3QZBA

Crystal structure of a putative superoxide reductase (tm0658) from thermotoga maritima at 1.10 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
131
structure length
131
Chain Sequence
MKLSDFIKTEDFKKEKHVPVIEAPEKVKKDEKVQIVVTVGKEIPHPNTTEHHIRWIKVFFQPDGDPYVYEVGRYEFNAHGESVQGPNIGAVYTEPTVTTVVKLNRSGTIIALSYCNIHGLWESSQKITVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative superoxide reductase
publication title Crystal structure of a putative superoxide reductase (TM0658) from Thermotoga maritima at 1.10 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
total genus 28
structure length 131
sequence length 131
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2011-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qzbA00
1DO6A 4BRJA 1VZGA 3QZBA 4BGLA 4BFJA 4BFKA 1VZHA 2JI3A 4C4BA 4BK8A 2AMUA 4D7PA 1DFXA 4BRVA 4C4UA 4BFFA 2JI1A 2HVBA 2JI2A 1Y07A 1DQKA 4BV1A 1VZIA 1DQIA
chains in the Genus database with same CATH superfamily
1KBGH 2MCMA 1IEBB 1RFDL 2XWXA 4XCFH 5ESAA 1RLBA 1CXIA 2DYPB 4JL2A 2EVHA 4NO2B 1LHZA 2XUWA 2F61A 2CO1A 4XP6L 1IE5A 4KKPA 5IJDC 5FK9B 5LGKA 1B4TA 1IGTA 3FCBA 4X6EA 1CE6B 5EV7A 3RIFF 3VXPB 4Z7NF 1U3HC 4PJ8A 1PX4A 4PWIA 4NIYE 4MVBC 3UXFA 5B39G 3AABA 2D4FA 3CH1A 4N28A 4Y2DC 4FXTA 1UWXK 2OS7A 2XXCB 3D25A 4TNFA 4FQXB 4ZPTA 3GWJA 1OOWA 3VXRB 5I6OA 3M6DA 2N4IA 5CSGA 3HS9A 2E7LA 1S7UA 4JVPA 5DJAA 2NUTB 4JFVA 2O72A 4Y4HD 4WFHE 4KRPD 4OLYH 1MFAL 1YNKL 4PREB 4RSVA 5I8CA 4E9VA 1P9MC 5LCVA 2QQLH 4UINH 4G8FB 3EO9H 3HE7D 2A38A 2AGJH 3TWCL 1X5MA 1BWWA 1E4WH 2VMJA 3U2SA 1UH3A 1WBXA 5JHLL 2DDQL 3F65A 4W1TA 3EDKA 2OSXA 3BLKA 3OF6A 2VDLL 4N5EC 2LW3A 1KB5H 4P3CH 3SOBH 2UZIH 3OKMA 4PSRA 3T2PA 2VSKB 2A9MH 3LIZH 4YMPA 1MLCA 2FGWL 3B56A 2APSA 3WAKA 1BQHG 3ZOAA 1C08B 2BVPA 3IJEA 1A1OB 4QHNB 3LRKA 4XWGH 4EIBA 2WLZA 3GMRB 3HZMB 5D4IA 4LSTL 4HUVA 3ATDA 2FZ3B 1I9RH 2WGNB 1Y6KR 3DV6A 1HT6A 3AY4A 3FFCE 4MA3A 2FIKB 1VIWA 1OE2A 1OF2A 4LLDA 5CZXD 4ACTA 4W93A 4WFGD 1NEUA 3SQBA 3MMEA 1X5JA 3BPCB 4Z78A 1D5ZA 2LLNA 1KFAH 3BRFA 3D39A 4KPHL 3WTWA 2QQKH 4ZXBA 3KBHE 5GS0C 1IGTB 1NLBH 5D1XC 2XC8A 2VN5A 3U48A 1HXMA 4LHUG 3D25B 4AGOA 1NBVH 1RY7B 1BBDH 1MEXH 4HUNB 4MAYA 1E2ZA 4I3SL 5FB8A 4MX7A 3WO3B 5IP4A 4LSDA 1L7TH 1X5ZA 4TM9A 1S7UB 3P1VA 1IAIH 5DJAB 5FYKD 1GY2A 3PWNA 3RHWF 4AIZA 3ELAT 5I8CB 1U3HA 5F88A 3A24A 5FYLD 1OAYH 2MEJB 3MLZL 2VN6A 4Y2DA 4NKDA 5HHMD 3RWGA 5BOJA 3AT8A 5GZNA 3U2SB 3NAAH 4FQ2L 3ARGA 3V10A 2XA8L 5D96B 1UXWA 5IB2B 3D50A 5HTSA 1QWNA 3IU3A 1QSED 3OKMB 2ITFA 2P5EE 1R3HA 3BHBA 3OHXA 3WMPA 2JK5A 4ODBD 1MLCB 1G94A 1P9MA 2BS9A 2LAGB 3FRUA 3E6FA 1CD0A 5MENA 2XN1A 1CGWA 1DBAL 4MNQA 5BV7C 5T1MA 1D6VH 1SLWA 3QXDA 4Q9CA 1CQYA 4KQ4H 4QRRA 4OZFB 2BSRB 1QBLL 3I9GL 4P3DB 4YVNA 5F3HA 3TOPA 5F6IB 2WBJA 2Q0ZX 1MFCL 3IPFA 3L7FB 4JPKL 4WGWB 3WLWD 1UM5L 1EZVX 5LNEA 3MXWL 1D5ZB 3D39B 1OTUD 1QABA 5LBSA 5C0DB 3KS0H 2NQ3A 2Y1ZA 4Z77B 4S0TD 2MQGA 5FW6A 4GRWE 1LD9B 2E9JA 2GSIB 3QQXA 4JRWA 3Q01A 1IKOP 4UDTB 4AJWA 5HHPB 3VWJC 4R2GD 3N91A 3PWPD 3B7UX 3S35L 5BO1H 5CMAA 3VH8A 3KG5A 1MCCA 3DETC 3MDJA 4J8RB 4MAYB 3T1WA 3NJFA 5FB8B 3L4TA 3VVWA 5AEAA 2IO5A 1F4WH 1YNTF 1NC4D 3BMVA 3DC0A 3P9MA 3FB7B 1MJJA 1P6WA 4G71B 3SPHA 2R2HB 3TIDB 3VXME 4D3CH 3PWNB 4YUEL 3T0EB 3OKKA 3ZYJA 4NHCH 1LEGB 3P40A 1T3FB 5F88B 2BOLA 4H1LB 4JO3L 2HSIA 1INEH 3L5XH 3BGMA 1X5AA 3QCTL 3QG7L 2CR6A 3VWKC 2VLJE 2O4EA 3ARGB 3PS6A 3MUUA 1D3CA 4QRPE 3LKPA 3K0WA 1T20A 2N7BA 1R24B 1T7WA 3FT3A 4LE8A 3QWOA 5INDA 3UH8A 4ANXA 3E3QC 4HZ1A 4DZ8B 5I15H 3V2AR 5JIQA 1R3HB 3BHBB 3OHXB 5ADOH 3JTTA 5DMIH 4TL4A 2BY1A 3O81A 2WOYA 1IC1A 5ICZA 3GUTB 3E6FB 3L3JA 1ERNA 1GR7A 1V7ML 4MNQB 3L3HB 5DYOA 4JRXB 3DBXB 2JLLA 5MI0C 3FT9A 2J2ZB 3UMNA 2DQEL 2OK0L 4JG5A 1WZMA 5HYSA 2R4SL 2BXYA 3VQLA 2WBJB 2DI8A 5I1KH 1MREH 1Z0NA 4K94H 4N3UA 2V3EA 4Z0XB 4MHHG 4K7PX 4JQVC 5EIQA 1KIQB 4QKXB 3UPRB 1CD8A 1IE4A 2A74C 3VXUA 1AHKA 3DHMA 2R2CA 3FFDA 4ZDHB 5EF2A 4M5ZL 1PLBA 5G5DB 3HRZC 4L5FE 4XAKD 3F58L 3E1F1 1WZLA 3JYBA 4OGAD 2OR9L 1AANA 4UZSA 5HHNA 3LNDA 4NUGL 4PV9A 1UUSA 3BAEH 3VFWA 2EVIA 5CMAB 3VH8B 1UWGL 5C6TL 5AW4B 1FNEB 1L9PA 3QEQE 1FG2A 5EZLA 4Z23A 5DJXA 1KJ2L 1VDGA 5SWZE 5IFAH 1YNTA 4OKVB 5CJ5A 2FH6A 3OAZH 4TSBL 4G82A 1VLXA 1OB0A 5LCVH 2GBTA 2ZNXA 1ACXA 5DD6A 1B3JA 3Q1EA 3QWRD 2CRMA 4ANUA 2PPDA 1THCA 1K4CB 3LXBA 3MOBL 4Z7OB 3NZHL 3SO3B 3QRGL 2WQSA 2WP3T 5E4IA 2P9RA 3LKPB 4LKCB 5ID1B 4PWEA 3FT3B 3QWOB 4NP9A 4BKTC 3G6DL 1A6VL 2VLKD 5DZLA 5JYMA 2E9IA 1BGXH 2EEFA 4N1HB 4NKMA 3BPLB 3CFMA 5IHLB 1HFUA 3MUY1 2XX1A 4IM8A 4CMMA 1CDHA 2ZPKH 3CK0L 3CVDA 1DJGA 1EZVY 4OZFH 4PHXA 3VWKA 3TBYA 4YSTA 2JCCA 5EBGA 1NDGA 2OTWA 3B37A 4ONHA 3QDME 5HYSB 4KGLA 3GS4A 4Q74A 3WFBL 3P2DA 5EUOE 3DOHA 2ED9A 2KH2B 3ZTNL 2DQCH 4HWEH 1S7WB 2QEJA 2XU9A 3MLWH 3U6XA 5FYJE 2NNXA 1ZLVH 3VXUB 2EIZB 4YDVA 3TA3D 5A2IH 3GKWH 1AS8A 1TVHB 2QPSA 3L1GA 4QRQB 1GRWA 3IU4L 3N42B 3GINA 1CGVA 5DHMC 2G5RA 1PX8A 3VFNA 4UQ3A 1U3YA 5E08L 4JKLA 5BOZG 2X6VA 4MJIA 1A4BA 4PRHE 1ZLWH 3KPTA 4R3SA 2AJ3A 3GTNA 3IAQA 5KANG 2ATKA 4GS7B 5DJXB 5DRWA 3V6FB 2A74A 3ETSA 3UROR 5I1AA 3WJMA 1OM3L 2YBRA 4WO0A 1RV6X 1EEYA 2YD3A 3HRZA 2UUDK 2ZKXA 3SDDD 2Z7ZA 5D6CB 5L8JB 2R59A 2FATL 3RJDA 1KBGL 1ZSDA 1OP3H 1OWWA 1IGCL 3DOSA 4JHWH 4WW1B 2ZXWB 2DJ4A 1CXKA 5GGSB 1U8LB 3FBQA 1KGXA 1ZGLA 2B77A 2OMWA 2IGFL 3HOGA 4KJPC 5T3ZH 1LQSR 4L1DA 4YLQT 3EOYG 3H2QA 4NKMB 2F5AH 5IMMA 3WDHA 3MLYH 2Z4TA 1TPXB 5JIPA 4GBXB 4B9KC 2J55A 3MLVH 1NCHA 4K7PY 2NT1A 4N2AA 2FJFA 3S5LB 5B38B 4FTVD 4JR9L 2CA4A 1ZT1A 1Q4NX 3CFBA 4PJGE 4EQ2A 3TBYB 4ZZKA 2JCCB 4XMPH 4ONHB 1ORSB 3CVHA 2V2XB 2BHZA 4H7VA 4JFPA 4XOBA 1QTSA 1X44A 3ARFD 2CLVA 3EOTH 4OLYL 5KSAA 5LBSH 3LX9A 3U4EA 1AO7A 3OQ3B 1PQZA 3QJZA 3NZ8B 1T0NB 4KNUA 3KAAA 4UINL 5E5LA 1TDQA 1G7IB 2L0DA 3C87A 4KH9A 5C0AD 2AGJL 4HJEA 1IAII 1SOXA 2P5PA 2DIBA 4UQ3B 1SQ2N 3ZTJG 3U9UB 3QZWA 4MJIB 2X2UA 4P3CL 1KB5L 3PPEA 2ATKB 4BZYA 2VAJA 1FZKA 4NKQB 3MHZA 5GS0H 4XN5A 3LIZL 5D72L 3T0DA 3MZTA 1BD2E 5MHSE 4I1PA 1JHLL 1NIEA 4N87A 1G9NL 4XWGL 1G1KA 1I9RL 1PG7W 1HWWA 4NNPL 3KBEA 4WI0A 4DOHB 1KJMB 4Z9KB 5AAPA 2ED7A 1AQMA 1KUMA 3ZDYE 2OULB 1KCLA 2A9DA 4NIKB 2OMWB 3NA4A 1J5OH 3QJQB 2V7NA 3V5DA 5IMMB 4XZUB 2VQTA 5D1QE 5JHMA 1E2WA 1I8AA 1QOKA 2DM3A 3KPSB 4G9FA 4OTXH 5E51A 1UG9A 1L9SA 1MFDH 3EUUA 1U91B 4A2LA 5DS8A 4Y1AD 2R83A 3CIAA 3RYMA 1JV2B 1NBVL 3B3IA 2XVGA 3KPRA 5C2BH 3B5GA 3WSQH 1BBDL 1MEXL 4TNEA 1L7TL 4O9HL 5BRQA 2FQDA 1HAWA 1IAIL 5DDHB 5C0IB 5KSAB 2GAZA 1PQZB 1TCMA 4KY2A 3V7AE 5BV7H 3Q6FA 4X0KB 1GOGA 1OAYL 4MASA 1BFVH 1KGJA 4ZD3L 1PD6A 4XPGH 4GG6F 4URKA 5T1LD 4HJUA 4M8RA 2P43B 1IBYA 3QR2A 4OIAA 3WHE0 4YHPA 1P84K 4AG4L 1BQUA 1GYCA 4M1DH 3WHXA 3QIUC 4NKOB 3UGEA 1FZKB 4NN6C 3K2KA 1S7SB 4WU5B 5F0MB 3FSZA 1PKOA 3RI5K 1NL0H 2H3NB 2W8CA 4PRIA 4R8WL 2ICWI 4X7TB 4NQUA 2A3TA 2O1AA 4PJCE 4JZOA 5E8PB 4GUPB 3O3UN 1P4LA 3Q8AA 4KQ4L 4WV1B 1HOCA 4IS6B 2D7MA 3GMQB 5B3SB 1SY6L 4UNIA 3W5MA 4RFEA 2XIIA 3GFUA 3FFCB 3LN4B 4ZMZA 3SKMB 3OG6B 5I1EH 5FLVA 3TEZA 2H2PC 4EI5A 4Q56A 2I26N 2WC7A 1GTFA 5DS2A 1PSKH 5AAMA 2V8LA 4LK4A 1HQ4B 5E9NA 2O61A 3B3IB 2XDHA 3KPRB 4YVUA 4ES9A 2JVUA 5C0EB 2WP3O 2R9HD 4AQZA 1ET8A 2XZZA 2EYTA 4ETQA 1GYUA 2JSFA 5DI8B 1UCBL 2GAZB 3V0IA 3VXOB 4NHCL 3TIEA 1NZRA 4NNXB 3FZUD 2DQUH 1INEL 4X98A 1NBZB 1UKTA 4N2KA 4GG6A 1HEHC 2IOOA 2CBOA 2H26A 4JDZA 2MRYA 4J3WA 2NYZA 1XR9B 2EVJA 3L95B 3RIKA 4YHPB 2X41A 3BRGC 1KTCA 1ZANL 3CVIL 4RZCB 7FABH 2YUZA 5I15L 3MCLH 4E9YA 5ADOL 2Q86B 2YOCA 2JELH 4S1SH 4PGJA 5CR8A 3REWA 1DBBL 3U79A 2YSSA 4DK3A 2X4QA 3I3DA 4PMEA 3MV01 4Y5YB 5KYYA 2ZKHL 3HB3C 2PYFA 4CN6A 1LM8V 1OY3B 5H37A 2Z4QB 1NUDA 1EFXD 25C8H 4K94L 4MMZB 1VFUA 5I1KL 4NRYB 2AVGA 5DC0A 3PNWA 4RFEB 5FCUH 2A4EA 5KBMA 4Q9QH 1KELL 2DJMA 3BKJL 1QSFD 4G8GA 5JXEC 2JIXD 4TKWA 4EI5B 5E94A 3IAPA 4C83A 1DQLL 4LGPB 4NCC1 4RETB 1L5GB 3P11H 1FDLH 4DT2A 4L8SC 5CZVL 2O61B 5TF0A 4GLRH 1XGPB 2V0AA 4F57L 3CVHH 5A2LH 1WFMA 4QYAA 4P07A 2WNXA 2VQ4A 4M1GH 5IFHL 5IFAL 3QH3B 1U2HA 1JF5A 4J3OC 4M6MH 4ETQB 4UI2A 2YEZB 3ISYA 3QRBA 4W4OC 2IOMA 2NY1B 3HS8A 1SVZA 3KYMA 3G04B 3II1A 2R0LH 4FULA 4X98B 4FMFA 2YAMA 2Y06H 2WKLA 4RSYA 4JFFE 2LFEA 1U9KA 2CLZB 2LGNA 5F89A 1UASA 1OGPA 2H26B 2YAFA 1DO5A 3DMMB 2DYRB 3GM0A 3HVDA 3JT0A 4CU8A 2M2DA 2TAAA 2YBGA 5B8CC 1P7QB 5HYEA 2HTLC 2J20A 4IHBA 1BFSA 4XMVA 4GXUN 4J3OF 1I8MA 4ZUUB 3NCBB 1QPKA 1ZEAH 1UGNA 3QI9B 2IV8A 2VLJB 1TO5A 3BAXA 2DLFH 3KDMA 3ATFA 4QRPB 3MFGB 3HCVB 3FB5B 2ZPKL 4N6QA 5F97E 3BWUF 1G1YA 2X4QB 3X3GH 4P8QA 5DCCA 4F8QA 5KYYB 3FQXB 3NK4A 1J1XL 4M7JL 4D8OA 4MXQD 1U3ZA 2UX6A 4E5XG 2X6AA 2DEYX 43C9B 4AVIA 3OG4B 4N4YB 2F9BT 2DQCL 4LGRB 4AIEA 1HHJA 3ATAA 4AM0A 5ICYA 4LARH 3SYQA 1V3LA 4F93B 1OM9A 4NQTA 4FCHA 2EIJB 1H15A 1OAXH 2ZICA 5IKCA 2HJKB 2WQRA 4MDRA 1RVFH 3FTWA 2GI0A 5CJXC 3HG0A 1U8QB 3HNVH 3WENA 5D2LF 4DP2X 2YLHA 3O0RL 1HI6B 3G5XB 3UYPB 4CMHB 3EHBD 3MV8D 5IUSA 1CFTB 2XPYA 5EN2A 4DP5X 3MA7B 3U4KA 3WU1A 3BJLA 1QWHA 3CFDB 1U8JA 4I0KA 3RKPA 1BYPA 1FGVH 2CRZA 3NESA 1B9ZA 1XH3B 4LVHC 4P4RA 1D2PA 2B08A 2BSSA 5K33A 2AEQH 1DCLA 1XMWA 4XE0A 2YHGA 6TAAA 1FAKT 3CFIC 5J1AA 5SWZB 2ICCA 3UERA 2WLMA 4U1HA 5IG7A 3UJJL 1FE8H 2EIMB 4DO4A 1E28A 1GSKA 5CCGE 4JHWL 3UO8B 4HQQH 2WJ7A 1VSCA 4YO0B 3VI3E 5CEZD 4M3JA 3ISRA 5HHOA 43CAA 1G7LB 5T3ZL 1BVZA 4W4OA 2DPKA 4GT7A 2MPAH 3ZJAA 2FEDC 2F5AL 4NDMA 3MLYL 2YN5A 4RDQG 1G9MC 4MXVF 4WI2A 3MLVL 5L8KB 4OZIF 3OAYH 5CGMA 1P5VA 3CXFA 1AZCA 1JTOA 3OXRA 1YEJL 3SDXE 3B7YA 4PBVC 1B2WH 5HSFA 4YDZA 4KGJA 4OQTA 2HKFH 4P2OC 5DC9B 3TYGH 3EXLA 1S9XA 3KYOB 5D5MF 3D09A 4IGBC 3KPQB 5DJ0B 3OB0H 4K3DH 3BAYA 3L5HA 3ESUF 4QEGA 1JZ5A 2V7HB 5EUOB 1RL1A 4Z76B 2I25N 5D2LA 2B1HH 1RP8A 3NCWA 4I2XE 4HK0B 4L3AA 3HG1A 4CSSA 1IU1A 2BVEA 2FECI 1I1CA 3RWIA 1Q1PA 3DA0A 2VLLB 4G7YH 5GRJL 4H25A 1N12A 4ESKA 4NLHA 4A68A 1QQDA 1A7NH 4HSAC 4ONGH 2P44B 2K8QA 2OSWA 2VW6A 3TJHC 2J4WH 5IF0A 5GS0L 1HXYB 4AXWA 3BJ91 3UJTH 5AKVA 1C8QA 4ZOCA 1A66A 5CJXA 4AE1A 2VXTH 5HVHB 2OW6A 1BZ8A 3CN3A 4XNQB 3Q5YA 1HDMA 3IGAA 1PEZA 4NQXA 4U1HB 5LVEA 5IG7B 3AB0B 3CMGA 5KTEH 4JFOB 5AB1A 2EDRA 2P26A 4FFWD 5C0CE 1ZIAA 4JDEB 3LD8B 3O8XD 5I8OH 4RWYL 5HHOB 43CAB 4WK2B 1J5OL 4TVPH 2QDVA 5DMGC 3CX5J 4F9PC 4G5ZH 1AXSA 4PJ5E 3SIKA 1E5UI 4MAZA 1QW8A 2CAKA 4OZIA 1WT5C 1G6RA 3EOAA 1WAAE 3V6OA 2FYYA 5KS9E 1Z3GH 1P5VB 4QT5A 4J4PC 5H37H 1DVFB 3BX7C 3VYOA 5IFJA 1NCCH 3EYFA 3IFOA 1UB6A 5D5MA 2OSLB 5ESQB 1LEIA 3IN2A 3N04A 1GGBH 2W1NA 3UZVB 1KIRA 3UFIA 1TO4A 3BH4A 1AIFA 2QZ5A 2LOEA 4LCIL 4YNYA 1FUNA 5HGDB 1BFVL 5AZEL 5D2LB 4JKMA 1XBRA 1VERA 1YUHB 4XPGL 1FFRA 1MCJA 3T04D 1KEGL 4FP8H 5F6HJ 5IK3A 4P2OA 1TQCB 4IRZA 5BS0E 4M1DL 4QNPF 1QQDB 4KUZH 4R97C 1T2JA 1WFNA 3BIBX 4WFHD 4KO5A 1JZ4A 3LMJL 2F18A 5L88H 3BKYH 5HDLA 3B9EA 4JMNA 1ONQB 4TLTA 3BW9B 3P69A 3LS5H 1ACYH 5B1JA 4XNAA 4NQXB 1XGYH 3V8OA 3FRPA 4X6BA 5HYFA 4AIXA 3BEWA 3RRQA 2A73A 4YH6A 1ZTMA 3O3BB 3VXSA 3V4PB 3UTQA 4AQAA 1XTLA 2Z93B 3NCEB 4OLUH 4Y19E 4ZUVB 2GUYA 2VUYA 4NRZB 4UNUA 4RGNE 1FSKC 4IJ3B 4K3GA 4XNYL 4WUUE 4A6YA 5I1EL 3SBQA 3HR5A 2QGBA 4XHJD 1AXSB 3ZDYB 3W9DA 1G0XA 2Y72A 3EOAB 3FFCD 1HX0A 1U42A 5KVGH 4ZPVB 3SKJL 1I7UB 4KXAA 2ENYA 2YKLH 4QI3A 2XKUA 4PJ7E 4WI7A 5F1SA 2GK2A 1TZ8A 3F7QA 2C4FT 1OB1A 1LEIB 2FX7H 4BDVA 5EZPA 3QGVA 2AK1H 1M9SA 4GLRI 3LY6A 5EIVA 4FLQA 1WT5A 1GHFH 2DQUL 3LSOB 2GJPA 3MV7D 2VDPH 2C3WA 5LQBH 2AXGB 4J4PA 4FRWA 5JHDD 1HYSC 3VFVB 4OZHF 3NP4A 3OJ2C 3R4DA 4NQDE 5GGTL 5IV2B 1YHPA 2GTWB 3DSNB 4W9FC 3K7UA 4KKAC 2WZ6A 3MCLL 2P8MA 4FLRA 2DB8A 3REVB 3IDXL 1JHKH 4G80B 4W6XB 3OWEA 4K8RD 4POZC 2F0CA 1OP5K 1HH9A 2WKGA 4RFNB 2EP6A 2P49B 1CF1A 3CZUB 2FWOA 2DOCA 1KT2B 2LTQC 5B3JE 3BEWB 3K0YA 3SPJA 1S7QA 3IMTA 2FBRA 4ZX5A 3TV3H 1T7VA 5PCYA 2ZXEB 3DDGA 1XMEB 4PJCB 4QGTA 1OSEA 1FYHB 4J3OH 5FCUL 2P5ED 1DN0A 1L0QA 4Z7VF 5J3HC 4CBZA 1O6SA 3IXTA 4N8VG 1RSFA 1R75A 2FHCA 3SPCA 2PF6A 3S88H 3HR5B 2XG4B 1U93B 2GK0A 3H54A 4X99B 3MCKB 4DERA 3BDYH 1FZJA 4Z7NE 2CPUA 4EIZC 2Q1EA 1OAQH 2ICEC 4IMLA 4FG0A 1M3JA 2WNGA 3VFTA 1TFPA 1J8HE 5IMOA 2OFQA 3CVHL 4OQTH 4JCMA 3D3VA 3VGGA 1CS6A 1I1AC 4M1GL 1NAKL 4L4TE 3LZFH 2W81C 3O3DB 3HLAB 3TT3H 4KAQL 3U7YH 3JWDC 2BY0A 1G43A 5CUSL 1MFEL 1TEFA 1X3DA 2R0LL 3IPBA 1UD2A 2CO7A 1EUUA 2Y06L 4ZSOA 1WITA 3KMDA 3FT1A 2OL3B 1E30A 5BZWA 3B34A 1NGYB 3LQAH 4AGQA 5EBLA 3ARRA 1BVLB 1P4BH 3EBIA 3FU6A 3VO0A 3UC2A 4M5TA 3VXMD 3BVWA 3ISWA 1OSPH 3FO2B 1NKOA 3RVWC 4AX3A 2YPLB 2B0SL 1TMQA 1P7QD 1K8DA 3HN3A 1ZK5A 4NXKA 2EIEA 1IAOB 2WXJA 3X3GL 2Z92B 1IGMH 3POCA 4I4WA 2HUHA 3FSVA 4XCNA 1WVZA 3VG9B 1I3RB 1UJ3C 1WCQA 1W91A 2BVOA 3U36A 3US1A 1AXIB 4NQEE 3KHOA 1J18A 1CL7H 4XXDA 3P02A 4Z7VA 5BZDA 1DN0B 3VTTA 3QDJA 2IDFA 2OYPA 4LARL 1O6SB 3OB8A 5CINH 5EZJA 4I0PB 1I1FB 3TS8A 3ZKNC 3GB7A 3QISA 3ZQXA 1OAXL 4P0DA 2F7OA 4JB9L 3TJEH 1OOAA 3MRGB 4IBTA 4IRSB 2ZUUA 1AFVH 1G6RH 1X6LA 3HNVL 1HE7A 5EF3A 1AR1D 5GHWH 3WKQA 1PX3A 1KLFA 1YEKH 2AJVL 5FDYA 4XNMB 4PRPD 4KK5D 5BQ7B 5CCKH 3D3VB 3QDGA 5GRVK 5B7FA 2ZYIA 3UTSA 3CG8A 3PQYD 3K1DA 1MCRA 3ARWA 4QDGA 4A7QA 1G9MH 4L37B 4NAQA 3ARYA 3PL6A 2AEQL 1LDSA 4LP8A 4MXWH 4U2YA 2OMVA 2V33A 1FHNA 4JO4H 3FU7B 1A9EB 3GGWA 2R56H 4LZKA 5D1XE 4HG4J 1NMAL 4P49A 4LHQB 3BPOC 3N1MC 4ZSOB 2E27H 3PY9A 3QJRB 3WTXA 3QRLA 5KVFH 2BP8A 3IKKA 5BZWB 3QEQD 2R1YB 3L9RA 4IRZH 2YAOA 5C0BE 3I2CH 4XMLH 3K6SB 2JMRA 4X7SH 1JGLL 2MPAL 3RG1C 5DRNA 3RBGA 4FFZA 4ODTH 4N0RA 4AC4A 2IWEA 4QCIA 4ZMTA 3NQKA 2BNQD 5EU5A 4XCEA 5I17B 1FL5A 2QKIB 2EE9A 2PWDA 4LCUB 5KN5B 1F6AA 2BRRH 1YYMH 4C56A 4I4WB 4FZEL 5IHBA 1ADWA 4XCNB 1TZHB 4P2AA 1B2WL 3U36B 4N2MA 2BVOB 2DWYA 3NIDF 1EXGA 1S46A 2HKFL 2PTTB 2YSTA 3TYGL 5JIDA 4YBQD 4Y16B 5AQ0A 5JNYA 3F83A 4HKJB 4MMYB 4FYSA 2XQYG 4K3DL 4A6YH 4GQ9H 3LQZB 2AXFA 5HDBF 3GB7B 1PKQA 2HWZH 1JFHA 4E9RA 1Y18A 3US9A 1RUAH 4DFIA 2BS8A 3QCVL 2YRBA 5C8JA 3CFKB 5I1AB 4KKCC 4ORGA 4LSSH 5IESH 4JFWA 4BFGA 1H6TA 3N41F 3QDMD 1UJ3A 4PYGA 1N0XH 2ZP9A 3EYQC 4G7YL 5E2WL 1HINL 5CJOH 1THAA 2WWKT 4MTMA 5C1MB 3CX5K 2G5UA 5DO2C 5EN3A 5FYJD 2HX7A 2J4WL 4F7CB 4Q9RH 3UJTL 5CSZA 4FQCL 3OLIA 1PMYA 3PL6B 5HHVH 1RJCA 3JTSA 4KZ0A 4YHKH 2OMVB 5GPRA 5EOCJ 4AEIH 4NYLA 1YSOA 3D30A 3WS6A 5DURD 2W91A 3A23A 4PRHD 1OCZB 1MCEA 2BP8B 1EEZA 4F8LA 4PYHA 4BD4A 1UWFA 4HFUL 5AKSA 2IEPA 5ESVA 1X9UA 1FZOB 2NZIA 3GSRB 3OZ9L 4CAGA 4ZUWA 3K4ZA 4HFWA 4TVPL 4GMSL 1CFNB 1F3JB 3IT8D 3QIBC 3A6CL 4ABUA 2RCSL 4G5ZL 4N0CD 2FD6L 5J13B 5L9DL 5EU5B 1TQBB 1T7ZA 1RHHB 3PHOB 2HT3D 4HF5H 2H8PA 2A6JB 2CU9A 3EYSH 2VR8A 4GP8B 4IOFC 4TSAH 1ILUA 1Z3GL 5DZAA 4C56B 1A3QA 4PGCA 3ZZQA 4PWHA 4HALA 1NCCL 3TZVC 5IQLA 3RWJA 1BZQK 5DA4A 1XXDC 1L7IH 1GOHA 4P2QA 3E3QE 4Z7IA 3FF8A 4CVZA 3ZDZB 5I0YA 4JY4B 4YC2B 4XB3A 5AW6B 3LVEA 4BKLB 5TGBB 3DIFB 4N8CH 5E99H 3HZKB 5C8JB 5D71L 5ECGA 5KBNC 3RA7L 2FTAA 4D0BA 3MLPA 1SOKA 2FX8L 2XJKA 3L8QA 4TYUA 1YECL 4APXB 1OK8A 4XGZA 1NINA 5DGQA 1DUYB 1XSKA 1MJ8L 3IJHB 3K2UL 1TQSA 1A47A 3LB6C 4NYLB 4GXUM 4EBQH 4MSWA 2X1QA 4GH7B 4XNXL 2P7TA 1ACYL 4JKPL 3UAEA 2VITB 3ZKMC 1S7VA 4JREB 2ZUWA 4OLUL 1EEZB 3VGFA 2J44A 2ENJA 1NBQA 3E6HA 4NN5C 3O4LA 2MJWA 1BD2D 4DW2H 4AV0A 5MHSD 3RZCD 1UA7A 3KPPB 3LKNA 4NQQA 2NSMA 3SE8L 4GW4A 5T5NF 3B9VA 5AAWC 2NXYD 2IH3A 3PIQA 2JI3A 2EDWA 2YKLL 1OTSC 3FJTA 2F68X 4AM0Q 3NIDB 1PZAA 5FHAH 1OVZA 5I9QC 3EJUA 2CBTA 2WNWA 1AKJD 5JPNC 3U1QA 4F3FA 2WBWB 1NCIA 4XMWA 1H3PL 4DWHA 2VLRD 1V27A 4UMSA 5ANMA 5D1QD 2OYKA 3STLB 3CLEL 3KJ6L 1GHFL 2VXVH 1NCTA 1AGCA 2ZP0T 1WAEA 4YZFE 4PJFE 4UBDD 4JM2B 4MGXA 1DANU 1ICTA 1WBZA 5J6SA 4JFEA 3N41B 4D0BB 5I0VA 2WLYA 4URTB 3TZVA 4MKTA 5H4YA 4B9CA 3TV8A 5HGBA 1UZGA 5E6YA 5EDXA 1G9HA 2GC4C 4B0MM 2A0LD 4AYGA 4HIEB 1PY4A 2X2IA 1LYQA 4XGZB 3AWFA 1A6WL 2E7CA 5DD0H 3S8FB 2HLAA 1HS6A 3L17A 4YSRA 4Y8DC 5BS0B 2ZWLT 3WYRA 3MJWA 4X7CC 2NW3A 1OGAA 2NDGA 3VSUA 5T5FA 3ELQA 4LCWB 4AMKL 5CN3A 1QKZL 4CDHA 3FHQA 4TQ8A 3TV3L 2ZAHA 1S7VB 3GBMH 3GD1C 2DTSA 5I19L 4Y5VB 4GP4B 1XGRA 5CLZA 4B3EA 3CFEB 1FNSH 4JRYE 2BO0A 3JWDH 2X1PA 4LLMA 5KJ4A 4FFZH 4YSUA 1CL7I 2XKNA 3QQ4B 3TXAA 4E68A 1RK1A 4AL8C 4P5TD 4PJDF 1NFIB 4G9FE 4UIMA 3CPLB 4GW4B 4WUUB 4POYA 4N2GA 2DW5A 2VM9A 1W9XA 2IH3B 3GIVA 3SN6N 4X7DC 2Z65C 5CD3A 1DUZA 1GPOL 1H6UA 3HBGA 2X70A 2H41A 5F7NC 1QNZH 3LZFL 2X2JA 3B7SA 5E6UB 3QWQB 4M3HA 3LS4L 4HW6A 5EBMA 3SO5A 3BGFB 3K4AA 3V0WH 3S6CA 3LN5A 5I82A 4PJ7B 1FVCA 1RKRA 2W07B 4QOKD 1Q90A 4ZNEE 1AGCB 2UY6A 2CUMA 1X5HA 4YN3A 5BJTA 1WBZB 3NTCL 4FLSA 4MA1C 3SDYH 2ESVB 3IDYB 4FXKC 4P2YA 1SOSA 1JUFA 2PWHA 3LQAL 5HGBB 5F7HA 1UACH 5JPNA 1OGSA 4JZJC 5J06A 5E6SB 5IBLD 2WXKA 1J0KA 1A7OH 1SEBA 4OZFG 4LL1A 3WE6B 4LQ1A 3MRKB 5DRXA 3D69A 2P48B 2HLAB 3KLKA 1I7TA 3CD4A 1U8PA 2G9HA 1EV2E 1Q9WA 5AD0A 2E9GA 3RDTD 2OMZB 5TD4A 2Q87A 1BXXA 1BIIA 4AK2A 4YDKH 3X13B 1U8MB 2WLIA 3C09C 2XV3A 1LEKB 1E65A 2A5UA 5IWLA 4LVNB 2R4RH 3V4PL 4F33B 4KDWA 1I8LC 1P7BA 2DQFA 3RWEA 3QUYC 3EH4B 4N2HA 2QADD 2H1XA 4LPWA 3DX3A 2JQMA 1XGRB 3DGDA 2WWKO 2DQIH 2BSBA 2JKNA 1R3IH 1MVYA 2Y1AA 3ZL4H 4AENA 4LLMB 1W0WA 3O3AB 1M6OA 2FL5A 3TJEL 2XKNB 1AFVL 3JBG7 4G3YH 4LLVA 5I73C 1G6RL 1RK1B 1SDDB 4NQCE 4XBMA 5GHWL 4UIMB 4RLDA 3IKCB 2F54E 3MYZA 1KTJA 2FNBA 1YEKL 4LL9A 3RL2A 4BZ2L 3GIVB 4H1LG 4PQXA 4IRSD 3QE5A 2TSAA 1W72A 5DJYA 3NH7H 1DUZB 4OFPA 5E6IC 4UOW0 5CCKL 1N5AB 2X70B 2EKJA 3MRBB 1QI5A 3T9WA 2F58H 1J8HB 1MRFH 4MJ6A 4X5WA 5GRXG 3SGJA 3N1FC 4JRFA 2XWJB 5DD1H 1BZOA 3LN5B 3U6RA 1FVCB 1OIOA 4UZGA 2PP7A 4IOIB 5LXGH 2K6ZA 3FB6B 3EGDA 4N2BA 4OD2A 5F0JB 3OLEA 2E27L 3OHMB 4OCYH 1RUMH 3BVTA 5KVFL 3DRTB 4UQDA 4HVBA 2DWEB 1RULH 1ZVSB 5DD5H 1JUFB 3QWNA 4IRZL 5ILTH 2PYED 5D70L 3CSFA 2H0FA 5SWSE 1WP6A 1SEBB 3O6FA 4EZLA 2D3JA 2N59A 5IVNA 5GISL 2EE6A 1DQQA 4NUJB 1WIPA 3L7EA 4ODTL 4A2MA 4E9LA 3MO1A 3WNMA 1JJUA 1Q9WB 2BDNH 2NXZC 3S3SA 4AVKA 1Y7VA 4G6AC 4JFFD 4EJ1C 4IW4C 4KOCA 2BRRL 1YYML 2PXYA 2BHUA 3GUFA 2LU4A 4FXKA 3DJ9A 3IDNA 4JZJA 2DQFB 3VE0A 2FSEA 1DQDH 5IREA 2YD1A 1F41A 3WY1A 2RFXB 4M3KB 2R8SH 2VE6A 3FTSA 1JF1A 3VH8G 1GCYA 2J71A 4GQ9L 4AENB 3CIQA 4TNWF 4KROC 3OKDA 2OXGA 4G8GE 4U3CA 5AB2A 3GXIA 1RUAL 1ZV9A 4NQEB 1IBDA 4LLVB 2FRGP 3D4CA 4EUPB 4LSSL 5IESL 1Q0EA 4ELKA 2JF1A 1P5UA 2DF3A 1I8LA 4J3BA 4U1IB 3QUYA 3RL2B 1N0XL 2NY3C 2IMMA 4KK9D 4LSUL 4Q0XH 5D7JB 5DJYB 1USQA 2XWZA 2VM3A 1FCCA 3C6SA 4PCKA 4WGVB 3QUXB 1HKFA 4ZMWA 4BRVA 1HHIA 1NGZA 4J5VA 5ETUA 3GRGA 4TUKL 5HHVL 4YHKL 3W38A 2RAMA 3SJVE 4DEWA 4UF7C 5IMLB 2C4XA 4WU7A 4NO0D 4DIXA 1J5CA 4YFLI 5IB5A 2WXMA 4Z3GA 2OL3L 2XQBH 3HC2A 3HNSH 1VJSA 3H1ZA 2LABA 2G60H 4D7BA 1QBBA 4YDJB 5E6IA 4B0MB 4MDJB 1VF5C 2DWXA 3H56A 3LNHA 3O6FB 3FPXA 2HRGA 1YEDA 5HYSG 3NCYS 3HG2A 1TQUA 1Q38A 2WV3A 5IEHB 1DVUA 2F6AA 4R4ND 4EI6B 5T5FH 4KQ3H 4HF5L 3MTXA 3EYSL 3WD5H 4TSAL 2PXYB 3D0VB 3D33A 4ZOBA 3ZKXB 3LXAA 2QSQA 2PR9A 1C9SA 2OTPA 1FYTA 1T7XA 3DPBA 3IDNB 3VE0B 2FSEB 4NUQA 4BH7A 4UQCA 4MCYA 1L7IL 1JF1B 5JW3H 1Z2KA 3NCFB 1BAGA 3T3PE 5FM8A 5J7CC 2QV2A 4A39A 5JOEA 3VFMA 4NBYB 2EDHA 5A6LA 5IIEB 4WJKB 3NABH 3O4OB 4M4PA 1GKEA 3KLHD 4N8CL 2IDTA 4RQQA 5E99L 4AI7A 5F6HI 5SX5H 2BM3A 1P5UB 4QLWA 1V54B 2HFEA 4F8PA 3CXHJ 1LO5A 3L5JA 2FR4B 1D9KA 3B6SB 4P23C 4PG9B 4PEEA 2H2SC 5GGRA 3QA3A 3RVUC 4UNTA 2J57A 3C6SB 1BXUA 1BG9A 2KKQA 4HEPG 2O5ZH 1X7SA 1XCQB 2V5RA 4M5SA 2Z7YA 1NGZB 5ETUB 2DY2A 3ARQA 2HTKD 1EO8H 1A6PA 1XBDA 4GG8B 5F2FA 2NY2D 3G5VB 1VA9A 1F86A 3CC5B 3GT6A 4EN2A 5JW4R 1QG3A 2A77L 2Z3FA 5EU3B 1SLUA 4R7XA 2GT9B 4LLQB 2VO5A 3U6RB 4HJ0C 1E5ZA 4PD4J 4XO5A 3S5LG 5B38G 1EMTL 1MDTA 1PZ3A 1QUNB 3MJ8A 3NJKA 4KNSA 4ZMQA 5HHQB 2ZCLL 1MFBH 1MXGA 4DW2L 3KLDA 4PLJD 2EUXA 2MTPA 1D6EB 4ZFZA 3TFKD 2WYHA 1GS6X 1J11A 2DD8H 1KB9K 4GUQA 3MYJB 3S7GA 3GS7A 4E9SA 3TPKA 1OARL 1KENH 5HDOA 2DMCA 3L5IA 3OGCA 2FLMA 1KG0B 3ZO0A 4G43A 2AV1B 1RD6A 4HS3B 5C0CD 4YSEA 1FYTB 3DPBB 1UZ6F 1ZE3H 4FNUA 5LNDA 4MD5B 2Y5TB 1UM6H 3D07A 5EZOH 5K5YA 4Y88A 3HN8A 5KSBE 1QW9A 4QRUA 2WLHA 5EUKA 3EZ8A 4OZGF 5DXWA 4PJ5D 4TMPA 3M17A 4KRNA 2MSPA 4TRPH 4N0FB 1HNYA 1DN2A 3FUIA 3KH4A 1OE3A 3P0GB 4PB0H 1JGVH 2VXVL 4L3CA 4TLSA 1NCBH 4QO1B 4H8UA 3HMXA 4JVWA 3UO1L 2R1XB 3AREC 5KYUA 4LSVH 4AGNA 3HG1E 5J6GB 1W72H 1D9KB 3BO8A 2R23A 3N44F 5GGRB 5TK2A 3UBFA 4KKQA 5DD0L 3LPGA 2VXUH 1DQIA 4ZOEA 4NNYA 4PW9A 4AL8H 3S37L 2GG1A 4KU1A 4XAWH 3SDCB 2N0MA 1M1XA 4FKKA 1M7DA 1XZ0B 3F7LA 3KVPA 3D2TA 2Z31B 4HC1L 4Z5RA 2EIDA 1HL8A 3GBML 4P23A 4O5LH 5DHXB 2Q8AH 4JY5H 2J72A 1E27A 2VSDA 3LKSB 2NYYC 3SKNA 5I0DA 3FSWA 1FNSL 4XMZA 4X9HA 3JWDL 5M7QA 3QJXA 4FFZL 3ZE1B 2J6EL 4L9LA 3L2MA 5DU7A 5DZ9A 4KZDH 2OPCA 5JHBA 1SN2A 1HEZA 2X0UA 2KLSA 5F7KC 3BT0A 2JTYA 3MU3A 4RDBA 3ZT6A 4Y19D 3VYPA 5DZVA 3AT0A 1ET7A 3BQUC 4EDXB 1OLLA 4P9MH 3QAZB 1VFAA 4RGND 4WW2A 1FL3A 2OMUA 1QNZL 3ULAB 4FXGC 3V9EA 4OZGA 5DFWH 5EUKB 3V0WL 1R9FA 1RJYA 3BD3A 1CLYL 2CIKA 1QMUA 4Y2LA 3CQFA 3WL9A 2WCGA 4JL1A 1HZKA 1KFGA 4L3CB 1GJIA 3HHSA 4FABH 4PJ8D 4KBPA 3IMSA 4PW3A 5KYNA 5T3XH 2P5WA 3BDXA 3VGHA 4HKZA 4JJ5A 1ASOA 1GZPA 4OFKA 5K9KB 1EHKB 2X3BA 3HUJE 2B3IA 3HS0B 2VKXA 3KYAA 3BVVA 1TCRA 1E5CA 1VHPA 4K5LA 5DFVC 5E8OA 4WY7H 1IGIH 1YQVL 1B2YA 4ZMXA 5F70A 4LPUA 4PY7B 5LUMA 3IDGA 5EA0H 1TTAA 2JKSA 5A6MA 1GIGH 3CZKA 4YK4C 5I0ZA 2VL4A 1RZJL 5G55A 3C6LB 2EC8A 1M7DB 1UFUA 3DGCR 3CLWA 2R4RL 2GFBB 5J8OA 1NPNA 4NQDD 3AXLB 4UTBH 4XXCC 1KTLB 5FR3A 3TL5A 1E27B 4LLWA 2IVFC 4HBQA 3V6ZB 4OR1A 3SKNB 1M71A 3WE1A 3BP4B 3FF7A 4NPYA 2DKUA 4P5RA 2A6DA 4JS7A 3ZL4L 4PGEB 3NK3A 2CH8A 4ZO8A 2FLBT 2IV9A 4HIQA 4L9LB 4ZAKC 3VB8A 2CGRH 2WAHA 4G3YL 5AYUH 5JORA 4I0CC 2SEBA 2YJLA 4XPTH 4HJJH 4X4MA 1WUZA 2GJ6A 3LOWA 4IBZA 3FXIC 4G7SB 3STBA 3D4ZA 1JGIA 4P4KC 4N0UA 1G7QA 4XX5A 4IRJA 1E43A 1BXVA 1OCRB 3NH7L 3OSKA 4Y4FC 2ZXBA 4WW2B 1FL3B 1XH1A 1VFBA 3O45A 1TYRA 4BHUA 2O6CA 1C5CH 4OBRA 2P45B 4PPTA 1K4DA 1J5HA 3N0PB 3P3TA 5DD1L 3OX8B 4XNUH 4M1CD 4YPGA 2WK2A 4JG9A 4JKNA 4RCAA 2E0PA 2HFTA 3MRJB 1JVKA 4PR5B 2F5BH 4LNVA 1Q1JH 4L8DA 4PRAB 2P5WB 1E8YA 5DD5L 2VM4A 1GGIL 2XN2A 4BE6A 2YZ1A 2X40A 1XF1A 1L9QA 4L4TD 4FXGA 1AXTH 2NCEA 5ENWB 1AY1H 1KACB 5GGUA 4YPJA 1Q72L 2JKWA 4NJAH 5FOBB 2G5BB 2F7RA 1NMCB 1U3HD 5EU6A 1T2QH 4HX1B 4MVBD 1TZGH 1QPXA 1PL3A 2YD7A 4MNGE 4B7LA 4CILA 1PW3A 1T1ZA 1E9PA 1TEYA 1MCIA 2CMRH 4FKHA 4RH4A 2AMUA 2QDWA 2EZ0C 2UZXA 5ID0B 4IIQC 4YSPA 2C7UA 1ZLUK 2FBOJ 3LNIA 1CC3A 3WFZA 5EC1B 2JNZA 1CICA 3KVDD 5I26A 1FGNH 2V2TA 4YGVA 3RILA 3EFFA 1IKFH 1IILE 4PJEE 4AKOA 4ELME 2VJXA 5MEND 2Z0UA 2SEBB 1LWJA 3GMLA 1HHGA 2GJ6B 2P47B 5C97A 3FOLA 3WLBA 4GUOA 3P9WB 4QRRD 1KGWA 4N0UB 3N0AA 3HI6H 4NQED 4XXCA 4LEXH 4KNQA 1YY8A 3KNBB 4IRJB 4N5ED 4YXKH 2WSDA 4PSPA 4ZFOB 4NQCB 1ZT7A 1MG3C 2Y7LA 4NN7C 1S7RA 5IGXL 5C07E 5BXFA 4PWKA 4U6XB 1A6TA 1FVDA 2VJ0A 2YC1A 2I9TA 4ZAKA 3KLLA 5DQDL 3ZHFA 3VI4A 1TTUA 2KMWA 5C08E 1LK2B 3BWAA 5EOTB 2CHWA 4XP5H 5SX4H 1A21A 4XBGA 2XQBL 1P6AB 3HMXH 4P4KA 5IOKA 1LE5A 5H94A 3W2DH 2DS4A 1R5WB 2ZX7A 4Y4FA 4UNVA 3U4BH 1TT6A 4OZHE 3HPJB 3T8VA 3X12A 4JRLA 4QY8B 5HJBA 4P2RA 1MW0A 5H37G 3NCMA 3N50A 3NIFF 2YLKA 4AUJA 5L2KE 2OMYA 2BJMH 3BD5A 4PWGA 4D0CB 5D1XD 3ULVE 1JNHB 4AEEA 2ZOKA 5EU6B 5SWSB 3WD5L 3CXHK 1XTMA 3EGSA 1E9PB 4KKZA 1DL7H 2EUWA 5CM1A 2RMNA 2VYRE 2W80C 1EAPA 1J48A 5DHDA 1X7TA 1QRNE 4G8IA 2X4PB 2A7BA 5I5JA 5C0BD 4L1SA 4ODUB 3VB9A 5C09A 2FJGB 4ODXA 4AMWA 1CICB 1LJMA 1XZWA 3MX0A 1EXUA 4UT7H 3PF2A 5LLIC 2ZONA 4NJ9L 2V2TB 3CSYA 4KI5C 1QNIA 2AQ2A 4XO3A 1AD0A 1XGTA 4ODVH 1BZEA 3QFJE 3NABL 5D8JH 2A99A 1FP5A 2GTZA 4GO6B 4PJIF 1GH7A 3IN0A 3M88A 3GMLB 1HHGB 4PD4K 1GZHC 1SUHA 5EBWA 1OAKL 4IIQA 5EOCL 4GFTB 5FUZH 4F7PB 3A6OA 3BEVB 2LE9A 4WTXA 3SGDH 3AROA 4Z3TA 5DUBA 1SJHA 4JHBA 3LZPA 3LZRA 3GDBA 1S7RB 5FGSA 3SGKC 5BXFB 3LKOB 4LU5L 5HDQH 5FO9B 2O5ZL 4GRLC 2B39A 3BUIA 3KWVA 4KI5F 2BHYA 1TVBB 2IOIA 1EO8L 2XTJC 3VI4B 1BQHA 4AJVA 1IGJA 3EH5B 3FOMB 4UTAA 2J56A 4YHOL 4UWQB 1DDHA 4H8WH 4QYOA 4NHUA 4XB8A 4HGWA 2R0KH 3HMWL 4R0LC 1FL6B 3FO1A 3SJVB 2D31A 2XWBA 4LCYB 1KLUA 4J8QA 4PRBB 1S5HB 3GLEA 1Z9OA 3X12B 3TO4B 1U2YA 1MFBL 4JFDE 5DC4B 3W56A 1F58H 4DO5A 3OLDA 4FA7B 3BAJA 1XT5A 1YY9C 4WKZA 1HTYA 4HBCH 4UOJA 2VZTA 2ZOKB 4XBEL 3CBKB 1HWHB 3MBXL 4XTRC 5B1CA 1T5KA 3U1PA 3DX6A 4YXLH 3VWJD 4ZW5A 1EAPB 1RJLA 1Z6JT 1UM6L 4X6CF 4EN3B 3KGRA 1F90L 1HIML 2ARJA 4Z7UF 3K71B 1M7IA 1P1ZA 3GSOA 1EXUB 4NZFA 5DTFB 4FCAA 1W2KT 3ZMEA 5C7XH 3CSYB 4J7RA 4G72B 4TRPL 2BIPA 3I3BA 1SJXA 4B9IA 1HHHA 1JGVL 4PB0L 4J23A 4PJIA 1IBHA 4XNZB 4ZO9A 3SEPA 1NCBL 1U8IA 3GXNA 2EYSB 2GTZB 3FUDA 4I77H 3GBLA 4R7LA 3L3GB 3NGBB 4YHIB 5IJVB 5KJRH 3QFDA 3LRLA 4G11A 4LQFH 5EBWB 4MJHA 1WG3A 4LSVL 1B4LA 3ES6A 3KYNB 3DXAA 2PWFA 4PU2A 4R6UA 5ABDE 4OI8A 4LRIC 1U0QA 2GJJA 3TESA 4PUBL 3EF7A 1N5YH 1IBBA 2VNCA 3I6SA 4QTFA 1Q9OB 4XAWL 5D93B 3RLSA 3WNOA 2AQNA 5DK3A 3AG2B 3NQIA 1GZHA 1DDHB 2AJZA 4QYOB 4NHUB 2V9TA 2VDMB 3T2OA 4XX1G 1Q94A 2Z64C 3NACL 4DKTA 4O5LL 4GB9A 3R06B 3EFDH 4XN7A 3W9EB 4JY5L 4JFHE 3UDWC 3ZPDA 1E9OA 5GQBA 1KTRL 3HVNA 1LWRA 4GRLA 1UWYA 3S2AA 5TF1H 4GAYA 2NX5A 3OC5A 2KS0A 4KZDL 3B43A 3NJMA 1GS8A 1O7VA 4WKZB 3QORC 1NPUA 3DJSA 5D7LE 3VNYA 3DYMA 2H1LM 4R0LA 3DX6B 2NT0A 4AQ1C 1CVRA 2IXQA 2EACA 4W9DC 4WTQA 4P9ML 1TTGA 4HV8B 4X6CA 5F3BA 2G3ZA 4Z7UA 4LOUC 1M7IB 1MCHA 3A0OA 3GSOB 4BK4A 4WEMB 1MZZA 2BNUA 2BVQB 2X3CA 3ABMB 1EHNA 3NRPA 4Y7MA 3IYLW 1CYWA 1U8CA 1XF5A 4PP1C 3UL4A 4FABL 1BLNB 5KSBB 1U8IB 1ZTXE 2NY7H 1VAHA 2K1MA 3HJ0A 3QFDB 2D2OA 3H4HA 2J8UF 3L2NA 2KDGA 4HIPA 4YDLB 1INQA 1FN4B 3DXAB 4KHXH 1J10A 2BVUA 4OCMC 1FZMA 1IGIL 1NIFA 4I3RL 2H0JA 5LGHL 5HYJE 5J12B 1AO7D 3KGTA 5EA0L 5BOPA 4P57A 1JV5A 1BM3L 2R7EB 3QNZB 4LO9A 3L9EA 3D4YA 2P52A 5D7KD 4JFXB 2WHVA 2CWRA 1PG7L 4X6DF 3MV9E 1PF3A 3QXTA 4FHBD 4UTBL 1BVKB 4OLEA 5F7MC 5B7EA 1E9OB 4YHNA 3WXWL 4LRIA 3C6LD 3QUKB 4F91B 1S3KL 1KN2L 3FCTA 1QEWA 3CU1A 3LXCA 3F7VB 2IALB 3H3KA 3GLDA 3MUZ1 4PLKC 3P0YH 1J8RA 1KJVA 4UQEA 5AYUL 3QEHA 1JCKA 1RZFH 1A8ZA 1AHWB 2WTOA 1KDJA 2KT6A 3R4RA 4XPTL 4ZUTA 3TO2B 4AYID 4NZRH 1DHKA 1RZIA 1IVTA 4IKKA 4TQHA 3BZ4B 3UDWA 3TGXA 1QVOB 4LBAA 2XOTA 3WTUA 3BH9A 5TFSH 4JRYD 4BXVA 1YMHA 2F53E 2NY6C 1LK3H 3I50L 2DIJA 5IMKB 4DAGH 3U0WL 1TKWA 3WFHB 1Q9LA 2F74A 4W68A 5EOQL 4RBPK 2PTVA 3H53A 3OXSA 2ODIA 1E50A 4G9FD 4GAGH 3RPKA 3MRNA 3O41A 2G4GA 2GYSA 2YPKB 4PWJA 1Q1JL 5IVOA 3W39A 3ZHLA 4AQ1A 5FM5M 3GSUA 5I75B 5JQ6H 5LNGA 1J9SA 2J8UA 5DVLA 3GBEA 4MS8C 5DT1H 1E3ZA 2H1PH 2XZAH 4MRBA 4DKFH 5SX4I 3H6JA 4KJYA 1U58B 4DP8X 5F0PB 3UAJC 1H3XA 1JPGB 4KJPD 5J9PA 1AY1L 1TFHA 4H8PA 3CU7A 5I1JH 2WVSA 4NJAL 1T4WA 5D2NB 3AT9A 1MVFA 1ZHLB 3PDOB 4UTAH 1JV5B 1T2QL 3D48R 1XIWC 4JLRB 5MERA 3WY2A 1KGCD 2VDMH 1OGAE 1AG0A 2CMRL 5FIEA 4IIZA 2FT6A 4OGXH 3PJSB 2CJUH 4PV8A 1NPJA 3EJPA 1OT2A 2OCFD 4E9XA 4I9XA 1ZK9A 3BFQG 1BEYH 4KY1L 1QX1A 4PGDB 4LDCA 4C55A 1FGNL 4LDLB 1NCAH 3R1GH 5BZZA 3S34H 4PRID 3JV6B 1KJVB 3FONB 1TJXA 2JKTM 3RE0A 3JSSA 2MQ3A 3PWLA 2VXQA 4TN9A 4AGLA 1A1NA 1BQLH 5CHNA 1IC7H 4L18A 3TBSB 3FO0H 3STZB 4LEXL 3ARZA 1CDYA 4I48B 4I85A 5T1KA 5LG6A 4YXKL 2ADIB 3N1GC 4WWKC 4JDVB 4XN4A 4MQXC 1U8NB 2CDFA 1OT4A 5F7AA 2HJFA 3ZE0E 5CWSB 1N6UA 3QO1B 3LZLA 1FFPA 5GGVH 3AG1B 3NFPB 3VUAA 1W0VA 2QTEA 3KDPB 2HYMA 2OI9B 1F6FB 2IQAA 2VDRB 3PXHA 2EIBA 4NQCD 3VFGH 3AM8C 4BFIA 5K1JA 2F54D 1SJEB 3HMXL 5D1ZC 1S9YB 1DJSA 4HUXA 4P48A 4WNJA 3EDFA 3E2HB 3W2DL 2WKOF 4PJ6A 2EVFA 1ZHNA 4KJYB 1DQJB 2C9UA 4ZS6C 5J9PB 2JE8A 3BFWA 2Q6WA 5L2JB 4NBXB 5CFAA 3QHZL 4EVNA 1G7MB 2BJML 2VO8A 3AS2A 3ETBJ 5FCSH 3GMOA 4CC4A 1K72A 3PAUA 2ZX6A 2OQJA 1KC5H 1ITBB 2YAHA 3CMOH 4GT0A 4QRSA 4D0DB 4XVOA 1UHVA 2ZKMX 1XSOA 3VGDA 2ENQA 2B1AH 4PV8B 1U8OB 4RMRA 3UAJA 1FIGL 2HRPL 5AZ2L 3KJ4B 2A6IB 4MNGB 3T71A 2VRKA 3EKCA 1JMZA 3Q05A 3E8UH 4E0RA 1JSYA 1TLKA 2XT1B 1H5BB 4UT7L 5E9DA 1RK0A 3BI9X 3MRDA 4AYFA 5D8JL 2WBXA 1XIWA 5HI5C 1NMBH 3IDIA 5IQMA 2PO6C 5JQIB 1KZQA 1WZKA 1IC4L 2WXPA 4JCWA 2AZAA 3NEEA 4PGZA 5CHNB 1HZHH 4I5BB 4PJDE 5I6PA 4PJEB 2H6OA 4ELMB 4BGLA 3BLBA 1SUJA 4YEFA 2WLKA 5I1GL 5FHBH 2Q20A 4UM9A 3QIUD 1NCJA 4E9WA 2CDFB 3FHEA 3OPUA 1NBYB 4KJWC 5ANHA 5HDQL 4G8GD 1UT2A 1A3ZA 1QTPA 2CK2A 4BIKA 1JPSH 4LB8A 2OV0A 2DTMH 4R83A 2Y25A 1AP2A 3NN8A 1M05A 2IQAB 3AG3B 2UXVA 4BFIB 4MD4A 4BHUI 3IF1A 4H8WL 5C07B 2CUIA 5CO1A 7CGTA 2AITA 5EO9A 4OV6F 2R0KL 3DLQR 3S35X 5IVZA 2WKOA 3OBAA 4QD2E 3OJDB 4ICXA 3HC0B 1XQ4A 1YPZF 2C3HA 1FAIL 3MBEC 1DEEA 3A22A 4NZUH 2JKLA 2F7PA 1AZBA 4WI4A 1CLOH 2XN9E 3CC1A 4PJ9C 2CALA 2VOTA 1MN4A 2Q6WB 3QXUA 4EVNB 2H2PD 3RGVA 1MHHA 1F2XK 2DMHA 3AM8A 4AQEB 1IX2A 3FUMA 5FO8B 2MKLC 1RZKC 5D1ZA 2IGTA 5F1NB 2O5YH 4A7SA 5LGJA 4QRSB 4TLUA 3V0FA 2EO1A 2WMPB 4PLOB 3NBNA 3SDAC 3KXFA 1R33A 2XG5A 3BT2H 3VSQA 3PWJA 3ZZ1A 1BZ7A 3OKYA 1S5IH 2NZ1A 4E0RB 3SY6A 2X6MA 4TUJA 4OD3H 1MJ7H 2EDQA 1HCYA 2VJ8A 5GS1A 3FMGH 4WCYL 3WEMA 2GEQA 3KPMB 1WD8A 1EDQA 1QRNB 1ORQB 4RGMB 4WNSA 3N43F 4XBPB 5LKNA 4CNIA 3RL1A 3SSGA 5KJRL 2CO6B 5GIRB 1UKSA 4D2NA 2LV4A 4L8BA 4A7VA 3ETTA 4WI3A 4QRAA 1ZHBA 2GBUA 4OZ4A 2VR4A 3ETBF 5T3XE 5C6WH 3UP6A 4ZFOL 4IU3B 2WANA 2WXQA 3R7QA 1AC0A 1ZVHA 3LNGA 3ZDXE 4UM9B 3KVQA 5KSVA 1YMMA 2B5IB 1F4YH 2IPTH 4L0ZA 5EDSA 2PUQT 3MA9L 4JFSA 1N5YL 3WNJA 5D7IF 5DGRA 4AEFA 1WDAA 5D9SB 2V9QA 1AGBB 2PO6A 4JFYA 4AW7A 2Y69B 1CT8B 2VSMB 1SN0A 3ALXA 4OF8A 3I75B 3HB3D 5DJZA 4KI1A 3G6JF 3T77A 5IVZB 3LZNA 5IVXA 1YPZA 4P46C 2JI1A 1INDH 3L13A 1S9WB 1JK9A 5EORH 5TF1L 1PLGH 5JXED 4BUQA 1MNUH 1F1GA 1YN6A 4FHKA 2FQEA 1TU2A 3IAGC 1WFTA 1EANA 2PPAA 2P8LA 3RGVB 2VCOA 1MHHB 3IFPB 1S2EA 2BOBA 4I18B 5AVSB 3UG3A 3QQ9C 5E2VH 4HUUA 4JFDB 1CTMA 4NPJA 4BZ1A 1MHPH 1P53A 3QIWA 3RAJH 1BZDA 2QELA 5LGJB 1K9TA 4WWOA 2A9CA 4LF3B 4DUVA 1A65A 4D9RD 4G1MB 3TX4A 2R29A 3MBEA 3PWJB 1AI1H 2DN7A 4PRNB 4U6YB 3ULSB 1CD1B 4PJ9A 4RAVA 4XMXA 4J3OD 3Q44A 3DYPA 4X9IA 5TQ2H 2X05A 2BOCB 2PP9A 1XEUA 5GS1B 4NQSB 1RUPL 3LPWA 4BWTA 1MPAH 3IFLH 4PI2A 4CNIB 2Y9RT 2NY7L 2VXQH 2YUVA 4WFGE 3SDAA 3BP6A 5TPWH 5DSCA 4G6KL 5CJQH 5EO1A 2BLFA 2X09A 3TJPA 5H2BA 3ZZSA 3PG2A 3MLXL 2AQSA 3DGGB 2QPUA 2HTLD 3B8YA 3O6KL 2AABH 3HE6B 4GMTH 4MWFB 4Y5XC 4ZW6A 4DN3L 4PJBF 3TWYA 1MCPL 1YMMB 1MRDH 3EH2A 4HJ1A 1FG9C 5D6DC 3TP4A 3KM2A 5D7IA 1U95B 3IDUA 2W60A 1CBVL 1KTDA 4KHTH 5I5MA 1E3FA 4F27A 1D5MB 4JFYB 3ZL1A 3GIZL 3T6XA 1A6UL 4LEEA 3H9ZA 4MKMA 3W57A 3VDAA 2KBGA 3QZNA 3TN0B 1SDAB 5DS1A 4R7NA 4BCYA 3G6JA 1LO4H 3HG1D 1YEGH 1R3JA 4OGYH 4IHOA 2QVMA 5F0LB 1O9ZA 5IVXB 4HDIA 5FYLE 2K8MA 5EU7C 3RTLA 4XMKL 2WY3B 1JK9B 3NJLA 3AQDA 4EE2A 1YN6B 3DX8B 4RA3A 1CDGA 2ZJSL 3CXDH 4KFMA 5KJ7E 2CGZA 1LP9F 1TQWA 4N6RB 1RZFL 2Y7MA 3EJYC 1KWKA 3OZKA 5DEZA 3UTTA 4NWUL 4UB0L 3EXJA 2BVTA 3GI9H 3RX7A 5K59F 5KOMC 3QIWB 2KUTA 1FC2D 4M8QA 2X2HA 3FTVA 4P46A 5HBBA 3C75A 3MRMA 3QZBA 4G42A 2J12B 3T2QA 4LLAA 4DUWA 2ZZUT 5TFSL 1O9WA 2J5LC 5D7LB 1LK3L 4RAVB 2XFGB 5A40E 4OFIA 1ZS2A 4X5XB 4DAGL 3TVMB 1QR1B 1UM4H 4PW4A 3GK8H 4ZODA 1VPOL 1AZRA 4DPAX 5LO7A 3P4OB 1X9RA 1HQRA 3EDDA 3MNZA 2R69A 2XZQL 5AL0A 2IAMB 1SBSH 4PS4H 3FSAA 4L8CA 5EO1B 4PS7A 1I3GH 1IEAB 3QC5X 2CKNA 3T3MF 5H2BB 3WTVA 5DT1L 3H9HB 4JPWH 2H1PL 2XZAL 4HUWA 4PJBA 5KVMC 2RQ8A 5HGAB 4ZTOL 4Z7QE 2QFRA 1SJVA 4BUHA 5I1JL 1WLHA 2FEDD 2ZWZA 3RTQA 2W94A 2EH8H 3TBBA 1JZEA 5DHYB 3NSJA 4RDQF 3X14A 4MYPA 4UTAL 3TF4A 2WIIB 4RNRA 2VR3A 3V4LA 2CG9X 5IOPB 2VDML 2WO4A 2FCBA 3F00A 3M1CA 4OGXL 2YGVA 4R9HA 2CJUL 1ZLEA 5CEXB 4IHOB 3ARBB 4OB5H 3RBSA 3M7FB 2NRDA 4P2OD 2AMGA 3LHPH 2B16A 4HDIB 5TDNB 4IGBD 1P7KA 1U8KA 5KVDE 1NCAL 3R1GL 1SFDA 5C70A 1LP9A 4JK0D 2AF2A 1PBYA 1SEQL 4TSCL 1UB5B 5IHWA 4G6FB 5FGCE 2UY7A 3S3DB 3UTTB 5CLTA 1BQLL 1IC7L 3RVTC 2KC0A 1D5BA 3H0TA 2ARJQ 4N25A 4G42B 1F42A 5AVUB 1UZ6E 5ALBL 3UG4A 1JI2A 5E00B 3TJHD 1GOFA 3BVXA 3MUGB 3V7MA 1XVSA 3B9KC 3GSNB 1JS4A 4FNSA 4JN1H 4JX0A 2F53B 4H8QA 4RAHA 3PPSA 4L3EA 3O9WA 1KIUB 4WHDA 4L8CB 3BWSA 3TEXA 3QAQA 3QNXB 3QG6B 4CU6A 5BMFH 4HJGA 3ZO9A 5T33L 4HUWB 1F3DJ 3EG9A 5F7YC 1PJ9A 4ODHH 4XAKE 3EJJX 5DR5L 5DMGD 1E67A 1PS3A 1ZLDA 3MQIA 3BC9A 5ICXA 4S11A 5LBVA 3RTQB 5KVEE 3GF8A 3GMMA 1YDPA 1CFSA 3WFDH 3ZE2F 5DHVA 4XP9H 4MZ3A 3X14B 1W6LA 3CMOL 2CUAA 4M61B 5F7DB 1OSZB 1CGXA 5F9JA 4HJTA 4G5AA 1NGWB 2I9LB 4J4PD 4S1QH 3EYOA 3NCXA 5AB9A 1BZ9A 2B1AL 3QUZB 4NM8H 2XICA 2WXHA 1KLGB 2GIXA 1AYRA 5HGHA 1MWAA 2KLRA 4I89A 3VFOB 4CVXB 1JOIA 1U8KB 3V0VA 1NGQH 2VDQB 1NCOA 4Y9FA 4FG6C 2QR0B 1NMBL 1J87A 3CDFA 4BZ1H 1ADQA 4V1DA 1HZHL 4PP2B 5CBEA 2VLKE 5AVZB 2ERJB 5ISZA 3WN5C 2R29H 4TOYH 1F4HA 1F18A 3HC4L 2Z91B 2JJWA 4TULL 3PNRB 1IFRA 2R1WA 4Y4KB 3WV0A 4U31A 4WTWA 4YSQA 5J1SC 2HKHH 1D5IL 2QMJA 4GSQA 4KRPC 1JPSL 4G8EB 3JWOL 3SHSA 2XBDA 4ZNCD 2HT2C 1RZKH 2XXFA 2AXHA 1KWGA 3AU1A 1LILA 3ZE0B 5CGBA 4BCZA 5FWQA 2B15A 1DANT 3VNZA 3O9WB 3GO1L 2FUTA 3TTYA 1WEJH 1HH6A 3T3MB 1XAKA 5I23A 5JO5A 1X4YA 4NZUL 5C9JB 2CR0A 2VMEA 2AS5M 1CLOL 2GW5A 2IPKA 3WAJA 2CUHA 4UM8A 1CXHA 4UT6L 3S0PA 1SMDA 4FLHA 5C08D 3JWNH 3DO3A 1FJ1A 5E1AA 3T65B 1R1CA 1DBMH 1MI5E 2B8OT 2WUBH 3WUWA 4W9EC 5CU5A 4RZKA 2HJLB 3D2UB 3JVGC 3VD3A 2EUZA 4B50A 1JMXA 4EUPG 1Y0LA 3C5ZB 3VA2C 4WDIA 1NSNL 2EJ1A 5HGHB 4OD3L 1MJ7L 4X9YA 5FS5A 1XB8A 5L2KD 4J1UA 2J73A 4WLCA 1HU8A 1OQXA 1IQDB 1SFHA 4OFQA 4BELD 4ZMNA 2ARWA 5T1DH 2UX7A 4RIRA 4X5RA 2FB4H 5IT2H 1DLFL 5TDOB 1U33A 4HS8L 3WGUB 4I7ZC 4O4YH 3RIAF 4V1DB 4YXHH 4KNTA 3INUL 4HOXA 3BH8A 4MB4A 3ARDB 1HYSD 5CBEB 1PAZA 4NERA 3T6VA 3X1BA 2XFXA 4U1SB 3DJZA 3H8NA 4JKKA 2ZXGA 4K3EH 4LGSB 4KKAD 4OCSH 5DK0A 2AHIA 3UTPD 1F4YL 5LN4A 1CYXA 5A6IA 3P77A 3QDJD 3ARSA 5AALA 3G7TA 2CBQA 3V8CA 1QLRA 3QFJD 1E40A 4POZD 1BJ1J 2JB6A 3ULUH 1RH8A 2R69H 3HJEA 3QARA 4UQ2B 3WXVH 4UYQA 3WN5A 4PTTA 1HH6B 2FWLB 2NY4B 3GSQA 4Z7WE 2C9PA 2OJ1A 1N0LB 3KL5A 3NSDA 1INDL 3C5SA 3DX2A 1GS7A 3G6AB 4GQQA 1Z5LA 3QDGD 5EORL 2X4UB 4Y4HA 1MNUL 4TPRH 2IPKB 3UTSD 1IM9D 4UM8B 4P2RE 4Z3EA 2UZPA 1ZPLA 4KK6C 3D9AH 3KZ8A 4JN2A 2OX5A 2WXGA 2XN9B 4HXAH 3T2NH 5C2UB 3PP3K 3P4MB 5KYWB 1OWRM 4YHMH 4OLZH 2MFNA 2Z6FA 1YUKB 1AI1L 3OZLA 1BV8A 1K6QH 1Y0LB 2DQJH 3FT2A 3C60C 1I1AD 3BZFB 4JFDD 4WDIB 2D3LA 2QGEA 5TQ2L 3FUKA 4ZO6A 5JXAH 1A22B 5C09E 4GKSA 2Q76B 1E90A 2VDQH 4J1UB 3ZYZA 3ZU8A 4Q8BA 3GRBA 1JG9A 2UZYB 3DHUA 2UXGA 3M7OA 1MPAL 1F00I 4RIRB 2X4OB 2VXQL 4GOSA 3JVGA 3UC0H 1NGPH 3KPOA 5TPWL 4N2OA 2WYIA 4HHAB 4XC1L 1P7HL 5CIPA 3LDBC 4GMTL 3NA9H 3KR3H 1B6UA 5JW4M 3LRHA 5B1BB 2FGZA 4Y1AE 3RVWD 2NNFA 4WJ5A 5GJTL 4KHTL 1NLDH 1T6BX 3DV4A 2A83B 4YDIH 1J8SA 3ZDXB 1PDKB 3DI3B 1WJ3A 1JRHL 3VA6A 4JY6A 4XP6H 1YEGL 3IETB 5HJDA 3CSBA 2EO9A 2RD0A 3BN9C 3CUPB 3KLAB 5E0QA 3K81A 3C5SB 4IBQA 5IJKA 4TXVB 4Z8FH 1KCVH 4Y4HB 1KYOJ 1VKXA 5D4QA 3ZKND 1VADB 4GI6A 3FTYA 4JANB 4MJJA 5JYLA 5DHVH 4AZ8B 1B0GA 1F45A 4YL4A 5EU4A 4FQIL 3HE7B 1LE9A 1AGEA 1KJ2A 3RWCA 4NZJA 4CN4A 1GGTA 2FIRT 3RNKA 3S48A 3GI9L 1MFAH 3LCYA 3QXAA 2AK4E 4H2AA 4ZJ9A 4DQOL 1MFUA 2EXYC 3ULVL 4JFHD 4JJHA 4QTHA 1M3IA 4M7LH 1JZJA 1MF2L 4M93B 5D1ZI 1R5IA 3S5ZA 4APQB 1MWAH 1N26A 2W65A 4HHGA 2E9BA 4P5SA 4JG1H 1UM4L 1QLFA 1OEZW 1U8HB 2VDLH 5JQHC 2ZF8A 4WAFA 1ADQH 3LH2H 2ENPA 1SBSL 1SM3H 4PS4L 3KPOB 2FGWH 1DO6A 1O6TA 1KBVA 1I3GL 4CW1A 2VZ3A 2EDDA 2YPVA 3M8OL 4S2SA 4JPWL 5CIPB 3C60A 1U92A 2WXOA 3VD0A 1AD9A 1BFOA 4LSTH 5TJWK 5GSRA 1IM3A 2XV6B 5J6HB 3BKCH 4L4VA 3SYPA 3MUHL 4HWZA 4YDMA 1OGTB 4O02A 4P2QD 5I71C 1FV1A 4JAMA 3DX7B 3ROLA 1R19A 3DV4B 4KI5E 1MCOH 4HKBB 1E2VA 1GSMA 3L1FA 3TPUB 3WS3A 5HP5A 5KG9A 2F2HA 3NPSB 4LT7A 3MFFA 12E8L 3KW8A 1HILB 1NM9A 3MKKA 3W1ZA 5AYQA 2XI9A 3LHPL 1G9NC 1HCVA 1VGEL 3GS0A 2BC4B 5E4EB 4ALAH 3KPLA 1WPCA 4LFHD 1KSRA 5HYJD 1VKXB 5HYQA 3R0MA 2AI0L 2PW1A 5G4NA 3ARBD 4LIQH 5FFLA 2QHRH 4KTYA 2AW2A 4DQAA 2XTJE 4I3SH 1QPPA 4FEIA 2V6HA 4MA7H 3KWUA 5J11C 5JW5A 1AGEB 4KKCD 4V33A 5IHUH 3NRQA 5HHMB 2VWEC 3MV9D 1A2YA 3QXAB 1PEWA 3D0LA 1JDAA 1Q9KA 3EYQD 5F1IA 2EYRA 4QTHB 3VFRB 3MLZH 2R0WL 2MOVA 4HZLA 4PAZA 5DO2D 3QQ3A 1QSEB 1EJOH 2EC9U 2W65B 3O4LD 1ED3B 4TNWK 4X4YA 4Z7UE 3VCLB 2XA8H 2FEEL 3OAUL 2KZKA 5CBAA 4U6HB 1CMOA 1AC6A 3U0PB 4D9QD 1IL1A 5EPMA 2HKAA 2YA1A 1BG1A 4LVOC 1SHSA 1G7JB 3WBDA 4CW1B 1WTGT 3DUSA 4P5KB 3RVXC 1DBAH 1OANA 2Y07H 1NFDF 4HWZB 3RFZC 4ODHL 1QBLH 3I9GH 4O02B 1KBWA 3QIBD 5JLZB 4JAMB 2EABA 3WFDL 3WS3B 3EOBA 1XF3A 2H32A 3FKUS 2QSCL 4KVNL 4UU9A 4IOFD 3UZEC 3MXWH 1U2CA 4Y2NA 1YEHL 4R2GB 4S1QL 3PWPB 4JFED 4YIQB 4U4IA 3TZVD 1HSBA 2XWTB 1QHPA 4P5MA 5F1KC 4NSKB 2OMNA 3WEXA 1NC4B 3DVFA 4GIAA 5HYQB 2HZHA 1PYWB 2C9RA 4PHZA 1O75A 4XOCA 4XT1C 4QHMA 3T8MA 4GNKB 5BUGA 3QWRA 3BP7B 1OGAD 2Y4SA 5CGYC 5JW5B 1WF5A 2PWEA 3LEXA 4O2CA 4J6RL 3MC0A 5E95B 1NQBA 2IBBA 1BOYA 4YUEH 2WLLA 4HIJA 2R29L 4DGVL 5F1IB 1UOVA 3WG7B 4F1ZA 4JO3H 5FGCB 1PD0A 1G1OA 4YSDA 4DPRA 1I8IB 3QG7H 1JGDA 3Q06A 2ITDB 4QF1A 2HKHL 5AKRA 4XPHL 5ACMA 1ZAGA 4FQXC 4NCC2 3LB6D 5BVJA 4XPFH 1XR8B 2C3VB 4U1MB 1W8NA 1AMXA 4XVSH 3T5WA 4ZMYA 1B0RB 4GAFB 3IJSB 1WEJL 3MGTA 4F7MA 2CHNA 2W9EL 3H9SE 3IMWA 5CIPH 5E5UB 1NFDA 3R18A 1A4CA 1SYVB 2WJ5A 4EPSA 1TTFA 1R47A 1A4JB 4LPVA 5AENA 3H85A 1AZVA 2G2RA 1WGVA 3EBAA 3NJHA 5I76A 3IBOA 1DFBH 5C0JB 4O51B 3VXQB 1XGQB 5LAXB 3NCCB 4ANWA 3QNFA 3S4SA 2DWDA 2FHBA 2ZXQA 3EOBB 4WSKA 1DBML 1FNFA 1W16A 1XF3B 5MEQA 5E8NB 2WUBL 5JMOC 4UU9B 1MCQA 2CK0L 4HPHA 1ROWA 1DSFL 4IQHA 1I4FB 1OTSD 1Z9PA 5FYKU 2VC2B 2WXIA 4X6DE 2OZ4A 3RJOA 4P5MB 3F58H 1ASQA 3JTBA 4NUGH 5FYKH 3ARVA 3ZK0A 1LNUB 1U3JA 1UWGH 3WKMH 5BCAA 5T1DL 3UGXA 2FB4L 2CM6A 2WSPA 3SDDA 3UZEA 1KJ2H 4F92B 3ECBB 3HBZA 5CP7B 4OLWH 5CEZE 4OGZA 2CJ3A 4O2CB 2ROXA 4YXHL 3IDMA 2ZYHA 3CPUA 1S7XB 2WLLB 3F01A 2IANE 3MR9B 1MCBA 3CFDA 4K3EL 1KEMH 1AACA 4PJAE 1IEBA 4PH8A 1H8OA 3MOBH 2VLKB 4IEFB 1GMEA 3GSNL 3QRGH 2DYPA 4MZRA 1SY6A 3V0JA 3ULUL 2X9WA 2XXMB 3BUQA 2VR9A 2R69L 4NO2A 4FTVA 2CXGA 2E7LC 1A6VH 3WXVL 5FK9A 2HA1A 3MGTB 1KGIA 2YPVH 1CE6A 2JJVA 1R5VA 3VXPA 1YEWA 2DRUA 2C1OB 4UDUA 3CK0H 9CGTA 4X4ZA 5KEZA 1AHMA 2Q2LA 1A3RL 1AGFB 1CCZA 1K5NB 4O02H 5LHDA 4RWHA 4TPRL 1QA9B 4GINA 5I76B 4FQXA 3E9UA 2YAEA 3TA3B 3QHTC 5D96C 3WFBH 1A3LH 5F93C 3D9AL 2IH8A 3S4SB 2VN3A 2EQDA 5KW9H 3L4XA 4HEME 2NUTA 3RUGE 2JJTC 2YXFA 3AAZA 4G9DB 4YHML 4F2EA 3RX8A 2DWTA 3FT0A 5A16A 4FD0A 4WI6A 1CTNA 2DQJL 1CPUA 1OCWL 3IU4H 1UXLA 2X5PA 3C08L 5BRZE 5JXAL 2VDQL 5E08H 3AY4C 5F6IC 5E9DE 1I9JL 4KKRA 5DJ2B 4B6ZA 3BMWA 4GI9A 3SDDB 1KPRB 4FZ8H 1WA1X 3R19A 3UC0L 1NGPL 1UA3A 1NC2B 1YVLA 1OM3H 2E4FA 1ZHKB 2X2YA 4YBLB 1EJ8A 5AL8A 2E5EA 4Y9GA 1C08A 3TFBA 4PJHA 4NT6B 1F1AA 4QHNA 2BIOA 3GMRA 3KR3L 1CYGA 3NA9L 4JDTL 4ONFH 5GSVA 2FZ3A 4Z6AT 3MRIA 3L16A 2FATH 1A7BA 2B59A 5C7ZA 2FIKA 5A1AA 1BMWA 4BRJA 1IGCH 1NLDL 4YDIL 3BESR 4MAYC 4NZTL 1O7DC 5E8DL 4BFKA 3BPCA 5AUMB 2IGFH 1BOGA 4FTVB 1ZCRA 3G5YA 1G5GA 2X4NB 4YHYB 5T3XD 2Y1YA 3QUYD 4XPBL 1R5VB 5TDPA 3T0EC 5IZ7A 1L9RA 4UDUB 5DUJA 2EDJA 2BW4A 4JR9H 3CZNA 3U30B 1KYFA 1URLA 5HVFB 4Z8FL 3GI8L 1KCVL 3ARFB 3OMIB 4F2ME 2COQA 3KL0A 4FJZA 1L0YA 5GZNC 4GP5B 1UZ8B 2Y24A 3ARGC 5IEKA 2WZ5A 5DF0A 2H32H 4MAUH 5C0AB 3PAVA 5T1LA 3AAZB 3HI5H 3OHXC 2LU3A 2QVTA 2RACA 5E1IA 2FVNA 4ANVA 5A16B 2VMDA 2CGYA 4M7LL 5IB1B 1LL1A 3KXFE 4PVMA 4LP5A 5E6ID 3S3PA 1GJUA 1MWAL 2B7DT 3NIGE 1QAWA 3KPNB 1E6JL 4JG1L 4UANA 5IHZA 3A4FA 4P99A 3GZQA 1KDIA 5IB2A 1HHKA 3JV4A 2WBJC 4RMVA 4APQD 1WA0X 3C2AH 2V2WB 2JJTA 4CC1A 1BF2A 1ADQL 3EYVB 3NJXA 4ONOA 3UBXB 3LH2L 5HHXH 1SM3L 5D72H 1URIA 2J25A 4MJ4A 6PCYA 4PJHB 3TONA 3EDEA 1JHLH 3US0A 1G9NH 4U4BA 2YRZA 3QW9A 2W0PA 5GSVB 4ZBJA 3BKCL 3MRIB 3GQFA 4NNPH 2BSRA 4OZFA 5FKPB 3IMRA 2EE0A 4P3DA 4P59L 2B59B 1JTTA 1UURA 1UYWL 3DJTA 3DUUB 3DVIA 3L7FA 3TCTA 4HWNA 4BQ6A 2EDFA 1MCOL 1M9WA 2NXZD 4W9ZA 4G6AD 5DMYA 4L9DA 2YA2A 2H0EA 3LXUX 1BOGB 4Y1AB 4HKXA 4W9LC 4XMUA 4OCRH 5C0DA 2EKSB 3G5YB 3ZTEA 4MJ5A 2DWSA 2K78A 4X4KA 2CO3A 4Z77A 5TDPB 5EG6C 3OR7A 1LD9A 2NZ9C 2GSIA 3KCPB 1D5XA 4WHTB 3QNYA 4UDTA 3MV7E 4ALAL 1SMOA 5HHPA 2YA0A 1I3VA 4MMXA 2LHAA 4PS8A 5JHDE 3DVGB 4FKEA 4KROD 3SO3C 4LIQL 4J8RA 5IEKB 2QHRL 3SKUD 3A5VA 4MA7L 1LMKA 1KY6A 4YEEA 4O9HH 1HK6A 2VLMD 1Y6MR 3TIDA 5IHUL 3FB7A 3QFGA 4FQHB 4XVTH 2R2HA 3PDGA 5T1LB 3RZWA 5DVNA 3T0EA 1UWXH 2YZ8A 1LEGA 2NY3D 3BPLC 1G0DA 1T3FA 4MXQC 4H1LA 3SE4A 2OZ4H 3N06B 5ITBL 1JK8B 3T8XB 4ZD3H 5JA8B 1EJOL 4PJXF 2LVCA 1H0DB 4AG4H 4Z7OF 5IHZB 2Y7QA 2J7LA 2OMXB 4YR6B 1HHKB 3JV4B 5BNXD 1J1PH 1R24A 3QUGA 2V5TA 1GL4B 4DZ8A 3C5XA 2MIZA 4ODWB 3GC3A 1JE6A 1TG8A 2CHDA 4N20A 4EZKA 1RZQA 3GUTA 2M26A 3F62A 1WC7B 4U0QB 2CDEB 3U0TB 4R8WH 1BX2A 4H0GA 2Y07L 3L3HA 1FVEB 4FQ1L 1KCBA 4KTEH 4JRXA 3DBXA 3GJEA 3PXLA 3FTGB 1YJDH 2J2ZA 1N9PA 4OJDH 5FFOA 5IT2L 3AUWB 1TJHL 2RHEA 3GZKA 4L23A 4CRPA 1T0OA 4M8UA 2DLEA 1SY6H 3FL7A 4MCZB 4Z0XA 2UWEE 5D7IE 2D0HA 1P84J 3WMSA 5DLMH 1KIQA 4GS7C 3UPRA 1KBKA 3ZQ9A 3RWHB 1MLBA 3CZFA 4HKXB 4M02A 2Y5EA 4MJ5B 4ZDHA 2CJSA 4U3XA 3FU0A 1F6LL 4EO5A 3G6JE 5G5DA 3OR7B 1Y1DA 4QJ3B 1D5XB 3N42F 3QNYB 3VRIB 2E47A 2IPUG 4FL4B 3QQDB 4M43H 4MMXB 4J27A 1EXHA 5FEBA 1FNEA 1ZOXA 1DSWA 2EUVA 3QO0B 4EDWH 2BFGA 1BAWA 4O2FB 3I02A 5IB4B 3KH3A 4F9LC 4OKVA 1JPTL 3KLQA 3WY4A 4NWTL 4KX9A 5FW8A 1UCBH 2VZOA 2GUOB 3J2PA 1I9EA 4LAJH 1O6VA 4EKJA 2NDFA 1ZXQA 4P23D 4TQPA 1NA8A 4GBXC 1IV8A 1E5AA 4Y1TA 3DX4A 3RVUD 4V11A 4PJXA 1K4CA 1PY9A 4QAMB 3H3BC 2Y7QB 2CDGA 3CN1A 4LKCA 4XPFL 5ID1A 1N4XH 1ZANH 2C9VA 3CVIH 4NUMA 4XVSL 3SCMB 2ZX8A 4F8TA 4UZUA 1GC1H 5E0FA 5E56A 1DBBH 2YMXL 4HJ0D 1EFXB 2X4TA 1FLRL 1BX2B 2B9AA 5JUEL 3Q6GL 1UOKA 4HLEA 2ZKHH 4FQQB 3GJEB 1UD3A 3UYRH 3FQUB 1QSFB 2KLTA 3AS0A 4DGYH 2JCCF 1DFBL 2JIXB 4LCCB 1NDTA 4H5SB 3BIKA 1F4XL 1N3NB 2Y23A 1KELH 4PRPE 1C8PA 1S7WA 1KIPB 5E5MB 1N7MH 3BKJH 4NOBA 1MCFA 2OCCB 3DSFL 3EJTA 1MLBB 3CZFB 2EIZA 3PQYE 4IKJA 3WY3A 5GXBB 3MV8A 1KPUA 2I85A 1TVHA 4QRQA 3FBKA 4ATTA 1DQLH 2W0FB 3FNKA 3ESPA 3VGAB 3LPOA 4U6VL 5FYKL 3V79C 2K3TA 1OPGL 1YZZA 5CZVH 3CFJB