9 A;  3JZA B;  2GYQ A;  4OYN A;  4LPM A;  2FFX J;  1AEW A;  4LPN A;  1VEL A;  3T9J A;  4YVZ A;  2Z90 A;  4EVC A;  2V2M A;  5ERK A;  3C1Z A;  3RD0 A;  1Z6O M;  2D5K A;  2CLU A;  4YXJ A;  4R42 A;  4DYY A;  4CVP A;  4TW3 A;  4DAS A;  5J93 A;  4ML5 A;  4ZKX A;  5D8R A;  5GN8 B;  3FRR A;  4TOH A;  3D19 A;  4X0J A;  1JIG A;  1XZ1 A;  3BVE A;  2X17 0;  5CMQ A;  4KVR A;  1IER A;  3E1P A;  3IQ1 A;  5JKM G;  4RC7 A;  3KX9 A;  4TO9 A;  2VXX A;  2JD6 0;  4EVB A;  2CN6 A;  1FHA A;  3AF7 X;  1YUZ A;  4M33 A;  3R2S A;  1DPS A;  4TOC A;  4XKU A;  2CHI A;  2YJK A;  2FG4 A;  3E6R A;  2QQY A;  5HU6 D;  4MY7 A;  3F38 A;  3AJP A;  3OJ5 A;  3DBY A;  2YJJ A;  5GU2 X;  3V3K B;  4CVR A;  1RCG A;  4M35 A;  4CYB A;  2IU2 A;  4Z3B A;  4LQJ A;  4IWK A;  3UNO A;  3VNX A;  3WVU A;  3U90 A;  4DYU A;  4P18 A;  4PG0 A;  5FEJ A;  2FKZ A;  2VZB A;  5HQO A;  2WTL A;  4II4 B;  1S30 A;  3QVD A;  2C6R A;  2Z5R A;  4KXR B;  4LYU A;  1NFV A;  1XZ3 A;  2FJC A;  3AK9 A;  4TOD A;  3KA3 A;  3AK8 A;  3H7G A;  4W4L B;  1DVB A;  1EUM A;  3R2M A;  1ZUJ A;  4DYZ A;  5C6F A;  3F32 A;  3PVY A;  2JD8 0;  3BT5 A;  3NP0 X;  2RBD A;  4YXM A;  1NF4 A;  3GGY A;  3KHK A;  3LKD A;  4PG1 A;  4WJG 4;  3MPS A;  5GOU A;  4LYX A;  2ZG9 X;  5J8S A;  3GE4 A;  4LPJ A;  3PZA A;  4QUW A;  3L0M A;  2FG8 A;  3QD8 A;  2XJN A;  3SE1 A;  1JI5 A;  3KA8 A;  1UVH A;  2C2F A;  1TJO A;  2IY4 A;  3PVR B;  2V2I A;  3F35 A;  4CVS A;  3R2L A;  2C2J A;  1RCD A;  3GVY A;  4MUD A;  3Q4Q A;  4ISM A;  1JYB A;  3NOZ X;  3QZ3 A;  5D8Y A;  4MJY A;  2C41 A;  2BJY A;  5GN8 A;  5ERJ A;  4PGI A;  1VJX A;  3BKN A;  3Q4O A;  1VLG A;  5GU1 X;  3C1Y A;  4LQH A;  1QYB A;  2ZA7 A;  3PVT A;  2AR0 A;  3F37 A;  3HL1 A;  3BVK A;  4RC6 B;  1L8H A;  2V8T A;  1SOF A;  3RGD A;  3FI6 A;  1R03 A;  1OTK A;  3TA8 A;  3UFB A;  3GGZ A;  4AM4 A;  4ZKW A;  3M6J A;  4ZLW A;  1VEI A;  4ZTT A;  2OKC A;  4ERU A;  4ZJK A;  2G38 B;  3PW1 A;  5FFE A;  3Q4R A;  5JDO B;  4W4K B;  3QB9 A;  2BW1 A;  1TKP A;  4LQV A;  1O9I A;  2V2O A;  5D8X A;  3E1O A;  2JD7 0;  2GYD A;  2ZA6 A;  3PW8 C;  2HR5 A;  5J8W A;  2XKQ A;  2PYB A;  1JRE A;  4REU A;  1JKU A;  2Y3Q A;  4ZKH A;  2QF9 A;  3ES3 A;  1LB3 A;  2YW7 A;  2CLB A;  4M32 A;  5JKL A;  1Z6O A;  3RBC A;  2CIH A;  4AM2 A;  4PGK A;  5FFD A;  2V15 A;  4RC7 B;  3BVL A;  1ZS3 A;  2YW6 A;  3A68 A; 
#chains in the Genus database with same CATH homology
 1H96 A;  4CMY V;  4E6K A;  5FFB A;  2F7N A;  1MOJ A;  3AF8 X;  3KA6 A;  4MXP A;  4ZL5 A;  5FFC A;  3UOF A;  1NNQ A;  3WVV A;  4KVS A;  1YUX A;  3E1L A;  2WWX B;  2BK6 A;  4ISP A;  1YV1 A;  3F33 A;  2V2J A;  2IB0 A;  3F39 A;  4LQN A;  3AJQ A;  2MGY A;  2FHA A;  3E6S A;  3KWO A;  2CF7 A;  5LBH A;  3ERZ A;  3KDQ A;  1RCI A;  2ZA8 A;  3GHQ A;  4RC5 A;  3UOI A;  2ITB A;  2ZG8 X;  3PW8 A;  3KA9 A;  1MFR A;  4A25 A;  1HRS A;  4CMY A;  1F30 A;  5GU0 X;  4M34 A;  2V8U A;  3E1Q A;  3O7R A;  2WLU A;  5E2D A;  4Z5S A;  3E1M A;  3WNW A;  3FRS A;  4U3G A;  1JTS A;  1O9R A;  2N02 A;  5HJF A;  3AF9 X;  3R2H A;  4ETR A;  1NF6 A;  3PVY B;  3EGM A;  5E1U A;  4RC8 A;  1RYT A;  5D8P A;  4XKS A;  1KRQ A;  3A9Q A;  1GWG A;  2GS4 A;  4CVT A;  1J30 A;  1QGH A;  3VV9 A;  1VEQ A;  4ITW A;  1S2Z A;  3SID A;  1TKO A;  1F33 A;  3PWF A;  1UMN A;  5IX6 A;  1LKM A;  3R2O A;  1N1Q A;  4TOB A;  4DE6 A;  1IES A;  2W0O A;  4EVE A;  3IS8 A;  4KVQ A;  4TOG A;  2XJO A;  1BFR A;  4MKU A;  4ZL6 A;  3SH6 A;  3RE7 A;  5LG2 A;  2V2P A;  4Y08 A;  3ISF A;  3FSE A;  1DAT A;  2OC5 A;  5LG8 A;  3KA4 A;  5FFA A;  5GU3 X;  2UX1 A;  3HIU A;  3F36 A;  4E40 A;  2ZUR X;  1JGC A;  3PVT B;  3QHC A;  2V2R A;  4II4 A;  4XKT A;  1LKO A;  1JI4 A;  5D8Q A;  3RAV A;  5CMR A;  2VXI A;  3EZ0 A;  2FL0 A;  2OH3 A;  3W54 A;  4CYA A;  2CEI A;  4XGS A;  1L8I A;  2CWL A;  3PWQ A;  2V2L A;  2Y44 A;  1SQ3 A;  4IWJ A;  3C21 A;  3O7S A;  1TK6 A;  2CHP A;  2HTN A;  4AM5 A;  3PW1 B;  1BG7 A;  2FZF A;  2Z5P A;  4IXK A;  3R2K A;  5K53 A;  1RCC A;  3KXU A;  4TOA A;  2XJM A;  3QHB A;  5J9V A;  3Q4N A;  4DI0 A;  5HJH A;  3AJO A;  1S3Q A;  3PVR A;  3E1N A;  5LS9 A;  4ZMC A;  3SHX A;  1B71 A;  5AXS A;  5CZU A;  2C2U A;  5JKL G;  2G4H A;  4DZ0 A;  1BCF A;  2XGW A;  3NP2 X;  5I4J A;  3C23 A;  3BVF A;  3R2R A;  2BKC A;  4TOF A;  2V2N A;  3FVB A;  3E2C A;  2CN7 A;  3EZU A;  2Z5Q A;  4RC6 A;  5D8O A;  1RCE A;  1LKP A;  4MN9 A;  3F34 A;  3N6O A;  4DYX A;  4EVD A;  4TOE A;  4CY9 A;  4YKH A;  3OGH A;  1Z4A A;  4ITT A;  1JKV A;  3PWQ C;  2V2S A;  5JKM A;  3ISE A;  2WLA A;  3VVA A;  2ZG7 X;  5K52 A;  5JAC A;  5D8S A;  3E1J A;  3IS7 A;  3WVW A;  3BVI A;  5JDO A;  2Z6M A;  4RC5 B;  3JZ9 A;  3JZA B;  2GYQ A;  4OYN A;  4LPM A;  2FFX J;  1AEW A;  4LPN A;  1VEL A;  3T9J A;  4YVZ A;  2Z90 A;  4EVC A;  2V2M A;  5ERK A;  3C1Z A;  3RD0 A;  1Z6O M;  2D5K A;  2CLU A;  4YXJ A;  4R42 A;  4DYY A;  4CVP A;  4TW3 A;  4DAS A;  5J93 A;  4ML5 A;  4ZKX A;  5D8R A;  5GN8 B;  3FRR A;  4TOH A;  3D19 A;  4X0J A;  1JIG A;  1XZ1 A;  3BVE A;  2X17 0;  5CMQ A;  4KVR A;  1IER A;  3E1P A;  3IQ1 A;  5JKM G;  4RC7 A;  3KX9 A;  4TO9 A;  2VXX A;  2JD6 0;  4EVB A;  2CN6 A;  1FHA A;  3AF7 X;  1YUZ A;  4M33 A;  3R2S A;  1DPS A;  4TOC A;  4XKU A;  2CHI A;  2YJK A;  2FG4 A;  3E6R A;  2QQY A;  5HU6 D;  4MY7 A;  3F38 A;  3AJP A;  3OJ5 A;  3DBY A;  2YJJ A;  5GU2 X;  3V3K B;  4CVR A;  1RCG A;  4M35 A;  4CYB A;  2IU2 A;  4Z3B A;  4LQJ A;  4IWK A;  3UNO A;  3VNX A;  3WVU A;  3U90 A;  4DYU A;  4P18 A;  4PG0 A;  5FEJ A;  2FKZ A;  2VZB A;  5HQO A;  2WTL A;  4II4 B;  1S30 A;  3QVD A;  2C6R A;  2Z5R A;  4KXR B;  4LYU A;  1NFV A;  1XZ3 A;  2FJC A;  3AK9 A;  4TOD A;  3KA3 A;  3AK8 A;  3H7G A;  4W4L B;  1DVB A;  1EUM A;  3R2M A;  1ZUJ A;  4DYZ A;  5C6F A;  3F32 A;  3PVY A;  2JD8 0;  3BT5 A;  3NP0 X;  2RBD A;  4YXM A;  1NF4 A;  3GGY A;  3KHK A;  3LKD A;  4PG1 A;  4WJG 4;  3MPS A;  5GOU A;  4LYX A;  2ZG9 X;  5J8S A;  3GE4 A;  4LPJ A;  3PZA A;  4QUW A;  3L0M A;  2FG8 A;  3QD8 A;  2XJN A;  3SE1 A;  1JI5 A;  3KA8 A;  1UVH A;  2C2F A;  1TJO A;  2IY4 A;  3PVR B;  2V2I A;  3F35 A;  4CVS A;  3R2L A;  2C2J A;  1RCD A;  3GVY A;  4MUD A;  3Q4Q A;  4ISM A;  1JYB A;  3NOZ X;  3QZ3 A;  5D8Y A;  4MJY A;  2C41 A;  2BJY A;  5GN8 A;  5ERJ A;  4PGI A;  1VJX A;  3BKN A;  3Q4O A;  1VLG A;  5GU1 X;  3C1Y A;  4LQH A;  1QYB A;  2ZA7 A;  3PVT A;  2AR0 A;  3F37 A;  3HL1 A;  3BVK A;  4RC6 B;  1L8H A;  2V8T A;  1SOF A;  3RGD A;  3FI6 A;  1R03 A;  1OTK A;  3TA8 A;  3UFB A;  3GGZ A;  4AM4 A;  4ZKW A;  3M6J A;  4ZLW A;  1VEI A;  4ZTT A;  2OKC A;  4ERU A;  4ZJK A;  2G38 B;  3PW1 A;  5FFE A;  3Q4R A;  5JDO B;  4W4K B;  3QB9 A;  2BW1 A;  1TKP A;  4LQV A;  1O9I A;  2V2O A;  5D8X A;  3E1O A;  2JD7 0;  2GYD A;  2ZA6 A;  3PW8 C;  2HR5 A;  5J8W A;  2XKQ A;  2PYB A;  1JRE A;  4REU A;  1JKU A;  2Y3Q A;  4ZKH A;  2QF9 A;  3ES3 A;  1LB3 A;  2YW7 A;  2CLB A;  4M32 A;  5JKL A;  1Z6O A;  3RBC A;  2CIH A;  4AM2 A;  4PGK A;  5FFD A;  2V15 A;  4RC7 B;  3BVL A;  1ZS3 A;  2YW6 A;  3A68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...