3QZBA

Crystal structure of a putative superoxide reductase (tm0658) from thermotoga maritima at 1.10 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
131
structure length
131
Chain Sequence
MKLSDFIKTEDFKKEKHVPVIEAPEKVKKDEKVQIVVTVGKEIPHPNTTEHHIRWIKVFFQPDGDPYVYEVGRYEFNAHGESVQGPNIGAVYTEPTVTTVVKLNRSGTIIALSYCNIHGLWESSQKITVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative superoxide reductase
publication title Crystal structure of a putative superoxide reductase (TM0658) from Thermotoga maritima at 1.10 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
total genus 28
structure length 131
sequence length 131
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2011-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qzbA00
4C4BA 4D7PA 4BRVA 2JI3A 4BFFA 1DQIA 1DFXA 2JI2A 1VZGA 4BK8A 1DQKA 2AMUA 4C4UA 4BGLA 3QZBA 4BRJA 4BFJA 1DO6A 4BV1A 2HVBA 2JI1A 4BFKA 1VZIA 1Y07A 1VZHA
chains in the Genus database with same CATH superfamily
5KW9H 2UZPA 5HGBB 1MWAA 4YHNA 5SWSE 2Q3ZA 4OFPA 4IS6A 3H3BC 2P49B 3ULVD 1VB9A 3QWNA 4CAGA 1UB5B 1TEYA 3MCKB 1GGIH 4PRNB 4G5ZH 3RTQC 1KWGA 5D7SH 2D73A 4YE0A 5SV3A 3RUGF 3GBNL 1C5CH 32C2B 3N41F 3X12B 3FXIC 5F96L 5IF0A 1SFDA 4OCRH 3UAEA 2X1QA 4I89A 5IB1A 3WY2A 3F58H 4F1SA 4HK0A 1P4BH 1VZHA 4ZMAT 5D1QD 4FADA 4GP8B 3K1DA 3FF8A 3KLLA 4PVBA 5JHMA 4U7SA 2IFFH 1N9PA 1QEXA 3OG4B 4IRZA 4KX8A 3SOBL 3KNBB 4XAKD 3S36H 3T09A 2ADIB 1XV8A 3BLKA 1JCVA 4X5XA 3GQFA 3NFSH 2BZCA 2X0UA 3T5WA 2AEIT 4HIEA 3R4DA 2BDNL 5ITFA 2NY5C 4OT1L 4YX2L 4BKSC 1HWWA 2EYRA 5AVTB 2D8KA 1BF2A 5AKRA 3RL2A 2FO4A 2YAMA 1NBYA 4K2UL 4WHTB 1LEKA 2VDNL 4P5KB 3V55A 3NPSB 1U92A 2AJ3A 5GRUL 3U9WA 3RGBA 4J6RH 3D3VB 3MLWH 4NYLB 3HHRB 5GSRA 4J12A 3SGDH 1IQDA 2ARWA 1PY0A 4KTEH 2X4UA 1HI6A 3DARA 3K6NA 4RCAA 4LKXA 5DJ8B 4ILDA 3S5LB 4FNQA 5AKTA 1FUNA 3FAXA 3I75A 2NX5D 25C8L 2BSSA 4XWOD 4J8RA 4A37A 5L9DL 4XMKL 2UUDK 5EWIL 2J3SA 1OAJA 4DP5X 4QO1B 4PJBA 1KACB 2FIKB 1TNNA 1UASA 1YY9C 4M8QA 1IE4A 4ELMF 1SJEA 4OD3H 2EEDA 4YLBA 2ZOWA 1RP8A 5KSAD 2F5AL 2BOCB 4Z7VE 2W80C 2BW4A 2HFFB 4NRZA 1QFWL 4G6MH 5DFTA 3O45A 4FEIA 1W8OA 1IGJA 1G1CA 2EDHA 2WGXA 2OMTB 3NCFB 5D7LA 3MRBA 4EJ1C 1ASOA 3FQRA 1HH9A 3MUZ1 4WWKD 2EACA 2VZ3A 3UPCA 5GISL 1NCWL 3FT4A 2QSQA 3SBQA 2EE2A 3MYJB 4N28A 1FN4A 4QY8B 2VQUA 4PYHA 3IDGA 2DBLL 2NY5L 4NPJA 4N87A 5DR5H 3P9MA 1LP9F 3VFWB 4RFOH 1KXQA 5L2KE 1PNDA 1HT6A 3MX0A 3UGEA 1XTMA 1WYJA 3FBKA 1JGDB 3ZMNA 1MF2L 1LWHA 4D0CB 4R0LA 1SJHB 4XHQA 2R1YB 3BRFA 5IIEB 3BVDB 3C5SA 4H25B 2P9RA 1ZLUH 4MCNA 4AY0A 1CLZL 5A6IA 2YAOA 3GMNA 1RERA 3FSAA 1WZMA 4KDVA 3V5DB 1S8DB 2YPLA 2QQQA 3FRPG 1QD0A 1QSEA 1SFHA 2W65B 3NZ8A 2HXAA 3I74A 5FYJL 5JXAL 3BUPA 2OM5A 1KTJA 4HWNA 4IOIB 4NM4H 3ZT7A 4I48B 4H1LA 4JGMA 3AJ7A 4M5YH 1OP3K 3ZYIA 5F7EH 4DPCX 1K8IA 1KJMA 2LE9A 3MFFB 5KN5A 1V10A 2PP9A 2QMKA 5E6YA 3ROOA 4Q52A 2AV1A 1NTDA 4W81A 4LSTH 4NC2B 1E30A 2YWYA 4G70B 4GY4A 1L6ZA 4X5RA 3SKMB 1QI4A 4Y9FA 4WO4D 4ZAKC 2OZNA 4NZRH 2WYIA 5KVGE 1LO3H 4Y5YC 1GMIA 1WC7B 4KTDH 3DETC 1IEBB 4AKOA 1TNMA 3QNYA 1NGYB 5C0CA 2AJVH 5DA0B 2AANA 1YEKH 2C26A 2R29A 5JHDD 4ELDA 5I1LA 5IB3A 3HLKA 3WS6C 1AR2A 4L2YA 4N6RA 1K4CB 2WXJA 1MCJA 2Z31C 1FZMB 1CK0H 4JZJB 3KJ6L 4R2GB 3RIFF 3F5WA 5D2NA 5DK3A 4JCWA 4JFYB 2VZTA 3AXLB 3MV11 1WWWX 2X4PA 4OZFH 3UZQB 3VA6A 5DJCA 2ZWYA 3D0AA 4MLSA 4L1SA 2R4SL 4F2EA 3DXAA 3AU1B 4M5SA 5DWPA 1CLYL 3HNVH 2WD0A 5E1QA 4HPYL 2V37A 3D2TA 2WTRA 4NDMA 1ES0B 1AGCA 3QFGA 1DBAL 3D4YA 1DBML 3JVFC 4WJ5A 4LOEA 3WJJC 4B3VA 1R3LA 2GAZA 1T5WA 3IM1A 5F96H 4LASL 3TGXA 4TPRL 2VN5A 4BK4A 2OR9H 2Y1VA 4WFHD 4HMEA 2GEEA 3ULUL 2V7NA 3QYCA 5GGVY 5HGGS 3SOBH 3DI2B 4UNVA 5JZ7D 2AKRB 4HDIB 4BUGA 3X3FL 3JTSA 1PG7W 3AREA 3X13B 1AI1L 3DVNA 4OM1L 2HVKB 1F3JA 4OT1H 4YX2H 1RJZA 4FXTA 1A3RL 5L6YL 1NBCA 3KPRD 3A6CL 1KYOK 2ORBL 3DO4A 5E4EB 2F7RA 4K2UH 4NQCD 1KTKE 1FFTB 4U1KA 2VDNH 1YY8B 1QASA 4JFFD 4CADB 4EN2A 1MCHA 5DJ0A 4EKJA 4X7CC 4ALAL 5GRUH 4JRXE 5AOJA 2WTOA 4WFGD 1IAIL 1A6ZB 3BAIA 1G94A 4N2KA 3FHEA 5MI0B 3BPLB 3TH3T 4Z7NB 1R5VB 4QKXB 5C0AA 4AEIL 1RUKL 1M53A 3P9LB 1K3IA 25C8H 4P2YA 5L9DH 3ARQA 4XMKH 5EWIH 3MREB 5AVZB 5L2KB 1ASPA 5FYKU 5CLTA 4AIZB 2Y6SD 3S0PA 3IJYA 3E3QE 4PWEA 1U95B 4FFWC 3EZJB 4NP4L 2NSMA 5E2UL 4GRMB 2CWRA 2F5AH 3MLYL 5FECB 4FS0A 3DA0A 1G7MB 4LVNC 3VTTA 1QFWH 3LN9A 4DAGL 3C6LC 4JVWA 3DO7A 3F3HA 4M61A 3FUIA 3Q06A 3QUHA 3QQNA 1MWOA 4E42A 2VCOA 3SZKC 4NO0D 5GISH 5IB5A 3AC0A 1D6EA 1NCWH 3G08B 4N0UE 4CC0A 3D25A 2LOEA 3D51A 4Y1SA 3GB7A 3FT3A 5DFVC 2X4RA 2CK2A 2DBLH 2NY5H 3GEFA 2ADGA 2XDHA 3HZMA 1EANA 1RZ8A 3HJEA 4J3UA 5E8OA 4FXLA 2CO6A 4I0KA 4X42A 2R23A 4Z6AT 5L2JA 2A9NH 3EH4B 1NEZB 4LNVA 1KXVA 1T7YA 3LKPB 4MYPA 4BYHA 1ZVYA 4WDIB 4XZUA 1U3HB 4OIAA 5DXWA 4KO5A 5F88A 2Q6WB 1QR1B 1U30A 2ENQA 4HISA 3UCRA 4F24A 4AYBA 4NI6A 4WSKA 2ESVE 1QZNA 5J8OA 2FLRT 1CLZH 3Q9QA 4BCYA 3A4AA 1BFOB 1NQBA 3QPQD 4K5LA 1ML0A 1E27B 3NRPA 3P77B 4AUJA 1Q94A 2O5NA 4NWTH 5EIQA 1RMFL 5D7IE 3KYOA 1AY1L 4J3TA 1Z1WA 3Q2NA 4HIJA 3X3GH 5FYJH 4Q89A 3Q48A 5JXAH 5EA0L 1BV8A 3BFWA 3WN6A 4P5MB 3QQ3A 2EDWA 3MNWB 4KZCA 4A7VA 1MPAL 5IESL 1EXUB 4N2EA 1KJVA 3CXFA 5JR1L 5KOVC 4LLMB 1T1WA 5DRNA 3ZHFA 1YMHB 1RPUA 1JXJA 3QIWC 3GMMA 3LPOA 4YXHL 3OL2A 3X2QB 3V5HB 3NSXA 5B21A 4N22A 5HHQB 4JQVA 2OMWA 1ZS8B 1GJWA 5FV1L 1MWAL 1DVTA 5JHLA 1SN0A 2X40A 3QS3A 4IBYA 4O2FB 4BZ1A 5GS2H 3S88L 2ZG3A 3CVHA 1HN1A 4RDQG 5IQLA 3BH4A 4LGPB 1PZSA 3N43B 3G9VA 3GSOB 2BWIA 1LEGA 1UA6L 4ZUWB 2D03L 3KJ6H 1IU1A 3RVWD 4I3RL 4U1NA 3US0A 3RTLA 1BW8A 4FG0A 4FD0A 2ICWI 4FN0A 5EOCL 4UI2A 4Y89A 4Z7NF 3NGBC 5IOPB 2R4SH 1IFHL 1WITA 3WKPA 1CLYH 1QBLL 3O6FA 1XXFC 4KJWC 4ZMOA 2WLNA 3AITA 1IC5L 1RSYA 2GSMB 1SF3A 3TEWA 3EO0A 3LPPA 4LLWB 1DBAH 2CK0H 1MFCH 4CKQA 1MCEA 3BQUC 3WV0A 4L1DA 1OANA 3K81A 4LASH 4PY7A 4TPRH 1DJWA 3W56A 3GBDA 3ULUH 5LGKA 1Q9WB 1JFQL 4FNUA 1FC1A 3LN4B 4AE0A 4KHXL 4MMXA 3TIEA 3KL0A 2Y25A 1Q0EA 3LZFH 1F4HA 3E6HA 5I8CB 1ZVNA 2OBGA 3X3FH 4HKBB 1AI1H 4OM1H 1U8JB 4E5XA 3TO2B 4MNGA 1F13A 4WUUD 1OW0A 5GGRA 4MNHB 3EUUA 1A3RH 4PV9A 3TBSB 5L6YH 3A6CH 4ZMWA 2ORBH 3I02A 3LN5A 4GI9A 3WG7B 2Z65C 4CGTA 1QI5A 1OHQA 3L1EA 5GRYA 2QLYA 5E23A 5JMRA 2FWOA 4CN1A 3B7UX 4PG2C 5T3ZE 1SDYA 2E8ZA 1U2YA 4HHWA 5CZXD 4ALAH 1XF5A 3D07A 1JHTB 4AGOA 4UM9B 1IAIH 2C9PA 2ZYSA 2R15A 3MKKA 3U83A 3OJVC 5FO7B 2JIXD 2WXGA 3EW3B 3MMEA 1BBDL 3NOIA 1RUKH 2R69L 3D87B 4TLSA 2B5IC 4U4BA 1T0PB 4W4NA 5IJVA 1RL1A 2Y06L 1J1XL 3B2PA 3O6KL 4JFDE 4ZW8A 2ZAIA 1TLKA 2B08A 4XTRD 3DHJA 5B3NA 2OSYA 1KTDA 1N0LA 4FLQA 4JE0A 4PBWD 4NP4H 4N8VA 3GSRB 5E2UH 5C71A 1MG2C 3MLYH 2JI2A 3PL6C 3PWPA 1MSPA 1T89A 3UTSD 4LCVA 2XX0A 3ARGC 4O02A 4DAGH 4QNPF 1E4KC 1B2WL 5CJXC 2CRIA 5E8NB 1U8CB 1V27A 4BV1A 2VIRA 3STLA 5D7IB 5IVXA 2YD0A 2ZUUA 4I2XE 4JFED 4W9KC 1CICA 2CHWA 2UXGA 4WJG3 1FG2A 3CBKB 1B4RA 4NZJA 1KMGA 1JF5A 1N70A 2PWGA 3BKCL 4U6TA 3COOA 2O5YL 4GSQA 3FQUB 3P69A 3LD8C 4U3XA 2WO2B 1NAKL 2VLKA 5BQ7B 2Z7UA 3OR6A 3QP3A 3T3ME 1KCRL 2DRUA 3N43F 4JRLA 2X2YA 4YE4L 4MQ7B 3M17B 2FX8L 2Y1YA 3LV3A 1N6VA 2WOYA 3QJXA 1MCWW 4X4ME 5CU5A 5E9DE 4NERA 5DHYB 5GIRB 3TBTA 1XB3A 4M7LL 4ZFOL 4NUJA 3FW6A 5GS1A 5C6TL 5DC0A 3ZRCC 4HPOH 1AR1D 2DQ6A 3DROB 5AW8B 3EJQA 3I3DA 4X4XB 1FZKB 3T2PA 5BO1L 3IVKA 3D7PA 3QZPA 3G04A 5E1HB 2XXCB 4ELMA 4W4OC 2XT1B 1XCWA 3T0EA 5GRJL 3D0LB 1BZOA 4OJEH 4H40A 1BP3B 1RMFH 2RHEA 3C6EA 2E6JA 2OJ1A 2YD8A 5EA0H 3CX5K 1PY9A 1ZLUK 2XKSA 2B16A 2WXLA 5IESH 3BPOC 5JR1H 3QI9D 3LVTA 4YXHH 2BNQA 4LVOC 3MNVA 2PPDA 3S34L 1OGAB 3EDKA 5EFIA 4DCQB 4YVNA 1U8QB 2Z92A 3B7YA 1PIFA 5IK3B 3BWUC 1YEEL 3HRZA 1LP9A 1GMEA 3RKDD 1ACZA 1J12A 1HHIA 3MKGA 4QF1A 3S88H 4HUNB 3GSWA 1MCIA 2DWXA 1DJZA 1E4WL 3EBAA 4JDVA 4CA4A 1UA6H 3ZSSA 2D03H 1EEYB 4I3RH 3ZZQA 1H3GA 3LZRA 2FB4L 1NA8A 3ESMA 4KH2A 5EOCH 4UINL 1KCVH 1IFHH 1MHEB 1ZK9A 3AG1B 2KZWA 1BMWA 1QBLH 3HG1E 2KL6A 4PRNA 2WYTA 4AQ1C 1IC5H 5J1AA 3N0PB 2V9TA 1C08B 4PU2A 5DEZA 5F72S 3WEXA 3DYPA 2G3NA 3DUUB 5F0PB 1MIEL 2NDFA 4TKWA 4PSRA 3KNBA 1IM9B 1A22B 3HBGA 3EXJA 2V9RA 3RU8L 4KHXH 2H1XA 3L5XL 2ED7A 4GQRA 5D7IF 3UTQB 1THCA 1CURA 3E8UL 2J1WA 1BZ7A 5FDWB 4NKOA 3PWVB 4IMKA 5IMKB 4G8EB 3WEAA 3BIKA 4MB5A 4Q58C 1TJXA 5EIVA 3Q2CA 3QB7C 4R5TA 2BIPA 2DYPA 2AJZB 4H88L 4I2XB 2UWEE 4NYLA 4FXGB 3TVMA 1UXWB 4XO4A 3MRPB 2PO6C 5KSVB 1CU4L 4O9HL 5DJ8A 2JKRM 3NK4A 5E6RB 2HUHA 3OKDB 1BBDH 1KN4L 5IQ7L 2R69H 3GLDA 4QO1A 1MNNA 1CDBA 4UQBA 2WLMA 1AKJD 3F7VB 4JZNA 2Y06H 2C4FU 1J1XH 3O6KH 2F74A 3CVCA 4I3GA 5E9DB 2MKLC 3WEBA 5E0FA 1HEJC 4LDLB 5I28A 2HFFA 3KW7A 3UTTD 3CDCA 2A83B 4OF8A 5FLVA 2OMTA 1TQCC 3IJHB 2JCCE 3FCSA 2WINB 3NN8B 4HUMB 3HUJE 1LE5B 4KNQA 4RGND 2IH8A 1B2WH 3K2KA 3QE5A 5CZVH 4PJCA 4A63A 1ZHBB 1AG6A 1S7TB 4X50A 5C0BD 3DRQB 5INDA 5TE6L 5B38G 2NNAB 4MFHA 5HHPB 1A1MB 1K8DA 1GYUA 4Y2DD 1AGFA 1RKRA 4HEPG 3VMPA 2WUCL 3BKCH 2IDUA 2E7BA 3ZZ1A 1UWGL 4RFNC 4P3CL 4XNZB 4HJ0D 1NAKH 3VCLA 3JVGA 4HAFA 1DP0A 1KCRH 3OXSB 4YE4H 2YGQA 1WBYA 2V3DA 4P2RE 2FX8H 3TIDA 3UYOD 1RHHA 1UATA 2R1YA 2FECL 5E00B 3KDMB 1VADB 5C6TH 3D85B 1YEGL 2EXWD 1JZDC 4M7LT 4MRBA 5D96B 1GW0A 2D31A 4WV1B 3V5DA 2HRPL 3W11C 3QIUB 2XWDA 3H2WA 3FL7A 2P80D 4X6CB 2BWQA 4OJDH 4XNDA 1J48A 4U1SB 2QPSA 1XCXA 3G5ZB 5GRJH 5FPIA 3MCG1 4IOIA 5SWSA 4A38A 1J0IA 4X2UA 2VC2B 4XOAA 4DIXA 2GITA 3APNA 4Y19A 4A04A 3FCTB 1PQZA 4HUWA 4ENZA 3VD1A 5JW4N 4D0DB 2F7PA 3HEIB 2B1OA 3HG1B 4L05A 4GW4A 3OR7B 1SYVB 1OB0A 1OSEA 3SKMA 4AV4A 4S1SH 3MRGA 1LO2H 3PAUA 4OGQC 1J8KA 1WC7A 1URIA 1OK0A 1IEBA 1YO4A 2VQ1B 3S34H 1KBGL 3LDBC 2GVYA 1E8YA 4OJYA 2G60L 4ISVA 4JN2A 1YEEH 3VXUB 3O2DA 2V3FA 5B3JE 1K4CA 4IEFB 1UD5A 2GPZA 4F3FB 4WHDA 2HT4C 4YSEA 2CZNA 3PRZA 4GB9A 4JZJA 1UM6L 5DZVA 3TEYA 1LDPL 1E4WH 3PHSA 1HS6A 5TH2B 2BP5M 3NT0A 4ABVA 3UZQA 4GUPA 2X89A 4OVVA 2FB4H 2H3NA 5BUGA 1NIEA 3AU1A 4F8TA 1PIGA 4WSJA 1HSAA 1X5IA 3OJDA 2IGLA 2AJXL 1LNUA 1ITCA 3MCYA 1ES0A 3S3BB 2LU7A 1JAEA 3IPFA 4UQDA 5B1AB 1D5MA 1E3ZA 2GTWB 4WFEE 5TDOB 5CM1A 5AW7B 3BRDA 1MH5B 2EXTA 2PUQT 1GZHC 4KRPC 1P5VA 1MKFA 3U0TB 5DZJA 2BY3A 1MIEH 5DMYA 1KXTB 5JQ6L 3PWNB 3BN3B 4N9OB 4CVUA 3P3UA 1BVNT 4OBRA 3X13A 3L5XH 1FGNL 1WSST 2I5YL 4XT1C 4Z7VA 3B43A 5DJDA 4BQ6A 4FYQA 3QUMB 4EI0A 4UZUA 2NXYD 4G71B 2IPTL 3GBEA 3LKRB 4LVEA 4QXGL 4BQ8A 2ZZUT 2J1KA 1R24A 1GOHA 2DD8L 2HN7B 3HUJB 4QRPE 4ERSH 5E9NA 3BX7C 1GOFA 4C54A 4CADA 1SF5A 2P43B 3CDZA 4GO8A 2OV0A 2XKUA 5DK0A 3RNQB 4FG6C 2K45A 1H9VA 2WOBA 2MWCA 1NM4A 2JV6A 4JM2D 3BP6B 5ACZB 3DV4B 3OMIB 5I71C 1U8PA 4UQCA 4DZ8A 3U4BL 1CU4H 4O9HH 1DVFC 3CDGA 2VDOL 5DD5L 2ICCA 4QYAA 4YDMA 2AQ2A 5L2KA 1NC2B 1AQKH 1KN4H 3P11L 5IQ7H 3K8LA 4OTXL 1IKFL 1KGXA 4X6CF 4YHLL 5LUMA 1V05A 1U95A 4WK2B 3UTOA 4P2RB 3VXMD 4YZFE 1T2XA 2H4EA 5FECA 3TWCL 1ND0A 5HP5A 1REIA 4PBXA 2IDQA 1IGYA 3EG9A 1Z3GL 2Z4TA 3TCLB 2FUQA 2IJ0C 4IBTA 3K71B 1S7RB 1P6AB 3CSYB 4MAYC 2XY1A 4O2EB 5CFAA 1TZOA 4JCMA 4M8UA 2EYSA 2R4RL 4N3UA 2QR0B 2AXFB 2C9VA 3WIHA 3WYRA 5J5EA 3GMRB 1DBJL 3CN4A 4LARL 5TE6H 4FLRA 1NFKA 1SJMA 2E8YA 4EVNB 3AW5A 4OKDA 2WUCH 5K1JA 3KVPA 5ITBL 5CWSB 1Q0YL 1UWGH 4TNEA 5EZIL 3BUIA 4P3CH 1L5GA 3MZTA 4X6BA 1E5YA 2X4QA 4KUZL 4FQXB 1WWBX 4WDIA 2P42B 1OE3A 1E9OB 3RP1A 2BSRA 2IXQA 1QR1A 4JUSA 1Z32X 2DL9A 3TO4D 2WVSA 3S37X 3QEQE 1AD0B 5FYKE 1YN7B 5I18L 1LGVA 3O9WC 1YEGH 4FERA 1BFOA 4N0FA 1CYWA 2HRPH 4FLSA 2H2SD 3TN0C 4LRIC 1YA5A 3MRFB 3B7TA 1FL5B 4OF6A 2F1BA 1UCTA 3GEWB 2H6PB 3B9VA 2CR3A 1PLAA 4XNXL 3TFKC 2MOVA 5I73B 4P5MA 3QG6B 3SGKC 3BLBA 3PIQB 3A22A 5KOMC 4S0TD 5EMYA 1ZMYA 1LQBC 4KK8D 4LLMA 1A6WL 4AQAB 5K1VA 4M1CD 3V5HA 3M1OA 1I8AA 3C5ZB 4GI6A 5HHQA 4DUVA 4I9XA 4XPHL 2XTLA 5F89A 3U9UB 4BXVA 3NSFA 1EXHA 4X5PA 1KBGH 4PJ5B 4UQ3A 2L7EA 3WKYA 2GEQA 5D9SB 2G60H 4A67A 3D4CA 5I75C 4EQ2A 3HUJF 2FJGB 3CCHB 4KNTA 4N2AA 1LK2B 3GSOA 4DEPC 1GH7A 4L5FL 1DJHA 4ECNA 1UM6H 4ODUB 1LDPH 2MMXA 3MRNA 2NYYC 3FFCB 1U8NA 4NO2B 5CCHE 2HVJB 3ETSA 2AW2A 1KENL 4UOJA 1L9OA 1FNGB 4H20L 4R7DB 1IAKB 3HHSB 1CBJA 5AB0A 1YLBB 1AOZA 3C5XA 5J11B 1I1FA 1FYTE 1EPFA 4JRXA 4Z3JA 1J1OH 2FJFA 1OE1A 3SDDB 4DKFL 3CFCL 1JS4A 4RBPH 4QHKJ 5C2BL 4FQJL 4FFTA 2ZUXA 4LP5A 3TH2T 3VXPA 3L6FB 5FWQA 2GB2A 2IDTA 5D1ZI 3T71A 5CFHA 5JQ6H 1M71B 1A7OL 2O6PA 2DQFB 2IOOA 2WBJA 4JVUA 1EO8L 3EH2A 1ILSA 3GXNA 4P4KD 1JRHI 2N0MA 5A2AA 4LXFA 4E9WA 1FGNH 2I5YH 3TO2A 3KPOB 4XO3A 4GAGL 2APBA 1S7VB 2A4EA 1ZA3A 3GMQB 4TTGA 1Y7VA 2XA3A 4QXGH 5CUSL 1JPSL 1LXMA 4N90E 1HILA 2WSDA 5D1ZA 4KZDL 1ACCA 1OL0A 2DD8H 3FQNB 4Y4HD 2LTQB 2LU5A 4TLKA 2NY1D 3RTQA 5EBGA 4Y2LA 1T20A 1NCCL 4G43B 1JHTA 3LH2L 3L3OB 4N0UA 4HOMA 1EO7A 3D09A 4AYFA 3O2WL 2VDQB 43C9B 4PP2A 4JPIA 3S5YA 5EO1B 3U4BH 1IJ9A 5K9OB 4JL1A 1JK9A 2BFGA 3VQLA 4R90L 2VDOH 3V0DA 5DD5H 5B3JF 5EBWB 1WG3A 1OD9A 1XD1A 2NNRA 3W81A 1JWMB 2UXTA 1OALA 2TRYA 3MCLL 3D69B 3HW7A 4OTXH 1OHZA 1IKFH 4L8SB 2B7DT 3QZWB 1TYRA 4RAVB 4YHLH 5TGBB 1AANA 2YAFA 4PJGE 5J6HA 4OVUA 3CFBB 4KKBD 1MQ8A 5A16B 2ESVA 3QEQB 3TESA 3RB5A 3CN3A 1Z3GH 2ZP9A 1ZVSB 3CZFB 2O61A 5KAQG 2WVTA 3AGVA 4D9RD 1A1OB 2J5LC 4R2GC 2VZSA 4ELKA 4MCYA 3O4LD 4P59L 5FKAB 3C6SB 2CDFB 5K59E 4YDKL 3ARBD 2MJWA 4KUCF 5D7IA 3TYFA 4ABQA 3FB8B 1ACXA 3O41B 1KXHA 2R4RH 4AWJC 3K0WA 4HLEA 1OTTC 1DBJH 4LARH 3FQUA 3WNJA 1U3ZA 1S78D 2W59A 5L4MA 4L8CB 4OFDA 4AYSA 5ID0B 5ITBH 2EC9U 3GC3A 1Q0YH 2VRKA 5EZIH 4NHCL 4MQ7A 4FGMA 3MV8D 4LPTA 5F8RC 3NJFA 4Y4FD 4KUZH 4PG9B 3KYKL 1T7XA 2CR0A 3K46A 1OPOA 3L3JA 4QD2E 4XBGB 1DHKA 4G72B 5D4HA 1QNIA 3DROA 5LXGL 3AM8A 4X4XA 5T1LA 2ZUYA 4H8PA 2XY2A 5CEZE 5E6SB 5I18H 3IRZA 1YNTB 4YFLI 4OZHA 2YGVA 4B7IA 4NN6B 1THAA 5I0VA 4XVSL 1IL1A 4G8IB 4XOBA 1I9JL 4KRNA 4TF4A 3GZKA 3SCMB 1JV2A 1CLOL 2MH4A 4K8RD 4XNXH 2BIIA 1MFNA 3P4OB 4HIIB 2WZ5A 3INOA 1TJIL 1MCKA 1DQLL 2J25A 4W6XB 4NQDE 1T2QH 1A6WH 1X5ZA 4NT6A 1QFUL 4RGOL 8FABB 5M95B 2BVQB 3HC3L 4MB3A 2YQ3A 1FYTB 4X6DE 2QGDA 1GVIA 3RVTD 4XPHH 4OBSA 3WJLC 5MENE 1JGIA 4X5QA 1CFQB 4POUB 1J10A 3T0DA 3FTYA 2OULB 1PG7H 1TUPA 3PGDB 1OQXA 3FTZA 4DP6X 3BEWB 3WXWH 3GO1L 1T22B 1CXIA 2W5PA 4HJEA 3M45A 4NXSA 2XPGB 4WI2A 4L5FH 3REVB 3VFPB 3GF8A 3CN0A 3L4ZA 1C5DB 4Y1TA 3WJMA 2J4WL 1IBYA 1P53A 1NDGA 4TSBL 4UIKL 4PREA 4M3JA 1BLNA 1EWHA 1KENH 4YBHA 4AJ0A 1RH8A 3W3BA 2B4CL 4KJPC 1ZA6A 4E36A 1KYOJ 1JWUB 4G7VH 4H20H 1PSKL 3RYMA 1JPEA 2UVFA 4Q74A 4KWUA 1FNAA 2JK5B 1SOKA 3Q9PA 4FG4A 1W6WA 1C08A 5BW7C 3ZHDA 2VQ4A 1MLBB 1EEUA 4WO4C 4ZAKA 2AXGB 5JYLA 4DKFH 4Y5YA 3DX7B 3VI3B 5IJCC 2R2HB 5C2BH 1MCRA 4FQJH 2GQHA 3LNEA 1SVCP 3WS6A 3MRRA 4ZTOL 5IBLD 1WFUA 4JFDA 3AQZA 2XG5B 4KKCC 1UEYA 2GIMA 2Z31A 1A7OH 1U3HC 1Z6JT 4QHPA 1NLDL 4RMVA 4FA7B 1EO8H 2XVLA 2ZYRA 4H8HA 4PJGB 5FDWA 2IH3B 2QQKL 3QQ4B 4IGBB 4ZUVB 5HI3D 4GAGH 5IMKA 1XGUA 3O3EB 2YMXL 2NCEA 4JMNA 5EBMB 1HZKA 4P2OB 3L4YA 3WTSA 4G6KL 3U46B 1NSNL 5DD0L 4FULA 4LNRA 2YC1A 2ZKHL 5DRXA 1W8EA 3U0WH 1JPSH 3RGVC 4PLJC 4X0KB 2BY0A 5GS3A 2AJZA 5I6KA 4LPYA 4ZXBA 4I2XA 1TPXB 2J57A 3MRPA 2WBKA 1NCCH 5KSVA 3LH2H 2HKFL 3V95A 3O2WH 3QJVB 2R0WL 3SBWA 5LB1A 4OLYL 3OKDA 1YNTF 1UXLA 5IWLC 3PXHA 1PZ5B 2F6AA 4KKQA 3UMTA 3SO5A 5E9DA 4EUPB 1CI3M 3MCLH 4X4MA 3S4SB 2O30A 3VXSE 4PRBA 2VLJE 4EI6A 5KZCD 1GTFA 2Q86B 3KBHE 4JRYB 1NCNA 5GGVL 4AW4A 4HW6A 2WINA 4DWHA 1LE5A 1U0QA 5C0DB 5JOPD 4PN6A 2PYFB 3P73B 3QJRB 3V0GA 1ZHBA 3ML8A 4S0HA 4P59H 3VM7A 1W80A 4B6ZA 2RGSA 3HAEA 4RZKA 3GSNA 3CIAA 4YDKH 5C9JA 4P23B 3DRQA 1PVHA 5IVZA 2ZX5A 2VSDA 1E9PB 2RB8A 3NVQA 4WGVB 3VFRA 2X1WL 4J6IA 1I1AC 1KLUB 2XQ0A 3TJEL 2Z9TA 3TZVD 2BOBB 3PWJA 2CGYA 2WXIA 1QLRA 5DC4B 1P2CB 2D3NA 5KANI 4HIHA 5D1XE 4NHCH 2EH8L 5GS0L 2R51A 3QWQB 1IGTB 1BG1A 3KYKH 4LGSB 5EZJA 2W60A 1L9TA 4MMYA 2CBPA 4GXUN 5LXGH 4L37A 3W9EB 4XMUA 3V4VB 3QR1A 1BVLA 3BZFB 4H26A 5GSVB 2BRQA 3RWHB 1WJ3A 3HZKA 3HMXA 2FLMA 1E50A 4AQEA 1P84K 3G5ZA 4KO7A 4XVSH 3ULVE 4QJ5B 4HVBA 3CFTA 1I9JH 2IANE 3LB6C 2BLFA 1DUZA 3VI3F 1CLOH 4NIYE 3FCTA 4DKDC 4HUVB 2X4NB 4OD2A 3KH3A 1DQLH 5ID1B 3HG1A 3BWAB 3DDGA 5D55A 2H1PL 4LB8A 3U82B 1L0PA 1QFUH 1E2WA 4RGOH 4XAKE 3RWCB 2O5ZL 4WU5A 2VQ1A 3QR0A 3F6JA 1NCOA 1V3MA 4ZX3A 2FSEB 3RURA 1EUTA 2X3AA 1I9IH 5E94B 1XIWC 5CCKH 3UEQA 4MS8C 3F83A 2NXZD 4AIOA 5I1JL 5JOEA 4UTBA 4IEFA 4F3FA 3EYUL 1OTSC 4GT0A 2H1LM 3T6ZA 3QA3A 4UNIA 1FFNA 3GO1H 1ZE3C 2CBOA 4P4RB 4E9LA 4GO6B 1J9TA 2RAMA 5A40E 1U8HB 3NFNB 2X2HA 4X7EC 2J4WH 2J21A 1MCDA 3X11B 5BZWB 4TSBH 4UIKH 5K93A 4D0BB 5I0ZA 1FE8L 1CFNB 1HDMA 1CD8A 1I7UA 4ZO7A 1N6UA 2B4CH 4BHUI 3IKCB 5I76A 1M1SA 2NX5E 5BNXD 1T66D 2ZX6A 3VH8B 3CBJB 4QUOA 1N6QH 4NNXA 2UWEA 4YPJA 1DN0B 4Y7MA 4Y5XC 2V9UA 4PGEA 4FNRA 3U0TA 3SKNA 2YD9A 4DQAA 3PHOA 1P7BA 1ZLWK 3BO8B 1MHHA 3SODB 4FMVA 3NABL 1O75A 4BHUA 3ENEA 4ZTOH 4ZD3L 5I8EB 4RETB 1W2KT 1I85C 4J1UB 3VXSB 5KBNC 1NLDH 3CGTA 1A4KB 4ZX6A 3T04D 4Q0XL 2QQKH 1HEHC 4G7QB 5LGJB 2PXYC 2YMXH 2FJSA 2JCCA 4OQTA 3QQDB 4WI9A 4BH7A 1LE9A 3T4AB 2YUVA 3O8XB 3HUJA 1NSNH 4G6KH 2V33A 2J55A 4MD0A 5J06A 2ZKHH 3BGFC 5K1NA 2MNUA 1AGEB 2AJSL 3C87A 3A67H 4Y1AD 1FDLL 5ABAA 1D5XB 5H2BA 5I26A 3F84A 3DV4A 1QKZL 2DS4A 4UU9A 3T2NL 2CG9X 3BQUA 2DOCA 1WTLA 4L9LB 2HKFH 4YSDA 2JQAA 1BFSA 3IDIA 4RX4A 2COVD 1RI8A 3WLBA 5T3XL 4OLYH 4R3SA 1NC2A 5LCVA 4CW1B 3BD3A 4TNWF 5DUML 3H9SD 4UT6A 5D1XB 4ZODA 1HQRA 4P2RA 2F18A 1OVZA 4HC1A 8PAZA 3WL9B 4PBDA 2O6FA 3ZHKA 1SNRA 3TCLA 4ZFFB 2NY3C 3APFA 5HY9B 5JORB 5GGVH 1KULA 1S7RA 2YXWA 3CSYA 3X1NA 3EYQC 4H8WC 5DQ9B 3UZVB 1N5AA 4XRCB 2MCMA 4HBQA 2E75C 3EO9L 4FFYL 3KHOA 3NCEB 2MEJB 5IHUH 2AXFA 2YO3A 4FFZA 1MCPL 5ENWB 3UGXA 4PG2A 3GMRA 4PAZA 2F68X 5A7EA 4UDTB 2FGWL 1IBGL 1JE6A 1JBJA 3Q3GA 2E0PA 2RA1A 1XR8B 3SYPA 2LAGB 4JW3A 4Z3IA 5KBDA 2OJZL 3SYQA 4L4VD 5D1QB 3L13A 5AENA 2P5PA 5JW3L 4Z7WF 1N59B 1A7RL 1L0QA 2P44B 3KWWB 2EH8H 2XKNA 2GI7A 3U2SA 3MGTA 2WIMA 4LPXA 5GS0H 4G6FB 1S9WA 3PL6A 3WENA 2ENYA 4KK9C 5DO8A 5E8EA 5TQ0L 3LJ3A 2CKNA 3L08A 1YAZA 3QIBD 1NKOA 3MRFA 3RPIB 3IE4A 1LDSA 3G5XB 4N2NA 1P0SE 1RIUL 1DSWA 1L0YA 4NQED 3FB6A 4XX1G 3DXAD 4WGKA 1XGPB 3G3LA 3Q8CA 2EDEA 5D8JL 4MD5A 3B7RL 4I0PD 5CBAA 2VM9A 1NBZB 5BV7C 5KVDE 5HPMA 4ZUSA 3QFJB 3P0YH 3GSUB 3GPSA 4WFHE 2CM5A 2ZCKL 3T2OA 1XGYL 2GHZA 2NX5B 3C5ZA 4JFHD 1D5BA 1I3UA 2VDRH 2H1PH 3UIYA 3G6JE 1XZ0A 1IJNA 3HPLA 1EDHA 4A2GA 2UY7B 4MBOA 4GRWB 4HT1H 5KSBB 1HYSD 5KSAB 4QTIL 1AR1C 3HBZA 5ADPL 5I1JH 1ZEAH 5C07E 1HHHA 2GCYB 3EJCA 3DSFL 4UB0L 3TA3D 3DX0A 2FJGA 3EYUH 5F9JA 5IJBC 1OSZA 2EKJA 1J87A 4QRRE 5CMAA 5T3ZL 2YFOA 4WWKB 1J18A 5HJ3B 2XLLA 4JFFE 5IV2A 3E1ZA 1HK6A 2PP8A 3WUZA 1FNGA 3LNHA 4MASA 4WFGE 2ED6A 5EORL 4QRPA 1FE8H 2VXVH 3HHSA 3IGUA 3GRBA 4RNRA 3ECBA 1SHXA 5CP7B 5B1CA 1L9RA 4R4NC 3S36X 1BMGA 4XOCA 4DKAA 3SDDA 5C0AD 5AD0B 5T5NG 2YEZA 5F6IB 1UEMA 4BM7A 4GG6E 4N68A 5EU6D 5JYMA 2ALAA 1CYGA 2WVVB 1UM5L 5SX4H 4NRXA 4GO9A 2DQFA 3NABH 1NEUA 2QKSA 3QORB 1Y07A 4UT9L 4YMPA 4JPQA 4EIBA 4ZD3H 3ULVF 3TCTA 1C9SA 2CA4A 3BN9C 3VXNB 2WQWA 5EBLB 4IIZA 1TOXA 3JWNG 4Q0XH 1OLZA 1RULL 4LSRH 4RAUA 3ZRSA 1XF1A 5I15L 2ADFL 3QAZC 3QIUC 4ODWB 2X2UA 2QPFA 1WUZA 1J8HE 1EGJA 3OF6A 4F7MB 3MDJA 3AWGA 1B0GB 1X9RA 2Q7YB 2AJSH 4AQ1A 2BNUA 3RIFK 1FDLH 3L3OA 4B95C 4PRID 1GCYA 1QKZH 1KIRB 1CL7I 2Y2WA 3T2NH 3FQ4A 4OIIH 3VXQB 5J9PB 2OL3B 3MODH 5DD6A 3TYGL 3TBYB 1INEL 3A4FA 4V1DD 5K9OA 4G59C 3ZQWA 4PGCB 1FH5L 2B14A 5DLLA 5EBWA 5T3XH 5GHWL 4P2QE 3IDMB 4DP7X 1INDL 3DTUB 4HD5A 5JHDB 4C58B 2DN7A 5DUMH 4MB4A 2VDLB 3V0IA 1SDDB 1EJ8A 1R34A 2PCPA 3QSKB 3BAWA 3QDME 1GC1C 3JWDL 5T5FL 3FCUB 1G7LB 2W88A 4XHJD 1CG9B 5E6IC 5HGAA 1L6PA 1ZVSA 4Y16D 1SLUA 4OFYA 1A1OA 2E46A 2XTJC 2CDFA 2B3RA 3C6SA 3RL1B 3EO9H 3IGAB 4FFYH 4P2AA 4YBLC 4JJHA 4C56E 2P5WD 4PMFA 2A73A 1MCPH 1PCSA 1A3LL 4GRWF 1NGWA 5KSBF 4YHMH 2FGWH 4NLAA 5KYUB 4YDJA 3LNIA 1XH0A 3VSUA 4Z7UB 3NDZE 3UYRL 4G7RB 4HKZB 2HJKA 2R9HD 2XUWA 1IZKA 4WW1B 2OJZH 2BJMH 1KJ3L 2W0FB 3BKYL 3HS0B 3NRQA 1A7PL 4FDWA 5AVYB 2BNRE 4GXUM 3VFSB 1JZ7A 1A7RH 3G6JB 4DGWC 4MMZB 4XBGA 4FQHA 1ORQB 2JLPA 3DMMD 2VC2L 5E08L 3PWLB 3U1QA 4Z7OE 4YDLC 3PLYA 3V0VA 1YNLL 5KBLA 1M6UA 4FG2A 1LYQA 4Q6YA 5TQ0H 2UXVA 3KPRB 3ZO9A 3IWVA 4G8IA 1UD6A 3B2UD 1UUSA 4C83B 1UZGA 3ZKMD 4YGVA 4NQCB 1P5UC 1RIUH 2F8XC 4JFFB 1E40A 4O5LH 3BGAA 3P4OA 3VE0A 3O6FD 4G80A 4U6XA 5B39G 2UY6B 3IWUA 4LHUG 3B37A 3II1A 2YD7A 4RFEA 3NIGF 1TFHA 2DLIA 4YHKL 2ZCKH 4HJ0C 8FABA 2BVQA 1XGYH 1FYTA 4HSCX 4FFVD 3GK8L 2MPVA 1XQ4A 2V5SA 5AG8A 4PIRF 3BFOA 4RMSA 3L4WA 3AABA 1T0MA 4IQHA 4PLOB 4ZX5A 1HWGB 2VWEC 1CFQA 4FQPA 1A4AA 1MHPL 1OIOA 2BCMA 4J2XA 1G9EA 3L3HB 1FZJA 3QDGD 4R97C 5K39A 5C09D 2JJTA 4UB0H 5AUMA 1FWXA 3DSFH 4KXZH 3RWFB 3KPQB 5JPNC 3REVA 5A2JH 1U8LA 3KBPA 1C5DA 3EJUA 3MRKA 3Q1SL 1WF5A 4YK4C 4BDVA 4F7CB 4GMTL 3QEHB 1CE1H 1A65A 3S3DB 2JKXA 4X9IA 4M5TA 4EN3C 2FHFA 3E7JA 5KYYB 3CFQA 5F44A 5EORH 3RPBA 1XBDA 2N7AA 1MVYA 5F6HI 3E2HC 4G8GE 1KGJA 4X83A 2EDNA 2KQMA 1NOFA 3FQ1A 4HLJA 5TDNA 5F3HA 3C5JB 3IYLW 3TXAA 1INQA 3RJOA 1CQYA 3QUML 1FJ1B 2R2HA 1KTBA 4R6UA 1FZOB 4ODHL 5DD1L 1XR9B 4PRAB 3CDFA 5BUPA 3WXVL 3DVGA 3FUNA 2DQHL 1HXMA 2W0LA 4F7KA 1UM5H 1SPDA 3ISRA 3Q8BA 4OLEA 4ZW6A 4XVOA 4UT9H 1WZAA 2C3VB 3KW8A 4QTFA 4K9EC 4PJGA 4TSCH 4Y9GA 2A9AA 4N2HA 3F7YA 4PV8B 5E5MA 1P7KA 2EEAA 4R96B 1AIFB 4YH6A 4JFEE 2OTWA 1XGZA 4WNQB 1U8OB 4Z7UF 2ADFH 4BQBA 4BSWB 5I15H 4EZLA 2WSPA 1HAUA 1QOKA 5LCVL 1UADC 3VQMA 1Q8MA 4KH9A 4N25A 5E8PB 1CICD 4U1GC 4Q9RH 1H5BC 4ZSOE 3SO3B 3G6JF 4NFBA 3DJ9A 1LJMA 4Q14A 1WIPA 3UP6A 4AQZA 2A0LD 2MOGA 3LRHA 2V2XA 2VLKD 3CQPA 1GZHA 5B8CC 2FZ3B 4PTTB 3TYGH 5CN2A 1INEH 2ZNWA 3IRPX 3KL5A 3PFUA 1FH5H 4NO3A 1ACYL 1XF4B 4PJIE 1KB3A 2VO5A 4GQ9L 3KWXA 5GHWH 4QRQB 4EUPA 1INDH 1QRNA 2GFBB 4FFZL 3SDCC 4AENB 3BUTA 3UOAB 3GHPA 4JG1L 3EYVB 1XWVA 4KO6A 3VGBA 3B7SA 1KGUA 2Q86A 3IF1A 1UJ3B 2RD0A 3JWDH 4Z7OB 4JANA 1NJ9B 5T5FH 1KIUB 3C8KA 1C1EL 2WJ7A 3ARPA 1QBAA 4HXAL 5ICYB 2G30A 1P1VA 3T0ED 4GUCA 2HLFC 1PZ2A 1Y18A 2XBZA 1NWPA 2PYFA 4YAQB 2YD3A 3WFCL 4JHVA 3FC8A 5DRZB 3UJIL 4ZX4A 2VR4A 2J8OA 1CIDA 1C8PA 1YZZA 5I9QB 3VM5A 1BPVA 4RMWA 2OXHB 1YUHB 4ODXA 1G7JA 3B1UA 1A3LH 4WWNA 2YA0A 2OMYB 2B39A 4WWOA 4NQDA 1DVFA 1BQSA 1RK7A 3UYRH 5T1MB 5C0JB 1P2CA 4NQTA 4LCCC 4OD1L 1KJ3H 4N9GA 2M8XA 3BKYH 4PCYA 4X6DA 1A7PH 1PTZA 2J8HA 5FKPB 3LS4H 5MENA 2AZAA 4APQC 1T5XA 5E08H 4LIQL 3W9EA 2H2PC 3ZDXE 1TF4A 3BZFA 1YNLH 4WUUB 5GSVA 3WKQA 4YSSA 4W93A 3UZEA 1OAXL 1Z0MA 4NB7A 1CYXA 4YDIH 3NCJL 1JMZA 1YPZE 2NYKA 3GBML 2GK0A 3D05A 2WAQA 1BM3L 1F00I 4XO5A 3V0HA 4MWFB 4HUVA 4OY9A 2X4NA 3FU0A 4HGWB 4CN4A 3U36B 3RIKA 2VW7A 1RIHL 4EI5C 1GZQB 1D5ZA 2LTQC 1S9KC 3GLZA 3U6RB 3KPLB 4B96A 3ZZSA 3WTWA 4RMQA 1JF1A 4YHKH 4CUCA 4Z18A 5B7EA 3OPZL 4JREC 3GK8H 4P5TD 3MRHA 3KLAB 3U30C 1BXUA 5E94A 3EJPA 4FQQB 3VUAA 3DX3A 5AOIA 4N8UA 3ETBJ 1CDUA 4JG5A 4QRAA 3O9WA 1I1YB 1S7XB 2EC8A 1R46A 4A6YH 1Q4NX 3UTSB 3VSTA 1MQKL 5CLXA 2XQYA 1N8OE 5H37A 4EXPX 4LRIA 1UYWL 5CJ5A 1UT2A 4DP2X 4HS8L 5C0RL 3C60B 1SRDA 1Q1PA 3FULA 3WHE0 4PFEA 3OAYH 4ZMNA 2VXQL 2Q10A 4OUUB 5ESAB 4JFEB 4D0BA 2APWA 3SGKA 1EHNA 1MUJB 3V9FA 2IOMA 2BSBA 3IKCA 2VR6A 2K6WA 4ZSOB 3N9GL 2BPBA 1BXVA 1YEDA 1DN0A 2ZWKA 2B1HL 3VNYA 1MJJA 2V5YA 2VSCA 3QUMH 5KVEH 3UPRB 4HUXB 4Z7OF 1S7WA 4KQ0A 2QADC 4ODHH 4XN1A 3OGCA 2KT6A 5F21B 5CN1A 1NGPL 5DS2A 3WXVH 2HG5B 1WA1X 5HYSG 2DQHH 5ERWB 4P06A 5FGSA 5I8EA 2DPKA 4KXDA 4OFQA 3RWIA 5AVXB 4J1UA 1NUNB 1A5FH 3VXSA 4FYRA 1D7CA 2VLJA 4NSKA 4W9IC 5I1AA 2SEBB 4KFMA 2Z8VC 1EFXD 2XVBA 3GI9L 5FO9A 4BKTC 3BAXA 1MCOL 4H8QA 1X44A 4LLQB 3AG2B 5DLML 3M1BB 3EBHA 1E5CA 5LCVH 1ETA1 5A2FA 1F02I 3TASA 1SXNA 1DVYA 2WXHA 4NS0A 5KG9B 3MXWL 4I5BB 2APFA 3KS0J 4WGWB 2BINA 3QI9B 1AQMA 2XXGA 3BDYL 3AFLA 5FYKL 2YLKA 4HCRA 4LE8A 4PW3A 3UIZA 3WNLA 4TVPD 4M6NL 4GRLD 7PAZA 2CJSA 1G1KA 3BGMB 1KB9J 5IQNA 1ACYH 5D1XA 1FA4A 4GQ9H 3WFHB 3WDJA 3AT0A 4BSVB 1M7IB 2DIBA 5FUCC 1R9FA 3RBGA 2E27L 3W9DA 3MSPA 1JOIA 2GIXA 2ZSVA 1OPGL 4JG1H 4PJDE 3NSYA 1IGML 1YEIH 1U33A 4QT5B 4KZEL 5HI5C 1BFVL 1ZD6A 5L0QB 4HXAH 1C1EH 3ZDXB 3I50L 3UZVA 1HU8A 4QI3A 2DH2A 3CU1A 1WFMA 2DWEB 3GM0A 5C6WH 1S46A 5SWSD 3BZDA 4X7SL 3SB3A 3UJIH 4I3SL 4L3CA 3CSFA 3FT9A 3IDJB 5ENWA 4NZDA 4Y19D 2IANA 5EC2A 2WANA 5H35B 4U0RC 1LD9B 5EO9A 2JELL 1JNHA 4KV5F 1XR8A 3FTUA 3UG4A 3PV7A 4N8CL 5BOJA 2IC2A 3I3EA 3AQDA 2APSA 1E4HA 1BLIA 4MDJB 4OD1H 3KWWA 2JKTM 4DK3A 4S1DD 5J1SC 2WN3A 4KK6D 4YHOH 2IGFL 3A4EA 3M86A 2EEXA 5FV2A 1H15A 4IBWA 1P6FA 4KKBC 1O5DT 2CDGA 3LMJL 1ADWA 2P28B 4LIQH 1WFJA 5L4FA 2P8LA 4D8OA 5J1TC 1VRSA 3FOLA 3O0LA 3RPIA 1BD2D 2D4DA 1A9BB 1OAXH 2X89D 3RVVC 1D9KD 3NCJH 1BREA 5EOQL 1RZKC 1XGPA 2OI9C 3C75A 3GBMH 2UX6A 5A2KH 3OKYA 4S11A 1FV1B 2EIZA 2OTUA 4X98A 2FVNA 2FQFA 2R83A 1S78C 1RIHH 3CUPA 4JO4H 4MXVE 4X99B 2NX5A 3GSXA 3NZUA 1KYDA 1SVBA 4EXKA 2YRPA 2MTPA 2RJMA 3NSCA 4F7TA 2DWDB 3FZUD 3OPZH 4K5OA 2BIOA 2WLIB 3CK0H 1KEGL 3VXOA 2FEJA 1BVNP 2FEEI 1HZHL 3UTTB 2X4SB 1SJVA 1TQBB 3SDXE 4HX1A 3BUQA 1AS8A 3H3PH 1MQKH 5I6NA 4OLWL 1HSBA 3VWKD 1UYWH 4RGNB 4APXB 4NQSB 5C0RH 2DIJA 3FOMA 1S7QA 3KYAA 1XZWA 2RQ8A 5C0BB 2IAMC 2VXQH 2JKWA 1VKXB 4Z78B 4Y2DB 1MFEL 4JG9A 3Q6FA 1KYUA 3EJJX 4IBQA 4JKMA 4OZFG 3WELA 4MJJA 3ILPB 3N9GH 3LQZB 5FFGA 3K6SB 2FL5A 1WBXA 2EKSB 3GMPB 3FKUS 3VXME 2AAAA 4OV5A 2YA2A 5B1JC 1ETB1 2IPKA 3SE9L 4HXBH 1SY6L 2QSTA 2I25N 1XH2A 2E9GA 4XI5D 1RZJL 3VFNA 3NACH 2A9CA 4ZYKB 3FSVA 5EBLA 2D7TL 2VNCA 2Y3AA 4HV8B 1JNJA 4K3GA 3RAJL 3FH7A 4KKRA 3QXUA 4MYWB 2EXYC 1GYWA 3K4AA 3EOAB 3TV8A 3D0VB 2JKJA 1B3IA 2WBXA 3GI9H 1C7SA 3RFRA 3ARWA 4TVSa 1MCOH 2F54B 2FQDA 5DLMH 1QQDA 4F7MA 3EOTL 3IMBA 1B0GA 3RDTD 1VLXA 2YSSB 4AYGA 1K2DB 2DYSB 5I0YA 3VXTA 2VISB 5BRPA 3MXWH 2CHDA 4WO4A 5J9PA 2OL3A 1O7DC 1KIQA 1CF1A 3L3KB 3BDYH 3TBYA 5CEZL 3M07A 5GJTL 1KIPA 1T4KB 1BQUA 4OZIB 3MRDB 2Y7QA 1O7VA 3DSNB 1FVDB 2YD2A 1PNCA 1LWRA 3W57A 1GPOL 4J8QA 2BIHA 3TFBA 5IEKA 1FNFA 4KC3B 4NPYB 1E4XI 2BY2A 4Z95L 5E4IA 3QJFB 3T77B 4KITB 2D7OA 3QUZC 2E27H 3D12B 2X7LA 4JHBA 1FNEB 1CG9A 2CO2A 4LMQI 3FU6A 1IGMH 2VXUL 4KZEH 3PF2A 1DEEA 1NCAL 1BFVH 4AXWB 2FBRA 1P4LB 4N2IA 3EBIA 4DHLA 3PDOA 2F19L 3CPLA 3W2DL 1O6SA 2XVGA 3BD5A 3RGVA 1XH3B 4X7SH 1FO0H 4AG4L 4I3SH 5HYFA 1MZYA 4ZFZA 1P84J 1RCYA 3OX8A 3VXRB 1I8MB 2ZCZA 4M62L 3EHBD 1N26A 5KYUA 3EYFB 3ZXAC 2NNXA 2JELH 1M1XA 2GSIB 4OQ1A 3V4VL 1BGXL 2FDBP 2YGOA 5AG9A 1BXAA 4N8CH 1TLMA 4WW1A 1QYGL 5IWLA 2W0FA 1MCWM 1WFOA 5JPMC 3IJEA 4U1MA 3FRUB 1BYPA 3G6JA 1ZSDA 4NX0A 1FL6B 3UJTL 2P5ED 2IGFH 4X9HA 1FVCB 2H3XC 1XCQB 4MJIB 1GA2A 2FCBA 3IFPB 3LMJH 1LWJA 5C07A 3ECWA 2G5BB 2WKOF 2Q7AA 3BP7B 4PLKD 1TR7A 1MEXL 2NXYB 4MNQB 4QRRA 1IVTA 3LIZA 4GFTB 2BS71 4YHYB 3TJHC 1O0VA 3VG9C 3GRWA 2L7QA 4ZOBA 1YYLH 3FRPA 4JFFA 5EOQH 4NPKA 3OSVA 4CMHB 1KLGB 3RZCB 3ARDC 3JV4B 2HH0L 5L8KB 3O8XC 4JM2B 2ARJB 4JHUA 1I1AA 3WFZA 2K70A 2X4TB 4JM4L 5EPMA 5AZEL 1J05B 2HLAB 5IVNA 1PU0A 2OSLB 3IS0X 1MY5A 2FQGA 4JFTA 2JFCA 3TS8A 4AGPA 5E6UB 1H6UA 1BWWA 3O3DB 5FUCE 1LMKA 4LLUB 4GG6A 2EUWA 4XN9A 2ED9A 3BVWA 4JE4B 3KD4A 2DEXX 2BFVH 4B53A 5DO2D 1KEGH 1G9HA 1WFIA 2B1AH 1KBWA 4DGYL 3K6FA 5GGTL 1KTCA 5HGHA 1HZHH 2F0CA 3B4NA 1GYAA 1TTRA 2PW2A 3N50A 2BXYA 3AS0A 4N5EC 4OLWH 4JO3H 4F7CA 5BPPA 1NFDE 1QA9A 3H7BB 4NO0A 4PJ7E 5F7AA 3DC0A 3DUSB 1YQVH 2PTTB 5JHAA 3EDFA 4OKVB 1S3KL 3P40A 4Q8BA 4OZIF 1J8HA 3ZUCA 3QYNA 3E0GA 3RTQD 1MFEH 4H2CA 4JQIL 4U1HB 4HHGA 2RACA 2K6ZA 5JO5B 4X7FC 1N19A 4QGTA 3OQ3B 5IREA 3C5JA 3KPSD 3NSJA 4QTHA 5HDLA 5KYNA 3ABLB 1FJ1A 5HYQB 1VDGA 3AAZA 3ROLB 1W72A 2EUXA 4RLDA 4XNQB 4LSVL 4DVBA 3OAYK 5DTFA 2X70B 5A43C 5FYLL 1EUUA 3TO4B 1A0QL 4P2QA 3SE9H 1Z2KA 4HS3A 1SY6H 4HJIA 1F1AA 5CSZB 1UVQB 2BZ7A 2C3VA 1RZJH 2ESVD 2K0RA 2OYLA 2O4EA 4GS7B 4PV8A 4LEBA 1I1RA 3QDMA 4R7XA 1I8IA 4U1JA 5B4MC 2D7TH 3IK2A 3PNWB 4GUOA 1IC7L 3RAJH 2A7BA 1XXDC 3GXPA 1SYSA 4FHJA 2DY2A 4ODSL 3QJUB 3QC6X 5DJAB 3E80A 2DJMA 1OCZB 3HB3C 2XFXB 3ZKSD 1UUNA 2NNCA 1NLBL 4UV4L 4C56A 1J11A 4LK4A 1LQSR 5EIIB 1N3NA 1BF5A 2Z8SA 3APDA 4NN7B 3W1ZA 3BYYA 1OF2B 4XMPL 2VGLM 3MV8E 2EIEA 4Y5XA 4KI5F 2EIBA 5C0NC 1MFVA 2G9HB 2DI7A 4LFHG 5FX3A 4J3VA 5BRQA 5GJTH 1YY9D 3AUWB 2XA8H 1GPOH 2BNRA 2BVYA 4YEFA 2OZ4L 2WQVA 1KT2B 4ICWA 4Z1PA 3T6XA 3ULVL 4AENA 1ZGLA 4Z95H 1I85A 1UJ3A 1F0LA 3WEOA 2QHRL 1EHKB 1KIUA 5ICYA 2BVOA 2DM4A 1IARB 2VW4A 2VXUH 2PXYA 4ANUA 4AK1A 1NCAH 3U7AA 4YAQA 2HTKC 3SKOB 4KU1A 2K8MA 2J44A 4NRYB 4EZMA 4L3AA 3HZVA 3TPKA 2F19H 3TC9A 3W2DH 2R1WB 3MAWA 2AITA 2HT2C 5LDUA 5KVFL 1SJXA 3H9HB 2OXHA 1YUHA 3QCUH 4AG4H 2B59A 3RA7L 5ACMA 1HOEA 4YEEA 4M62H 5ISZB 2IMMA 2OMYA 2ZOKA 3EOBB 4K94C 3CBRA 1AZUA 4IOFC 1P4UA 3LKSA 5BZXA 5T1MA 3OKOA 3ASWA 1BGXH 3V4VH 2H26B 3QZOA 4JFUA 2LHAA 1QYGH 4IU2A 4F8NA 1PD0A 2HKAA 5EDXA 3DJSA 3IDYB 1ED3A 1J0HA 5F1KC 3UBGA 3UJTH 3MNZB 1YG9A 1A64A 3DO3A 2YPVL 2YN5A 4P4KB 1CDCA 5K33A 1ZDQA 5DHVH 3L3DB 4NQXB 2CO7B 3DGGA 1MEXH 4L9DA 5IJDC 2BHZA 3BAJA 4PS3A 1CGVA 5IMLA 4Y4HB 3ULUD 1PZ3A 3UTZA 1ZGLM 4KVCL 1WLHA 4J4PC 1CS6A 2HH0H 2OMUA 4FXKC 4RAHA 1MXDA 4KROC 4JM4H 5AZEH 2HVBA 1OGSA 3CN1A 2G2RB 2JIXA 3H8NA 4ESKA 5CN3A 4G8GA 4UUJB 4ZAKD 2VABA 3O3AB 2C7UA 4GEJA 3DETD 4PJHE 4J28A 2IBGA 3KLAA 2FSDA 3MPCA 4YO0A 3WY1A 2XI9A 4FQQA 3GUTB 2BMKA 5IM7A 1FVEB 3CWGA 4JG0H 4JFDD 4LFHD 3V0WL 3WOVA 2AFNA 1JGEB 1HIML 2Q0ZX 5FOBA 3TEZA 5FM8A 5GGTH 5EU5A 1W6LA 1JZIA 3ZE2E 2DJ4A 5B3SB 3RZCC 4C4KT 3FN0H 3DX9B 5D93C 4Q7DA 5TE7H 3VA2C 2Y7NA 3GHBL 3LQAC 3O4LB 3ARBB 4PJFE 3KYMB 2GKIA 5ESAA 2J2ZB 4JFEA 3OHXB 2AVFA 3BOVA 3ZDZE 3CVDA 1PZBA 1XCTA 1S3KH 4FC3E 2E7HA 4QXTB 1AXSA 4LCWB 4ZSOA 1MRFL 1JZEA 4JQIH 2ZUQC 3UBXG 4PY8I 3IBEA 5BJTB 2BSTB 3UPRA 4Y4FB 2VN6A 3B2DC 3MA7A 3THML 2R0LL 5AAWC 4MQTB 2I9TA 1MI5E 4LSVH 2BOLA 2AQ1A 3LZQA 5FYLH 3WHXA 1PZCA 2FTAA 2K7QA 1IBDA 2HG5A 4A68A 2NY6B 1GS8A 3FH5A 1TZIB 4PJIA 4TRPH 5ERWA 5HHOE 2CDEB 5E5UB 2UYLB 4MA1C 1JTPA 5JOPE 3S6CA 1YHPA 4XNYL 4Q9QL 4WU7A 5BMFL 3S8GB 2OL3L 2QFPA 1IC7H 5I16A 2MCG1 5IMMA 4ODSH 5KTEL 5JW5B 1B4TA 1R3KA 4I18C 5DUJA 2NZ9C 5F97E 4BK5C 1U3JA 2G0LA 3H9ZA 4LKCB 2VDLL 5KG9A 5CIPB 1NLBH 4UV4H 4ZNCD 4GG8A 5AVSB 9CGTA 2J88H 4XMPH 4Q6IC 2Z93A 4J27A 1L4IA 4W9GC 3UDWC 1RU9L 5C3LD 1WAAE 2GW5A 1Z9MA 3HE7C 3N04A 1F58L 4WTZA 3FO2A 3L1FA 4BSVA 1HHKB 4HJJL 4FFWD 5DWUL 3RQ3A 5JW4R 2OZ4H 3ULVH 3IMSA 3N40P 4I13B 4NP9A 1NFIB 3SYCA 2HYMA 1M6OB 1FYHB 2BHUA 1KG0B 3C6LD 2QHRH 4GW5B 4LGRB 5KVDL 1FFOA 2ZX7A 3UO8B 1HJCA 3T0XA 1I53A 5AW3B 1H0DB 3DOHA 5HDBF 4AM0A 1YPZA 4XP5L 5IHHA 2XN9E 3VD3A 2OJEB 5DFVD 5KVFH 1V8HA 2A4ZA 3RA7H 4Z3TA 1OT4A 4TOYL 4LDCA 3ZTEA 2QQLL 4OZGB 3BCDA 4F93B 3MRJA 5J0BA 5FHAL 3DDFA 4ZMXA 3LIZL 1C16A 4XNMB 3IJ8A 3GRWL 4FCAA 2VJ8A 4GBXB 4PJHB 2I69A 3GMOB 4MRCA 1PKOA 4BFGA 3LSOB 2JXMA 4X80L 3MFGB 2YPVH 2W9LA 5E6IA 2TAAA 3O0RH 4XPGH 3I9AA 1BQHG 4Y16C 3L4CA 2X3BA 4UAOC 2BXZA 3ZE2B 4URTB 1BIIB 1ZY9A 2X1OA 4H1LG 3APMA 1GOGA 3M46A 2Z0BA 1VEOA 3NZSA 4GRWH 4PJFB 3Q43A 4ZDHB 5FO8B 3JUZA 4LBEA 4KVCH 2IAAC 3BPCB 3MO1B 2BVUA 2JB5H 2V5TA 3L45A 4R7NB 4GLRI 3QIWD 3MUGA 4KDTC 4N2LA 5FC9A 1M56B 2R9HC 5DVPA 3ZTJH 2F7IA 4BZ2L 5C0FA 3IE9A 3LYRA 5DQJB 1AKJA 3QQ9C 5DHMC 3IJ9A 4KK5C 5DEFA 4E9RA 2R0KL 4JPWL 3DMMC 4JHWL 3PREA 3B2MA 3WMSA 1CVRA 1IAOA 2YBRB 3D9AL 5D4QA 2X4SA 2YGPA 1HIMH 2ZWLT 4JAMA 5DYOA 3GJFB 3WFDL 4H8UA 4P9HC 4DZBB 1OCWL 1TJHL 1AACA 4QXVA 3JTTB 4DFIA 2P47B 4P57A 1GSKA 3GHBH 3EJZC 4Y1AE 4O58L 4HG4K 3JWNC 3N85H 1VKXA 4Z78A 1EDYA 1H3WM 3MLTB 4Y2DA 3MV7E 1YEJL 2R8SL 4G6AC 2J43A 3AS3A 1IM3D 1QBML 4UZGA 4A7GF 4DQOH 3F2LA 3NDYE 3NJLA 2X4OA 1MRFH 1W0WA 3TZVB 5HYJB 3FO1A 3CFJB 3H9SE 4RX4D 3RI5F 4BBWA 3R7RA 4WI7A 2EINB 2H8PA 1CFBA 3THMH 5JA9A 1JHKL 1TJGL 5D7KD 4PS8A 1IX2A 2I07B 1WFTA 3WMQA 4XXCC 4LO9A 4Y8AA 5JPNA 2BH0A 4ZYKA 1ZDSA 2WNXA 5JXEC 2B9BA 3OZKA 4DO4A 4PJDA 4XNYH 4Q9QH 5BMFH 3GFUA 3EOAA 4IS6B 3DUHA 5CINL 2GUOA 3KYNB 4OZGF 4NFCA 5KTEH 3ARZA 3IU4L 5FA3B 2ADYA 5I8OL 1CR9H 1K2DA 4P9HL 4IRSC 4RDBA 1S9VA 4PS7A 4PJHF 1NAMB 2VDLH 4L4VE 4RMBA 5AVWB 2EABA 1J5OH 4LVHC 5E2TL 1P7QA 2FATL 3DJTA 3FU5A 5LG1A 5IB1B 3QUYC 4HK0B 3Q8EA 3L3KA 4QOKD 3HKFA 1HE8A 1RU9H 1T4KA 3B3IA 4QXUH 1JGLL 1FVDA 1G7PA 4EE2A 4X8XA 4M43L 1F58H 2NXZB 2X0VA 3ULAB 3L81A 3ZE2F 3CFEA 4HJJH 3QJFA 5DWUH 1BZ9B 4HIEB 1KJ2A 1DLFL 5ITFB 3MBEC 1FNEA 4NQEE 5EU6E 2XN1A 2EYRB 2JLLA 3FQ2A 4A7QA 3ARGD 2QGCA 3RL2B 4AXWA 2FO4B 1ID2A 1JNNH 1ZLVH 4BXSV 1NBYB 1PJ9A 1FNLA 1LEKB 5FDYA 3OB8A 4CBZA 1IKOP 2DIEA 3IETA 1UA3A 1U92B 2FH6A 2AJ3B 4OR1A 4PGBA 2F8VA 2OCFD 4LQ1A 3G6AB 2W07A 3ABZA 3P2DA 4JFHE 4U0QB 5GSRB 1IQDB 3W82A 5C6PB 1LM8V 4A2MA 4KRLB 4GFXA 2X4UB 4TOYH 4H2AA 3I75B 5B8CA 3B9KC 1G4RA 2ROXA 2QQLH 1XGTA 2IDFA 4HEPA 4MJ4A 3W37A 1ZIBA 5FW7A 3JV0A 4PJBB 5FHAH 4KNUA 5HYEA 4Y4KD 4M8QB 5AL0A 2XQBL 4MTMA 1X4YA 1SJEB 3LIZH 1J0KA 1N8ZA 3DHUA 4TQ8A 5PAZA 3SDCA 1PKQE 4NRZB 1CXHA 1BYNA 2A74C 3O45B 3PQYD 4I88A 1MVUB 4X80H 4WI6A 4Z7AA 1KFAH 3B8YA 2DV6A 3BP7A 5D7LB 3MRBB 4FABL 2QKIB 3SDXA 3VMNA 1HH9B 4LEXL 2FR4A 2VN7A 2CRYA 4TNWK 1CGYA 1VENA 1OP5H 1CVSC 3REWA 2VXTL 3FT4B 3O2VL 1GKEA 1FN4B 1KLGA 2JKLA 3HC4L 2D7NA 2OCJA 3IDGB 4QRPD 4Y1AB 1XL4A 4ONFL 4YUEL 4JM2A 3P9MB 3ARFC 3T4YA 4KFZC 5DSCA 2HLAA 5FUZL 1IFRA 4HZAA 2OSLA 4LZKA 5E99L 2WAHA 4JKKA 3BW9B 3MX0B 4QLWA 5CCJA 5GQBA 1EJ6A 4RVBA 4BZ2H 2GTZB 3EJYC 4IIQB 4R0LB 1WT5C 2H32A 3H9SB 4LLUA 3C5SB 4X5LA 3VXMA 2E7LC 2R0KH 4HU2A 3LZNA 4OCSH 4JHWH 5F3FA 1HL4A 1L9SA 2EE0A 3D9AH 4NUQA 1WGVA 5IBUB 5MHSE 3BQVA 3ZU8A 1YEWA 1PW3A 4DGUA 3WFDH 1NKGA 3WGVB 2HSIA 3BCFA 4Y7OC 1AZVA 2VH5L 1K5NA 1OCWH 1TJHH 4ZRGA 3TBWA 3NZ8B 3S7GA 5EC1A 4G2AA 3ETBF 2JJVA 4UQ9A 1EZLA 1K8IB 1KJMB 4O58H 3SPIA 2VSKB 4PRIE 2V2TA 1TU2A 2BCKA 3ROOB 2AV1B 4HMCA 4YHIA 4EI5A 1YEJH 3QPXH 4U1HA 2R8SH 2Z91B 4V1DE 1QBMH 4GYBA 3MVSA 4L4VB 4ZQTA 5HYQA 3VYNA 3QNYB 1T1XA 4P5TC 4XNQA 5C0CB 4JFQA 2X70A 3L4XA 4A1RA 5I1LB 3TO4A 4ENEC 4GW1A 5C0IB 3KLKA 1G9NC 1JHKH 4N6RB 4ZG1A 1TJGH 4ZQKA 4PRPD 5KJ7E 2DQJL 2GC7C 3PY9A 4L3EE 4PJ9C 3F5WB 5D2NB 2DH3A 3PWUB 2YEQA 3QIBB 1NWOA 1NOLA 2X4PB 5DJCB 2HFGL 4Z3EA 4NQEB 4OFYD 1T03L 1J5CA 1AHWB 1GJIA 2A6KB 3DXAB 2P5WE 5DJAA 5CINH 5J4MA 4XP1L 4F1ZA 1D2PA 1QLFA 4NDMB 2YGNA 4OF0A 2BVTA 3IU4H 1OK8A 1ZCRA 3EF4A 4PJBF 3OLDA 4HWBL 1XFPA 4FHBD 4P9HH 2PO6D 2GAZB 4HK3N 3ZZLA 2XV2A 5E2TH 1ET5A 4F92B 2FATH 3MHZA 4OI8A 1ETJA 1RQ5A 5IB2A 2V7NB 3MR9A 4EQ3A 3HE6C 1JGLH 4KKPA 1R6VA 2UZXA 1A21A 4M43H 1KT2A 2FWLB 4N8VG 5AAPA 3QCTL 3TA3B 1U42A 4WHCA 5EOTA 3AREB 3DVNB 1IILE 1T80A 4OGAD 3QYMA 2EO7A 1DLFH 5FA4A 1C7TA 1SGKA 1F3JB 1RJZB 5E2VL 3QGVA 1CGSL 3NIFB 1L9NA 3EJTA 3JWNE 3SKOA 3EBGA 1IFGA 2W91A 1KNOA 4N0RA 3M7OA 1AP2A 4IRJD 5DJ0B 1E28A 1CFSA 2XV0A 2X6UA 5DDHB 3ZBMA 4X5WA 2ISDA 7FABL 3OZ9L 3EOBA 4Q2ZB 4ZTPL 1MFMA 3NMEA 2PKDA 2QPEB 4M93C 5C0AB 3UYPA 4OJCA 1JZ6A 3WUWG 2GHWB 3FTVA 2H26A 4HQQL 4Y5VC 4M7ZC 1WIOA 4W9LC 2OTPA 4BH8A 1W15A 3BPNB 3QDGE 3IJYB 5C09E 4HFWA 2KUTA 2XQBH 3T1WA 4PIBA 1MJUL 4MD4B 2XCMC 2QV4A 4XH2B 1NICA 1PLGL 2HKHH 2EUVA 1LO5B 1QHPA 2NY0C 4MDIA 2CJTA 4IJTA 4EIUA 1IO4C 4P4KA 5IKCB 2A6DA 3W11D 3FUMA 5ETUA 5KJRH 3GSQA 4FABH 3DO7B 3R18A 4LEXH 4HIPA 4WNSA 3UABA 4E42B 1MFAL 2P45B 5AYUL 4Y4HA 5IB5B 1D6EB 3O2VH 1U21A 4NJ9L 1NFDA 2A9ML 3V8CA 3D25B 4PJ7A 1KWKA 2BW5A 2XHNA 3FT3B 1ULVA 2X4RB 3GB7B 4FL4C 3HC4H 4WW2C 4YUEH 3WIIL 4D9LL 3EXLA 5JDSA 2ADGB 4K71C 2APTA 3HZMB 4PRIB 1RZ8B 2V6HA 3QHFL 4U3HA 1AD9A 5E8OB 3OXRA 5HHMD 4YPGA 1UCBL 2CO6B 3ZKND 1TZAA 2G2RA 5FUZH 5L2JB 4JO5A 3BDXA 4V1DB 5FGCE 5E99H 3UC0L 3O3AA 4KMTL 2AEOA 3K72A 1JXGA 4XZUB 1TEGA 5F88B 4KK6C 1OP3H 4J3OG 5CLWA 2NT1A 2N56A 2ITDA 2X53A 1H8SA 1FVEA 1HC1A 2F53D 2HT4D 3FTSA 5BCAA 3WTVA 5EEUA 5IGXL 1FSKB 1KTRL 3BHBA 1Q94B 2KZKA 3HCVB 3B9EA 5AOLA 4TS6A 1YUKB 1D9KC 2R1XA 2VH5H 2HRGA 3KYOB 4R4FL 4ZOCA 4HIJB 3KYMA 5MEPB 5JUEL 2J2ZA 3OHXA 4HOZA 4L2LA 2J6EH 4POZC 5GGRY 4BRJA 1HWHB 1RZ7L 3DV6A 4QXTA 3F12B 4ABWA 1T1WB 1J5DA 5DRNB 5BVJA 1JXDA 8CGTA 3VSVA 3GMMB 3UG3A 1NBQA 2YPKA 1JI2A 3U0PB 2BSTA 4KRPD 3MV8A 3FZUC 5FM5M 2ICEC 3V4LA 4CU7A 2WLHA 3CTTA 2ADJA 4H44C 6TAAA 5LG6A 2R59A 3NIFF 2OLDA 3AADB 1YEHL 1QRND 2QLVB 2VYRE 3GS0A 3H4HA 4GKSA 2WXPA 2UYLA 3BI9X 2DQJH 3CZJA 2ATAA 1WDAA 4KI5C 1DJXA 3RVXC 1RK1A 2HFGH 2HWZH 1H6FA 1T03H 3OLGA 1EZVX 2XYBA 2LLLA 2VLLA 4XP1H 2IAMA 4N2FA 2HFTA 3O6FB 4BRVA 1X5MA 1HH6B 3FN3A 4XGZA 4FG6D 4HUKB 3EO0B 4LAQL 3DGDA 4HWBH 5D7JC 3S5LG 3NBNA 2ODHA 2HX7A 4R4BA 1Q0XL 4FYSA 4NQDD 1A14H 2ICWB 1B6DA 1UT1A 3ES6B 1CXFA 5J56B 2AEQH 2G3ZA 1Z9NA 3OG6B 5B1JA 1ADQH 3RIAF 3RWGB 4PWFA 2A3TA 1HHKA 1PEWA 3TIEB 2F58L 2JNZA 2X09A 3QDGB 3ZIMA 2WQRA 5C09B 4XE5B 3QCTH 2Q5BA 1H3PL 2QTEA 2Q87A 2ZYHA 4E5XB 1G5AA 4MNGB 1E8ZA 4L18A 4GW5A 2J56A 5GGRB 5LBSL 4MAYD 4PV9B 5E2VH 1QFPA 5JMOC 4WI8A 1GZPA 1CGSH 5JDJA 3BUDA 3H4FA 1YRKA 3I02B 3LN5B 1E5ZA 3QK0A 1ZXKA 4ZFGL 1JYVA 2QEJA 2YUZA 4Z7IA 1Y6NR 2NY4C 4IKNA 4TUOA 4O4YL 1F1DA 4HUUB 3VRIA 3KLDA 1XF5B 1N68A 7FABH 3OZ9H 4ZTPH 5H4YA 3NA9L 1VFAA 2PF6A 2OMNA 3MMEB 3WDIA 4JNXA 2DJUA 1SUHA 5IJVB 4N26A 1ZLVK 3VU2A 3V6OC 3SE4C 4AKPA 5FGCB 4XNMA 2FX7L 4B9GA 3S2CA 1KCSL 4YNYA 5HD8C 3GMOA 3KVDD 4QXWA 5FOJA 1N0LB 1MJUH 1PLGH 1KPUA 1RZIA 1DQML 5D6DA 3EOYG 3QUZA 1KBBA 4ZMLA 4DN3L 4KJYA 2IDCA 3UAJC 4B9IA 4O02B 3TN0D 4UNUA 3HS9A 5DUBA 5BRZD 1N0XL 1UKQA 4NNYB 2YQGA 2VIRB 5IVXB 5J6SA 3PE9A 1MFAH 3TFKD 1E4JA 2HTLC 1CICB 5AYUH 1A6AA 1FG2B 2XJLA 4PJFA 1BBJA 5GRZA 1ITBB 4ZDHA 5JIIA 4NJ9H 2A9MH 2WNWA 1SN2A 1NGXB 3RDJA 3KH4A 3ZE1E 2AQRA 4TMPA 2AABL 3MO1A 3QJQB 3WIIH 2X6VA 3STZA 1AQ8A 3QHFH 2VLKB 3TNMA 3RFZC 1UCBH 3IJSA 1WCBA 2AJUH 5ACLA 1R3IL 3WNKA 5DQJA 1G6RB 3UC0H 4PRHD 3LV3B 5H8DA 1J5IA 3TBTB 3ZR6A 4KMTH 1E2ZA 4NUJB 1TT6A 3Q01A 5GS1B 4WUKL 1QHOA 2P8MA 1MI5A 2MQCA 2AF2A 4TQIA 3KPMB 5LKNA 2WQSA 2NY2B 3IVKB 3P3TA 5AW5B 3G04B 4MA7L 5HHOA 5LN4A 5IGXH 2VLJD 4LOUC 3ZT5A 2Y5TA 3VFVA 5IOKA 3T0EB 3MJWA 2WYHA 2NYYD 3AMLA 4OF3A 4R4FH 5JUEH 4EEEA 3DVIA 1UENA 4YSCA 3ARDA 4OGZA 5DEGA 3ISWA 1NANI 1RZ7H 1A4CA 4QAMB 4TVPE 3TZVA 2BIMA 1S7UA 2AEWA 5IEHA 3CNKA 3MNVB 2JCWA 1KY7A 1OCRB 5F7WC 3EADA 4MJ5A 3RVUC 1KC5H 5HVHB 4TNFA 3IMRA 3HRZB 1WAAA 1SEQL 4KQ4L 1HHIB 4QF1B 1VGEL 1WA2X 3B8SA 1N64L 1X4XA 1YEHH 2I07A 5HXMA 2X6MA 3BKJL 4ZZKA 2NQDA 1DCEA 4W9JC 4CDHA 5ALBL 2IF7A 1TFPA 4Y19E 2ERJB 3KYNA 5LN8A 3I6KB 5FA3A 5F7DB 1N10A 2IAND 4YZWA 4OGXL 3TBCA 2F8OA 5J1AB 2XN9A 1NAMA 3NTCL 2VN4A 4LAQH 4WSGA 3ZJAA 3SDYL 1JSYA 3WEXB 1VERA 2XNAA 3RY6C 2VUKA 3D39D 2EVHA 2WQXA 1Q0XH 3LKNA 3GNMH 3P0VL 4QR7A 3VRLF 1FI8C 4IJ3C 3X1EA 4PCTA 4AT6A 1YN6B 1WK0A 4UQEA 2M83A 3J07A 1OP4A 1MAJA 2JJSC 1RZPA 4UOQA 2ZKMX 2F58H 1BZ9A 5IVXF 3L1GA 4Q9BA 2DQDL 2FWSA 4HOXA 1BD2E 1BZ7B 1H3PH 2C4XA 4NKOB 4BZYA 1UJTA 1DBKL 4LEOA 2QVFB 3CZGA 5EN2A 5F0MB 2X12A 5LBSH 3ATAA 3BIKB 4R2GD 2B3IA 3HG3A 4GAJL 3K5RA 4R84A 5SWZE 2IALB 2WO4A 1DTUA 3FU9A 4ZFGH 4DN4H 3RLSA 2V17L 2DYPB 3G6AA 3ZO0A 1OTTD 2YAPA 3WO4C 3TVMB 2WZPA 3SJVD 1NEZG 4BWUA 5GRWA 3NA9H 5CEXA 4GMSL 1F56A 4M1DL 4JGUA 2XXFA 4JZNB 3CHPA 5I74B 3TEUA 2F74B 4BIKA 3VGAC 3TTYA 2FX7H 5CGMA 3MLUL 1KCSH 4WTQA 1MCSA 1OARL 12E8L 4W9EC 5L4IA 1MVUA 1DQMH 3AS2A 1GY1A 2NY6C 2QKIA 3FCSB 1ICTA 3I6SA 3KPPA 1XAUA 3CQFA 3N44B 5ECGA 5I2IA 3LNGA 3VDCA 3CXDL 4PJCB 1NZRA 3SHSA 2X9WA 3ILEA 4H4NA 3DX4A 4MKMA 1N0XH 4PWGA 1R33A 4C47A 5INDB 1WFNA 1K8DB 3FQXA 3DPDA 1CDJA 1QP1A 1R19A 3NJMA 4G3YL 4MA8L 1AGFB 4XWGH 2BK8A 1ZAGA 4BUHA 4J3OF 3MV7A 4JFVA 2AABH 4YSOA 1AOHA 3TU6A 3BW9A 3VCLB 4DP8X 3WBDA 1G4MA 4YN3A 4GRLB 4B60A 4E9XA 3MLSL 2GTZA 1WBYB 4HS6B 4IIQA 1W16A 3TIDB 3ZDYB 3BP5A 4F9LC 3H9SA 1RHHB 2ZXAA 2J1XA 3B34A 3AXIA 3QDHA 2JF1A 4WUKH 3BZEA 4N85A 1O9WA 4OI7A 1Q90A 2D31B 4N0CD 3QDJE 5LO7A 15C8L 3NK3A 3AGWA 3SPCA 3SGJA 4PVLA 1S7SB 4MA7H 4A2HA 2CUAA 5ILTL 1PZAA 1EERB 1AKPA 5SWSB 3I9GL 1OQOA 2XN0A 3ULUC 2GITB 5ECJE 4Y19B 1PQZB 4HUWB 4KJPD 3QEUA 4L29A 4XXDA 4J4PA 4MCZA 4I1RA 3HN5A 2Z91A 2DKMA 4GW4B 1BIHA 4BFIA 2E47A 1TSHA 3MRGB 3V6OE 4L4VA 1CXEA 3PJLA 4AJWA 1SVZA 3GINA 3S9DB 4OZ4A 5G5DB 4ISVB 1FH2A 4JN2B 1UZ8B 4K8RL 1SEQH 5C0IA 4KQ4H 5E5RB 4KKCD 5EEWA 1VGEH 6FABL 2I85A 1R5WA 5AVVB 1U3HD 4F15C 3NJIA 1N64H 3IJ7A 4GBXC 2ZG2A 4ALAC 5IP4A 3A0OA 3BKJH 3PWUA 1E6OL 1J8SA 3QIBA 1HTYA 2P7TA 1BD2B 4UTAA 4GUPB 5E6ZA 4YSAA 4NQEA 4UM8B 5ALBH 5EU6A 1AHWA 5EF3A 2A9BA 2A6KA 2H3NB 2PWEA 3KJ4C 1HSAB 1TVDA 3OJDB 3QCVL 1F6FB 4S1RL 3RGVD 4PLJD 4I0PA 1LNUB 4V11A 2NY7L 5GS0D 2QT6A 1EEZA 4HA1A 4FMKA 1S4IA 1D5MB 5IFJB 4OGXH 1IBFA 3NTCH 3GBNH 5F1SA 3HZ3A 1SHMA 4JJ5A 5GZNC 3HNTL 1P5VB 4UQ2B 3P0VH 2OAAA 1QNZL 2P5EE 5AAWA 1GGUA 1MNUL 3N44F 4PJCF 1AC6A 3IN0A 1JP5A 3TA3A 4CGUB 3LHAA 4GKNB 2PPEA 1DZ0A 4TULL 4Z7VB 5DJDB 2DQDH 5LHDA 2BDNH 1PKQA 5HVGB 5C07D 4NEHB 5C8JA 3SPGA 1H3UA 3VWKB 4RISL 2Q7NA 4QRRD 2VKWA 4IU3A 3NEOA 1R24B 5E2JA 4GAJH 1F4AA 4I18A 3EAKA 4QRUA 3CDZB 2Y7LA 4BK5A 4FMFA 4WI4A 5DK0B 3H6JA 4HJ1A 5DDHA 5ICXA 1T1YB 1TMCB 2E3VA 3ZDYF 3H3KA 3EO1B 2X05A 4CMMA 1I1AD 3QUXC 4Q2ZA 4CBPA 1U8PB 4P3DA 3ZTNH 1UD3A 4DZ8B 2CCWA 4Q6IA 2ZAGA 4LF3A 1NMCB 3CDGB 1B9ZA 2DQCL 4M6OL 3UDWA 2WLJA 5LGYA 3KLHC 4QEGA 4AQOA 5F0LB 2TRHA 4JB9L 4NUGL 4OJFL 4BJLA 2DJSA 4M1DH 4FJ6A 4NBZB 4JFXA 2ENPA 3ALPA 1E8WA 1UXSA 4MD4A 4XH2A 3VD9A 1EFQA 1LO5A 1HINL 3MLUH 3OMAB 3N40F 1OARH 1G5GA 1ND0B 5EB9A 5GGQL 12E8H 4PWHA 5IKCA 2OMXB 1YMME 1IGYB 3EG9B 4OLVL 2NW3B 2A6IA 4N2OA 4PQXA 4P8QA 3FO9A 4W68A 5J3HC 1AHMA 2FLBT 3WLWC 4FTDA 4NGHL 2L4OA 2YR3A 3CXDH 1UZ6E 3LB6D 1PEZA 2EYSB 3Q2VA 2OP4L 4MGXA 5FB8B 2DEYX 3RDTB 4TNGA 3WS3A 1CUOA 2YAHA 1J8HD 1WIUA 5MEQA 1SMDA 3KPSE 4G3YH 1JYWA 4HG4J 4PRIA 1U8IA 1SBSL 5AW2B 2MRYA 4PJAE 4ONGL 1Z0NA 4JGJA 4HJTA 1JD7A 4V1DA 35C8L 3AU0A 2WQ8A 4X6BB 1L5GB 2X4QB 5K69A 2WP3T 3FT0A 5BXFB 1T0NB 1BOGA 3H53A 1MF2H 3MLSH 2BSRB 2IXQB 3I6GA 1XIWD 1CLVA 1JG9A 2F1EA 4MS8D 2P8PA 5ESVA 2OMZA 2NZ1A 4JY4B