3QZBA

Crystal structure of a putative superoxide reductase (tm0658) from thermotoga maritima at 1.10 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
131
structure length
131
Chain Sequence
MKLSDFIKTEDFKKEKHVPVIEAPEKVKKDEKVQIVVTVGKEIPHPNTTEHHIRWIKVFFQPDGDPYVYEVGRYEFNAHGESVQGPNIGAVYTEPTVTTVVKLNRSGTIIALSYCNIHGLWESSQKITVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative superoxide reductase (TM0658) from Thermotoga maritima at 1.10 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
molecule keywords Putative superoxide reductase
total genus 28
structure length 131
sequence length 131
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2011-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qzbA00
4C4UA 1DO6A 2AMUA 1VZGA 4BRVA 4D7PA 1DQIA 4BK8A 3QZBA 4BFJA 4BFFA 2JI1A 4BV1A 1VZHA 1Y07A 4BFKA 4BRJA 4BGLA 1DFXA 2HVBA 2JI2A 1VZIA 2JI3A 4C4BA 1DQKA
chains in the Genus database with same CATH superfamily
4NQDD 2YGQA 1MFDL 1RI8A 2X2YA 2QKIA 4JRXD 4JFVA 5D4JA 2DDQL 3HUJA 3M8OH 4N6RA 5DURB 1K85A 4JREB 3D52A 2ARJQ 1H6EA 2DIBA 4XO3A 1PLGL 5JNYB 2NX5B 2EIDA 3FU6A 3PWVA 1BBJB 3U4AA 4LPYA 4BUGA 1WITA 3AXLA 2FTAA 5IG7B 5EN3A 4NHUA 4ODSH 3HG1B 1CFBA 3OJVC 5I18L 5I0WA 4GRLD 1NFKA 2P8MB 4JFTA 5B8CA 2HXAA 2R8SH 2YRZA 2KPNA 1UT1A 3W1ZA 1KV7A 1RZGB 1RERA 1UFGA 3NESA 1A4JA 4EEEA 2A9BA 1T5XA 2A1WL 2XCMC 4PWKA 2YUZA 3ARQA 3MYJA 2ENSA 2I85A 4JDVA 4RQQA 4R90H 3SD2A 4GRLB 4DVRL 5EBWA 4G8EA 4X6CE 2AJYH 1NCIA 3HG1D 1MNUH 3D85A 3UTSB 5DR5L 3ZTDC 1X5LA 1ZTXE 3PREA 1TITA 1OE3A 5CHNA 2PYEA 1HDMA 4U1GB 1FF5A 4ZO9A 1EFQA 5EOTA 2R29H 2JQAA 1GZPB 2OL3L 4ZX3A 5ELIA 5ETUA 1GTNA 5KUKA 5J11C 2ZOUA 5DHMC 4EMZA 1JJUA 2VM4A 5E2VL 1BXXA 2XWBA 3JWDL 1CZ8H 1ED3A 3VXRB 2WWOA 2PUQT 1NH6A 4APQD 2N7BA 1HI6B 1HIMH 4KXBA 3MVSA 2N1KA 3SPJA 3UTZB 3SE4A 1U93B 4NN7B 1VJSA 1R34A 1QO3B 4P5KA 1CLCA 3SJVD 1BQSA 1HKLL 2Y6SD 5FGBC 3ZDWA 1DBKH 3EG9A 3DHJA 2AJ3B 3BD4A 4YFLF 1AP2A 4LSRL 3ASOB 3RZCB 4HUNB 5D1XD 4OZFH 3TPKA 3U7YL 3TV8A 1JZJA 3N5AA 2W8CA 4LOFA 3TT1H 4JG1H 2WQVA 4PJEE 3IJEB 1OSZB 5CLZA 3NPSC 1QBBA 2IH1A 5A2IH 1Q94B 4KTEL 4AL8H 1JCVA 3FFCA 3VFNB 5KVGH 4E68A 1T2QH 3BPLC 1FO0B 5DQ9A 1PZDA 5EF3A 4DJMA 4N0UA 1MIML 1MQKL 4PB9L 4WTZG 4P59H 4B9ZA 3A4EA 4R26H 2NXYD 3JV4A 1D5XA 2CO3A 2R0KL 1E8WA 4V2CB 3TTSA 1M53A 5I1EH 2FIKA 2P5PA 5DD1L 5IQ9B 1MVYA 4LPTA 1R3LB 4OGAD 4BFEA 3QC6X 3U25A 5G4NA 1EEQA 3GC3A 4Q4IA 4KXCA 3T0AA 1T22B 3QCTL 4UB0H 1GHFH 5B3JF 1E9OA 3VFRA 4N0UB 1C16B 2CR3A 5CP3A 1OW0C 4R5TA 3QA3B 1FZJA 1FBIL 1ZD6A 4PJ8D 2BSDA 3EDJA 5BS0A 3U2IA 4KK6C 1RJCA 5J3HC 2AKRB 3AAZA 3V4VB 5D70H 5CEXB 4P57B 4HWBA 1IILE 2ODHA 3LQAC 2WGNB 2BRRH 5BQDA 2LTQC 4EQ2A 5EZOH 3CFUA 3LKOA 4JDZA 5DRXA 5DGQA 3DUSA 4Z7OE 4U2YA 1NJ9B 5BVJB 4ORGA 5KJRH 2F58H 3RFZC 2DMBA 1KJ2B 2F18A 1CUOA 4M7ZB 2AZUA 2EINB 3IDYC 3QZWG 1BAWA 5T1LD 4DN3L 2VO8A 5J6HB 1OCCB 1NGPL 3E3QC 1J5OL 3SODB 3ROOA 4MRCA 1KJMA 1YSOA 3WS6C 1QBMH 1KZQA 3FUFA 1T1YA 4O5LH 3S8WA 4LP5A 1F97A 2JB5L 4G9DA 4G5ZL 2IDTA 5I1KH 1W6WA 2OW7A 3ZDXB 1TPXB 1CGVA 2R0ZH 3MV9D 4HK0B 5GRWA 4PRIB 2YKLL 1BAFH 4QXUH 3C75A 1UM4L 4QMEA 4NENA 2AERT 1CF1A 4D7BA 1A6PA 3V4PB 4DKEH 2ROXA 1JDAA 2Z0BA 4KKLD 3VMPA 2CA4A 2ZWNA 4TXVB 5AOMA 3WYRA 4BBWA 4ZUSB 4EI0A 5GGSY 2Z92A 4LCCA 3SYAA 2DIJA 2AAVA 3WIAA 4D9RD 2Q7AA 1N68A 4HUUA 2LU4A 4DO4A 3ARGA 1IGFH 4MS8C 4P4RB 3UYOD 3UERA 5ACZB 1UG9A 3SE6A 1RZGA 4UINL 4GLRI 4X0KB 3IWUA 3MLRH 1CFSA 4QUOA 5I76B 4BSWA 4BRVA 1WTLA 2NX5E 3ARVA 2Q3XA 4YBLC 3BP7A 4M6AA 4QRPB 3GJFH 4IM8A 2P8MA 1ETZA 2WB7A 2Y72A 1XGQB 1XX9C 2Z35B 4XNMA 1KULA 5DJYA 3V6FA 2QTVA 2WAQA 4MD5B 1NGQH 4AI7A 3O9WC 1ZJAA 4GH7B 5EU6E 8CGTA 2LQRA 3OAYH 1XGZA 3CMGA 5TQ2H 3QDMD 2WKOA 2EDOA 3WHE0 4UWQB 5B3NA 3V4LA 3QUYB 3RVUC 5FYKE 2D03L 3SDAA 5JOFA 2Z0UA 5I66B 4X6BA 1UJ3C 1XMWA 1Y7VA 2QZ5A 3C08L 5IVOA 3NEXA 1H3PH 2QFPA 1CR9L 4UBDD 4IU2B 4XPFL 4B95C 1CFVL 3CDZA 3TEXA 4FL4C 1HZHL 1H5BB 1TZIA 2G60H 3V0GA 3B9VA 4ODUA 3ZL4H 3IXAA 3ZE1B 4X6CB 3QK0A 4L2YA 4YR6A 1BECA 1JERA 2YK1H 1KN2H 1U8MB 1GS6X 4OFVA 4XVTH 3GXDA 2BHZA 2CO4A 2IVFC 5CJXC 3V0FA 3MCKB 5EEVA 1PAZA 4YZWA 1G87A 5C07A 3SE9H 4TNEA 4F37F 3IMUA 1VF5C 3TC9A 3FUMA 1LXMA 4NO2A 2GJ6A 3LB6D 4YHNA 3GWJA 5KYUB 4MJ6B 1RAMA 1E30A 3NJMA 1A25A 4M8VA 1TNNA 4B0MM 2E6JA 4LAQH 5HYQB 3B5GA 5BXFA 3ASNB 1MFDH 3P4MA 4IRZH 3O45B 2ARWA 4PBWD 4CVWA 1NDGA 1GAFH 4NZRL 5AZ2H 1JYNA 4DHLA 3H9SD 1NUGA 1KCVL 1MI5A 3DPDA 5I15H 1XF1A 4W9FC 3RDTC 1J8SA 3B2UD 3KPLA 3P0YL 4CILA 3CBJB 4M6ML 4YZFE 2EDEA 3WS3A 1RUKL 1BVLA 5FYKL 4DVBB 3MGTA 2F7OA 3HI6H 3ZMEA 1ZHLA 4LLYA 2DV6A 3SGKC 5AAMC 1FC2D 3RTQB 4TULL 1F3DH 5I19H 3ATAA 1F6AB 2EDXA 1QSFD 2BRRL 4K94H 4ZUVB 4OIBA 1J9CT 4XN9A 2ITDA 2X40A 4P2QA 4XVJL 3QYMA 3IMVA 5PAZA 5ANMA 5HDBB 5DJCA 2AGJH 4Y9FA 2IBGA 1WRFA 4APQB 3U4KA 4C47A 1N0LA 4PG9A 1FFOB 5SWSD 4H8UA 3A0OA 3L5HA 5JDSA 3U36B 1E43A 4UAOC 3WJMB 5CBEB 1A4KA 3IGLA 4ANXA 1MRCH 2VLKB 3F7QA 4MA1B 5BNXD 4ODBD 4AKPA 1SDDB 5E56A 4JHUA 4XO4A 1JVLA 4P2RD 1XSKA 4Z7NB 1AHKA 3DSNA 4IBSA 4XX1E 4U3CA 1QWHA 2HP4A 2WYTA 3ARUA 5AOKA 4P49A 4F92B 4KQ3H 4NZJA 4FFVD 2Y23A 3NIGE 3R18A 3TA4D 5IJCC 1RSYA 4D9QD 4LEXL 5IJKC 4UBDC 1RU9L 1QWNA 3ECBA 3HE7C 1BMGA 4N0CD 1FIGL 3EIFA 3CGTA 5DC2A 4X4YA 4DFIA 4QKTA 2FX9L 3DO4A 4OT1L 1JXJA 2EE3A 1NPUA 4ZK8A 2GABA 3QXDA 3PJLA 4IBYA 1OT2A 4MA3A 4HLEA 3BN9C 3BMVA 4F2MB 5E4OA 1XH3B 4L8DA 2BO0A 4HEPA 5HHOD 4NPKA 4FQQB 1B0WA 1U8PA 1GKOA 4R2GC 1SXZA 3DV4B 4LCWD 2O93L 1PGRB 2E59A 2AP2A 1JWUB 5DUML 1NL0L 2ESVE 1PTZA 2ZAGA 4QAWA 1KIQB 3VD1A 3APFA 4JCLA 2V3FA 2ZOOA 3GRWH 4Y2OA 5IW6B 4FJYA 4IHBA 1MCLA 1HYRC 4JLRA 3BH4A 2BSEA 4GIOA 4OH2A 4JRXB 4PLJD 4XC3H 5EUOB 2WWKT 1XAKA 5FW7A 3DJZA 4TVPL 5GGVH 3H9SA 3EFFB 1XIWD 4PREA 1OCRB 4G9FE 3ZY7A 2KDGA 3JTSB 5C6PB 1NCUA 2Y1VA 4XNYH 4NQEE 1HWHB 2R83A 4N22A 3RL2A 1A02N 2UZYB 4HGWA 5HHXL 2HLAB 4WJG3 2C9AA 4ALAH 1NUFA 1GSKA 4M7LT 1QOKA 5K9KA 2UZXB 1FWXA 3N40P 4JN1H 4K4KA 2A1WH 3S9DB 4B3EA 4B9FA 2YD5A 5C08A 4Z8FL 2A77H 3ULSA 4FMKA 1HT6A 4ZYKA 4PREB 4UV4H 4EDXA 1OTTC 4GKZA 4NB7A 3GMMA 3E6HA 2DLEA 4HAGA 4UAHA 3RWCB 1G4MA 1PZSA 1QNZL 1Z7JA 2ADIA 2WY3B 1QSEA 1NCAL 5EORH 4QRAA 5CP7B 4NQXA 2H0PA 5ES4B 4TUOA 5EB9A 4FFWC 3LH2H 1IGCL 4JFDB 1VZGA 5E9DE 3CXHK 4M3HA 5T3ZE 5K5YA 1EXHA 4CDHA 4P8QA 1C7TA 2YIHA 3KDMB 2C1OA 3C8HA 4K9JA 4MLSA 5E99L 1FJ1B 4OB5L 5TQ0L 2H1XA 2OR9H 4FKEA 2ILLA 4PJ7B 2ID5A 2C5DC 2IH3B 4JPQA 3V4UL 1PQZB 2X4NA 4MYWB 3DPBA 5FK9B 3BAWA 2OX5A 3SE4C 1XF2A 4HCGA 3IFPB 4ZUTA 1A4BA 3P0GB 4L1DA 3WN5B 1C1EL 3QO0A 2VUKA 3CFCH 1LDPH 5JIDA 3O3BB 3KWVA 3OWEA 2I32A 2D7OA 4J7RA 1RMFH 4GAGH 4WGWB 3BXNB 2X1WL 3ZE2B 3Q2NA 4WI7A 1BF2A 4XCEA 2J12B 2VH5H 1ASPA 1UD2A 4ZOEA 2JMRA 4RA3A 3BWZA 2G5UA 1TZGH 1WA1X 2BVEA 3RFZB 4GMTL 1BGXH 5GIRA 3BQVA 43CAB 1F1GA 3N2JA 3NEOA 3MRIB 2X0WA 3MRCB 4PLKC 1IE5A 3QARA 4XMPL 2VQTA 2ITDB 2PP7A 4AVKA 2LGNA 3BD3A 5CR8A 4IBZA 1N6QH 5EIQA 4K71B 2WGXA 4JB9H 1JXKA 4NYLB 4Z7OF 3UYRH 2GTQA 4HK3N 5LUMA 4MMZB 2C3HA 2HRHA 4UV7H 5D1ZB 5F7DB 5D7IF 4D2NA 5JYLA 3RIAK 3UYPB 4BFRA 2CLZA 5ALBH 5D7LB 1P7HL 3CPUA 4NIYE 1CDIA 3TCLA 4JFPB 4WI0B 3KPLB 1B2YA 3QAZC 4E0RA 3QDHA 2J1YA 2X3AA 3LV3A 3MNWB 1KB9K 1DE4B 1Q38A 1I4FA 1CXFA 1A6TA 3QDME 4KWUA 5F1KC 2NPLX 3BEVA 2AV1A 4Z7NE 3VDCA 1A1MA 1DVFA 3FTVA 3FCTB 3GMRB 3MLTB 3HC4H 4XCYA 2J1WA 4OF3A 1I53A 2FQGA 1LYQA 1OM3H 1QW9A 3QWOB 1NIDA 3VRIA 1CGYA 2Z31D 5GSVB 3T4YB 1RUMH 4I5BB 5JW3L 3IBEA 3HHRB 2A4CA 4M5YL 3GSQB 1A7PL 3EZ8A 1H8OA 4ZTPL 5EU7C 2H3KA 1S6NA 3H9YA 1I85A 1IBZA 2H6PA 3D0VA 3UZVA 4GQQA 3LNIA 3RWJA 3A67H 4PJHE 4Y0GA 3UBFA 2VB5A 3LSOA 4Y4KD 3TA3C 4EBQL 3SCMA 4NM8H 1DVFB 4PB0L 1VGEH 3WE6B 1KNOB 1X5IA 2QVIA 3OAUL 3MCYA 5I66A 4BZ1L 4LFHG 1NC4A 3QUYA 4B9PA 1PDKB 4GG8B 3MNWA 2BNRD 2A0LC 2XPYA 1S8DB 1SUJA 1I85C 1D5ZA 2O5XH 4F7MB 1U2YA 2H3XC 1HWWA 3FB6A 4CSPA 3N06B 3W38A 2XVBA 2VKWA 4DO5A 1XGQA 1W91A 2ZP8A 4YBHA 4HPOH 5I28A 3SYCA 1F2XK 2CRZA 1WT5C 1G9MC 2CHZA 4LAQL 3DKHA 3LEXA 2OAAA 1S78D 3F7YA 4N8PA 4PY8J 4FXLA 1FBIH 1KUMA 2H2PD 4AMXA 1AR1D 3TTYA 3DJ9A 4QYOB 4IKNA 1ND0B 1KF9B 3BVDB 3MKKA 4QRTA 5EC1A 5E0QA 5J57B 4P5MB 4LB8A 3BJ91 4LLUA 4J4PA 4TTDC 2XYBA 3QQ4A 1A9BB 3OZKA 1QR1B 4Z0XA 1CICB 3ARZA 4WTXA 4JZJC 3WIFA 1AOZA 3PGFL 1KN2L 3S0PA 2YAPA 2DJUA 1ZK5A 4XCEB 2WN3A 3H1ZA 3HLAA 2H2SD 1A0QL 2YN3A 3VI4E 5I9QC 4NUJA 5BO1H 1P0SE 2FYYB 3Q43A 4P46D 3Q9PA 2CLRA 1ZSDA 3HC3L 3N43B 1MJUL 4RAHA 4NC1E 2UXFA 4OFYD 1WD9A 3T6XA 1KJMB 2E6QA 4OLVH 2OK0L 4NDMB 5E9DB 4NO5B 1XBRA 3WN5A 2MOGA 4WWKB 5AVWB 2JXMB 4YZFF 2DQIL 4OCYH 5DR5H 2C3XA 5I73B 3UEQA 3NAAH 4Y4FD 1PVHA 3E8UH 4NC2B 4RWYH 4XNZC 1H6TA 5IVXB 3KW8A 4OZIE 1YEFH 4KKZA 4GO6B 2PP8A 4M1CC 4LSVH 1M9WA 2PWHA 3HG1E 3E6FA 1RVFH 3KJ6L 4UUJB 5AW9B 3ALPA 3DX0A 3DI3B 3S3JA 4Z3EA 4PS7A 3EHBC 1TZGL 3ABKB 3H7BA 4LSQH 4POYA 1ZK9A 1F4HA 4M93B 5DRNA 3S2CA 3ECQA 1AE6H 1ASQA 2CH8A 5K33A 3RBSA 3IYLW 4QO1A 1JPSH 1YEDA 2ZKHH 4YDJA 2YEZB 4GKZB 2WN2A 1B2WL 3VYPA 4EDXB 5DVOA 1ITBB 4JHWH 1JZ3A 2VLMD 2BWIA 2IAMA 4B0MB 5HI3D 3K2UL 1U95A 4I77L 1BF5A 4OAWA 4NQQA 1RZKH 4J4PC 4O00A 4LIQH 3EF7A 1T20B 4B3VA 4IBLT 3KR3L 1A6VH 1SF3A 2XZAL 4PTTA 3ZHNA 3WFEL 4X6EA 3FFCB 5KTEL 3II3A 4S2SA 5IW1A 1W0YT 3MRGB 4DO6A 4ZD3L 2LT9A 2ZAHA 3HG3A 4LSPH 3UG5A 1H3XA 2P9RA 1Q1PA 1TTUA 2JLPA 4XC1L 4JO2H 5SX5H 4XX5A 4CUCA 5C7XH 2FO8A 4ZFGH 3HJEA 4NOBA 3MACL 4XWOC 3GXMA 2EAEA 4J3SA 1IU1A 3CFBA 1IL1B 1ZMYA 1QLFA 1QR1A 1B4TA 4WLCA 1UXMA 1BEYL 2LAGB 1I1FB 5CINL 3BFOA 2GAZA 3FQXA 4QTIL 2X9XA 2W0KA 4NWUH 1NUNB 5I26A 4YDKH 2GT9A 1YEIL 3U48A 4JUSA 2QHRL 1MDTA 1DZBA 4G42A 5SX4I 5A6LA 4JE4B 4TRPH 4YHLH 3QE5A 2X05A 2LV4A 3SE8L 4Q7DA 3B5HA 3PLYA 5FAAA 4C54A 3CDCA 2DYPD 1DVQA 4JFEE 5C2UB 3TBBA 4CAGA 4EUPH 2QVMA 3HHMA 2OI9C 3HN3A 4Z7VF 1T3FB 1K8DB 2WWKO 3H4FA 2K78A 4PD4J 4PCSA 4HHGA 4QHUA 5AVYB 3RGVB 3TN0C 1OTTD 3WHXA 1JNLL 4M03A 5CD5D 1VEOA 4P59L 2KLTA 5CIPH 3AADB 4O02A 3HB3D 1IC7L 2V3EA 2OKMA 3MNVB 1YHPA 3P30L 4PJGF 5BRZB 1DUZB 5HVHC 2WZ5A 1U6AH 1O75A 3LEXB 2EKJA 4UNUA 3D09A 1A9EB 4KTGA 5JIPA 2CCWA 3DROB 3N41B 4AGPA 1I9EA 3B5TA 3MUUA 1OAKH 4FFVC 4P23D 1X44A 4XHJD 1OGPA 2VR4A 1Q0YL 1QFHA 4A2MA 3L8QA 3QDGD 3KWTA 1AVAA 3MV7B 1JZIA 2E56A 1AD0A 4N5EC 5I1JH 1O9VA 2VW6A 2WVVB 2ZSWA 3R06A 2IAMD 4P5RA 1CTMA 3BLBA 1UWGL 1C5CL 3FRPB 5GJTL 5F9JB 2NY3D 3UACA 4HHAB 2VQUA 1NEZG 4AV4A 3AS3A 7PCYA 2X4PA 1NC4B 4DERA 3L95A 4M1DH 3WFDL 4WV1A 4R4FL 1CZ8L 4PG2A 1B6UA 3BAIA 1H9DA 2APXA 3HCVB 2QBWA 4RBPH 4AQAB 4BCYA 3LKNA 3V7AE 5BMFL 2VR6A 1P5VB 1XR9B 3SDCD 4A37A 5CZRA 2OFQA 1A4CA 3EHBB 5AW3B 1FLRL 4JY4A 2DQEL 4MCYA 3WN6A 4QTFA 12E8H 4PRIE 3WV0A 4KKAC 3ZRSA 3LXCA 5FR3A 5GSVA 3V7MA 1H3TA 1R5VB 3JUZA 3L17A 2KERA 2WVSA 1PZAA 4OJEH 3ULUE 2GW5A 4IIQC 1ZLDA 2ZYSA 4MNGE 1AJ7H 3Q6FB 5CBAB 2CUHA 1KJ3H 3II2A 2NCMA 4AENB 2FVNA 4E9WA 1JMZA 1G7IA 1Q1JH 4Y16A 2XRAH 3U1SH 5I8OH 1I1RA 4GKOA 5FYKD 4UOZA 3BKYL 1QPXA 2D31B 2GC7C 3FJTA 3KS0H 4XVJH 3ML9A 4ZSOE 3RVVC 2ZUVA 1OE2A 5ESAA 4JY4B 5IVXE 1X4XA 3APNA 3F05A 2D7NA 5T1MB 3JSSA 5DQDL 3K2KA 2H6OA 3FN0H 4JVPA 3VFUB 4DN4L 3UYPA 3CVHH 5GGUB 2D3NA 2WXMA 5ADOL 1FHNA 1F3JA 4OSUH 3ISWA 3BP4B 4KNSA 4NJ9L 3H54A 4AQAA 1NOFA 4W9HC 2ZT9C 4F57H 2DBLL 5I1KL 3QUZB 4LDCA 3TEUA 2OR9L 3SDAB 5JOFB 1S7WA 4K7PH 3BLKA 5KOVC 1P5UC 1AGBB 4MXQC 5F96H 1JGUL 1OARH 3LKPA 4AC2A 4XAKE 3KHQA 4X42A 3FO9A 2WXJA 5GZOD 1ZA6A 5MEND 3P4OB 3MV7A 3HPJB 2A2QT 5ITFB 5C70A 4I18B 4HS3B 4G11A 5I9QB 3ILDA 2FJGB 4YBLB 2EACA 2PTUA 3T77A 2NW3A 5I1CH 1Q4NX 1EHXA 2MNJB 4UDUB 1U8JB 2VITB 5IK3A 4D3CH 3FYIB 4XO8A 3FFOA 2C3VA 4UT6H 3ELQA 3FFCE 4KU1A 5F0MB 1XD1A 1E4XH 3Q2LA 4ICWA 4IKKA 2AMUA 5KTEH 5IWLA 1CDBA 1KGXA 4XXWA 2OCJA 1CCZA 4N2IA 4CVXB 3O3BA 2FWUA 5T5FA 4ZUSA 1LLAA 3TP4A 5T33L 4YE0A 4J28A 4BINA 2EUZA 3DYPA 1A5FH 4JAMB 4E9LA 2DLGA 1ERNA 3MN8A 1MIEL 1XZWA 2RACA 4JFHE 4PJ7A 4ZMNA 1QYGL 2D03H 1ZV9A 4G6KH 1F86A 3C2SA 1U0QA 4X5RA 4GUPA 1DVZA 4JO4L 1IBHA 1CFTB 5FW6A 4XNXL 5J8OA 1WVZA 2P5ED 2Q7NA 1E9QB 1R24A 4DKTA 2YRBA 3RWDA 2DWEB 3BUYA 4TQEH 5HHQB 2JKRM 4UNIA 3BZEB 1MNNA 3PGCB 1AD9A 5D1ZD 1I75A 4B50A 4P2OA 2DQUL 4Y2DC 3FRUA 4B9GA 1HXYB 1ZEAH 2ADIB 5E4EB 3OXRB 2DM4A 1IBGH 1IARB 3CDGA 5T3XE 1A7BA 1RP9A 1AJ7L 4F9LC 5I30L 4NKQB 4YSQA 3LCYA 1DBBH 5ID0B 2IC2A 3LKOB 4JDZB 4PR5B 2IXQB 3PFQA 2DWTA 5HD8C 3DETD 1U8LB 3Q1SL 2VC2L 4WO0A 4XN8A 3UAEA 1VENA 3LS4H 3QEQB 1TT6A 3BIKA 3DVGA 4K9EH 5K9JL 4FHJA 1MXGA 2VLKE 4ZFQA 3ZW3A 2F19H 3L1OH 4P2OC 2BY2A 5LNEA 4MVBD 5IW1B 2YZ1A 3QIBA 4JKKA 2YA1A 1NKGA 4E5XA 5DGRA 5EU5A 1IKFH 4K2UL 3KXFB 3L9EA 2H32H 1NSNH 5T3ZL 5FDYA 4GBXD 1QABA 3GO1H 2I9LB 3HNTL 1BLNA 3GSNA 3L6FB 3RURA 3WFDH 4NNYA 4AIZA 4F80A 3MRLA 4ZNEE 3EDKA 2QMJA 2MWCA 5GRVL 2EVIA 3BFQG 2N1TE 4J2QA 2MEJB 3KCPA 3NJFA 1RQ5A 5D5MF 3C87A 4BQBA 1HWGB 4DGVH 5IMOB 5EUOA 3G6JA 1V3JA 3QEGH 4OVVA 2A6DB 5GRJL 3WO4B 3OX8B 4FNLH 2JKLA 2ZWYA 4JDTH 1N26A 2ZZUT 2AJYL 3RX7A 5C0BB 3MCLH 3DV4A 2X10A 1U4EA 3MR9B 3SIKA 3MJ9A 1U8PB 3BAEL 4KK5D 2OYLA 4K5LA 4WTWA 1F11B 3CQQA 3MRNB 4LCYB 4XZUA 1UT9A 1N4XL 4UUJA 2P24A 3HRZC 4RMWA 4X9IA 4YH6A 2O6PA 4YSAA 4M7KL 5L8JB 2ESVB 2VUYA 4IBUA 4XCCL 3TBSA 1WC7B 3MV11 7FABL 2XQYK 3DGDA 5L2JB 2R2BA 5I23A 2Q1EA 4JRXE 4MAUL 3UG4A 1NCNA 2F54E 1MLBA 5LCVH 3X14A 3LDBB 5L2KA 3VD2A 2LABA 1BZOA 3EADA 1L3NA 1OAQH 5KG9A 5AVTB 1N5AB 2O6DA 2WMPB 1SOXA 2X28A 3LEYL 4G2AA 4TULH 1F2QA 3S5YA 3PF2A 4KVNL 5EZIH 4FTVE 2GHWB 4UZUA 3FN0L 1NSNL 3V55A 7TAAA 4JJ5B 3HAEA 3PIQA 5E5MB 3BZFA 5FM8A 1QFPA 3C5JA 4F58L 3SKMB 2YA0A 5CHNB 5H37A 3PP4L 2E86A 3WIFB 1FSKB 3KYNB 1PMYA 2QVKA 2W59A 4C83A 3U79A 5KAQG 1DSFL 1WFOA 2QQLH 4FYQA 3IETB 4RAUA 4U1NA 3VW3L 1KEGL 1IT9H 3EYSH 5FB8B 3GMOA 1AKJD 4HVBA 3I6KB 1NGYB 2CXKA 2AQSA 5ANMB 4UOQA 2IQ9H 2VDKB 2NR6A 3IRPX 2FT8A 3ZTNH 3B3IA 3QFGA 2VC2H 4OT1H 1F58H 3S36X 3GB7B 1H15B 3KLDA 2P26A 3MUY1 1BW8A 5HHPB 2ICEA 1T0NA 1HIML 1LVEA 2FL5B 3FQ1A 1BVLB 4LASH 4XNBA 1UOWA 5DJ6A 5I75B 5BUAA 4PGDB 1HHGB 1NZRA 4Y4HD 5IG7A 3C6LC 3KPOB 4P2AA 2EIZB 2H2SC 2HJLA 3IFOB 1HKFA 2G75A 3L7FA 3QHZL 4HD5A 3UIYA 2E47A 2PYED 3TZVB 5JO5A 1SJHB 5FGCB 3L3DB 4I0PC 1LO0H 1MAMH 4HKBA 5BS0D 2WD0A 1BOGB 4H25B 1DDHB 1AQDB 2ENQA 4TTDD 4H8WH 5ADPH 2WCSA 4PLKD 2AW2A 4EIGB 1ETB1 2OMYA 3ZDZE 2ICWI 3PS6A 4PMEA 1QZ1A 1AR1C 3BQUA 4MJ6A 3LIUA 4M8QB 4AYBA 3D0VB 3UZVB 2ZWSA 4BK8A 4AG4L 4XNUH 5FECB 3ZE2E 5J5EA 5HDRA 4OM1L 1BD2E 4G8FA 4M1CD 1G0YR 2W9EL 5E4IA 3UABA 1YECH 4IKLA 4MA8L 1ROCA 1IGYA 2BVUA 3V4PL 4JPIB 3O11B 4QHNB 5I1IH 3BQUB 3GXNA 1FZKA 4O58L 4ODUB 3ZTNL 4F8LA 5B1BB 1QFWH 4ZMYA 4HPHA 1IBYA 4HWZB 1ZT4B 3CSTA 3QUXD 2P43B 1CK0H 2GSMB 3M1CA 3WLBA 1TQVA 2P4AB 2HRGA 3EBGA 1I8KA 2CO1A 4YHPB 1ODUA 5K1JA 2CCVA 2ZD0A 2ITCA 2R9HC 3D30A 1SJHA 3HNSH 3LN5B 4GKNB 4NNXB 3T0VA 4KUZL 5D5MA 3UP6A 3V0HA 1JOIA 5FA3A 1GYCA 2EIZA 3IFOA 5JHBA 5E2TL 4AGMA 4IOIA 5DJ6B 1K4CA 3WGVB 4NGHH 3BP7B 1TKWB 5D5ME 4IIQB 5HHXH 3NJLA 4C57C 1MZZA 3C12A 2F1AA 4I2XB 4C59B 4F8OA 1AGFA 1I8MA 4DN3H 3B3IB 4IJTA 4OD3H 3ZYJA 3AG2B 3FQRA 3FT9A 5HI4C 3E9TA 1J5IA 4P4RA 1QBLH 3K2MC 3P54A 2XRAL 5T5NG 3VI3B 5I8OL 3PHQA 2BW4A 4KV5F 2GJRA 3ROLB 5EULV 4A7SA 1BG1A 3VFPB 1RJLA 4RCAA 5JXEC 1FLTX 1HCFX 1X7SA 4OLZL 5F71A 5F6HI 2YBRB 3SKOB 2VN5A 3TVMC 4KQ0A 2OMXB 4FN0A 5B1JA 2PN5A 3I6GA 5TK4A 3CN1A 1XCQB 3ULUH 4XPFH 1OGSA 3INOA 1J1PH 1EXUA 3CN4A 3EYOA 4N86A 3C5ZC 1KGCE 2DQFA 3F84A 4M43L 1XF3A 1EJFA 1GW6A 1YMHB 2JK5A 4PGJA 1FGNL 4JRWA 5FO2A 1F3DJ 2Q6WA 2N01B 2P80D 4ZUTB 5H37G 5KG9B 5J9PA 2GQHA 3FB7B 2V6HA 5FK9A 1A6ZA 4RGMB 3ZE0B 1MLBB 5FYLD 4OCMC 1JPSL 2M26A 2ZKHL 4LEXH 4MMXA 2CKBB 2AJUL 1HNGA 4JS7A 3V0WH 1L9QA 1VDGA 2WNXA 4NUGH 5LJYH 4ZOAA 2HTKC 5ICXB 2XWXA 1USZA 4LDLB 4UOJA 2W9DH 3TURA 3CDFA 4JFDA 4IDLA 4QT5A 5MENA 2VRQA 3BVNB 3MRRB 4TUOB 1N59B 5LN8A 4NQXB 3OR6B 5TE7L 2P5WA 3Q5YA 4TSCH 1IT9L 2H8PA 3EYSL 1TMQA 4QRPD 1OGAE 1QLEL 3WXWH 4U6YA 4XODA 1X3DA 3DX9B 2XIIA 2F74A 4AL8C 3GSUB 3VD4A 3EUDA 3K1KC 4NIKB 3D0AA 2VR9A 2WUCH 3LHPL 1RZ8B 3V9EA 3POCA 5DSCB 4FNRA 4L0PB 4AIZB 3GMQA 1KTDB 3BIBX 3X13B 1EAOA 3U6RB 2V2WA 1DCLA 5JXEA 5C0EB 3ULVD 1V3LA 5KSVB 1G43A 5IHZB 2DOCA 2XPGA 4M56A 3UJTH 4XCFL 1KLGA 4GW1A 4M61A 4HWUA 5ALCL 3A22A 2C3GA 2F0CA 4G6FD 2IH1B 4JM2A 1NCHA 1ZLWH 4RFNC 1KB9J 4K5PA 3DVGB 3O2WH 4MA7L 4L29A 4HQQH 1BEXA 3D39E 3IJ7A 1X6NA 1GPOL 4G6MH 4HUXB 4TUJA 1HAUA 2Z9TA 3WDIA 4ABVA 43C9A 1P4UA 1BZ7B 4JCWA 2NY5L 4PG2C 4E9SA 4YGVB 5L2KE 5BUPA 4LOUC 1A7PH 3AQYA 4ZTPH 3MLXL 4IRSC 4R7DB 2EEBA 1K2DB 4Q74A 4E41B 5IR1A 3CDGB 4KRNA 2CRYA 4P5KB 3ILPB 3O0RL 4NQCE 2A74C 5AW2B 1TTBA 2V8MA 4WI6A 1E8YA 1J86A 5PCYA 5E2JA 3O8XD 1NCDH 2UX7A 4JG0H 1AO7E 1ETJA 3D7PA 1WBXA 4FQQA 4PJCF 3VWJB 1QLEH 5IMLB 4KAQL 2PCFB 4KO5A 3RZCC 5DHXB 2HTLC 2LVCA 1JBJA 1F6FB 1NFDB 3V8OA 2R4RL 4U4IA 2Y06L 4DK5A 2MOQA 3GRGA 2XV6B 1ZXKA 3T3PB 3IDMB 5I74B 1IAIH 1GYVA 3ECBB 1E2WA 3IJ8A 4DP4X 1BJMA 3MFFA 2DMHA 2E74C 3D51A 2QV2A 4UMSA 5CCJA 2NY0C 2XV2A 1J10A 3WIHH 1QVOB 3RDJA 3LRGA 3P0VH 4G9FD 4K5MA 4CVXA 3IE9A 2HB0A 3H6AA 1CN4A 3VA2C 3O3AB 4NERA 2HFTA 2HX8A 4LIQL 5E24E 2C3VB 1CK0L 1BBDH 1M71A 3LIZA 2BFVH 1FDLH 3A21A 1U3JA 3I75A 3L7EB 4NNPH 4UIMA 4L8CA 3FNKA 3L3IB 4W68A 2I07A 4HS3A 7CGTA 3FCBA 4NZFA 3I9PA 3BGAA 4BWTA 4PRDA 4RZKA 3P4OA 1N0LB 4Z6AT 2FATL 1ZA6B 4APQA 2R59A 3TEWA 3OHXB 4K23H 2YAMA 3ZDXF 4ENED 4PGBB 1THCA 5FKAA 2IMMA 3R1GH 4L0ZA 3TF4A 2VZOA 2X9YA 1ZHBB 3M45A 1E3ZA 3IMWA 3ARED 1F6AA 5KBDA 3FU7B 1CVRA 4LSVL 1GC1C 1CFQA 3BX7C 5EN2B 3AW5A 4JRYD 4XMLL 1JYVA 1F3JB 2H45A 3QNXB 4NLAA 3DTXB 3VRJB 1RLBA 4UV7L 3VFUA 3WEMA 5E9AA 3KPTA 3LRMA 5D2NA 3EZJB 2WC7A 5E6RB 1CL7L 1XT5A 4JFEB 3FTXA 4PWEA 1S7VB 2H26A 5DK3A 3NJJA 3CFEB 4GT7A 1XSIA 3ARYA 3KPPB 3NZHH 5GPRA 3NJHA 4PLJC 4IBQA 1IMHC 1V55B 1RZ7H 4L3EB 3II1A 3C8DA 2AFNA 1A8ZA 2NXZB 3TBVB 2HG5B 2NY3C 3GI8L 2BCKB 2BNQA 3AS1A 1LK2B 4E9YA 2IAMC 4TUKL 3ZUNC 2HJFA 1YMME 4FFZL 5KBLA 2QV4A 4OD1L 4APXB 3CDYA 4PWGA 1S46A 4XC1H 3NFPB 4GG6F 5LNGA 1XTLA 2VKXA 1FPTL 1MRDL 2J4WL 1YN7A 1KIUB 3KPPA 1FP5A 3KYKL 3CFEA 1J8HB 1B90A 3G5VA 2A99A 5GGRY 3MLZH 2DQTL 1MPAH 3GSVB 3K2IA 3L54A 4L8BB 5ABAA 3MRBA 2HTLD 5CP3H 4K3EL 1RMFL 2Y7OA 4U7SA 2OJEB 4KVCH 2ERJB 3MV7E 3THMH 1CYXA 1GY1A 4LLQA 5F3HA 3HE7A 1BWWA 1HEHC 1CGTA 1RIUH 4MQ7B 1SNRA 5CU5A 5HJ3A 3STLA 5IZ7A 4ZZKA 4W9CC 3FU7A 1BXAA 1XCWA 3UZEC 4KZEL 3BO8B 3PWUB 4QXGL 2BM3A 2ISDA 1GPOH 2JWYA 4G6ML 4PY8I 2X4PB 4D8PA 2PXYD 5D6CA 5TJWK 1XZ0B 4D0DB 4GS7C 2H5UA 4HFUH 4NN5C 4WUKH 5E8NA 2G4GA 4QRFA 3VXNA 5DZVA 1BFTA 5CKGA 4Y9EA 3V5KB 1LEIA 4NQDB 4CC0A 4XN7A 1FNGB 3GSXA 4KVNH 5IBUB 3IU3B 4KX8A 3CWGA 4X8GA 4BK4A 3APCA 1S7QA 4K5OA 4F7EB 1F4YL 1HQ4B 3ZHDA 1SDYA 5IGXL 3P4NA 5ICZA 1UGNA 4IMLB 4GKSB 3H9ZA 1A7NH 5C0FA 4KJWD 3BDYH 4AGNA 3M1BA 1E40A 1VLXA 3AY4A 4HJ0D 5C71A 1B6DA 1KIRA 3O3AA 4V33A 4XWOD 3C5ZB 3RVXC 5CILL 4PWFA 4OI7A 4HPYH 1XGYL 5IOPB 3CZEA 5DJ8B 4HLZH 1QVOA 1UT2A 2ED6A 1I8UA 3N1GC 1B0RA 5FKPA 2DQTH 3ARXA 1TLMA 3EDDA 5DHVB 5IV2B 3RGVA 3V4PA 4WRLA 3KLLA 3TXAA 4WY7H 2CJ3A 2IWGA 4A6YL 1SXBA 1YY8B 1PCXA 3SPVA 3RVWD 4AYFB 5C0CD 3RDTD 5GGVY 4WHDA 2WXQA 2EDKA 1O6VA 4TLTA 2VLJD 3ULVL 3SDCC 3VE0B 1G6RB 2WLHA 2EVHA 4XN1A 2QDVA 3A6BH 1BJ1H 5D1QD 4ES9A 5JHDA 2PABA 5DT1H 4CKVX 5BMFH 2OSYA 5DQJA 5JMOC 2ATPB 1BQHA 4HMEA 2VSMB 1UWGH 2GI7A 1YN6B 2WCGA 2NNAB 5SV4A 4NI3A 2EE2A 4LZKA 5ALBL 3QPXL 3SKJH 3SO3C 3UAFA 3ILPA 4ORGB 4Y19E 2CGZA 2WHVA 5C9KA 2WOBA 2F54B 3V0VB 2ZUQB 2R2HA 2IGFL 5T1KB 2GJJA 3U6XS 4MHHI 3WJLC 4J6RL 3DOHA 3OVUB 1JWMB 4KDWA 4BZ2H 1IBFA 3SCMD 4PRPB 5KS9B 1KEGH 2AEOA 2F8IA 5D7JA 1U6AL 1D6EB 2IPUG 5CILH 5EUKB 2AGJL 3PFUA 3QA3A 4JKWA 5TGBB 2BC4B 3RVTC 3ZE2F 2RH0A 2WLIA 5I1CL 1UOLA 4D9QE 1E9OB 3WEBA 4RGNB 1T22A 4FLOA 4UQBA 4ALAC 1PLCA 5FYJH 3A24A 5CD3B 3GPSA 1N0XH 1FL3A 3CMOL 3DX6B 4LSSH 2VH5L 5JXAL 4BWWA 3JV5A 3VGAC 1BQKA 1DBAH 4XP5L 3GGWA 2NSXA 1KTLB 4PMFA 5EEXA 4UNTA 4MNQD 3QVAA 5EU6B 1DR9A 3BUTA 5FFGA 1JNJA 1EUTA 4AVHA 4Z7NF 3KPSE 5DQ9B 4OCRL 3DNKA 3DXAA 4ADIA 1WEJH 4IMKA 4C4UA 5EBLB 3K74B 4HXAL 3T1FA 2B9AA 5HGAB 3ALWA 4NZRH 4W9IC 5AVVB 4D9LH 5I1GL 5INCA 3VFWB 4BFJA 1JDCA 2Z31A 3D85D 2AJSH 2D0GA 4JEGB 4UQAA 3FN3A 3S34L 2VC2B 4HXBH 4JFHD 3CAFA 4OLWL 1W2KT 3CFJA 5AAWA 4OI8A 2HT3D 1JPST 4HWEH 1Z3GH 5C0JB 2WBXA 5CSGA 1YNTB 5GZNA 2J20A 4H5SA 2L7JA 5ACMA 1VRSA 3HUJE 4Y5XC 3AU1A 2C26A 3O2DL 2R0LL 3C2AH 4N2FA 2DMCA 5I30H 3NSDA 4A38A 5E8DL 4OV6F 4BSVB 4A55A 4H1LH 3AT8A 1L7TH 2XN1A 1IKNC 1KPUB 1R75A 4OBRA 2UV3A 3MV8E 2CLRB 4HWBH 4CA4A 2OJ1A 1HXMA 4XH2A 2UY7A 4DAGL 1FVEA 1NDTA 3M88A 3UAJA 1SY6A 1SMAA 2DQGL 3ECUA 2Y9RT 4PPTA 1CE6A 1W8EA 2FB4L 4U3SB 4BH8A 1UWYA 3HNSL 1E2ZA 3DX8B 5FUOH 3VD3A 5JPNB 1CICA 2OSLA 1QHQA 3FFDA 3T0EB 1A9BA 5D1XC 2B8OT 3HZVB 5FO8A 1P84K 4JMNA 4G8EB 3QWQB 3HC3H 4YK4C 5CF3A 1M3IA 4WUUA 1FZMB 2ZCKL 2MPVA 4MKMA 4BV1A 5CCKH 2TSBA 2N0MA 1VZHA 3P3TA 4HF5L 4EBQH 5GJSL 3V6ZA 3IK2A 1TZOA 2SEBB 3S4SB 1MZYA 4YDLC 5C0BE 1A3RH 2HAZA 4FAAB 3WFCH 3K7UA 1OSEA 2HKAA 3N85L 1C08B 1SDAB 2MKLC 1ZGLM 1LK3H 2QT6A 1YEFL 4IU3A 2J2ZA 5HGHA 4CN4A 4ZFZB 5BVPL 1IM3B 2R15A 3PXHA 2YQBA 2JQMA 3E8UL 5GSRA 1A2YA 1PPIA 3MLUL 1A6AB 1YC8A 1YUKB 4FXKA 1F90H 3TV3L 4AYID 1BPVA 1QZNA 1JNNL 3KVDD 3D48R 4FRWA 4H26B 5MEOA 1JHTA 1RIHH 4UM9D 2F7RA 4N8CH 2AXFA 3P0VL 1L6PA 2VLRA 4OZGB 5TK2A 3EYQC 4HJTA 4A2EA 3QDJB 3FW6A 4DAGH 2V5YA 4GSUA 4MQSB 4NFBA 1IFHH 4G7YL 4QRQB 3EFOA 2NY6D 3ARSA 4MDJA 1MCEA 2ZTBA 4JY5L 1T89C 1P2CA 3O11A 4L1HA 3VFGH 4C56D 4I3GA 5ABZA 2EO7A 1NWOA 4HZ1A 3ZDYE 5F7MC 5KJRL 4A63A 1DVTA 2EDRA 3LH2L 4OIFA 4FA8A 1ZLVK 3FULA 1J18A 1I7UA 5KSUB 3DV6A 3N40F 5C7ZA 5GRUL 4IRJC 1IAMA 4FC3E 3VG0H 4FTVD 3IDYB 2W95A 1UD5A 2XTJB 1O9ZA 4FFWD 4N8VG 4HWEL 4YXLH 4HH8A 3FCTA 3IPBA 1DP0A 5FHBL 4JY6B 1QX1A 1A1MB 1M7UA 2AQPA 3LDBC 3REWA 1JGVH 1NBYB 3NUKA 1NGZA 1FH5L 5GXBB 5FDWA 2YAOA 2YKLH 3O0RH 3S5LB 1TZHB 2W88A 5D7SL 1F6LL 3PWPD 4JFPA 4WI0A 1N18A 1AZNA 3KPOA 5FF6B 2RGSA 2CLZB 2LFEA 1AZUA 2WANA 3QHFH 4OCXH 4RFOH 5DI8B 1YNKH 2BXYA 2QKSA 4JVUA 5DMGC 4R5VA 4PRPE 5FCSH 4BGLA 3CG8A 1G9HA 5KS9E 4Z3HA 3LMJH 3GIVB 1A14L 3LHAA 4JO1H 4LSSL 1B4LA 1ZE3C 2R1XA 5AAPA 4PRHB 2KQNA 3B43A 4XCFH 1E0OB 4TRPL 1D2PA 3WJLA 4YHLL 1UH4A 5DJAA 2OMVA 1FNHA 2R2EA 4N24A 1YAIA 4GXUN 1NBZB 4EO5A 1RK1A 3GLZA 2ZUUA 2FCBA 3P9MA 4WJKB 5C08D 2FGWH 3ZDZB 1DQIA 4F7CA 1JZFA 1KMGA 4M7KH 4KRPB 4AZ8A 1E4HA 1EFXB 3JVGC 2PPFA 5DJ0B 2HT4C 1WFUA 2J5LB 3IKCA 2CO2A 1FN4A 4NO0D 3KYNA 1H9VA 1MCQA 2OV0A 3WAKA 3PHAA 1JN6B 3HS0A 5GZND 1ONQB 2XN9D 1VHPA 4XBEL 1DTUA 5J1SC 4Y5VC 4NWTH 2DTSA 1QKZH 3BXNA 3EYUL 4WCYL 3C9NB 2ZP0T 2JIXA 4DEWA 1UZ6E 4GRWF 4IEFA 3OBAA 4PJFF 3WUWA 1MCOL 2X1QA 3IFLH 3PV6B 4JFDE 3KMDA 2NY2C 3UBXI 3V5DB 3I9GH 3EFDL 1SJMA 4NN6C 4YDIL 2Y2TA 3I9IA 5L2KB 3DPBB 3EYQD 1K5NA 2NYKA 4H5SB 2NR6D 1QAWA 2BOLA 5D72H 4G7YH 5FGBA 4AX3A 4RMRA 2CO6A 4HFWB 3CZFB 4BFBD 1EEZB 3C8KB 2BNUB 1YPZE 2LTQB 3D0LA 3PQYD 3VX1A 3T4AB 4KITB 4MQXC 1C1EH 1Y0LA 1R3IL 3RL1B 3UTQB 2Q8AH 1AQKL 1Q0EA 1TQTA 1FGNH 4TMPA 1ECYA 1FYTA 5CEZH 5CP7A 1OK8A 3IDGB 3IRZA 3DMMD 5ITBL 2E0PA 4UOW1 2BS71 4XI5D 3L5JA 5IUSA 3LKRB 3R8QA 3FQYA 4GO9A 4NWUL 3RWCA 1AGDA 4NQED 3MJ9H 5EF2A 5LVEA 2CDEA 1OTUC 5K1VA 2VDMH 2XWCA 3QIUB 4LKXA 3WNOA 3MI6A 2VIRB 4B9CA 1BIIA 3QG6B 1PY0A 3OKKB 4HF5H 2A6KB 1G9NL 3GGWB 2FH8A 4XBGB 5AB2A 3MJ8B 3COOA 1EMTL 1T66C 2XWTB 3T3MB 2BERA 4FQ2L 1X9LA 4A2GA 4IW4C 4I87A 2YWYA 3QJHA 5E6ZA 1L5GB 2UZXA 1D5MA 4ABWA 3V8CA 3GS7A 2PTTB 2O6EA 1CICC 1OAZL 4B9IA 1UXLA 3SOBH 2OJZH 2XETA 4X50A 4GG6E 3RY4A 3ZBMA 1AZBA 2DMKA 5JMRA 5K1NA 4BKSC 1X5KA 3IMSA 4L4TD 5I6MA 4HX1B 4H2CA 4M6OL 4BCZA 4IBTA 1NICA 5CEYA 1RL1A 1YVLA 1AQ8A 1YNLH 1P4IH 5IHHA 3K5SA 3GTNA 1RIUL 2ZXGA 2IALB 5CS7A 1DLHB 2AITA 4OSUL 1IQDA 3SDXF 4ZMXA 3DBSA 3H42H 3OJDB 4JM4L 2V5RA 1FG2B 2R0LH 3C2AL 3F58L 4ODTL 1S7UB 3IBOA 5E8DH 3FN9A 3TVMB 4K3HA 3BZEA 4YSRA 4EUPA 1X9QA 2JJTC 3VRLE 4JPVL 4WW1B 1ZLUH 1REIA 3PP3H 1HX0A 5C0AD 1Z9PA 4I4WB 2IPKA 5L4IA 3EJZD 4FFZH 3ZUCA 1KCRH 1LL1A 1QSEE 3PL6A 1OB1A 3VE0A 4GIPD 3CHXA 4XPHL 4L48A 3L9RA 2ZUWA 4FNUA 4EZMA 3V4PH 3K5RA 5C09D 1UWXH 4AYFA 2OXHA 1CXHA 1SEBA 3JTBA 1JGVL 3HPLB 4QKXB 2JTYA 4F15B 2KBGA 2MIZA 2XQBL 4DKDC 3ECVA 3CVBA 3VWKD 2E7CA 2MKWA 1UH2A 4ZOCA 5ISZE 3RIFK 1D5IL 2UUDK 4JO3L 5DJXB 5HYJD 4UQCA 4XP6L 3OXSB 5DD1H 1OF2A 3HBZA 3TJEL 2F5AL 2VO5A 1TCMA 5F9AC 1CDCA 3UBXG 1J8HE 1B9KA 4U1HA 1O5DT 1TMCB 3ME0A 3IMBA 2G30A 1HQ4A 4CBZA 1JZ6A 3T3MF 1S7QB 1DN2A 1B4RA 3A6BL 1A64A 2F53D 1PKOA 3FO9B 5I6XB 3TT1L 5FM5M 1MREL 1MSPA 1J9QA 3WL9B 1MCOH 3IFLL 4E41E 2VLJE 4N2MA 4U3XA 2QQQA 4HUWB 2X2JA 4OGXH 1KXTB 2X87A 4LPCA 3VG9B 2XA3A 2XWJB 2P5WE 4YSDA 3PNWA 1T04A 1AO7B 1DJSA 1JGDB 1RJYB 5HJ3B 2FZ3B 3D69B 4XB7A 5BZDB 3HE7B 4HPYL 3M86A 3O4OC 5F2FA 1LGVA 2LAAA 5GS1B 1NFDE 2UWEE 3UG3A 2W60A 5CO1A 1UFUA 4PJXB 5DC9B 1HINL 3RJOA 2AJUH 1MRFL 2CNZA 4HH9A 3FTWA 4B5EA 2QQKH 2VDOH 1ZANH 2GY5A 2HFFB 3I3EA 2JB6B 4GT0A 2R23A 4FXTA 4XAKD 4R5XA 4ODWA 5EU3B 3VU2A 4FQLL 3VFVB 2BOCA 1KN4H 4HCRL 4Y16B 4IRJB 3P4MB 4G3YL 4UAOB 5CZXD 4U3HA 5BXFB 4ONHA 1I1AC 2YD9A 5L8KB 3QIWA 5AVXB 5AZEL 2X4RB 3Q3GA 2ZOLA 3C60C 2Z93B 5H37H 5IT2H 1OAQL 2R23B 3PL6D 4G1MB 1BXUA 3FBQA 2EO1A 3DX1A 5F7LB 3OAZH 3RB7A 4LHUG 1NC2B 5HDWA 3F12B 5T3ZD 1XF5B 3ZT6A 5AOLA 5I6KA 1V5JA 4P9HH 4AW4A 1JUFA 2F7IA 3MCLL 4N9GB 5B4MC 3GUFA 4ERSL 3D69A 2ROYA 1KIPB 1EIBA 2EABA 3NA4A 2P42B 4YUEH 2X9WA 3HCVA 2B3RA 4GRMA 2VDKL 4S1RH 1DHKA 1T7WA 2D0FA 4TQPA 5HPMB 1ZHBA 5C0NC 2V9RA 1UATA 4JR9L 1MVUA 3MNDA 2DH2A 1T7ZA 4FHKA 5IVZB 5B38A 4FG2A 4GYBA 3S3SA 1LP9B 3H42L 4AYEC 4MD5A 5IJBC 4ATTA 1XEUA 1ZANL 2YPKA 3NCJH 4U1KB 4Y1AE 4DCQB 5CJQH 4HS8L 2Q8BL 1BQHG 2I07B 1KY7A 2DPKA 2IBZX 4IJ3C 4FFYH 3ZYOA 1GZQA 4WQOA 1P4IL 1M7XA 1MJJB 3FH7A 4PJAB 3JWNC 2K7QA 3B7RL 4HEME 4J8QA 5H94B 1ZWIB 4L3EE 2NYYD 4V1DD 3OHXC 5DJXA 2Y7MA 1P4LB 4QOKB 5F7EL 2Z8VC 3H3KA 1MJ7L 4KUCF 3EH5B 5TE4L 4DESA 4QHUB 2GK2A 3STBA 4F3FB 4AUYA 5EDXA 4EVNA 2V7HA 3VXUB 1SN5A 1J8KA 4P9HL 2K70A 3OWRA 1T89A 1UM6H 2Z65C 3QFJE 2TRYA 4G82A 2CMRH 4N90D 4XGZA 1M3JA 1FYTE 1UUSA 3MLYH 5C0RL 4G42B 4H0IA 2OSXA 1TEYA 3VYNA 3O2VH 3ROOB 4YDZA 3AY4C 2OZ4H 5IF0B 1XCTB 5HYJA 1QUNB 5DVKA 1IAOB 3WCYA 3WFBH 4E2OA 4DPRA 3ZKMC 3T2QA 1AGEB 1KDIA 2ZXAA 2HVBA 4FQCL 1IUZA 1F4XH 1XXFC 5IR1B 3IM1A 1IQDB 5FYJL 3GEFA 2XTLA 4YGVA 3LN9A 4MCZB 3IDNA 4MB1A 4HUXA 2APSA 1TETH 4JL2A 2NDGA 3GXPA 3QQNA 5DXWA 5TDPB 4Y1AD 4ES8A 1ANUA 1Y07A 1IKOP 4S2SB 5D2NC 1A6UH 4ZMWA 1IQWH 2R51A 2J1XA 4I9XA 4MFHA 4LHQB 4GIAA 3T2NH 4DIXA 3QC5X 3EJZC 1MFEH 5KYYB 3NCWA 3AITA 2HFGL 4N2OA 4NQUA 1RZKC 2XG4B 4EPSA 4DZ8A 2FIKB 3RNKB 1HCZA 3ARGD 2WJ5A 4BKLB 5JR1H 4ZX6A 3PG2A 3TEZA 1O5PA 4LOVA 2WTOA 5F0LB 4P2YA 2EC9T 4QO1B 2ZX5A 2ADJA 3L3OA 4IGBD 1FO0A 1IX2A 2BIIA 4K94L 4OFDA 5DDHB 5E2WH 1X7QA 4FQXC 5CJQL 3LZOA 2GCYA 3TWCL 2IANB 4POZD 1XFPA 1WCQA 4HIIB 3HS9A 3UTQA 3US1A 4I3RL 1ODAA 4K8RD 1I3UA 3QH3A 4OJFH 4W6WB 3QZLA 4RISH 4ZS6D 3KYAA 4TOYL 1D2OA 2AJ3A 4FLQA 3NVQA 3EG9B 1HSAB 1MHPH 1S5HB 4XB8A 1HYSD 4P5TA 2XN0A 3QXVA 4ZSOA 4ANWA 1E27A 2EE9A 3TBYB 2VDKH 5J9PB 3EYVA 1U8QA 3S48A 2IV8A 4GAFB 2QELA 4NO5A 2Q10A 2Q6WB 3EGDB 4P2RE 1MFAL 4U6HB 3IXTA 2CGRL 4BIKA 1KJ3L 5JORA 1CD1B 1YEHH 4ZI8A 4WI3A 3TEYA 1LO3H 3DUHA 3RWFA 5IGXH 3G6AA 3BDBA 1X6LA 3F83A 3FONB 4G6JL 3U0WH 2Z31C 5I1EL 1P9MC 3DMMC 1DLFL 3G3LA 1YC7A 1XCQA 1ZOXA 3SPIA 2QDWA 1GJWA 4HZLA 3HKZA 3BQUC 1OCWH 4WHTB 4WFFE 2MHAA 1FN4B 4F8TA 4KXDA 1QWUA 4QRRD 4LK4A 5KYNA 4PYHA 1S9KC 1NBVL 1JK9A 1FGVL 1VACB 5GS0H 5EFIB 2NY1C 4P5MA 1K6QL 4K5NA 4LCUA 2X4OB 5EBWB 3ETBF 4QRTB 5EC1B 4IK7A 1G1CA 1JS4A 3QJTB 4GI6A 4YVUA 4M6MH 4K2UH 1V3MA 4C4KT 1NBZA 5IQOA 3ZQXA 3N6YA 1AH1A 1P5UB 1M42A 1U3HA 1WGVA 3GSNL 3EOTL 3QORB 4KK8D 1PL3A 1FQ9C 2E8YA 1SVCP 3IVKA 4G80A 4PRHA 1Q9WA 4DKFH 4I8DA 1TFPA 1TKWA 5B8CB 3LZQA 3PYCA 2HX7A 1J0YA 2AJXH 2AAAA 4XNDA 3L3JA 4JMXA 4NHUB 4YE4L 3T2NL 4CW1A 4FNTA 1MUJA 2APTA 4XOAA 1MHHB 5ESVA 2NUTA 3O6FD 1SYVB 3I9AA 1OCOB 5CCKL 3HUJB 4S1QL 4YBQD 3AUVA 2DF3A 3WIHA 2B7DT 4UI2A 1KNOA 4G8GB 5CSBA 3TIDB 1B0GA 1I9JH 2ZJSH 4BQ6A 1ZGLB 3QG7L 1T80A 1MCPL 1OGTB 1U91A 4GP5B 3SYQA 2ZUXA 3MV8B 3CD4A 3ESOA 2GEQA 2GBVA 4JPIA 3C60B 5KZCD 1QG3A 4R97B 5A7BA 3EOBB 3D18A 3P3UA 4GW5A 4Q52A 5DJDB 1I1CA 4P5SA 3N41F 1XB3A 4L5FH 5D7IE 1LE9B 1QRKA 3RGBA 2J8OA 2ORBL 2Y3AA 4HIJA 2YLHA 3GINA 1UJTA 2X6UA 3E8VA 2YA2A 3MV8A 4LFHD 2I7SA 3H55A 1ZGLA 4ODHL 4QRRA 1BVNP 4B7IA 3MLTA 2J88H 3D4CA 3MBXH 5IIEA 1YEEL 2RFXA 1R4XA 3KPRD 2AV1B 3A4DA 4GMTH 5J6SA 4HC1H 4NRXA 1BOGA 4AEIH 5BZWA 4JZNB 2P8LB 3UJIH 1ZIBA 5HXMA 35C8L 3OAYK 3HZMA 3MLZL 2A7BA 1A2YB 1GCFA 1KDJA 5EZOL 1QPKA 1BWMA 1N8ZB 5A2AA 3U46A 1G7MB 3NJIA 3NYKA 3BPLB 3WFHB 3LKSA 1JI2A 2OL3A 5JW4M 3PAZA 2BVQB 25C8L 2CIIA 1LEGA 4F24A 1DSWA 2DIEA 2EYTB 1AC0A 3UTTB 2N59A 1GCYA 2WUBL 4LNRB 3ZZSA 1RURH 3UC0H 1JGLL 2LLLA 4HGKC 1LWHA 1TTAA 1HZHH 1M1XA 4PJ5A 1IGML 5I71C 1C5BL 1GHFL 3UOAB 1GW0A 1S9XA 1MG3C 1ZHKA 3MUJA 2ITFA 3MRIA 4OBSA 3TCXA 4BFGA 2X6VA 4I9WD 1PX4A 4EKJA 2JB5H 4F1ZA 3JWOC 3OKLB 1L7TL 1JV5A 2BOBB 3RFZA 4XPBL 3T1WA 2D7QA 1KCBA 4K3DL 1BJ1J 5DEFB 5BQ7A 1OE1A 2XZQH 2MSPA 4L0YA 3GKWL 4WHTA 4ORZC 4BH8B 4LQFL 2XZZA 3N43F 3QWRD 4PQXA 1Y1DA 1I3GH 2Z8SA 3CLFH 4WAFA 5EO0B 4GG6B 3SDYL 4QXTA 1E5ZA 2VERA 4KZDH 4JJ5A 3WFCL 4YSUA 3MLRL 2AC0A 1HZKA 3CX2A 4HXBL 1PKQA 4OM1H 5FO7B 4DQOH 4MNGA 1OOWA 1RHHB 2G2RB 3MBED 2KLRA 4PRAB 4WUUD 1GGCL 3DUUA 5DRWA 2OX5B 1QQDB 3AU1B 1CYWA 3X14B 1U3HD 4UZGA 1NIFA 1CMOA 2IH3A 3EOAA 2MPAL 3QIWC 3C6SB 1WT5A 4YHKH 1QNIA 3T0EC 4GFXA 3CFDB 3GBDA 1NOLA 3OKDA 3IAPA 5D7HA 1KPVA 4LL9A 2AK4B 1A7OL 2ZQKA 3W2DH 1KYOJ 2Z1PA 3BW9A 4LPWA 3FCUB 5E8EA 5H8DA 4H20H 4NRZB 4OCSH 3MR9A 4U6XA 3T1FB 1QSEB 2F8XC 3IGAA 2F9BT 3Q8EA 5ENWA 3OX8A 4GOSA 3IMRA 3BUDA 3NZ8B 1P7QB 3MJ7B 3MLSH 4WO4A 3L3GA 3QJQB 3QZPA 3U0TA 1CF8L 1SHSA 5M94B 1MXDA 4IK6A 5A2BA 4BKLA 1KTLA 5KVGE 4O02H 3HN5A 4D9RE 4M48H 4KO7A 2ETWA 1YJDH 3RNKA 4BRJA 1FL3B 1T7VA 2K1MA 4LPXA 2WZPA 1KGCD 3QULB 1K8IA 4Y7MA 5ID1A 3S5LG 5K9KB 3D39D 4G1EB 1HE7A 1WIPA 2WZ6A 1J11A 2PO6B 3WD5H 4HGWB 2VAAA 4XNQA 4BH7B 5KBPA 1JGUH 2AV7B 3K4AA 2Z34A 1MF2H 5B4MD 1V7NL 5D7JB 8FABB 1IE4A 3QULA 5I6OA 5JA8B 2HWZL 4PUBL 3MQIA 4MAYD 4PP2A 1P53A 3ZO9A 5FOBA 3UTSE 3MYZA 2YD8A 4R8WL 3PAYA 2EXWC 4J3OC 3LQAH 5IHLB 1EZLA 4XVUD 3PWNB 5TFSH 1NPJA 2EVGA 1W0VA 5GS3A 3VXMA 3B8SA 4JREC 5HYFA 2CA3A 3OGCB 3PXLA 4UZSA 3KBHE 3EYFA 5IEKB 5HI5D 4XPBH 1XGPB 5C6TL 2EILB 2XTJC 4H8PA 3RPKA 1KPRB 5F7YC 1BQHB 1KWKA 1DN0A 2BP5M 2V9TA 3QFDB 2A9AA 3FQWA 5E00B 3NOIA 2YMTA 4GI8A 2HKHH 1R0AL 4FQHB 4R7XA 2CLVB 3BUIA 1GYAA 3SN6N 1A1OB 2YAQA 4IGBC 4ODVL 4AQ8C 4UT7L 3DWTA 1I8IB 4EVNB 3M46A 1OM3L 3KPRB 3VFTA 1EO7A 2CXGA 3MLUH 3SCMC 3TV3H 1M6OB 5IB5A 1D6VH 3BT2L 1NDMB 1J48A 1OANA 4PRAA 1T5WA 1G0XA 5DD3H 2YXFA 1UVQB 5BCAA 4ZXBC 1U2CA 3QJFA 4FOMA 4IHOB 4LIQE 4R6UA 2VZTA 5DJ8A 5CFAA 3HE6D 3JV6B 4D0BB 4QAMB 1IEBB 2Y7LA 1NMAH 3W9EB 3L4UA 2JJTA 4Z9KB 1ZWIA 1VIWA 5H94A 4XPGL 1QLRB 3F85A 3UPAA 3HS0C 1A9VA 5KN5A 3DHMA 3US0A 1IC1A 5DLLA 3VFGL 2JIXD 3L48A 4P48A 2ZUSA 3CVHB 3FT2A 4MLIA 1EZSA 5D1QC 5D71L 3X3FL 4JM2D 4DCQA 1DQKA 3D6GA 4DP6X 3BH9B 3U83A 3W9DA 4R2GB 3DYMA 4K3EH 1RZJL 3CXDH 4JPWH 4K3JL 5BV7H 3OKNB 3MRQB 1AGBA 1HK6A 4PJ5B 1HC1A 4KO6A 4GXVL 4B7LA 3GI9L 5A2JH 3FO1B 3BO8A 3PWUA 3M7OA 4OLUH 4AK2A 3JWNG 1TZAA 4P5TD 3QHTC 5SX4H 1S7XA 1CIUA 4LAJH 1KIPA 1DANT 3RAJL 2ENYA 1OP3H 1VFOA 2P8PA 4NC0B 3WS3B 5IP4A 3KWXA 3ZRCC 4JN2B 1T4WA 1XHHA 3JZYA 1H3WM 3EJYC 3TS8A 4OZIA 3NCBB 3WEXB 2Y1YA 2P5WD 4BDVA 5GHWH 4Z7OB 1CC3A 1N64L 3X12A 2FECL 3DRQB 4LGRB 3ATEA 1KBBA 3NEEA 5CM1A 5FYLH 5IBTL 4RX4A 3UIZA 1KTCA 3WN5C 4AEHH 4NRXB 3OLGA 1NPNA 2OYPA 1LWJA 4JO4H 1ZJBA 4CC4C 4LCWE 1WAAE 2NOYA 2ADFL 4KKNA 3T04D 4AENA 2J71A 4KRMB 4QRRB 1KBKA 4NO0A 1A3LL 1F45A 4PJGE 1FVDA 5SWQB 1YUHB 4HV8A 3X17A 1KWGA 1YYLH 3FF8A 1S7RA 1QFUH 4NM4H 4ELMB 1JHLL 5EU3A 1OZUA 2EDJA 5IB2B 3D18B 1S7VA 1EJ6A 3KPMA 4NO3B 3VXUE 3I74A 1E9PA 5E6YA 1CIDA 1ADQH 3U9PL 5CNHA 1N5YH 1WSST 2DD8H 3UADA 1DBAL 2EC9U 3FO2B 3VMNA 4X4ZA 4ONFL 4JQVC 3VCLA 4DF9A 2YAHA 1DVXA 4YHYB 4P0DA 1DBML 4DH2A 5F3FA 1AO7A 5HI5C 2WLNA 3UBXA 4C4KO 2AJSL 3BT2H 2OM5A 1CXKA 1E65A 1IC4H 3B8YA 5B1KA 4MXQD 3VFOA 4D9LL 3IDIB 1CGSH 2NY7H 3AWEA 1Z3GL 3EH1A 2XG5A 1YNTF 1IEAB 1GOHA 1ZHNB 5A3IC 4N0RA 4PJDA 5CMAB 3IKKA 3ARDB 1CDHA 1NFDF 2BSTA 2YD1A 2P47B 1FNSL 5MP6L 2UWEB 4KK6D 1A22B 4TL5A 1NOAA 4X98A 4OI9A 4Y2DB 1DUYB 2VDLH 4CNIB 3PL6C 4U1HB 5KN5B 1NMBL 1R46A 3QORA 3T0XA 1RV6X 2QPFA 5DUPL 4R26L 4K8RL 3ULUF 3EF4A 4ZT1A 1VSCA 3D08A 5IQ7L 1RJZB 2R0KH 3ARGB 4WU7A 3IF1A 3F65A 3VWKA 3GKZA 3TONA 4HZAA 1JIBA 1Z0NA 3O3DA 4BZ1A 2NXYC 4MD4A 3ZE1E 3BPCA 1DQMH 1X5ZA 4AXWB 3WHXB 1PW3A 2C9UA 3D8MA 1BMZA 1DQDL 3P77A 4EZJA 3H9SE 4NFCA 3B9EA 4NENB 3SDDD 2RJMA 2BSSA 2J25A 3D2UA 4NAQA 2X4TA 5EF1A 1I8IA 3O6MH 4KMTL 1V10A 1UWXK 2V2XB 3O8XA 1J5CA 3QUKB 3MRFA 3X1GA 1FAIL 5G4MA 4NQCB 2FWOA 4M7JH 2V8LA 3N04A 4NRYA 2VR3A 4HUVB 2VDRL 2CLVA 4FP8L 1U8HA 3CVIH 4PBDA 2CWRA 4E9RA 1T03H 3BGMB 4G8AC 4PJGA 1IM9D 2GT9B 2AEQH 3FBKA 4L4JA 2P1YA 5BRPA 3FUEA 2OMZB 3UAJD 4DKAA 1TUPA 3Q8CA 1INQA 3EYVB 2XX1A 3QIWD 3T3PE 2A3TA 4F33A 5FA4B 1OVZA 3EYFB 5IEKA 1M2VA 3OGCA 3B9KB 1W0VB 3VXMB 1K9TA 2HRLA 3EXLA 2CIKA 3NJGA 1M2OA 2OL3H 4XOEA 4JQXA 1Q9LA 1RIVL 3LQZB 1NBVH 3QH3B 3SE3C 5GS0L 5C3LD 4DSYA 3ELAT 3CVDA 3MGOA 2EH8L 3TJEH 4Y9CA 3EJJX 2CGYA 4JHAH 2ZUYA 1X5HA 3S4SG 1F8TH 3CFNA 2XWRA 5EH1A 2UVFA 2PO6C 1QTSA 1KGJA 4GW1B 3SYOA 4OZIF 4J39A 3L3HA 5KSVA 5C0EA 1TJIH 1XV8A 3OSVA 2GTZB 1XGUB 2R7EB 4YK4B 3K72A 3KYMA 4A2LA 1U95B 4V1DB 3L5WA 3GDBA 4UILH 2IDSA 1VFAB 4L9LA 4AITA 5KAQF 5J4MA 1BIIB 3QG6A 3SGKA 3ARFB 1WFIA 4LKXB 1NIBA 2J8UB 3B2PA 1ULVA 4K23L 4DOHB 2F74B 4LL1A 3DX9A 5HDQH 5IMMB 3S88L 2EH7H 3MZGB 2IDUA 3GKWH 3UPRB 5DRNB 1F41A 1Q94A 5ERWB 2ENPA 4WFHE 2KLSA 5E6IB 1L0PA 2Q86A 1F4YH 2F5AH 4M6NH 5TDPA 2O5ZH 1CPUA 4LF3B 2X4SA 1EJOL 5DHYA 4GMSL 4ZPVB 3TPUB 2E9WA 2QSCH 3LEVL 4G6AD 3LQZA 3U9PH 1GGBL 3LRLA 3WENA 2CIKB 1K72A 3ZE1F 5CGMA 3DOSA 2PCYA 3FUDA 5I5IA 1D7BA 1N6VA 3CZJA 5KYWB 2FJHA 1LHZA 2Z7WA 1N3NB 1ASOA 4QEGA 2GEEA 5JZ7D 1Z5LB 5K93A 5CXPA 5E9DA 3QUXC 5GISH 3VXSD 2ZE0A 3PV6A 4ETYA 2XWBB 1XF3B 1NAMH 1UM5L 3BKMH 4PJGB 1WAAA 3WNLA 1QFWL 2WLJA 3LS4L 3VSTA 1EBAA 2EKSB 2VRKA 5ETUB 1GZPA 3V5HB 3DURB 3SBRA 4OLXL 3KYKH 3HS0B 2ALWA 5HJDA 1R6VA 3JYCA 1DO6A 4Z0XB 4ZODA 2VCOA 2VR8A 1P6WA 3PQYA 3T08A 2XZAH 1RJLB 3LJ3A 4UQEA 3WFEH 4F7CB 4OV5B 3M6DA 2OPCA 4JDVB 2YJLA 2VQ4A 4ABQA 4DP0X 5IESH 2DQ6A 1OWWA 4NJ9H 4N2HA 3WTVA 1TVBB 2DEXX 1T4KB 2PLTA 2QSCL 1PIGA 2R1XB 1I8MB 1GZQB 3GIVA 4LSUL 1BQ5A 3KBEA 1KC5L 4OLVL 2OK0H 5FGRA 2ICEC 2ZKYA 3HI5H 1U58A 3P2BA 2I7OA 5IFAH 2XG5B 1TZHA 4QRBA 1VGKB 1RZJC 4HIPA 1NWPA 3B9KC 4KBPA 1GC1H 1I8KB 3D87B 4FZ8H 5HJGA 5BZWB 3U7WL 5E9NA 1TTFA 2IOIA 3CLFL 3K8KA 2NY2D 4HWZA 1MJ7H 4LSRH 4UT9L 3HI1A 4HG4K 3N44F 3VB9A 2VTFA 5CEZL 1Y6KR 1N2RA 4IDJH 3V4VH 4I13B 2VL5A 3D3VD 4HIJB 1TQWA 4PJ9A 3F7PC 1QPPA 2AJVH 1E9PB 3GSQA 4NO3A 3UMTA 4L18A 1QSVA 1LO5A 3N1FC 4IRSB 2ARJA 2EE0A 4HOWA 2HLEB 3TYGH 3FO0H 2NTFA 3Q5TA 5I0DA 3G6JF 3HNVH 4MDRA 3LRSB 3TBWA 1E4KA 3T65A 1OGTA 2R1WA 1U91B 1Z6JT 4GRWB 1OO2A 4P3WA 2OMYB 4NC1C 1OKEA 1VA9A 4OQ1A 4XP4L 3TIDA 3UH8A 2DS4A 3AVEA 1WE5A 3ARFC 1TJMA 5GRXG 2MTPA 4GKLA 4TVSa 1PY9A 2R4SH 3GFUA 4PI0A 2Y25A 2H3NB 2Z4TA 3FQUB 2ZP9A 1AXTH 1VFBB 3NJKA 1KB5L 4LMQE 2O6CA 3CH8A 4Y19B 3SDXB 3PDDA 4RIRB 3T0BA 1JPTL 4NPJA 1I3VA 2XI9A 1Q72H 4KHXL 3L4CA 4ZFZA 4PGDA 5CN2A 3TVMD 1EK3A 1BDYA 2NY0B 4GQ9L 1Y1UA 4AM0A 5BZDA 2YZ8A 2FZ3A 3VD9A 1MCCA 1JGDA 1RJYA 1CE1L 3VD5A 3KM1A 4JRLA 5KWYC 2Z8WC 4OZHB 3RVTD 4LESA 3MREB 5I5JA 1XMEB 4G80B 5GGSA 3TBTA 3NZUA 1MN4A 1Z1WA 2Z3FA 1R47A 3NIFB 2DICA 4G6AC 3W9DB 3I6KA 2F68X 1FL5A 1M57B 2DQEH 3IE4A 1YMMD 43CAA 2X1OA 2XVKA 4ZNEA 3RKPA 4PHXA 5FO8B 2PYFA 3UTPD 4ZD3H 2D0HA 5FYKH 4R8WH 5FLUA 3FYEB 3NJXA 3PWJA 5E2WL 4DOHE 4S11A 2Y07H 1CE6B 4U3SA 4KI5E 4HJEA 1TPXC 4E36A 1WAAF 5F97E 3ENEA 2UY7B 4JG1L 3G6AB 3AABA 4UT9A 4JZJA 1F56A 3WMSA 3W2DL 2ICWB 4N3UA 5BOPA 3G5XB 2GIYA 5E0FA 4Z7WE 3QIUD 3GM8A 2BIOA 3TA3A 1EEYA 4YE4H 3BAEH 2OR8A 2BIMA 4Z76A 3LZFL 5J13C 1M6OA 1IJ9A 5B39G 1YYCA 1XWVA 3B9DA 4UT9H 3IFNL 2VMJA 2WPGA 2OXHB 1N8OE 1Q0YH 1KYAA 1ZDQA 5HHME 5L2JA 1C7SA 4R4ND 4DKFL 2NY4B 3A4FA 2IBZY 4A39A 1W0WA 3QCUL 4MJ4A 1ADQL 5GJSH 5AENA 8PAZA 2EH8H 4R96A 4R97C 4ZO8A 1TXKA 3TJHD 1JNHB 3WEOA 2AK1H 1XSJA 5EBGA 3O9WB 2IANA 3UTTE 2WQXA 2H4EA 3LVEA 4Q9QL 4KKBC 2B16A 1S7UA 3GS0A 4DP2X 4A7GA 2WBKA 5L2KD 2A74B 3J2PA 1EA9C 5LWYH 1CWVA 3QUXA 4NP4H 2JF1A 1LP9F 3OJDA 1RFDL 3E6HB 5G2NA 3ZKND 4TVPD 4CADB 1L9TA 3G6JB 1NGWA 4DPAX 5C3IA 1F4XL 1HHHA 5LGYA 4XMKH 1UJ3B 4U1MA 2Y5TB 3CFCL 4X5PA 1CO1A 4FQ1L 5LBGA 2FJFB 2UXTA 1L4IA 3F2LA 3WXVL 4NNYB 5DS8A 4PP2B 4DZ8B 1QEWB 5IWLC 4HD9A 5CD3A 5I8CB 2G0KA 1A65A 1EANA 4HX1A 2W65B 8FABA 4PS3A 2X42A 4QF1B 3VSQA 3ZSSA 3VH8G 5EU5B 2UZYA 1Q72L 1DFBL 4HIEB 5A16B 3S35H 1I3RB 2FE0A 4AMKH 3FS9A 3QUMH 3ULUL 1D6EA 2VQ1A 4PJBB 4KRPD 5EOQH 3NK3A 1LMKA 5I8CA 4KZDL 3ATDA 1KCWA 3LIZL 1MG2C 1NCWH 2MQ0A 5DS8B 2YN5A 1KELH 4BELD 5FPIA 4PTUA 3MJ8A 3MX0B 4XBGA 2A6KA 3SKUD 2IXQA 2YEQA 4XBEH 4HAFA 4ZX4A 2HFEA 5DJ2B 5F1NA 1ZLWK 1RUPH 3GZKA 1ETA1 2V9UA 4NN6B 1TF4A 3QUMA 3D1MC 4QTHB 1ZLSH 3PDGA 4MB3A 2V3DA 1ORSA 4OD3L 5I8EB 2A74A 1B4JL 3KLHD 2DBLH 3U6XA 3L5IA 3N44B 3OKYA 1AD9B 1DQLH 4OFQA 1XCTA 4U6XB 1KENL 4C58B 5LQBL 4FD0A 2ATPA 2EIJB 2DWEA 4L8DB 3BW9B 4F2MA 5A2KH 1W6LA 2YC1A 1MCKA 1HL9A 2WNWA 3G6DL 1Q9KA 1E6OL 5HHVH 3MRKB 2F8OA 5F1IB 1UB6B 3NIDE 3ZDYB 1KT2A 1DBJL 5CEZE 5L0QB 2BVOA 3EJTA 3FB8A 5AEAA 3TO4B 3HG0A 1K5NB 2PXYC 3JWOH 3UO1H 2Q3ZA 1F4WH 5AYUL 1T6VN 2ZOTA 3BP5B 1WWCA 4LSQL 3HC0B 1ACZA 2EXSA 3WUWB 3DK0A 3ES6A 2CM6A 4QI3A 3MKGA 5I1IL 1WICA 4NKMB 3TN0A 1Z9SB 4K71C 4JZJB 1O7VA 3E0GA 2XFXA 2I69A 3VFSA 1AANA 4HISA 2VITA 4FFTA 1O6TA 1PX3A 1OGAD 2L8AA 1CI5A 3POHA 1D5BA 5FYLE 5AKTA 2NY6B 3SGDH 3ARBD 2JCCF 4GY4A 4M00A 5IT2L 1N19A 1QYGH 1DJHA 1KG0B 1SBSL 2E76C 3QDJD 4U1KA 4E9VA 1JK8A 1MIEH 3B2VL 5KYXA 3EJPA 2YRPA 5F72S 5KJ4A 1ZA3B 3MXVH 4GXUM 2BHUA 1S9XB 1CBVL 1BFVH 5FFLA 1RU9H 4P2QB 3LQAL 4U6TA 5D6CB 5IW3A 4LP8A 5C0DB 2MNUA 5I1HL 4ZUVA 1T1XB 2KI6A 3CC1A 4CGTA 2EDHA 2NY4C 3I6SA 4NSKB 4GBXA 3LHPH 2CKBL 4DVBA 1URLA 2J8UF 5GGUA 3WFHA 1E4JA 4XOCA 5D1QE 3PGDA 2I24N 5FF6A 4P3CH 2AJVL 3BN9D 2ICES 4FYTA 4YHYC 3DETC 3OTTA 3FPYA 3Q13A 4WFEE 1JPEA 3MRHA 3LQMA 3M17B 2GKIA 2RIKA 1G7LB 1AI1L 2X1XR 3FHQA 2PCPA 2VDRH 1J0HA 2J44A 4F15C 4JK0D 5IIEB 5JQHC 2R0WL 5EG6C 1JAEA 1JZHA 3H2QA 4F58H 3ARDC 4W70A 2GG1A 4TSBL 3A47A 3GS4A 3GSWB 1F42A 5BV7B 4JG9A 4ODWB 1T21B 1A0QH 3JWNE 4X6DF 1EZUA 1SOSA 4HOZA 5I1LB 4Q0XL 3EOBA 4GW5B 1UOKA 2H1PL 4OCWL 4JFEA 4JJHA 4XPGH 1A7OH 3HE6C 3QNFA 4PD4K 4KRLB 4ZTOH 2VL5B 3JYBA 3QRGH 2IFFH 1W72A 2R1YB 4X6CA 3HR6A 4W6YB 2PKDA 3IXAB 4QRQA 5EO9B 3UJTL 4PIRF 1IEHA 1UA6L 4PP1D 4KY2A 3QDJA 2V5TA 5MHSD 1MFNA 1T04B 1EEUA 5JPMC 3QPKA 5DO2C 3RTLA 1WIOA 3FTYA 2XWJA 2FEDC 4NKIH 3VXMD 4ZAKD 1UWFA 4U33A 2EP6A 3QI9D 1VGKA 1SMOA 4H26A 4XBMA 5LKNA 5ICUA 1DQTA 3WL9A 4HHAA 1GRWA 3QRFM 4FXKB 1T6WA 3BHBA 1MUJB 4FERA 4L8SB 2MCAA 5HDOA 4CW1B 2DLIA 3VFMB 2RMNA 2Z35A 4AJVA 32C2B 3DGGB 2JKWA 2JCCE 3VH8B 4GAAA 2WXKA 3OG6B 3L3IA 5DHDA 2LE9A 1BVNT 3ME0B 5F21B 1U4FA 2HN7B 4OU3A 2SEBA 1LO4H 3DROA 1CFSB 1PEWA 3V6ZB 1A9EA 4X0KA 1TVBA 4ESKA 1L6XA 4FTDA 2A4ZA 3CHRA 4V11A 4ZO7A 1I9RH 2L0DA 4XMZA 1D7CA 1ZT1B 1E90A 2WLLB 2Z8RA 5KANG 2WQSA 4Z8FH 1CD0A 2G60L 1BYOA 2Z92B 4LCCB 4XBPA 9CGTA 5D93B 4OF7A 2IG2H 1YEIH 3QXWA 4FLSA 3U2SA 3OPZH 1BREA 1JK9B 1VACA 1KB3A 1A6VL 4HUMB 4KJQD 4MASA 3GHBH 2MHAB 3FQTB 2B3IA 1JD9A 4FDWA 2J8UE 1G6RH 1T83C 3G08B 4XI5C 2VISB 1H5BC 4HK0A 5HGDB 2IGTA 1TIUA 2WXFA 1EHAA 5HYJE 3KLAB 1TTCA 4UTAH 3N42F 4MGXA 4U6HA 5IMLA 3ARBC 3QSKB 3L1FA 2DQUH 3G7TA 3MV9A 5EF0A 1Z5LA 3A23A 1R3HA 2RBLA 1S7SA 2BVTA 2DLFH 1PSKL 1QATA 3PJSB 1EHKB 3EH3B 2A77L 1P4BH 4I0PB 3GSOA 3QR1A 4PBVC 4XHQA 3AREA 3IRCA 1DLHA 2EYRB 1W72L 2FSEB 4OJAA 4W1TA 1S3KL 43C9B 3APDA 3RJDA 3FOMB 4YNYA 2EYSA 4K3JH 3DIDA 5BV7L 1OD7A 3VFWA 3ARWA 1AKJA 1D5IH 4NKDA 1WFJA 5C0CB 2K7PA 4BA0A 2GUYA 3FT3B 3T6QC 3QS2A 3US9A 1ZY9A 5GZNC 3ZMNA 2XFGB 4LU5L 1UWEH 2FLMA 3ZQWA 4X83A 4H40A 5IMMA 4EI5B 3AY2A 5B38G 1GTFA 2YJQA 3RWGB 4RMUA 2JKXA 3HJ0A 5I73C 4JFZL 1T20A 3RG1C 3LEVH 3CZKA 2NY0D 1AY1L 2WTRB 4XP1H 4UQ9A 3VTMA 1RUPL 1OCWL 4XMWA 1H19A 3QI9B 3OKKA 3RZWA 5AW5B 4ZAKB 1HNYA 1E4XL 3GSUA 3MROA 4YDJB 3RWGA 2COVD 2CDEB 5DD3L 1BOYA 3BYTA 3OKEA 3K46A 1GGIL 5A2FA 3VFNA 2AQ1A 1WK0A 5F7EH 1HJBC 3AMKA 2P5WB 3JZ7A 5LXGH 4OZFA 2FWSA 3IJEA 2ZSVA 5GISL 4R7VA 1NAMA 1OARL 5IJVA 1AHWB 2A6JB 1PZ5A 1TJIL 2VDPB 4R7LA 4AC4A 3D0LB 3RIKA 3I84A 2CO6B 3H3BC 4P9MH 4KTYA 1SJEB 1TYJA 2XVGA 4QD2E 4IRSD 4TKWA 3V0EA 1GGYA 2BFGA 1UA6H 4LVEA 3W3BA 1E4XI 1ZRUA 5JW4Q 4G83A 1RURL 1EQWA 1KJVB 2HSIA 3QCVL 3UC0L 4N0FA 1NUDA 2BWQA 3LEYH 2ATAA 2QMKA 5EIIG 1H3GA 25C8H 3V5DA 4A66A 4Z95H 1MVFA 4RA0C 4H13C 2YUVA 2PR4L 3TA3D 3HZ3A 4AWJC 2HLFD 1V27A 2JIXB 4XGZB 1G6RA 4O58H 2FYYA 1OAUL 4NUJB 2FWOB 1EDHA 3UGUA 2DLTA 4EDWL 2DTMH 4JGNA 1CU4H 3CPLB 4UT7H 3AXIA 2JLLA 3KYOA 4JHZA 2EXYC 1M7IB 3VJ6B 1Q9OA 1V3KA 2YHGA 2Q87A 3IKCB 2YBRA 3SKOA 5K9JH 4BGDA 3HE6B 4NXKA 3K6IA 4CJ0A 4AZ8B 1PD6A 3VFPA 4MD4B 3PABB 4GRWE 4PV1C 4NQVA 1ND0A 1WH0A 4PJFE 3T4AC 4FG4A 2J43A 4RQQB 3V7AG 1XR8B 3OB0K 1R3JB 4KXZI 1VCAA 1JFHA 3NCMA 3P9LB 4HKZA 4FKKA 15C8L 3D12B 5DJAB 4ALAL 1ZSHA 4FE9A 1QRNA 3PWLA 3HR5B 1AMYA 4M48L 4RGOL 1IGJB 2R56H