3QZBA

Crystal structure of a putative superoxide reductase (tm0658) from thermotoga maritima at 1.10 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
131
structure length
131
Chain Sequence
b'MKLSDFIKTEDFKKEKHVPVIEAPEKVKKDEKVQIVVTVGKEIPHPNTTEHHIRWIKVFFQPDGDPYVYEVGRYEFNAHGESVQGPNIGAVYTEPTVTTVVKLNRSGTIIALSYCNIHGLWESSQKITVEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative superoxide reductase
publication title Crystal structure of a putative superoxide reductase (TM0658) from Thermotoga maritima at 1.10 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
total genus 28
structure length 131
sequence length 131
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2011-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qzbA00
1DFXA 4BFFA 1DO6A 4BK8A 4BFKA 4D7PA 2JI3A 4BGLA 1DQKA 1VZIA 2JI1A 1VZHA 4BRVA 4BV1A 4C4UA 3QZBA 1Y07A 2AMUA 4BRJA 2JI2A 1VZGA 2HVBA 1DQIA 4C4BA 4BFJA
chains in the Genus database with same CATH superfamily
3EGXA 5IB3B 3U25A 3NPSC 3BIKB 3II2A 3TV3H 1T2QL 3E6FB 4UZUA 1G9NL 4F7TA 3NZUA 3NZ8A 1TYRA 1BBJB 3DARA 1SYSB 2AJZB 3QUXA 4HWBH 1UOVA 3EFFA 3CVBA 3ES6A 5L8KB 4M93C 1YMHA 3ARVA 4LVHC 2KHAA 5JIIA 1ANUA 1XO8A 3W2DL 5L0QC 3CSFA 3F7KA 2PWHA 5ABDE 4CNIB 4W9HC 4EUPH 1G87A 1XXDC 4PTTB 3BN9C 2AXFA 1EEYB 3C2AL 3CVHA 4ZMZA 2MQCA 4XMWA 3UPRA 1T20B 4LASH 2XN9A 4KNSA 4RETB 3S8WA 3TFKC 2ARJA 2FLBT 3BD5A 5JXAL 3FOLB 3CSYB 3F12A 3OKKB 3WN5C 3CC5A 1MFAH 3FT4B 4YK4B 3G6DL 3UC2A 1L9NA 5D5MB 3HE6C 1XBDA 2P24A 2OR9H 4MMXB 2YOCA 4CRPA 2VE6B 4PN6A 1RUML 5AZEL 1FQ9C 3IAQA 1O7SA 3RY5A 3A67L 5D93B 1JP5A 1K4CB 4OT1H 4NQSB 4YLCA 3VWJC 1UCBL 5TDOA 1X6NA 3MFGB 3OX8B 2ZOOA 3AWEA 4H44C 5DSCA 1P7QD 2ZJSH 4A7SA 3GLZA 4M6NH 4NRXA 3WOVA 4P23D 3UXFA 1YPZA 3WFDL 4U1KB 3SDCB 4HD9A 4OLYH 1AHWA 3TBWA 4ONGL 1QSFA 1A6AB 3TXAA 5CLYA 3C5ZA 4L9LA 4B3VA 2V8LA 4F8PA 2G30A 2AQ1A 3A6BL 5DLLA 2P5WA 2CDFB 4FKEA 3FRUB 4NYLB 3W37A 1OAXL 3VXQB 4PJGF 4XXCC 4OM1L 3TA3B 3K71B 4NHUA 1BZDA 4JL1A 2YMXH 3H8NA 2XETA 1BQSA 3P2DA 2YARA 5BZXA 3MBEB 3QJTB 4FQLL 2DQEL 4OTXL 4DW2H 5I2IB 1KJVA 1DANU 3EJTA 4P57A 4AOFA 4WGWB 2WXLA 5ELIA 1TCMA 1KCVH 3BOVA 3BX7C 3FBQA 1ZHLB 4WW2F 2FR4A 4NP4L 3BP4B 1T5KA 4ODHH 4OLXL 3SZKC 2VDKL 2MFNA 2GAZB 1OGPA 3IM1A 4HUXA 5I6LA 4AEIH 3SJVB 2DYSB 4L5FH 3QRLA 1JERA 4FYTA 2J8OA 4NKQB 4XCEA 5T3XE 3V6OA 5KVDH 4LPTA 3LEXA 2EE0A 1CICA 1E4WH 3O2WH 1IGFL 4ZT1A 1CE1L 1D5BA 4BELD 4O5LL 4NT6B 3K1DA 2CGYA 1TUPA 4KZDH 3AGWA 3F00A 3M6DA 3I3BA 4L1HA 4E2OA 2AGJL 2RJMA 1W8EA 3QUZB 4N8VA 2B1AL 2C1PB 1A1MA 4HC1H 3O4OB 4BH8B 1KT2A 2C3XA 3EOAA 1AD9B 3UZEC 1SLVA 1SRDA 3BAWA 4YHML 1R5IB 3ARGD 2LU4A 5GGTL 1S7TA 1N3NB 3UTSA 1A02N 1AZCA 1S5IL 2DOCA 3QHFL 2VDPB 4QAWA 1E67A 1IC0A 1KCLA 1A7QH 1WD9A 1D7BA 5CFHA 3CSGA 3MXVH 3JSSA 1H15A 2PWDA 1UT9A 1YEHL 2GSMB 1JGDA 5IHHA 1MXGA 3VWKC 4P5TB 2NY6D 3CLEL 3LD8B 3GMNA 1PY9A 1T2XA 4ZD3L 3QIWD 4UOW1 1ODAA 3UCRA 4PJ5B 3OJMB 5FYJH 3VB8A 3HI6H 5ECGA 1ZHBB 4KK9C 2CMRH 3KCPB 3ESOA 1PZ2A 1PBYA 4KVNH 2HJFB 3IMTA 3VFOA 2HLFC 3LQAC 4B7IA 2FWUA 3WDJA 4RFOL 5AKVA 5I1HL 1AD0A 1F3JA 4GAGH 1RJCA 1JCKA 4TUOA 4O9HL 4Z7NF 5GZND 3V7MA 3OBAA 3I50H 4MA7H 5IJCC 3L4ZA 3MRFB 1IRAY 4YHZH 1HKLH 4YX2L 4W9CC 5E5LA 3ZE1F 1ACXA 4G8AC 3DRQA 1UTDA 4KOBA 4P2QB 2FO4B 3DO7B 4HSCX 4NXSA 2DPKA 1T1ZB 3I2CL 1UD3A 1RV6X 4PUBL 5CP3A 3RL2B 1KC5H 4K9EL 2J43A 2Q7NA 1ZK9A 3A6CL 3MLRL 5CNHA 1TZGL 2NY3D 2AJXL 3FQ4A 3Q5YA 1DEEB 1A4BA 1EUTA 4X9BA 4Y16B 1NGXA 3DHPA 4TN9A 5F89A 2J73A 3RBSA 3V5HB 3QQDA 1WZAA 3PLYA 1A7RL 2ZXBA 5DA4A 2DQDL 4ATTA 4PVMA 1XGRA 1IAOB 2YXWA 5D9SA 3TO2B 5JW3H 3EJRA 4GT7A 4KDWA 3ZX1A 1G7JB 1S9WB 2G75A 3PJSB 3X1FA 4X50A 2Q8BL 3D39E 3DIVA 3S2AA 4Z7QB 5KJRH 3UFIA 1XHHA 4PJDE 5DD1H 3NJXA 4N0CD 3FPYA 1YNTA 5E0FA 2XG4B 5DC2A 5E6IC 3EYSH 5AW7B 1NMAH 1NFDF 4XNYL 3FQNB 5FUZL 1KLGA 5GSVA 5F7BA 1NGPL 2WSPA 4OGZA 2DH2A 4C4KO 1CFSA 4ENZA 1MG3C 4M48L 4KVCL 4QY8B 4U31A 5DHXB 4ZMAT 1I1RA 4WK2B 1UVQA 2D7NA 5LCVL 1KPRB 5I8KL 4Y5XC 4HXBL 3VA2C 3US0A 4AC2A 5AAMA 5IKCB 1ES0A 4K7PL 1CZ8L 2K0RA 4WRLA 2YPKA 1YC7A 3NCJL 1OE3A 3UADA 2FJSA 3L5JA 2VMDA 2F18A 1ZA6A 3ARFB 4FMKA 1LYQA 4TNEA 4KXZI 3D48R 2R7EB 4JX0A 1HWWA 3TPKA 3KLHD 3GBEA 1YEWA 1FFOB 2AMUA 1N5YL 4W81A 4MZIA 1X7SA 3Q48A 1IAIM 1IO4C 1S3KL 1IM9A 5KSAA 3L4YA 4G8GE 4WHYH 4GKLA 4H8WH 1PD0A 3FU7A 1EVUA 5CZXD 3S34H 2OTUB 1ZDSA 2JJSC 2QLVB 1B6DA 1W0WA 4RGOL 4V2BA 2Q20A 3FAWA 1WC7B 3OAUH 4PJ7B 4TVSa 1KGWA 2WK2A 3QI9A 4PJXF 1G6VK 3H7BB 5FM5M 3SEPA 5JPNA 4AQOA 3CFNA 1MEXH 3QZPA 4PJFB 4X4XA 4LQFL 4WLCA 2WXGA 4FFZA 3WL9A 2E56A 1IKOP 2EYRA 3TLRA 1MFCH 1KCBA 4PJ8C 4CW1A 4JY5H 3SE9H 1OTTC 4WFGD 2V17H 4X4YB 5JZ7D 1T4KB 1WTGT 2X05A 4DK6A 1C5DB 2XUWA 4LSPH 1G94A 5DVMA 4L8DA 3LS5L 4JAMB 32C2B 2VL5A 1U41A 1QLEH 4A7UA 2XG5A 1JYXA 1UUNA 3GXMA 5F1IA 3BPOC 4Z8FL 4Q8BA 1ZE3H 1MELA 3LV3A 1VFBB 1CURA 2EDTA 4HISA 2ZWNA 1OE2A 5IT2H 4X5WB 4KRMB 2MNUA 4F7CA 3FUFA 3I9GH 2AXWA 1F11B 1LEIB 2BJMH 3B3BA 1TNNA 1OCWL 2IPUK 2PCFA 2ZOUA 5E1HB 2X6MA 5DJ2A 2XOTA 5JIKA 4XHQA 2TRHA 4QAMB 3LNDA 2VXVH 3DUUA 2QKSA 1GOFA 1Z3GH 3IE4A 4XMLH 1NWOA 3LMJH 5C1MB 3AITA 2X4RB 4HKXB 2RALA 2XQYK 2XKNB 3JWNC 2HRPH 4GP5B 1X7TA 4ZXBA 3JTSB 2I24N 4G43B 2X10A 1A6VL 4QRUA 4NUJA 4ORGB 3PDOA 1IAKB 3BIKA 1EAOA 4N5ED 4XCYB 1JGVH 4D9RD 4IBYA 2RAMA 3ZHLA 1I8LA 3CZSA 4HAGA 4ZAKD 1SYSA 3QEHA 2EDMA 1SY6H 3OKNB 2DEXX 4P04A 3EO9H 2A6IB 3HIZA 1RURH 1SXSA 4AEFA 2E59A 4LLVA 5FKPB 3V7AG 4Q2ZA 4XP1H 1KV3A 4LIQL 1LEGB 2CPUA 4XZUB 1UWYA 5DZLA 3RA7L 4C4KT 3GDBA 4FXGA 4JM2A 1T66D 4JR9H 1U8LB 4PTTA 3BUIA 4ZFZA 2WVUA 4YC2C 1UWFA 3ETBF 2CUAA 4X9IA 5GS2D 1RP9A 1TZ8A 3GHEL 1ZVSA 3RWHA 5J6SA 4JFFB 4HLJA 2PP7A 5ICZB 2AZAA 2JJVA 3ZZQA 2NNFA 5MHSE 5D1XB 1MAKA 35C8H 3BFQG 3FMGH 3V4VA 4WENB 5D5MA 3ZZ1A 4L37B 2MPAL 5AOIA 5FLVA 3JWNH 4F7KA 1D7DA 5KSBF 4LKCB 1K4CA 4P2RB 1WBXA 1YN6A 1N26A 1B6UA 5TTRA 2FJGB 1JGIA 2PXYB 3EFDH 2E6JA 1J9TA 4GMSH 3VXTA 3KE0A 1QTSA 5I1AA 1D5MB 3LRKA 3DOIA 3VXRE 4NQEE 2LLLA 3LZFL 1E8ZA 1AO7A 1V7NL 2AEPH 3RDJA 5I1CL 2M26A 3B2VL 4QHMA 3MBXL 4EJ1C 2CDFA 5F7EL 2GEQA 1R0AL 4F3FB 5AVVB 5EIVA 5A2AA 3TA3A 5EOCH 1I7ZA 3KPSA 2CJTA 5I24A 5ANHA 5L2KD 1E28A 4NEHB 4N2MA 3MBEA 5CJXC 3B1TA 1M71B 1ADQL 1PZAA 1NCAH 1AQMA 1BEXA 2FX9L 5DC9B 1V10A 5JPMC 2Y06H 3P11L 3RZCA 3V4PL 3BP4A 4P2OC 1JPEA 5EF0A 3D3VB 2W0FA 3ARQA 2GAZA 2JJTA 4E36A 2P3YA 1MFMA 3KWVA 2YQ2A 3D34A 3SJVA 4IU2B 4G9DB 1MKFA 4Z7UF 1HDMA 4UQ9A 1L4IA 1KIUB 3IPFA 1BQHA 5JW4Q 1N8ZB 2WKLA 1BM3H 2W1NA 5GGRY 1ZGLP 3EJYC 3T0VA 4RESB 1J0ZA 2O6FA 3GO1L 3PP4L 4JKNA 3WMPA 5DWUL 1O0VA 2HN7A 3BN9D 1QR4A 4APQD 5T3ZD 3WD5H 4QOKB 3TFKD 1N4XL 3QWRD 3QUMH 3STZB 1L7IH 1AD9A 4L8SA 1AXSB 3PWVA 1R5IA 2BSSB 3U36B 4J6IA 1WAEA 3HE6D 4ZBJA 2BNRD 3MNVB 4U3XA 1C5BH 5HGHB 1QABA 5E08H 3ARTA 4GFXA 4WI0A 3VWJD 4P5TA 4ATWA 4P2QE 1RL1A 4NAJA 3RB5A 1DBJH 4OCWL 1EGJH 2K6YA 3E6HB 3CXDL 5C3IA 4PJ5A 2B9AA 4Z95L 1L7TL 2XYCA 4E9SA 1ZHBA 1WCBB 3KXFD 3KCPA 1GZPB 3BSZA 2QELA 2IFFL 5D7LA 4E9RA 1J5IA 4G7RB 1I7TA 4Y0GA 4C8XA 3GIVA 4KTDL 4XN7A 2ZCHL 1H8OA 2DQUH 3AY2A 4WAFA 3GZQA 4Q9QL 1QI4A 3FC8A 2CO4A 3MV7D 1HINL 1XD1A 4IRSA 4WFEE 3ECBB 4ODVH 3BE1L 5HDBB 3S6CA 2EVGA 2R4SL 1FP5A 3INUH 4TLSA 5JIQA 1MFNA 3U82B 1SEQL 5GJSL 3WEMA 4YHOL 2A6KB 2J44A 3DVGB 5AVXB 4P2QA 1LO2H 2OYMA 3FZUC 4DGYH 3CZGA 3EG9A 3FU9A 4U1NA 1EH9A 3TU6A 1YVLA 3SD2A 5FYJU 4FQXA 2CO6B 4JQVC 3ULVL 2Y22A 3N1MC 2QV4A 3OKLA 3D4YA 1FGVH 2YKLH 4MWFB 4PHZA 2G5BA 4GSDL 4DKDC 1CVRA 1I8UA 4PVLA 3QPXL 1EJ8A 4Y16A 1M3JA 1ZDQA 5T1DL 4Y8AA 3U7AA 4IRJB 3UIYA 4F33B 2R59A 4MRCA 1DQJB 1EMTH 3TO2A 1QFHA 3QARA 4CL7A 1X9RA 1H8LA 2DYPD 3U7WH 4XX1E 3NRFA 5BZDB 2P7TB 4S2SB 4DP0X 2BFVL 3PJSA 1CGVA 2JTYA 5C8JB 5CEZE 2OJZH 4MNHA 5E2TH 1NH6A 1YJDH 1WJ3A 3MLXH 5HYFA 2XG4A 3OR7A 5IJKC 2KPWA 4JFED 5L4FA 4OQTH 2Y7MA 3VG9B 2FT7A 1WWBX 4EIGB 1XVSA 4U6VH 5E6UB 1CF8L 4UDUA 2WQXA 1V3LA 4AQ1B 4PJ7E 5HI3C 5C86A 4PS3A 1IC5L 2YMOA 3N43F 1T2JA 3VWKD 2F8XC 1ZHKB 2XNAA 4PJFE 1P7KA 1BECA 3NZSA 2FIKB 1RZIA 3IXTA 2CNYA 4L4TB 3SGKA 5JLZA 4J3VA 1P6AB 3PUCA 1M7XA 3B7TA 2BY3A 4QDGA 5IR1B 1HN1A 3LZQA 4ONHB 4EVNA 1HXMB 2UZIH 4WW2A 3RBGA 4JZJB 2NLJB 5CEYB 4KK9D 1KY6A 3C6LD 1QFWH 4Z7VF 4UILL 2FYYB 3H0TA 4OUOA 2GG1A 3NG5A 1YRKA 1PW3A 4MQXC 4BA0A 4ZFGH 4Z7WA 1EA9C 3V8CA 4XP6H 3QSKB 5DO8A 4OJFL 3W0WB 3ARUA 3U46B 2Y1AA 1C08B 1EDHA 4JO2H 5HDWA 4AVKA 2VDLB 4PJ7A 2JJWA 1BQKA 5BUPA 3JTBA 2DTSA 3IN2A 3SZ6A 1D9KB 4Y2OA 4M43L 1HAUA 3IETB 4C4UA 3U4EB 3QIBC 5C0IA 5IGXH 5AW9B 2Y36H 1DZ0A 5SWQB 3B2DC 2OXHB 2VQ1B 4X9YA 4FTVB 4HDIB 7FABH 5DLMH 1U8HB 2A77H 2YD7A 1QUPA 3RFZB 4RDBA 2E7CA 4UM9D 1MCOH 2EH7H 3IJ9A 4HKJB 1VPOL 1UJ3B 1T4KA 3FRPB 1EXGA 1LO4H 1UXSB 2VXQL 2F08A 1J9QA 2X41A 5FM8A 3O8XA 3DYOA 5T1KA 3MGAA 4XNAA 1L0QA 5IHUL 2N3JA 3TBBA 1CDJA 4IOSD 4PREA 4XT1C 3R8BB 2EO9A 4EN3A 4I7ZC 4F37F 3UO1H 4PJ9A 3EUUA 1KTCA 5EC1A 4MGXA 1MAJA 5JIDA 3AB0B 2CLZB 4F37K 4YOKA 2WPGA 4P9HC 4YSAA 1G7LB 1Y6KR 2H4EA 3QPKA 4GRLB 5CGYD 1E9QB 2Z91B 3IJ8A 1KJ2L 5F3HA 1NCUA 4UOQA 2HT4D 4OFPA 3B2MA 2A7BA 3TN0B 4HS8L 4JW3A 1NPNA 5ALBH 2FJFA 1B0RA 5F1SA 3GSRA 2GSIA 2A4ZA 4NM4L 4PS7A 5HDOA 4EUPG 2Z8RA 2QEJA 4IBVA 1BFTA 2R2HA 5C09A 4K5MA 4QHUB 5CIPH 4RBPK 4C4BA 2NNXA 2P8PA 2ZXGA 3C60B 2X4RA 3FU0A 4GSUA 4HKXA 2KLRA 4P5MB 3RU8L 3KLSA 5EU7C 4JFSA 4M1GL 5I9QB 2O61A 2GT9A 3JTSA 2W80C 4NOBA 3TC9A 4EI0A 4JFFE 1OARH 1Z9PA 1SDDB 4JM4L 5D1XE 1IAKA 3SDAB 4YUEH 3KR3L 2EUXA 1CMOA 1XBRA 5CSBA 4LF3B 3MGTB 2E27H 1I4FB 2EABA 1KOAA 4PWHA 1XSJA 4P2RE 4R7DB 2HVBA 2A6IA 1YN7A 4OZGB 4P9HH 2E74C 3UBXB 3KYKL 5FKPA 4GAJH 5HGBB 3WIIH 3PDGA 3BW9B 2GHWB 3TV3L 4HJSA 2J20A 5A2IH 2I27N 1OLLA 4L3FA 4NKDA 1WZ1L 2OSWA 1TTBA 1U8LA 1TTCA 3ABZA 3QCVL 1EAPB 1BOYA 2JLPA 2J6EA 2ATKA 3GS7A 4GINA 4MCZB 3WMQA 1DUZB 2HTLC 3ZBMA 4DEUA 4K8RC 3MRQB 1A3RH 4PJ8D 4UF7C 1LJMA 3UJIL 4DKTA 1U95A 3I6LD 1OTTD 2PPCA 4J23A 5C0BB 3QZWB 3KLAB 3QZOA 3CFDB 3HRZB 3TFBA 1AR1C 25C8H 4LKCA 3PWLB 4F58H 5SWSE 3ZW3A 2VSCA 4XCNA 5DJCB 3BH8B 4OV6F 1H3PH 2QSVA 4NRYA 4U1MB 4DKFH 2NY1D 4O58L 4NQCA 4WTZA 3V0WL 2BVPA 1VADA 4QRPB 1ZSDB 1B2WL 4O2CB 5HHVH 3D3VE 3JVGA 2XHNA 4HIJA 3V4UH 1D5MA 4PJEB 3VFGH 4ODWB 4BZ2L 3C8DA 1JYVA 4JDVB 3ECWA 4E0RA 4PJBB 5TE7H 2B1OA 1NAKH 2VNCA 1O6SA 2GJ6D 2AC0A 5D55A 2D31B 3QDGD 4AQZA 1NCTA 4Y19B 5E6YA 3L1OL 2QKIA 2J21A 2Y23A 4WHTB 4Y4FB 3H9ZA 4PH8A 4PJXA 5KYYA 1YNLL 5CCKL 2BXZA 4OH2A 2J5LC 4QOKE 1M71A 2WUBH 1CO1A 1UWGL 4JE4B 4KI5F 4CVXB 4I9WE 4DUXA 1NBQA 2NUTA 2B08A 4N28A 4UQIM 1JTOA 4W6XB 1JVOA 1TVDA 3WNKA 5J13C 2B0SL 5T3ZL 4XPGH 3G5XB 2YMXL 1KJMB 4ERSL 2Z0BA 1NIFA 1HNYA 5DQDH 3UYPA 3OVUB 3D69B 5ESQA 4HHGA 3BPCA 4G9DA 4U6HA 2FBJH 2R39A 4XOAA 1KIUA 3QIUB 3G6JA 1CFTA 2Y1ZA 3TJHC 1CCZA 5FOBA 5BS0B 3AXHA 1DJGA 3NFSL 4JVUA 1LDSA 2DLEA 5LB1A 1LVEA 2LQRA 1HXYB 1YEGH 5JXEA 3UAJA 1WEJH 4N0RA 2BVQA 4QOKA 1FCGA 3RWIB 5EO0A 1P4IH 1NKGA 4I3GA 4L5FL 3WFZA 2BOBA 2ITCB 3ME0B 1INQB 3STZA 5KVDL 4OLWL 5F0PB 1VZGA 2HFFA 4O2EA 2XU9A 3QYNA 1E4WL 4J4PC 4LEBA 5D7EA 1JV5A 4H20L 2R1WB 3LN5B 4OLUL 4YSTA 3HJEA 4LLQB 5CS7A 3X1GA 3L8QA 4JPSA 1WS8A 4KZDL 4FKKA 5HDBE 3VGBA 2MJWA 2JB5L 4TVPE 3KVPA 2A74C 4GMTH 4QRAA 4HC1L 3GSVB 3LDBC 43C9A 2F0CA 3W9EA 3FULA 1A5FL 4XP4L 4KKCC 4AJYV 5E2UH 3DMMB 4ZK8A 1YY9D 3TTYA 4YHYC 4GLRI 1GGBL 2YN5A 4Z3TA 2GITB 4PP2A 1XEUA 4HK0B 5I5MA 1Q1JH 4F5CA 4U1SB 1GKEA 1J8HA 1IBGH 4IGBA 5DYFA 2DKUA 4KV5E 4KZ0A 3MOBH 5AD0A 5HVGB 2E4TA 4OSUH 1NUNB 4XNQB 5FYJL 4WU5A 3EO0B 3E1F1 5DMGD 1YUHA 3HB3B 3RGVC 3IDMA 5KVFE 1MHEB 2ENPA 2KT6A 3VXMB 3QHZH 3CFIC 1UB5A 2X6BA 1ZCRA 4KTEH 5J11B 1A7OH 1XCXA 3VFSA 1LQBC 3RUGA 2BZCA 3L7FB 1L9RA 2VDQL 5FECB 2HVJA 4KK5C 4BK5C 4GAGL 3IAGC 1LHZA 3HE7C 7PCYA 4P2OD 3KPTA 3LEVL 4G80B 4MWFA 1A3ZA 4U1IA 1D6VH 1J7VR 3R1GH 2DKSA 2G5RA 3I50L 4WY7H 4Z5RB 5I6OA 4CVUA 3N41F 4EDXA 4YHZL 5I71B 4UT6H 1J1XL 2AERT 4TULH 3QVAA 4OKDA 2BWDA 4Q6IB 2NY2C 1FPTL 1H3WM 3EJYD 4S2SA 5CJ8A 1IEAA 1KC5L 4G8IB 2IDQA 3VFUA 2D73A 4X6CF 4L3CB 2R2CA 4UQ3B 3O0RL 4FQCH 4WHYG 4YIQA 3X14B 3VD7A 1JWSB 3GKWH 3QUXC 4CJ1A 1JYWA 4TRPL 1D2PA 1QBLL 3EYVA 4WUKH 1P84K 1A3QA 1XGYH 2Y6SC 1A4JB 5I1KH 1J1PL 2X4QA 1W0YT 4K5OA 1E30A 4HUVA 2G3MA 1WZLA 5E8OA 1ID2A 2X1WL 5DD1L 3LQAL 4NQQA 2H3XC 5DGRA 3RNQB 1LNUB 4AYMC 1X5MA 3W39A 2WCGA 3EYSL 1NMAL 3PJLA 3Q2WA 1JCVA 1EAJA 2FIKA 4HIXH 5C08B 4HWUA 4L4TA 3JV0A 2O5YL 3TGXA 3CZLA 3F85A 2Z34A 2QPFA 4OI9A 3VFWB 5FGSA 4ONHA 4ODBD 4XX1G 5CEYA 1TSRA 3SOBL 3VE0A 3OXSB 2C3WA 2UUDK 1BW8A 2XYBA 2VZTA 5DJAB 4IKJA 4N0YH 5KAQG 1MNNA 2AV7A 1MFEH 3W0WA 4B6ZA 2QHRH 5JYMA 2E7LA 1FHNA 2ORBH 1C08A 2Z4QB 3N44F 3QUKB 5D7IA 4LU5L 4H0IA 5DJDA 3RWCB 4YJZL 1D9KA 5ANME 4NLAA 3SO3B 1E9OB 4NDMB 1N64L 5DTFA 4PV8B 2YAPA 4JNXA 2VQ1A 4QXTB 3C5ZC 1S9XA 4FTVA 4L9LC 4UM8B 3MUY1 2MSPA 5DEGA 1MJ8L 4H8PA 3RQ3A 1MH5A 3DTUB 3KPOB 3TBSB 1AOZA 1T0PB 4HKJA 3BCFA 4OBSA 3VXOA 2W8CA 3FRPA 3MA9H 3GPEA 1UXSA 4X8JA 3CVHH 3H3KA 3HMXA 3Q6GL 4K3JL 3OSVA 4O00A 5E7FA 2EE6A 1UASA 3OG6B 3STLB 1NGYA 2CR0A 3MJ7A 4S0TD 2H1PH 3BRFA 3ECUA 5DUBB 3T2NL 5IHLB 3LXUX 1YSOA 1TQUA 1FF5A 3QA3B 2ENYA 5DVKA 4YS4A 2V17L 2L7JA 2UX7A 3SCMD 4QWWC 4OJDH 1VSCA 2MTAA 1E9QA 2Z91A 4LSPL 1DLHB 1JGLL 3QQ4A 4JN1H 5LAXB 2EEAA 1KN2H 3QJHA 2WVTA 4GP4B 2JCCF 2WLJA 2GHZA 2NTSP 2VR6A 1ZV2A 2EDOA 4PRID 5KTEL 3LKPA 1TVHA 3TH2T 1JZ4A 2ADYA 4MXWH 4PRAB 5DURD 4NKIL 4MB1A 4OZGE 5J89A 3LKNB 1E27B 5EU4B 4N25A 1KG0B 5HI3D 3T2QA 3DDFA 2P8LA 3WO4B 1YEEL 3DURB 3R7QA 1ZANL 3I9GL 3KH3A 2BJML 5FR3A 2ICCA 4ONOA 3MMEB 4I0KA 5HJDA 3EH2A 4EEEA 2GYSA 1GGTA 1J5DA 1Z66A 5KVEL 1XFPA 2JCWA 5C0BE 4Y88A 4Z3FA 4KRPB 3AG4B 4JREC 1Z3GL 4XMLL 1NOFA 4OJEH 2YD3A 1SN0A 1MRCL 1KSRA 4G3YL 2HKFH 3IPEA 5TDNB 3EOTH 3ZHKA 2HRPL 4XP5H 3ESMA 5JTWA 1R3KA 1JL8A 1GOGA 2VITA 3NDZE 1SN5A 1HCZA 4XNMB 3QDJA 3K72A 5K9JH 4QRPE 3ZDZF 2J6WA 1FNSH 3VVWA 4B9CA 2FX7L 4HIHA 3ZOAA 4ENEC 2VDRH 3C08H 4MYWB 1W8NA 4MCZA 1UWXK 4DJMA 4PJBE 1FYTA 5JHBA 3HBQA 3QULA 1RURL 1OOWA 2O30A 2DQFA 3ZDXF 3AQYA 3OMZA 5LDUA 2CR6A 4MHHG 3DJZA 5F7YC 1W16A 1ZA3A 4WWKD 3HRZA 4KJPC 1HZHH 3FTYA 3ZE2E 1HOEA 1PIGA 3N0AA 4GSQA 2VJXA 3GK8L 2WLNA 1A0QL 4UYPA 2X87A 5AUMA 3HG1A 2RIKA 4YXHH 3P9LA 5CN1A 5K9KB 2MEJB 1GSMA 4O2CA 4AIOA 1ND0B 2X5PA 4PJEA 1T1XA 2ZUWA 1FVDB 4LVNB 4JDVA 5D1QB 5E1IA 3LH8A 3T77A 1WISA 5LLIC 4APXB 2O5ZH 3REVA 5CCHE 4OKVA 1CJYA 2V9UA 3PF2A 3BRDA 4Y19A 5BS0E 1X5LA 5T5NG 1ZT7B 1QFPA 2HG5A 2BIPA 2DRUA 4ODXB 4I1PA 4PGDB 3D12B 5KYUB 3GMRA 4C83B 4O51B 4QXWA 1IZJA 1DQIA 3CLFH 3VUAA 3LSOB 3QRGH 1Q9LA 4CVXA 4YGAB 5KG9A 1EFXD 2VMEA 2IV8A 3O41A 4QNPF 4YHPA 3HBGA 2H32H 4JKMA 3RY4A 3S2CA 3D87B 4XAKE 1L9QA 4NWUH 4RGNC 3G5XA 1HE8A 1KJMA 3SDYH 3SY6A 1DVTA 1T1WB 4MJJA 5JHMA 4XPHH 3D69A 3QAQA 1MJUH 1XGQB 5AAMC 1DBML 4W9KC 5TDPB 4F2MA 2CGRL 1A65A 3E9UA 5CP3H 3ZO0A 1YEIH 4A66A 5I73C 3DHMA 5HVFB 4I1RA 1CS6A 4A55A 4N26A 3WSQL 1JDAA 4JO1L 2IQAB 3CV5A 3T3MB 3EJZC 3B9AA 1BZ7B 1OB0A 2BVYA 1GY2A 1DSYA 3ZRCC 3W38A 1INQA 4K8RD 5G5DB 3T0AA 1WAAE 5IB4B 4Z7AA 1RZGB 4UAOC 4MJ5A 4YDVB 1SEBB 3A23A 4YLBA 4LLQA 1DQLH 1WT5C 2OL3B 3Q2VA 2CBQA 4U2YA 3ML8A 1NLBH 3VXME 1MQ8A 3FQRA 3QI9C 1JZFA 4TUJB 3WD5L 2QSCH 1AR1D 4ZMWA 1FO0B 5I75C 4IMKA 5JPNC 3G5VA 1MWAB 4Q89A 2O4EA 2BW5A 3QUML 3R19A 1L7IL 3KAAA 3G9AB 2BNQB 1WUNT 1A6TB 2OMYA 2VWEE 3WENA 3CVIL 4MQSB 2ZP0T 5K9QI 1G0XA 1C5BL 5ADOH 4GG8A 5D4JA 4X98A 4JPVH 4U1SA 1NBVH 3LS4L 3RVUC 5KVGL 1HH9A 1JUFA 2OM5A 3FYEB 1O7DE 4Y4KA 3ELAT 2B3IA 2BDNL 5E2WL 1RZKC 2XPGA 1WFIA 3VSUA 4XNQA 1CE6A 1KYOK 3BPLB 1IFRA 1KDJA 1KB5B 5BOPA 3V5DA 4G2AA 3GUTB 4GYBA 3SBQA 4CBPA 4RFNB 4U33A 2XKSA 2MRYA 3GTNA 4BQ8A 1XZ0B 3T71A 3MV9D 4P5KB 3FB5B 3ECVA 5KZCD 2XZAH 3U1QA 5IFHH 2NX5D 4JPKH 3OKDA 1X5IA 3L7FA 5IROA 1QSZA 3CHQA 3DX9A 4IMLA 4XC3L 4J1UB 4G80A 1FIGH 4CBZA 3NIFB 3DYPA 2QQLH 1RIUH 4ZMTA 5CJOH 3V0VA 1KXHA 3INUL 2V5MA 1GJWA 2HLAB 3L6FA 4FFZH 4M5SA 5LVEA 1FWXA 3VTMA 5KS9F 1KBVA 3PWPD 4NUPA 1IQDB 2OMTB 5CINH 1AHKA 3HPJB 4MA3B 5C08E 3TJHD 1KFAL 4ZXBC 2DMHA 5A7BA 2B59B 3IDUA 4G8IA 1ONQB 5I0VA 2VDNB 5E8DH 4L3CA 3BSGA 1I8LC 1DEDA 4UOW0 4X6DB 3X14A 4ELMB 1AKJB 1SHSA 5H94A 4OZFB 2ED7A 1BZ9B 5HGGS 1EMTL 1RZKH 4TLTA 3RRQA 1FAIH 3B37A 1DDHA 5E9DD 3ZGIA 4OJAA 2FTAA 3OJVC 2IQ9L 3KGTA 4J4PD 3FS9A 2OJZL 3KBFA 4JRYE 3KWTA 1N10A 1AXIB 5C0AB 3MLXL 3RFRA 3RNQA 4E5XB 3SYQA 4JM2C 1HHJA 2WW8A 3I75B 4B97A 2CO3A 4YH6A 3KW7A 3S37H 2WYTA 3GBMH 4H2AA 2C3HA 3CN2A 3KPMA 3BXNB 3VFWA 1XT5A 2R1YB 3MKKA 3FFCD 5GHWL 4IBZA 1Z7JA 2QPDB 2BW4A 2JIXB 2WXOA 5C07B 4MMXC 3O3AB 3QCUL 4Q0XH 4AQEB 2ODIA 2WCSA 5G4OA 1TLMA 1J0YA 2KYIA 2F9BT 4AYFA 2ZXEB 3UYRH 3WXWH 1F1AA 1ZEAH 5EBWA 2D9CA 3QEUB 4LHUG 1HQRB 3RGVD 3RIKA 2P52A 4RISL 1QFWL 2I07B 3ZT6A 5FM4A 2PPAA 4R90H 1UXMA 4AZ8B 1B0GB 1E9OA 1U8MA 4G42B 4NDMA 3SDCC 3WNIA 2JI1A 3P4OA 1XD0A 3H54A 4PV8A 5EZIH 5F44A 3CE1A 2XV6B 2YSSB 5F0LB 1N70A 1UXWA 4XP6L 4KK5D 2NXZB 1XSKA 4O2FB 3HE7D 1XWVA 4YAQB 4B41A 4JANB 3TBSA 5AOZA 1KTBA 3TA3C 4Q6YA 4KQ4H 3TCTA 1H0DA 1XF2A 3LRSB 4NX0A 5KOMC 2R56L 5FO2A 1KYFA 3GSNB 5IQ9B 2HFGH 5IGXL 1PGRB 1QLFB 1NJ9B 5DUBA 3MBEC 1RJYA 5C6PB 4AI7A 1HVXA 1HS6A 2NY2D 2VABA 3CCHB 4WTXA 2A77L 3VQLA 1U36A 3V4VH 3F5WA 1EZSA 4TSBH 3QA3A 4G7VH 4PR5B 4X5XA 1MCBA 2XKUA 3IMVA 2Y07L 1D5IL 2DLTA 4RZCA 5AWNH 3ETBJ 5JDSB 5LAXA 3Q5TA 2XZCL 4LSUH 3CDGA 2R4RH 1YECH 3QUXD 2A9MH 4H26B 1DLFL 5IFJB 2J2ZB 4K5NA 5GIRB 1MDTA 5HJBA 1QOKA 2Y6SD 2ED8A 2ZYIA 1HNFA 4NBXB 3RJQB 3LKNA 1QRNE 1E27A 5EU4A 3RNKB 2QTEA 3M1BB 2CBOA 1KG0A 5CR8A 2PO6B 4PRBB 2CCWA 3DURA 3MACL 2Y5TB 2OCJA 2VLLA 3RVWC 3KWWB 3X3FL 1II4E 4B9ZA 4NKMA 2XN9D 3K6OA 2ADFL 3O4OC 1JZIA 1ITCA 3KPQA 4L8SC 2WBJB 2A6DB 4X7SH 5L4IA 1E5CA 4ZRGA 3FN9A 4QRSA 4EQ2A 2VZUA 2WLIA 2NY5H 4P3CH 2YQ3A 4UTBA 1E4XH 2EQDA 5KYXB 1R6VA 2P49B 3CPUA 5HXMA 1KJ3L 4OFIA 2F53B 1K2DA 4B9YA 2A4CA 1BIHA 2EILB 4P5TC 3BUDA 2VRKA 1J1OH 2VLKB 4UUJA 4Y5YB 1OSYA 1UC6A 4JFOB 3LD8C 3HJ0A 4JPIB 3VD9A 1OARL 4E9QA 4FQIL 4XNMA 1U8PB 1F3DH 4W9ZA 3SYAA 2E27L 3DIDA 1MFBH 2X0WA 4JPQA 1QSFD 1MIML 3FO9B 4PLJD 2OK0H 4MTMA 3C5ZD 2R29H 4BH7A 2EDWA 2AXGA 1FZMB 3GRGA 2K3TA 3PNRB 3THML 2P5WD 4LL1A 4P9HL 4WNQA 3CVCA 5FK9A 4A2LA 1U8CA 4L29B 1CI3M 3WIIL 4AMWA 1U92A 4EI5A 1PS3A 3GMPB 4CU8A 3ZT7A 2M8XA 4XBEL 1P5VA 1U3ZA 2ADGA 5AZ2L 1EHAA 3B8YA 2VM9A 4D9LL 3I84A 4NOFA 3VCLB 4MJIA 3QZWG 3NH7H 2Q86B 2I7OA 3NJHA 2HAZA 5GQBA 1FN4A 4LXFA 3O9WB 4B9PA 3CBRA 3O6KH 4LSTL 3NJMA 2ADIB 3NFNA 2V2WB 2XA8L 4FQXC 4WEBL 2R0WH 4ABUA 1ZIAA 2VLRB 1JGEB 3PAUA 4QWWD 3CN1A 1UOKA 3EBGA 1ND0A 3PRZA 5FYLE 1JXDA 2DD8H 2P5EB 3IMWA 1TJGL 1OGTB 4Y16C 5CJ5A 2AK4B 1A6ZB 1RULH 4WUUB 5D1QA 5IEKB 3WUWA 5ACZA 2R23A 2JMRA 1X5FA 1RZFH 3V9CA 3D0LB 4ODUB 1H3PL 3T08A 6PCYA 3VSVA 1ZT7A 2A38A 1M6OB 2X6CA 5HHVL 1HH6A 1SDAB 3BSZH 3G08A 1HHIB 2X70B 5E9NA 4W93A 2GJRA 3T3ME 3VFGL 5KYUA 5A16B 4UOZA 1MHPH 2VIRB 3ARZA 3HUJB 1TNMA 4BFIB 4EIBA 1RHHA 3LSOA 3Q1EA 1E6OL 1NAKL 2AJVH 2XC8A 5TE7L 4AL8H 4AK1A 2OW7A 1NC4B 3IWVA 2OZ4H 4HU8A 1IVTA 3UTSD 3O81A 1OHZA 4DGUA 4HH9A 1FNEB 1LGVA 4KDVA 4N90E 3U0PA 4D9QD 3DV6A 2H3NB 3MRHB 4K8RL 5BRZB 2WUBL 4DVRH 5B38G 4HAKA 3U0TB 1AAJA 3SGKC 3TL5A 3PPEA 2BNQE 4HLEA 2I9TB 2XA3A 3ARFC 1DSWA 3D51A 1BEYL 2HT2C 2WIMA 3CIAA 5GISH 4X80L 4S1RL 4UV7L 1A14L 1AJ7H 3BWUF 2X4NB 4GAAA 5FYKE 3V5KA 1FA4A 1V5JA 3LEYH 2LV4A 1C16A 3LOWA 4XPTL 5G5DA 4YN3A 4FABL 5IVXB 4FNRA 4DO5A 4GW5B 3MREA 4YDVA 3Q06A 1SEBA 1I8IA 1HEHC 2OL3A 2QR0A 4M8QB 5SX4I 1YEGL 4YMPA 2L0DA 1JFQL 3FAXA 3P0YH 4KJPD 2A73A 1MCRA 4TUJA 3FTSA 2WWMC 1FO0A 3CHXA 4LCCB 3MLYH 4NNPL 4NZTL 2CH8A 4YXLH 3X1EA 3ZK0A 4ES8A 3NSCA 3IXAB 1FNLA 5I6PA 5EU6B 3BUYB 4NENA 1X5GA 4LLMB 4AE1A 5ISZB 2WXPA 2CHWA 3MQIA 4KUZH 4B9KC 1U30A 3LKOA 5CHNA 5FWRA 1OW0A 5FF6A 3NIFE 3PHOA 4NC2B 3VW3H 3GXUB 3ULVF 4GMTL 1OT1A 4KMLB 2DI7A 5AB1A 4KKLC 3UG3A 2VLJA 4GUCA 1IBDA 4PJ9C 5E2UL 2EIZB 4NZRL 1FL5B 3QK0A 3QFJE 3L1FA 4L2LA 2FATH 3FUHA 1XB6A 4UZSA 1E5YA 4X6DE 4ELME 5AW6B 4EQ3A 5HHNB 4P5KA 4XHJC 4IDJH 4NNYB 3JVFC 1HIML 3MOBL 4DEWA 3QISA 3TONA 3FO0H 3SPGA 4OSUL 3GSWB 3PFQA 2ZOLB 3UZVA 4NO2A 3WS3B 5DWPA 5TFSH 4WO4B 4KJWD 1TTAA 2GJZA 4OLZL 2RMNA 3QHZL 1NEZG 1QEWB 5C0AE 1NMBH 2IPTH 5A3ID 2WBWB 2IH9A 2HLAA 3PHSA 4YSSA 2R69L 5EV7A 4A67A 3HPJA 1CT8B 4S1QH 2H6PA 4HX1B 4JGNA 5C9JA 2LLGA 3D39D 3D9AH 2VOTA 1D6VL 1I85C 5E5MA 5E8EB 5AYQA 1TMCB 2HWZH 5IJDC 1BM7A 1BJ8A 4IRZL 1SM3L 3MXWH 4YDLB 4XVJL 1I31A 4UT6L 3FSAA 5D1ZB 1IVLA 4LVEA 2B16A 2DEWX 2R0LH 5AQ0A 3TX4A 3K2KA 4E9YA 1RK7A 1T04B 2ROYA 3G6AB 4XH2B 4C59B 1I3RA 1NGQH 3EDDA 3QI9D 1DJZA 2BOCB 4E5XA 3PP3H 4JMNA 2IAMA 3GKWL 2FD6H 2X88A 1FZJA 4D0CA 3BXNA 4WUKL 4XCCH 5ECJE 2R1YA 3TJEH 1HILB 1XGYL 2C4FU 3EKCA 1RZJC 5E94B 4WDIA 3V0AC 2CBPA 3QJOA 3QAZB 5C07A 4KH9A 3O3AA 3FU6A 1T03H 5EF1A 3G9VA 4AQEA 4BSJA 5I5RA 4JRFA 1RH8A 2BZ7A 3DGDA 2FL5B 1BFVH 5EZLA 4BV1A 3KPLB 2K45A 3KDMB 5DEFB 5GGTA 4AGOA 5IQ7L 1H19A 1EZLA 2D0HA 1QR1B 4M7LH 2EIKB 2JXMB 2BLFA 2DY2A 2PXYC 3QZMA 5F7DA 4JDZB 4LLYA 5D7JB 5I0ZA 3AS2A 5M7QA 1U8IB 1TZAA 1BAWA 4QRUB 3JVGC 2X9YA 4GG6B 1EBAA 1XEDA 3H42L 1FNFA 3ZTNL 4R7NB 1ZWIB 2V2TB 4K94C 4A2DA 4P4KB 4EOWH 4WU7B 3HI5H 5IHWA 2JKIS 4O2FA 2E3VA 1ZK5A 2ORBL 4YAQA 4JANA 4B9FA 3NJGA 2Q8AH 5JQIB 1O75A 3PHQB 4J3WA 3T0BA 4JFXB 3BPNB 4XAWH 3LRSA 2QKIC 3UDWA 1TCRB 4FQHA 3RLSA 2J6EH 5IQ9A 4QLWA 4ZFOL 1NJ9A 5I6KA 2PYEA 4HS6B 1RJLA 1Z9MA 2F54A 4KY1H 5EBGA 1W2KT 4ZXBD 3GS0A 3BUBA 3AS3A 4WI6A 1NCDL 4M62H 5J9PB 1KNOA 4PB9H 5IHZA 1E4KA 4G8FB 4JN2A 2VZ3A 4OJCA 2NRDA 3GWJA 3S37X 5FA3A 2WN2A 2YPVL 5FKAA 2F53E 4MB5A 2J2ZA 4UNIA 1OP4A 1LO3L 2EICA 3QUHA 4XNBA 3UH8A 5FGCE 3NPZB 3HEIB 3RVVC 1USZA 3M1BA 2RR3A 2NDFA 2D7TL 4PRBA 4F57L 3EHBB 5LGJB 2L7EA 5JXEC 3EDFA 3QXAB 2Y5TA 3GIZL 4K94H 3UAJC 3KWWA 4BIKA 4AW4A 1KN2L 2UWEA 5EEVA 5G4NA 5BPPA 1CGXA 4JL2A 1MFDH 1AQHA 3QDMA 5F7MC 5ADPL 4HQQL 1T5XB 3NP4A 5GRZA 2WBJA 3TYFA 1KB9K 3RKDC 2DWEA 2JKJA 2YAQA 2GY7B 2IGLA 3B9DA 3FL7A 5KYXA 2YGOA 2VR4A 4JPWH 5ICUA 1TEYA 4M7JL 5IV2B 1G1KA 5KS9A 2VLKA 4LE8A 3BZ4B 3E2HC 1BVOA 1SOQA 3AC0A 5D2LF 3IDIB 3VI4F 5A2BA 1KCRH 3KYAA 3OAWA 4P46A 1B90A 1EX0A 1T7XA 1U8PA 5G4MA 4R9HA 3B6SA 3T6ZA 4NHCH 1HU8A 5AYUH 3B9EA 4LFHD 3SDCD 2P5EE 3BDYH 4N2OA 3U2SB 4K3DH 2VJ0A 3FO9A 4OGYL 3BT2H 3EIFA 2HKFL 3L3GB 3QNXB 4IGBC 5DYOB 4K23L 3EOTL 4Y5VB 4AM0B 4P07A 3PQYA 1FZMA 2BP0A 1YNKH 4K71B 4YZWA 4N3UA 2IANA 4L29A 2I69A 2W81C 4HJ0C 3FOMB 3K0YA 4JFVA 3TA3D 5IK3A 1FFNB 4CDGC 3TF4A 5K9JL 4IS6A 3UAAA 2IEPA 4JO5A 1YYMH 3BLPX 3ZPDA 2BCKB 3MBED 3TZVA 5JHDA 3H9SB 2VDRL 5EN3A 3C08L 3B8SA 3HUJE 2XXCB 3HVDA 3W9DB 1NICA 2DQGL 4C56E 6TAAA 1X5YA 2W9EL 4PJ6A 3UAEA 2ADIA 2WZ0A 5FGBA 2V2WA 3KL0A 5D8JL 3BZDA 1FG2B 1JGEA 2VLRA 3LRLA 5E8NA 4JFYB 2LTQC 3WE1A 2P5EA 3HAEA 4PJGE 2ZAIA 2Z7YA 5EUOF 3EBIA 5D72L 2AK4A 3FCSA 3NSXA 4IRJC 1A6ZA 3SJVD 4WUUA 5BRZE 4RA0C 3P4NA 5KSBB 1DL7H 4KJQC 4YXHL 5I30H 1EHKB 5IW3A 1UZ6F 2EZ0C 3ARDB 4WFFE 3SKOA 1M6OA 3TA4D 4FI8A 2GIMA 5IOPB 2YJQA 3VFNB 2PCPB 3MNWB 3QUZD 2FGWH 3S98A 2IAAC 3SODB 3H4FA 3SKUD 4FJZA 4YO0A 1NC4A 5A2KH 3D18B 2YZ1A 3OM3B 2X1PA 1KTLA 2WO2B 4FF9A 3RGHA 3VG9C 3UGEA 4EXKA 1AGFB 1MCCA 4TMPA 4Y2DB 3DOSB 1G9MC 3IDNB 1PX8A 2EADA 1NUGA 4M4RB 4FXKA 1U8JB 3QG6B 1GGUA 2CXKA 2LE9A 3GJFK 3QNZB 4WTWA 1OM3H 4DZ8A 3U0TA 3O2VH 4P5TD 5DK2B 2XVBA 1W72B 1ROWA 4AQAA 5JW5A 1I7UA 4X6EA 4QUOA 1CDUA 2I9TA 5DFVC 5ISZE 3Q44A 2H0JA 1AIFB 4PJ5D 4KX7A 4NWUL 5I66B 4U3HA 4HFUH 5HTSA 3FU8A 3B7SA 1AR2A 2YAMA 1PNDA 2EDDA 3PWJA 1E9PB 5TPWL 1MJUL 3ZGHA 5JOFA 1P6FA 1IBZA 2BSBA 2X7LA 5IVXA 3CZUB 4RCAA 1A6WL 5CN2A 3B2UC 4L3AA 3DA0A 5I1LB 1OP3K 3S88H 4NAQA 4FFYA 4NIKB 1RUKL 2K7QA 5CD5C 5EU3A 3K7UA 2QT6A 3CFEA 1CWVA 1F58H 5IWLA 1D9KC 1GGYA 4L3EB 4MBOA 1JI2A 4W9DC 4P2QD 3IXAA 3CMOH 1Z9SA 2MOVA 4G8EB 5EU6A 4ABQA 2EDXA 3U7YH 4DP9X 1OGAB 3C5JB 3RFZC 4XBGA 5L8LB 1DQLL 5K93A 5I6MA 4GIOA 4Y16D 1P84J 1OTSC 1CLZL 3JZ7A 3WDHA 4RDQF 3F04A 3VQ2C 4OGQC 4R6UA 4M5ZH 4CN1A 1XR8B 2KBGA 4PWFA 1H8NA 1E7VA 5ITBH 3UGXA 1WAPA 1FL5A 4LEEA 2YD2A 4ANVA 3HI1B 2N59A 5ADOL 3MNMA 1OAZH 5J3HC 5I1JH 3AQXA 4HKZB 4NNYA 1NAMH 4OV5B 4XVUC 3GSWA 5LXVA 4LCYA 3WIHL 4FL4B 4YDMA 1R1CA 1UYWL 1L9MA 4HMCA 2VZVA 3ALWA 3OHMB 3QHTC 3ECQA 4AH2B 4MASA 1JDCA 1QEWA 2BHZA 1VFUA 4AVHA 3K3QA 3LXCA 3S48A 2GW5A 4QO1B 3C60C 4KK8C 4I5BA 5IFAH 3AAZA 5DJ8A 5I9QC 3BAYA 3AABA 3LYRA 2I60L 3EF4A 1KN4H 5I8CB 4ZUWB 1NFDE 3ARFD 3HMXH 5BQ7A 5CEZD 2C9XA 2HT2D 2GTQA 4XMKH 1FIGL 3APNA 4X2UA 2QQLL 5F9OL 3D25B 1YLBB 5D96B 3VAEA 2F5BH 3HC3L 5IBLC 3GQFA 3MRRB 3WNMA 3IJHA 3NCEB 3BFWA 4OIIL 2K8QA 1M4KA 1Z0MA 5HYSB 5EOQL 2G3NA 4UQCA 2XWTA 1KB3A 2EO7A 3V4PA 4OZFG 5C70A 1HNGA 4NPYA 2E9GA 3VA6A 1KULA 4PRNB 2Q7YA 2BCMA 3G6AA 5E8DL 1DBBH 4KGLA 1I1YB 3GSUA 2H2PC 2WWMD 2XBZA 3VU1A 1KBGL 3ARGA 2O5XL 3LHPH 4GG6E 2XTSA 5LGHL 2VN4A 2A0LC 7PAZA 2XZQL 2QQKL 1M7DB 3RILA 4X7DC 4N2LA 3RIAF 3OPZL 3RVXC 4DPAX 5LN4A 3VYNA 1HHKB 3NEXA 3RIAK 3ZYZA 4E9WA 3PAZA 3HRZC 4IHOB 4KPHH 2FL5A 3MA7B 3OQ3B 1XF1A 3BLBA 3FQ1A 4KKLD 1S7QB 1QR1A 3RWEA 4HV8B 3IE9A 2E5EA 1PG7H 3ZKSD 1FE8L 1HSAA 1XXFC 5KBNC 4JDZA 1GIGH 1LM8V 4CA4A 1KV7A 1U8IA 1JVKA 3BUTA 4M00A 4HPYL 5EWIH 3TVMA 3OKOB 4QI3A 1IT9H 4R7NA 1X5ZA 1ZWIA 2YGPA 5E5RB 2GBVA 4P4KA 5ID0A 1Z9OA 5T5FH 2FHFA 3UYRL 1Q0EA 3OGCB 1ZEAL 3VRJA 2NUPB 3S7GA 1D3CA 5BV7B 3CMGA 1NBCA 3PHQA 1OAJA 3KYNA 1K5NB 4TNWF 4XX5A 3ZR6A 3IDJB 1TCRA 5EC2A 3WYRA 2WJ5A 5CKGA 3M46A 4TNWK 3SN6N 1IM3B 2P43B 4ESKA 1M3IA 2D8KA 5EIIB 2E4FA 2V7HA 4UIMB 5F1KC 5KSUA 1OOAA 4MZ2A 1SHWA 2YXMA 3ROLB 4WKZB 4QF1A 2NR6A 3IT8D 2VERN 2BVTA 2CKBB 1FFQA 4YQXH 4NO0B 4OB5H 4LRNH 5E00A 4A2FA 3F64A 1WPCA 2H6UA 3VGFA 3Q2NA 3IU4H 3PGFL 3QIUC 5DCCA 1KLUB 5DO2C 1S7VB 2YEZB 3PCYA 1CN4A 3SKJH 1SDYA 2W07A 3UC0L 4I2XE 4YDIH 3N1GC 5LGJA 3VRIB 2Y2YA 1BQHG 1F97A 1N0LA 3QXAA 4OCRL 1PTZA 4LSUL 4TOYL 2NW2B 2FE0A 1P69B 2BY2A 5I1IH 5IB2B 2DQJL 1YECL 3B3IA 5ENWA 4RIRA 3GRWL 1RZ8B 3IF1B 3WXVH 2Z3FA 4DZBB 4JFFD 2ZCKH 1L3WA 4R26H 5D1XD 5D70H 3HZMA 2VDMB 3L3JA 3ULUC 4JY6B 2QGDA 4BCZA 2ZYSA 2HUHA 5CKAA 2JV6A 4XB8A 1GSKA 3QORB 4RGMB 4GP8B 3D7PA 3EYQC 3QO1B 4P2RD 1PEWA 3RI5F 3H9SE 4KGJA 4CJ0A 2XQYA 5EZOL 1UKQA 3REWB 5IV2A 3QJQB 4Y2NA 3RI5K 2M2DA 3IDIA 2PXYD 1RZ7H 1AC6A 1FC1A 2WP3O 4WWOA 3BP7B 3F05A 3SDDB 2J1XA 4QYOA 1E4XL 1O6VA 3JWDH 1J5CA 4JRLA 5DD0L 1Z5LB 4HEMA 4NPJA 5DYOA 4U7KA 5HVHC 3PGDA 3BJ91 4Y5VA 4KO5A 5KSBE 1BZ8A 2HVKB 3N85H 2KLTA 1XCQA 4AX3A 4ZW5A 2YFNA 3UJTH 3CN0A 1DUYA 2AV1B 4NZUH 2J8UA 2JH2A 1MFBL 2ZD0A 2EE3A 3UTPD 1WIUA 1KENL 2BCKA 1TZIB 4Z7OF 1MJ7L 2ITDB 4UU9B 3QQ3B 2X4UB 3SE6A 5J11C 2NZ9C 4MMZA 2LVEA 3ULUH 4I0PB 5IROC 2JFCA 3OKEB 1IEBB 3QS3A 3MUGB 4M6AA 2XN1A 4QXUL 4JLRB 5I17A 1I8MB 2GK0B 3WKNA 1KPVA 2W88A 3ARWA 4RVBA 2IMNA 4HS3B 1J05B 2OMWB 1CGSH 3WKQA 4HPOH 2Y7SA 1JK9A 3MYJB 5D7KE 2VDPL 1NIAA 4H40A 4JHBA 1H8SA 4UAHA 5C0DA 3RVVD 3B43A 1R24B 2JELL 4KXBA 1IGYA 2R0WL 5FCSH 4NP9A 4JHAL 3SYOA 3QJFA 2Y2TA 5D71L 3UAJD 2PCPA 3MNWA 4HA1A 4RX4A 3WE6B 1Q9WB 4QOKD 2EDQA 1RULL 1U8OB 3NJJA 1OAUL 2OYPA 4LCWB 2BX5A 1VGEL 2WBKA 1RZFL 3HG2A 2YLHA 3D18A 3M8OL 4QXGH 5I15L 2DJSA 3RKDD 3I6SA 4ODSH 4LCUB 1J86A 2FBRA 4HOXA 2R2EA 3GHBH 1A25A 1CTOA 1KJ2A 5K5YA 1RP8A 4AGQA 4XE5B 1AGBB 1IC4H 2I32A 2V3FA 1JXFA 3BUQA 4X5RA 3VD3A 2IH1B 5FDWA 1B88A 3QNZA 4L3EE 4R4BA 1QLRB 4JKPL 2AJVL 4KTGA 3TT3L 1H6UA 3ZU8A 4JG1H 1OGAE 4RMQA 1AIFA 1JNHB 3OXRB 3U6RA 1J10A 5CEXA 2Z6FA 5B3NA 5EIQA 4DGVL 4ZYKB 2PN5A 3NVQA 4G1EB 1EHLL 1DJIA 2G60L 4HJ0D 3U6XA 5DGQA 5I1LA 2FO1A 5JDJA 4UI2A 2CLVA 3FN0H 2IOOA 5F1OB 4FYQA 4HG4J 5GISL 3IYLW 2DTML 4TVPD 1AJ7L 1DCEA 3GMLB 4L3EA 3SO3C 2BY1A 4GKZB 3LEYL 3B9KB 1I7RA 2Z1KA 3WN6A 4QHKI 4TQ8A 1HYRC 1JS4A 2ZXDA 2PR4H 4S1SH 4WEUD 2YD1A 1CLOH 4NN7B 4MA1B 1JPSH 2F5AL 5DS8B 2GCYB 2R8SH 1QA9B 3P0YL 2ZWKA 1AS6A 5LN8A 2WP3T 2XVKA 4IRJD 4N68A 4XCFL 2OCFD 1G7PA 4W68A 1LE5A 1A47A 4XNUL 1BFOB 3OKYA 3X3GL 2EH8H 4A6YB 4GUOA 1XR8A 2RH0A 2HFTA 4NQDB 1EZVX 2AK1L 3B7UX 5D2LA 3MX0B 3WIFB 3ZUCA 3OKMA 5DHDA 5E0QA 1HC1A 3VW3L 1T83A 1AG6A 1GC1L 5I18L 3EDEA 3FPXA 4HKZA 3F2LA 2ZX6A 3FONA 4OV5A 4G5ZL 1JNLH 3AS1A 5CEZL 3TOPA 4RA3A 5E99H 5L2KA 4HHAB 1U2CA 5K1JA 2D7QA 4W9EC 4HU2A 3GS4A 3WO4C 5C7XH 3NSYA 1A2YA 1CG9B 4X9FA 3WFHB 4QTHB 4ZOCA 2OQJA 1AE6L 1Y0LB 1SJXA 4QO1A 1H3GA 3FHAA 5ID1B 2VXUL 4L4TD 4W4OC 5FV2A 5DFVD 1QFWM 1I9EA 4ZS6C 2I25N 3FT0A 5L7XL 2JJUA 2BC4A 1MVFA 1F86A 2A6JB 3WCYA 4R7VA 5IEHB 1NANH 3D25A 3FK3A 3ALPA 5DZAA 4F15B 3I9AA 3MLUL 1A6UH 3CDZB 4G6JH 3GFUA 2Q2EB 2D7PA 3N41B 5HYSA 2EUZA 3P54A 1CYWA 4J3OH 3B2UD 4APQA 3NIGB 3W0WD 5FCUH 4E9TA 1ICTA 3IJEB 3EBAA 1S7SB 1UM4H 4AM0Q 2VLME 5CD5D 3QWRA 5BO1H 1D9KD 5ITFB 1KTDB 2EKSA 2ID5A 1R5WB 3QR2A 2WTRB 4OZHF 4UZGA 4LAQH 2AMGA 2BNRA 2QGCA 3D0VB 4X6CB 4CU6A 4Z7VE 4FTVD 3I9PA 2R0LL 4JHWL 3VDBA 2Q7AA 1NKOA 1M7DA 4HH8A 3QGVA 3VWJA 3GEWB 3DX7B 4MNQB 4R2GB 4EI5C 1OTSD 4DTGH 3QDHA 3KBHE 4N2EA 3MA7A 1EXHA 5DEZA 3HFMH 4YZFF 2ITEA 3NCCB 4UNTA 3GEFA 4XTRC 3TJEL 2FWOA 2OMZB 3F6LA 3A4AA 1UWEH 1JK8B 3MLZL 4UTBH 3NRQA 2YMTA 3L3DA 3HHSB 1HL4A 4D8PA 4MSWA 5IMLB 4Z7IA 4GRLD 3MRJB 1NIEA 1U3HB 3ZY7A 5J3HD 3K1KC 4XXCA 2DL9A 3RKPA 3VGDA 3OKOA 1PEZA 1CTNA 3KS0H 1AP2A 3MV7A 3O6FA 4WTZG 5D1QC 3VXPA 3TN0D 5DD3H 4XVUD 1FVCA 4M7LL 3BVUA 3PXHA 2DWDB 4JFDB 4M7KH 3S35H 3SKNB 5JOPE 4OLVH 1HCYA 3MHZA 4JB9L 1K5NA 5SV3A 4D7BA 1T22B 2YK1H 3D2UB 1KCKA 3N44B 2H8PA 2YJLA 5DS1A 5HJGA 2EDHA 2KI6A 1BMZA 3C60D 4KKNA 4KK8D 4B60A 4XC1H 4M7ZC 1GPOH 5EIIA 1S9YA 3HI5L 4UIMA 2UZYB 1TTUA 4KQ0A 2JTDA 3HNSH 1L9OA 3LIZL 4WNSA 4OD2B 5EO1B 4OCXH 1BA9A 2CO2A 3MRGB 4CVWA 3C5XA 4MAUH 4WKZA 4X7TA 2DYPA 5IBLD 4B9IA 1Q94B 4NO0A 2XV3A 4J39A 4LLAA 2FHBA 1RZJL 2E0PA 4XMZA 2ZOTA 1FL3B 3TT1H 5I76A 3C75A 2AQNA 4L0YA 1L6ZA 1RUPL 2H0EA 3CSBA 1KYUA 4M62L 3A4EA 1LLAA 1EO5A 2X0VA 1K8IB 4GBXB 5CZKA 4LEOB 4HOZA 4FMVA 1Z3RA 3CAFA 3KH4A 2MQGA 1F00I 1BPLB 1ZT4A 3FH5A 4LPUA 4F93B 1WLHA 3FCUB 4M1DH 3IF1A 3Q13A 4L1LA 2A0LD 4PG2A 5IREA 1MQKL 4DZBA 2HX7A 2JCCB 3E8UH 5K9OB 1E0OB 2IH3A 3DVIA 4CVZB 4FG0A 3RVXD 4ZTOL 2IPUG 2V9QA 2WXNA 4UOJA 2AKRA 1QSEE 2CHDA 3BN3B 1PMYA 4I18A 5IBTH 1JF1A 2ESVE 3C6LA 1BAFH 4LL4A 3O45B 1F4HA 2CWRA 1CDGA 4P3DB 3VSTA 4A7TA 4R4FL 5HHXH 4CC0A 2CBMA 2QSQA 3OZLA 2EDKA 4QRPD 3SDXF 2F7IA 4D0BA 4DESA 4C57C 1OW0C 2QL1A 2YRBA 1PKOA 3H7LA 3EO1A 3QQNA 4E9VA 3N04A 4JRXB 4DSYA 5AW2B 4PRHB 3MR9B 5GZOC 2FSEB 3H4HA 5B22A 1XIWB 2JLLA 3CFBB 2YRLA 1TOXA 1Q9OB 3DXAE 2VXSH 1BVKA 4ZMNA 1AGEA 4Y19D 4NQVB 1KCRL 2VUOA 4HKBB 4H7VA 2WWKT 4LP4A 4X8CA 3BPLC 2IG2H 3L3HA 5DMJB 3PY9A 4Y4FD 4NHCL 5AYUL 1E2VA 4MNGB 1BLNB 2VUYA 4RFNC 3K91A 2W91A 1VFAB 3MV8B 3ZDZB 3O3DA 4G59C 2W60B 4PLNC 4UU9A 4LOVA 1CL7I 4XN1A 1T2QH 2J57A 3GMQB 2N56A 4OF3A 4LCWE 1G9NH 3L9BA 1CGUA 2YRZA 3BAXA 3KPRB 3S3CB 3WEXB 1JYNA 1VIWA 3OKEA 1IEBA 3DOHA 5ETUB 1G6RA 4TL4A 4J12A 2F6AA 2GK0A 5F72S 5DUML 1U33A 2GUYA 1K3ZA 3AU0A 4MXQC 4AUJA 3W2DH 4HS3A 3MDJA 4KHXH 3DX1A 2L04A 3QIUD 5DO2D 4AEHL 5BS0D 5DRXB 1HQ4B 1HL9A 4I89A 2ADJA 1MWOA 2QZ5A 1JPGA 2VDOB 2X42A 4KXAA 3ZHFA 5JYLA 3WE6A 1Q9WA 2NY0C 3RX8A 1JWUB 4AIZB 4F7MB 5EBMB 1VLXA 4H1LB 3TYGH 4Y5XA 3QQ9C 1GW6A 2LFGA 4MHHI 5AZEH 1RUMH 1C7TA 3ZIMA 5I30L 3F7QA 4LCUA 1WE5A 3RIFF 1XZWA 3TNMA 1L9TA 2CA3A 3U1SL 3DSFL 1UCBH 3WY4A 4K3HA 5CR1A 1AGBA 3UTOA 5C0FB 5AVQB 3V52L 4P49A 2G4EA 4JFQA 2IH1A 5CUSL 2KL6A 5DHVB 2AI0L 3AG3B 2IAMC 2FH6A 1T0NB 3WFDH 3MCLL 4KITB 2FYVA 4ONGH 1JNHA 3DMMD 4KROB 4TVPL 3US9A 3P0VL 5EOTA 3A6BH 1QHQA 4BFOA 1PFCA 3LPFA 4HFWA 4ZYKA 4DN4L 3UOAB 1KGUA 5E23A 1AQ8A 3GRBA 3O2VL 4HUMB 2AQPA 3GSXB 3K81A 1KIQB 2BMKA 3EADA 1YYCA 3A21A 5EEZA 2AS5M 3CU1A 1ADWA 4FQLH 4NQDE 2DQEH 4OTXH 1UZGA 4C55A 1K9TA 1NCCL 3DBXB 3K2IA 3HB3D 4JJ5B 3RTQB 3VXMD 2CDEB 3BCDA 4J7RA 4M61A 3GMLA 3HRPA 1A9BB 3SQRA 5DRWB 1E4HA 4BJLA 1F3RB 2V5RA 1F6AB 1CDYA 2VMFA 4NP4H 2NZ9D 4OLXH 3BJLA 2VDKH 3MUJA 5TQ2L 5FB8A 5KW9L 2P45B 4P4RB 5CP7B 2NXZC 3SIKA 4I77L 3FUEA 4MAYB 1RK1B 3W5NA 4FNSA 5A7EA 1NSNL 4WI9A 1AY1L 3HFFA 2GCYA 3JYBA 3N40P 4U6YA 1TXKA 4H8HA 4LMQE 4QRTA 5BJTA 3QYMA 3UDWC 4HMDA 4RRPA 4A63A 1IGFH 3ZN6A 4YBLB 1CE1H 1A4KB 1EJFA 4O5LH 3Q3GA 3U7YL 3ARBA 4YSRA 1G9ML 1P5UB 2Z93A 4ABWA 4NQDA 3V2AR 2VC2H 3MX0A 1RAMA 1GCYA 2GJ6A 4BGDA 2WMPB 1E4KC 4R96B 3GD1C 3BO8B 4YHMH 3DX0A 2J7LA 5GGTH 1SGKA 4KXZH 3QHFH 2AJ3B 4M5ZL 5FUCE 4Z78A 2BSDA 4DN3L 1LP9B 1PSKL 5F7AA 5CBAB 1PLGL 5ITBL 3NIGE 5SX5H 3ZSTA 1YEHH 8PAZA 3WHXB 3SGDI 4TF4A 1M05B 5C9KA 3DTDA 3CLEH 3IBOA 4OZIF 4JZOB 1JZEA 4X4KA 4ZD3H 3T0EB 4QTHA 5I1JL 3VD4A 4PBDA 4U1JA 4KU1A 4XGZB 3GGWB 4X6CE 3S3JA 4HOMA 3PDDA 3U30B 1BD2B 1RIVL 1N59B 2FZ3B 2VDLL 3O3BA 2PLTA 3V95A 2CKNA 2DIAA 2WBJC 2CGZA 3KCWA 4N8PA 4RFOH 3L9RB 3OJ2C 1NL0L 5I1HH 4MDIA 4MNQE 2NXYB 3OD3A 3Q2CA 1QTYT 5A40E 4RZKA 3SSGA 4O9HH 3FBKA 3T8XB 2CALA 3IJEA 3BKML 3HMXL 2WGXA 1AS7A 1J87A 1MLBB 1VEOA 3VXUB 5C0EB 4P46C 4Q52A 1O5PA 2Q6WB 3FB6A 1DBAH 5ITFA 4PJAF 3I2CH 3HZVA 3D8MA 1KELH 4PUBH 2WTRA 2VSKB 3RWGA 4K9EH 3UABA 5AB0A 3MLRH 4IYKA 1ORSB 4BHUI 4OCLC 1TZGH 1TG8A 2CK0L 2JKNA 2AJXH 4LHQB 1A7RH 1EZVY 5HDQH 2DQDH 4IDLA 2EE9A 4JFDE 1WHPA 4B9GA 2ETWA 2K78A 4Y1AB 2R0KH 5LG6A 3INOA 5CSZB 5FOJA 2WSDA 3LPGA 4UQEA 5DS2A 4K2UL 2Q8BH 3T1FB 5GS1B 4Z0XB 4PJCA 2R2BB 4O4YL 5HDLA 2QVFB 5FGBC 1MSPA 1YYLL 5TE6L 1HHHB 1G5AA 1EIBA 3U2JA 4XNYH 5FUZH 1S9VB 4KQ3L 4EIUA 1DBKL 1NGPH 1U3HA 2IADA 3G04B 1J5HA 4GRWH 4KPHL 4IEFB 4KVCH 4M48H 3VRLE 3IFOB 1G0DA 1E4JA 2GTWB 2ZOKB 5LCVH 1YEDA 4HXBH 3FTXA 2DWDA 3AVEA 4K7PH 1OPOA 1CZ8H 2B77A 4RAUB 2YLKA 3PG2A 2UXGA 1JV2A 5EWIL 4GO8A 3RVTC 3EBHA 4QLRA 4JO8A 1DN0B 3JQOB 3BP5B 1T6WA 4NQXA 1N5YH 2JCCE 4ZS6D 2WLKA 1QQDB 3MRGA 3AQZA 4I3SH 4KRPD 1GVIA 2WLYA 3FHEA 1RKRA 3K8MA 4NZJA 5JNYA 1YMMA 1JZ6A 2EYSB 4XO9A 4HGWB 2OAAA 1XQ4A 3NFPB 4OCSH 3L5WA 4RGOH 1THCA 5GJTL 1GGCH 2UY7A 3TBVB 5BVJB 4R0LB 5GGRB 3FNKA 1RPUA 3V10A 2D0FA 1YA5A 3HAEH 4LQFH 3L2NA 3GXTA 3G5ZB 1MZYA 3UROR 4LRNL 4V1DE 2NSQA 4PHXA 3LH2H 4PRHE 5EZJA 4LSDA 4MDRA 2J88L 3IU4L 1FLTX 3EH5B 4PIBA 5K9OA 1U8QA 3SGJA 3CWGA 2OJ1A 3LS5H 3ARSA 2BWQA 3CVDA 4GXUN 4X83A 3UCQA 4HPHA 1SYVA 1VFMA 4CC4A 1T3FB 4NN6B 5H2BA 4ZMQA 4YDIL 1N2RB 4G71B 1M7IB 2DIEA 4FQJL 1DVFB 3NEEA 4Z8FH 5I1IL 5IWLC 4MNGE 2RQEA 4P99A 1D5ZB 2WIIB 4MJ6B 4JFPB 3MV8E 3ZDZE 4PJHB 4ISVB 4QPEA 2PWFA 3Q43A 3C8KA 1UD8A 2JF1A 4X4MA 4X8GA 1K72A 1SJHB 2F7PA 3FFDA 3GNML 2Z65C 1A21A 3KPRE 3MLVH 4P3DA 2YPLB 3BVWA 5BVPH 3Q9PA 5TGBB 1DQQA 3W5MA 2BXYA 5EORH 2O6DA 1NA8A 1OCWH 5CJQL 5FHBL 1TQBB 4MLIA 4NO3A 3RPIA 4JRXA 4NB7A 4QT5B 3CFUA 4I87A 5D1QD 1QWHA 3CFBA 2ZE0A 4CGTA 3LZOA 2E9BA 2YUZA 4MZRA 4L4VB 4JFUA 2E75C 2OSXA 3QYCA 4L1BA 5DVPA 1A6VH 4MNGA 2J56A 3FT3B 4GS7B 5J8OA 4K4KA 1CD9B 1GYVA 2J3SA 4E41B 2BIOA 1Q9KB 3US1A 5DJXB 2ATPA 3PL6B 3CU7A 1K8DA 1T89A 5E8PA 3KPRA 2BVOA 5C3TA 4HIEB 4CMMB 3IGAB 4YNYB 4WO4C 5FYLD 1GA2A 2OMNA 3O4LB 4DUWA 5IB5B 3H6AA 1GHFH 2B9BA 4BSVA 2OMXB 3ATFA 3SCMA 3RA7H 3BI9X 3UBXI 1BCIA 1WBZB 4U7MA 5DRXA 1N6UA 2VSDA 1HQ4A 2WZ5A 5I28A 1H6EA 1EEZA 4ZUVB 4XMTA 5IJVB 1RUQL 3QUYB 4PRIA 3GHEH 4AV4A 4QNPE 4ZNEA 3ZR5A 2GVYA 5BZWB 3NTCL 1W0VB 2GKIA 4AIZA 3A5VA 1IIKA 4Y9BA 4F91B 4YDLC 3A6OA 3DGCR 2MPAH 1MDAA 4ICXA 5KN5B 4UT9A 3OV6A 4S1DC 1I1AB 1MCWM 3S5LB 4DGIH 3CFJA 2Q76A 3AREB 2A9BA 3EGDB 3N1FC 4KH2A 4MAZA 5CBEB 3KHOA 5JHLA 5GRYA 3ARGC 2VM4A 3MBWB 3L13A 3D30A 4QXGL 3DRTA 1ODUA 4D0DB 2BNQD 4YFDB 2BHFA 1ZS8A 3LZFH 1FV1A 1XH3B 3U4KA 5IMMA 1V7NH 3ZXAC 5I1CH 4URTB 3B2VH 1QYGL 3MBXH 1BYNA 1B3IA 3X1BA 3QAZC 2NY6B 5F7EH 4AVIA 5IESH 1RUAL 1R0AH 5FYKD 5GZOD 3L3IA 4LDCA 4MCYB 1G7HB 4QRRB 3KPNB 1FVEB 2N4IA 2HXAA 1S9KC 1YNTF 5HHMB 1KIQA 1CVSC 4JG1L 4L1SA 2WXJA 1OSZB 2A83A 1ADQH 2WYIA 1EZUA 4ZUSB 5LO7A 4JJ5A 4XO8A 2GJPA 1UZ8A 1UKSA 2XWBB 3O3EA 3CDCA 2FX9H 3FQXA 1MCNA 1OV8A 5DRWA 1AZUA 3P11H 4B7LA 1NINA 3V4PH 3TVMC 1PQZB 2V5YA 3TO4B 4P4KC 2B5IB 5CP7A 3NK4A 1RHFA 4WWKA 5GGUA 4MAYA 5FC9A 2E9WA 1J18A 3SQBA 2X1QA 4XMPL 4K9JA 4PJIB 3VJ6B 2LVCA 2Z92B 3BPNC 3D4CA 3T65A 4MXQD 8CGTA 4QRFA 4WHCA 1JN6A 5IG7B 3JT2A 4PJDF 1A4KA 3JV6A 1O5DT 1PY4A 2WXHA 3BD4A 2WQAA 2L3BA 1GYWA 1BD2E 2NY3B 2PR4L 4HUKB 5ESVB 1CBJA 1F5WA 2FHCA 5EUKB 5KYWB 1N4XH 1JPSL 2WMPA 2NR6C 4R96A 3BO8A 1CXEA 2AVFA 1KEGL 1AKJD 1I8AA 3NAAL 5K1VA 5AOJA 1ZLSH 2G3ZA 2EH8L 1LP9A 5F8QC 1MRFH 3SY0A 1KYDA 5CBAA 2WUCH 4YFLI 1M05A 3UX9B 2EIDA 3L4CA 2V2XA 1CLYL 5C0AD 3VXUE 4LPCA 4X9GA 4F8NA 3EHBC 4WFHE 1JGUL 5DJ6B 5A2FA 1F8TH 3T0EA 1WCQA 4OBRA 5IQOA 3CXDH 1KIRB 3GGWA 3GF8A 1L7TH 4Z95H 3TTSA 1EO8H 3MLPA 4N1EA 5E99L 4AT6B 1F45A 3S4SB 3QJZA 4PG9B 2IFFH 1Z1WA 4FCHA 2GBTA 3FFOA 2G5UA 2YRPA 5IVZB 4YSEA 4XO5A 5DJ0B 1IJ9A 5C07D 3L9RA 4BYHA 1TSHA 4KTDH 5C7XL 3TESA 4Y1AE 2BOLA 2XIIA 2FB4L 1KEMH 4Q9QH 2ICEB 3QWQB 3T8XA 2R4SH 3NESA 3SPVB 1HT6A 3VNYA 1SEQH 5GJSH 4YHOH 4GXVL 1T4WA 1MLBA 4IK6A 3T6XA 4WF7A 5C0EA 2CIIB 1F6FB 1FFPB 2L8AA 1M6UA 2FWSA 3J2PA 1CFVL 1JHLL 3TEZA 2AITA 2UXFA 3DBSA 2WJ7A 4O02B 2C9VA 1OK8A 4CMHB 1EHNA 2Q3AA 2CIKA 1ORSA 4GSDH 2WB1A 3LIUA 1X9QA 4HUCA 4Y5VC 4K71C 2NXZD 1JAEA 3P3UA 5T1DH 3VFMB 2DLGA 2W65B 2WVSA 2CLRA 3S0PA 3X17A 3RGBA 5BO1L 5JIMA 1XF5B 2GSGB 4WV1B 2YA1A 2C9UA 5CSZA 4DIXA 2BFVH 4LAQL 5DK0B 5E95B 2WAHA 4R8WH 5I23A 2F54D 1YEKH 4LT7A 5GS1A 5JZ7C 1DSFL 4Z0XA 2IPKB 4MMZC 2VXTH 4CSZA 4BKLA 1XGPB 2PUQT 3IGKA 4G9FE 1DVZA 3N3EA 1D5RA 5D2NB 3C87A 5CU5A 1S9VA 2L7UA 5JQ6H 2DN7A 4W1TA 4AXWA 2VZ1A 3G04A 5FO8B 1G7QB 1PVHA 4ELDA 2I9LB 3E1ZA 4IEFA 2DMCA 2XTJE 2Z31B 3ZKXC 1CF8H 3GSOA 4JM2F 1BOGB 4NFBA 5D6CA 1X44A 2FIRT 2AFNA 2DZEA 3QEGH 1A7PL 4CN6A 3MV9A 2RHEA 3N50A 1KBKA 2VW4A 4UTBL 3KGRA 4X7EC 3K2UL 3F01A 2PO6D 3T04D 3VNZA 5BUGA 4F27A 1PYWA 1WBYA 4Q9BA 3VFPB 4QTFA 5D5MF 4OFVA 2DQMA 1KXQA 1CYXA 5DJYA 3LNGA 4UILH 5AL0A 2J12B 1KGJA 2WBJD 1X4ZA 1EBPA 1SLXA 2FQFA 3P3TA 2V5TA 1QQDA 1E2ZA 3DX6A 4HUUB 4M7KL 4W9GC 4TTDC 4Y4HB 3UMTA 3PWPA 3DPDA 4OLVL 3TBYB 3PE9A 3LZLA 2QPUA 4AVJA 1E50A 2DQIL 3DYMA 4OJFH 4U2ZA 4RMVA 5KUKA 3L3OB 1NEUA 1GW0A 4Y1SA 1QEXA 4JDEB 2F53D 3IVKB 1KZYA 2WWNA 1JWMB 1MI5B 4PJHE 4F1ZA 2VLKD 3HNSL 3Q5OA 2YXFA 2X2UA 1WVZA 1MCIA 3KM1A 4M43H 4OCXL 4LIQE 4ZUTB 2BSRB 4ZAKB 4DP8X 2YPLE 3MODH 4FDWA 1UA6H 3PGCA 1URLA 1GTNA 1MAML 2R69A 3E7JA 2J1YA 5ESAB 3OZ9L 5KSVB 4JHZA 1R3LA 3BAJA 1VPOH 4HETA 2FJHB 2VXQH 2IWFA 1F18A 4N0FA 1BBDL 2JE8A 2A74A 4ETQA 3IFNL 4L4VE 3WJMB 5BOZG 5KANI 3LKSB 4ZPVB 1DVFA 1IB5A 4GAYB 3ZE0F 4HIIB 1D5ZA 5EOCJ 4JFPA 3FB7B 4M1DL 3ZHDA 4XRCA 4E41E 3KWXA 3O9WD 2PP8A 2P48B 4K7PX 1QO3B 1TQCB 1SJHA 1KJ2H 2G2RB 4G8GB 3T6VA 3TH4T 4AGNA 2VLRD 5F2FA 2NNRA 2P5ED 1PX3A 1DP0A 2XDHA 3O4LE 5F0MB 2GQHA 1OLZA 2AK4D 1EK3A 2GFBB 2WOBA 1NLDL 4WUUD 3CFKA 4NM4H 3VGAC 3PREA 5FUOL 5IBTL 4ZSOA 4WJG3 3VG0L 5FYLL 1VCAA 2E7DA 3EYOA 5L9DL 4OD3H 2LU5A 4UQ2B 1YUKB 4H0GA 5J1TC 4EUPB 1N5AB 4M1GH 4LPYA 3UZQA 4NNXA 3VI4B 2P26A 3RVTD 3BHBA 4OLEA 4LNVA 1T83C 3CFCL 2Y7NA 3KR3H 4E41A 4RAVB 5DJXA 1NC4D 1PIFA 1UFUA 1Z5HA 2WYHA 2VXSL 3P77A 3PL6A 2LAGB 4LSRL 5E2JA 2WZPA 5GS2H 2GUOB 3IDXL 4OM0L 4YNYA 4FL4C 1MCJA 1VEMA 3OLIA 4RSYA 2WHVA 2Y4SA 1WK0A 2X9XA 4I48B 5F7FA 3EZJB 1MCQA 5IB5A 4DPCX 3BDXA 4U1LB 5BRZD 3MGOA 5B39B 1HEZA 3MRLB 3NA4A 2IGFH 1WZ1H 2NQDA 3B5HA 3BP6A 2OL3L 3QEQB 3T8MA 3QS2A 1AQDA 3A3YB 3QCVH 4XI5D 5JMOC 5IJVA 3QO0B 3C6SA 2R1XB 5DDHA 1FO0L 4ZFFB 5JMRA 3SGEI 2E9JA 4ZFOA 1MWAL 5DI8A 3UJIH 5D96C 4XNZB 1RQ5A 3KG5A 1MG2C 2BS71 4JG0L 5BZWA 1X9LA 5E4AA 4GLRH 3UACA 4KHXL 5L0QB 5EUOB 2G0KA 4QRRE 5IM7B 1JBJA 1R3JB 3HNTL 4GUPB 5HHME 2HTKC 4APQC 3T2PA 4ZZFA 1ET5A 1KTRL 4D3CH 4OFKA 4H1LG 1BF8A 1JZDC 3U6XS 2IWGA 4YDJB 1XCTA 2OMUB 2YPVA 2ZSWA 3K8KA 1TETL 2AEOA 5CBEA 2YAEA 3HBZA 2X53A 4PY8J 4TSCL 5HPMB 3MBWA 3ABGA 5DZOA 4O58H 1MW0A 3V0WH 3M17B 3TYGL 1B2WH 5JUEL 5EU6D 4D0DA 1GL4B 3N06B 2AQRA 2EACA 5ISZD 1DHKA 2Y3AA 4BZ2H 4QCIA 2YBRB 1UJTA 3L2MA 3FB8B 2YGQA 4ZPTA 1WH0A 3GMMB 4PFEA 4PJIE 3BRGC 5F97E 2OTPA 5F0JB 1KYAA 3MV01 2YKKA 4Z7QF 5K1NA 1KUMA 3L1OH 1G7HA 3QP3A 2HJKA 4BFJA 3KPNA 4KNQA 1FVEA 2BSTA 2OW6A 4UNUA 4E9XA 4MKMA 1S7RB 2VAAB 2XXMB 3JV4B 1YNLH 3MU3A 5CCKH 5KBPA 1UWGH 4MD4A 3IU3B 2OSLB 3WFBH 4F2EA 1MUJA 5BUAA 2BINA 4X8XA 2B0SH 4GI8A 1ID5I 4ZDHB 1J9CT 1R33A 2ZWLT 5T3ZH 1U2HA 4TL5A 1PQZA 3O6FC 1J8KA 4MD5A 1U21A 1JZ8A 4HF5L 4ERSH 1YQVL 3ULVE 2W92A 3M45A 2YZ8A 3FYIB 3HPLA 1SOSA 3EYFB 2P47B 3K80A 4WO4D 3II1A 4WCYL 5BV7C 2ROXA 1E3ZA 4PJIA 3VJ6A 3HR5A 4UDTB 4ODTL 3A0OA 2DM4A 3CZEA 2EIEA 3NFSH 1Z5YD 4P5SA 3CSPA 5FA4A 2OLDA 2X38A 2AJYL 2OX5A 3ZL2A 4HJGA 2MOQA 3VXRB 4NQEB 1J0KA 4GW4B 3X12A 3QBTB 5KYWA 4Z7WF 3GJFH 3BWAB 4KZCA 4MMYA 2EEXA 5J06A 5MENB 1JRHL 1OCOB 2F58L 1HXKA 4OLWH 1N7MH 2BNUB 3BZFA 4MXVF 2WYZA 3CFQA 4PJ7F 4H20H 4OLUH 1QACA 1SXBA 3VDCA 3FTGB 5EN2B 4YGVA 3QXDB 2CQVA 5KOVC 1S8DB 3BWZA 5F7WC 2Y7LA 5MEOA 2ICWJ 3FH7A 2BP8A 2JB5H 3P73B 5ERWB 1D6EB 3QH3A 1CFNB 4KMQA 4S1DD 1P4BL 5GSRA 2VC2L 3WTXA 5KJ4A 4F7PB 1HK6A 2WKGA 3TIEB 4JRWA 3BC9A 1A5FH 3PIQA 5HDRA 2KQMA 4XP4H 3HN5A 3UTZB 5DJ6A 3T3PF 4CSSA 2D9QB 3AW5A 4LLUB 3MCG1 4B95C 5E70A 1OP3H 4UYQA 1GGBH 1VACA 4FQQB 2ZAGA 4PG2C 4DERA 2JI2A 2VRAA 2IGTA 3K6NA 4AT6A 4WEMB 3MJ9L 3EZ8A 3HLAA 2OJEA 2EKJA 3VWKB 5IB1B 4PCYA 4W9LC 3MRNA 4QGTA 5GRJL 2DJ4A 3VQMA 4RGMC 1CDIA 4XPFL 1GYAA 2JKXA 2W95A 1CB4A 2XQ0A 4I18C 5DHEA 4J6RH 1VENA 3C6LC 3FQUA 4NWTL 1I3GL 2NNAB 4KZEH 1U58B 1FH2A 5EBLB 1AYRA 4PM1A 5D2NE 4GH7B 3RWFB 3PP3K 1ML0A 4G5AA 1JTTA 1FFPA 4PWEA 5D7JD 2VDQH 5FXCH 4JGMA 3H2QA 4O02A 3TVMD 2IWKA 3LEVH 3OC8A 5DHYA 4FX5A 4K7FB 4P4KD 5HVWA 1BJ1H 3P3RA 2W65A 4LEXH 1G5GA 1J1XH 5LQBL 4BRVA 1DBAL 4WV1A 5GRUL 1FPTH 2PW1A 4LLDB 3U0WL 2CK2A 3PV7A 1KELL 4YLQT 4KAQL