3QZSA

Crystal structure of bptf bromo in complex with histone h4k16ac - form i
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
111
structure length
111
Chain Sequence
SVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTAIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleosome-remodeling factor subunit BPTF
publication title Recognition of a Mononucleosomal Histone Modification Pattern by BPTF via Multivalent Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/nuclear protein
total genus 42
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3qzsA00
5D3JA 4NR9A 5CP5A 3P1FA 4NR7A 4O7AA 4KV4A 5LVRA 5A82A 4LDFA 5I89A 5EM3A 3AQAA 4J0RA 3MB3A 3U5LA 5LJ1A 5DFCA 4UYFA 5DBMA 5LKZA 5FH8A 4NQMA 5LKXA 5E3GA 4HXLA 5KTUA 4NYVA 4BJXA 5HQ7A 1WUMA 4O75A 4QSUA 4HXMA 2OO1A 4NRAA 5F62A 3U5MA 5L97A 5D3TA 5D3RA 3U5PA 5I86A 3NXBA 4CFLA 5DKCA 2D82A 5CY9A 5ETDA 5E3DA 4Z93A 4TTEA 3QZSA 4IR6A 5F25A 4YATA 4NXJA 3SVGA 5DW1A 4MEPA 5DYAA 5ENFA 3AADA 4IR5A 5CS8A 5FB1A 2R0VA 5D24A 5D26A 3K2JA 3S91A 5I83A 2DKWA 3JVMA 5ENIA 3UVWA 5I7YA 4YABA 5C7NA 4QYLA 2YELA 4A9EA 5LJ2A 4HBWA 4QR4A 4PY6A 4UYGA 5LKTA 5G4SA 4YH4A 4YK0A 5EWHA 5FE3A 5A7CA 4Q0NA 5FFWA 4YYIA 4QUTA 5F36A 5F2PA 5HRWA 5F1LA 5BT4A 5CRZA 4QNSA 5FE0A 5F3AA 4YBTA 5DLZA 5DW2A 3UV5A 5A83A 4HXKA 5CFWA 5DFBA 5EA1A 4CUSA 3O33A 4CL9A 4YYKA 4N4IA 5DYCA 5FE5A 4MR6A 5JWMA 5IGNA 5DY7A 3SVHA 4RVRA 5AMEA 4HXSA 3U5KA 5E9KA 3Q2EA 4Z6IA 2F6JA 2NXBA 4BHWA 4FLPA 4O71A 4N4GA 4O76A 4YY4A 5F5ZA 5CTLA 5COIA 5FE8A 4MR5A 5CQAA 5FFYA 2RO1A 5FH6A 4NYWA 4QYDA 5A85A 4J3IA 3U5NA 5CUGA 4ZQLA 4A9MA 5I80A 2DVSA 2DWWA 5CUDA 3P1DA 3UVDA 4A9IA 3U5OA 5KO4A 5CQ7A 4UYHA 5FFVA 3ZYUA 1WUGA 5D3NA 5HFQA 4YYHA 4QC3A 4LR6A 5II1A 4XY9A 5E7DA 4QR5A 4YADA 3JVLA 2RNXA 5FE2A 4O7CA 4XUBA 3LJWA 4UIYA 5CQ4A 2RS9B 5F1HA 4Z6HA 4MENA 5D0CA 4AKNA 2YEMA 3JVJA 3MUKA 5A5RA 5L8TA 1N72A 4YBSA 4CUUA 4YYDA 4CLBA 3QZTA 5HQ6A 5C89A 4OUFA 5DYUA 4KCXA 5EWVA 4MR4A 5LKUA 3P1CA 4QSPA 5HM0A 2WP2A 4LYWA 4QUUA 5DKHA 2YW5A 4UYDA 3I3JA 4XYAA 2GRCA 2H60A 4WIVA 4HXRA 4A9LA 5H1TA 3O37A 3O34A 3QZVA 5D3LA 3UW9A 4LYSA 4O7EA 4A9KA 5IBNA 4E96A 5IG6A 2G4AA 5ENGA 3MB4A 4TS8A 4Q0OA 3HMFA 3LQJA 2WP1A 4TU4A 5E9VA 5D3HA 4LC2A 5D3PA 4ALGA 5FE4A 4Z1SA 5I1QA 3IU5A 4BW1A 3MULA 4UIXA 4TT6A 5L98A 2E7NA 4NR4A 1X0JA 4IR4A 4Z1QA 4XUAA 5ENEA 4BW3A 4NUEA 4TYLA 5DX4A 4QSQA 5E9YA 5FG6A 2LSPB 4YYGA 5EQ1A 5E9LA 4J0SA 5HRXA 4PTBA 3UV4A 5L8UA 4A9FA 4NRBA 5CUEA 4TU6A 4YBMA 4O70A 5TCMA 5J0DA 5EU1A 5LUUA 4O7FA 2MJVB 5EWCA 5CQTA 5AD2A 5A5QA 4C66A 5E73A 4X2IA 3FKMX 4QSWA 5ENCA 3G0JA 5FB0A 1F68A 4UYFB 5KU3A 2E7OA 3UVYA 5CQ5A 5H1UA 4TT4A 5CQ3A 3LQIA 4IOQA 5L99A 4LZSA 4QR3A 5E9MA 1EQFA 4TZ2A 5HENA 4NR5A 4GPJA 2OSSA 5G4RA 4A9OA 5FE9A 3DAIA 4O72A 4IR3A 4CUTA 5ACYA 3P1EA 5ETBA 4QSVA 4C67A 2YYNA 5FG5A 2I7KA 4CURA 4UIUA 5C4QA 1ZS5A 4QC1A 4UIVA 4PCEA 4PKLA 4UITA 5HEMA 5I7XA 5BT5A 3O36A 5C85A 4HBXA 4QSRA 4KV1A 2R0SA 5CUAA 4WHWA 5EI4A 4A9HA 5IGMA 5C87A 4NR6A 2R0YA 4QSXA 2D9EA 5DKDA 4NUDA 5FH7A 4OGJA 5FG4A 4O77A 5A81A 5C8GA 4YC9A 4HXNA 5IGLA 4NRCA 2N9GA 4QEWA 5DYXA 5FE6A 4DONA 4QEVA 4NQNA 5I88A 5E0RA 5EISA 4YYNA 4O78A 4CFKA 3HMHA 5CUCA 3UV2A 2RI7A 2E3KA 4HBVA 4N4FA 5HFRA 3IU6A 3MXFA 3HMEA 3D7CA 5A5OA 5EP7A 4QSSA 5EV9A 2FSAA 5CQ6A 4BW4A 5CGPA 5EPSA 5CQ8A 5L96A 5CRMA 5EPRA 5A5NA 3U5JA 5CU8A 5HLSA 5KHMA 5HQ5A 5H1VA 4J1PA 4PCIA 3O35A 5DLXA 4ZC9A 4HXPA 4NS5A 4OGIA 4QY4A 4QEUA 3LQHA 5EK9A 5FE1A 5EICA 2RNYA 4NR8A 4MEQA 4QZSA 3S92A 5TB6A 4LZ2A 4A9NA 2R10A 3TLPA 5E9IA 4HBYA 4A9JA 5ENBA 4MEOA 5LJ0A 5KTXA 5D25A 3MQMA 5A5PA 5HJCA 4QSTA 4MR3A 5EVAA 4QB3A 5CUBA 5FE7A 4UIZA 5HELA 2L85A 5EGUA 2OUOA 4YY6A 4YYJA 2KTBB 5EWWA 5CPEA 4UIWA 5ENHA 2F6NA 5F63A 5I29A 4TZ8A 5CZGA 5KTWA 2RFJA 4N3WA 5IIDA 5D3SA 3RCWA 3ONIA 4O74A 4F3IA 2DVVA 2DVQA 5EWDA 5II2A 4ALHA 5EPBA 5F60A 4QBMA 5ENJA 5K29A 5AD3A 4LYIA 3G0LA 4IOOA 5HCLA 4NYXA 1JM4B 3SVFA 4N4HA 5I40A 4NUCA 5JI8A 4O7BA 5D7XA 5H85A 3GG3A 2RNWA 5HRVA 3JVKA 3LXJA 4IORA 2DVRA 4Y03A 2I8NA 1E6IA 5E74A 2YQDA 2YEKA 4LZRA 3Q2FA 1JSPB 4PS5A 4ZW1A 5DFDA 2DATA 4YAXA 4BW2A 5FDZA 2L84A 2L5EA 4WHUA 5A5SA 3UVXA 2YDWA 5LVQA 5BT3A 4TQNA 4XY8A 4LRGA 4YYMA 3P5OA 4TT2A 5F61A 4CUPA 4UYEA 4CUQA 4YH3A 5AMFA 5FBXA 4HXOA 3DWYA 5IGKA
chains in the Genus database with same CATH superfamily
5D3JA 4NR9A 5CP5A 3P1FA 4NR7A 4O7AA 4KV4A 5LVRA 5A82A 4LDFA 5I89A 5EM3A 3AQAA 4J0RA 3MB3A 3U5LA 5LJ1A 5DFCA 4UYFA 5DBMA 5LKZA 5FH8A 4NQMA 5LKXA 5E3GA 4HXLA 5KTUA 4NYVA 4BJXA 5HQ7A 1WUMA 4O75A 4QSUA 4HXMA 2OO1A 4NRAA 5F62A 3U5MA 5L97A 5D3TA 5D3RA 3U5PA 3VKGA 5I86A 3NXBA 4CFLA 5DKCA 2D82A 5CY9A 5ETDA 5E3DA 4Z93A 4AI6A 4TTEA 3QZSA 4IR6A 5F25A 4YATA 4NXJA 3SVGA 5DW1A 4MEPA 5DYAA 5ENFA 3AADA 4IR5A 5CS8A 5FB1A 2R0VA 5D24A 5D26A 3K2JA 3S91A 5I83A 2DKWA 3JVMA 5ENIA 1PUOA 3UVWA 5I7YA 4YABA 5C7NA 4QYLA 2YELA 4A9EA 5LJ2A 4HBWA 4QR4A 4PY6A 4UYGA 5LKTA 5G4SA 4YH4A 4YK0A 5EWHA 5FE3A 5A7CA 4Q0NA 5FFWA 4YYIA 4QUTA 5F36A 5F2PA 5HRWA 5F1LA 5BT4A 5CRZA 4QNSA 5FE0A 5F3AA 3D1BA 4YBTA 5DLZA 5DW2A 3UV5A 5A83A 4HXKA 5CFWA 5DFBA 5EA1A 4CUSA 3O33A 4CL9A 4YYKA 4N4IA 5DYCA 5FE5A 4MR6A 5JWMA 5IGNA 5DY7A 3SVHA 4RVRA 5AMEA 4HXSA 3U5KA 5E9KA 3Q2EA 4Z6IA 2F6JA 2NXBA 4BHWA 4FLPA 4O71A 4N4GA 4O76A 4YY4A 5F5ZA 5CTLA 5COIA 5FE8A 4MR5A 5CQAA 5FFYA 2RO1A 5FH6A 4NYWA 4QYDA 5A85A 4J3IA 3U5NA 1ZKRA 5CUGA 4ZQLA 4A9MA 5I80A 2DVSA 2DWWA 5CUDA 3P1DA 3UVDA 4A9IA 3U5OA 5KO4A 5CQ7A 4UYHA 5FFVA 3ZYUA 1WUGA 5D3NA 5HFQA 4YYHA 4QC3A 4LR6A 5II1A 4XY9A 5E7DA 4QR5A 4YADA 3JVLA 2RNXA 5FE2A 4O7CA 4XUBA 3LJWA 4UIYA 5CQ4A 2RS9B 5F1HA 4Z6HA 4MENA 5D0CA 4AKNA 2YEMA 3JVJA 3MUKA 5A5RA 5L8TA 1N72A 4YBSA 4CUUA 4YYDA 4CLBA 3QZTA 5HQ6A 5C89A 4OUFA 5DYUA 4KCXA 5EWVA 4MR4A 5LKUA 3P1CA 4QSPA 5HM0A 2WP2A 4LYWA 4QUUA 2EJNA 5DKHA 3D1DA 2YW5A 4UYDA 3I3JA 4XYAA 2GRCA 2H60A 4WIVA 4HXRA 4A9LA 5H1TA 3O37A 3O34A 3QZVA 5D3LA 3UW9A 4LYSA 4O7EA 4A9KA 5IBNA 4E96A 5IG6A 2G4AA 5ENGA 3MB4A 4TS8A 4Q0OA 3HMFA 3LQJA 2WP1A 4TU4A 5E9VA 5D3HA 4LC2A 5D3PA 4ALGA 5FE4A 4Z1SA 5I1QA 3IU5A 4BW1A 3MULA 4UIXA 4TT6A 5L98A 2E7NA 4NR4A 1X0JA 4IR4A 4Z1QA 4XUAA 5ENEA 4BW3A 4NUEA 4TYLA 5DX4A 4QSQA 5E9YA 5FG6A 2LSPB 4YYGA 5EQ1A 5E9LA 4J0SA 5HRXA 4PTBA 3UV4A 5L8UA 4A9FA 4NRBA 5CUEA 4TU6A 4YBMA 4O70A 5TCMA 5J0DA 5EU1A 5LUUA 4O7FA 2MJVB 5EWCA 5CQTA 5AD2A 5A5QA 4C66A 5E73A 4X2IA 3FKMX 4QSWA 5ENCA 3G0JA 5FB0A 1F68A 4UYFB 5KU3A 2E7OA 3UVYA 5CQ5A 5H1UA 4TT4A 5CQ3A 3LQIA 4IOQA 5L99A 4LZSA 4QR3A 5E9MA 1EQFA 4TZ2A 5HENA 4NR5A 4GPJA 2OSSA 5G4RA 4A9OA 5FE9A 3DAIA 4O72A 4IR3A 4CUTA 5ACYA 3P1EA 5ETBA 4QSVA 4C67A 2YYNA 5FG5A 2I7KA 4CURA 4UIUA 5C4QA 1ZS5A 4QC1A 4UIVA 4PCEA 4PKLA 4UITA 5HEMA 5I7XA 5BT5A 3O36A 5C85A 4HBXA 4AKIA 4QSRA 4KV1A 2R0SA 5CUAA 4WHWA 5EI4A 4A9HA 5IGMA 5C87A 4NR6A 2R0YA 4QSXA 2D9EA 5DKDA 4NUDA 5FH7A 4OGJA 5FG4A 4O77A 5A81A 5C8GA 4YC9A 4HXNA 5IGLA 4NRCA 2N9GA 4QEWA 5DYXA 5FE6A 4DONA 4QEVA 4NQNA 5I88A 5E0RA 5EISA 4YYNA 4O78A 4CFKA 3HMHA 5CUCA 3UV2A 2RI7A 2E3KA 4HBVA 4N4FA 5HFRA 3IU6A 3MXFA 3HMEA 3D7CA 5A5OA 4AKHA 5EP7A 4QSSA 5EV9A 2FSAA 5CQ6A 4BW4A 5CGPA 5EPSA 5CQ8A 5L96A 5CRMA 5EPRA 5A5NA 3U5JA 5CU8A 5HLSA 5KHMA 5HQ5A 5H1VA 4J1PA 4PCIA 3O35A 5DLXA 4ZC9A 4HXPA 4NS5A 4OGIA 4QY4A 4QEUA 3LQHA 5EK9A 5FE1A 5EICA 2RNYA 4NR8A 4MEQA 4QZSA 3S92A 5TB6A 4LZ2A 4A9NA 2R10A 3TLPA 5E9IA 4HBYA 4A9JA 3VKHA 5ENBA 4MEOA 5LJ0A 5KTXA 5D25A 3MQMA 5A5PA 5HJCA 4QSTA 4MR3A 5EVAA 4QB3A 5CUBA 5FE7A 4UIZA 5HELA 2L85A 5EGUA 2OUOA 4YY6A 4YYJA 2KTBB 5EWWA 5CPEA 4UIWA 5ENHA 2F6NA 5F63A 5I29A 4TZ8A 5CZGA 5KTWA 2RFJA 4N3WA 5IIDA 5D3SA 3RCWA 3ONIA 4O74A 4F3IA 2DVVA 2DVQA 5EWDA 5II2A 4ALHA 5EPBA 5F60A 4QBMA 5ENJA 5K29A 5AD3A 4LYIA 3G0LA 4IOOA 5HCLA 4NYXA 1JM4B 3SVFA 4N4HA 5I40A 4NUCA 5JI8A 4O7BA 5D7XA 5H85A 3GG3A 2RNWA 5HRVA 3JVKA 3LXJA 4IORA 2DVRA 3ERRA 4Y03A 2I8NA 1E6IA 5E74A 2YQDA 2YEKA 4LZRA 3Q2FA 1JSPB 4PS5A 4ZW1A 5DFDA 2DATA 4YAXA 4BW2A 5FDZA 2L84A 2L5EA 4WHUA 5A5SA 3UVXA 2YDWA 5LVQA 5BT3A 4AKGA 4TQNA 4XY8A 4LRGA 4YYMA 3P5OA 4TT2A 5F61A 4CUPA 4UYEA 4CUQA 4YH3A 5AMFA 5FBXA 4HXOA 3DWYA 5IGKA
chains in the Genus database with same CATH topology
5D3JA 4NR9A 5CP5A 3P1FA 4NR7A 4O7AA 4KV4A 5LVRA 5A82A 4LDFA 5I89A 5EM3A 3AQAA 4J0RA 3MB3A 3U5LA 5LJ1A 5DFCA 4UYFA 5DBMA 5LKZA 5FH8A 4NQMA 5LKXA 5E3GA 4HXLA 5KTUA 4NYVA 4BJXA 5HQ7A 1WUMA 4O75A 4QSUA 4HXMA 2OO1A 4NRAA 5F62A 3U5MA 5L97A 5D3TA 5D3RA 3U5PA 5I86A 3NXBA 4CFLA 5DKCA 2D82A 5CY9A 5ETDA 5E3DA 4Z93A 4TTEA 3QZSA 4IR6A 5F25A 4YATA 4NXJA 3SVGA 5DW1A 4MEPA 5DYAA 5ENFA 3AADA 4IR5A 5CS8A 5FB1A 2R0VA 5D24A 5D26A 3K2JA 3S91A 5I83A 2DKWA 3JVMA 5ENIA 3UVWA 5I7YA 4YABA 5C7NA 4QYLA 2YELA 4A9EA 5LJ2A 4HBWA 4QR4A 4PY6A 4UYGA 5LKTA 5G4SA 4YH4A 4YK0A 5EWHA 5FE3A 5A7CA 4Q0NA 5FFWA 4YYIA 4QUTA 5F36A 5F2PA 5HRWA 5F1LA 5BT4A 5CRZA 4QNSA 5FE0A 5F3AA 4YBTA 5DLZA 5DW2A 3UV5A 5A83A 4HXKA 5CFWA 5DFBA 5EA1A 4CUSA 3O33A 4CL9A 4YYKA 4N4IA 5DYCA 5FE5A 4MR6A 5JWMA 5IGNA 5DY7A 3SVHA 4RVRA 5AMEA 4HXSA 3U5KA 5E9KA 3Q2EA 4Z6IA 2F6JA 2NXBA 4BHWA 4FLPA 4O71A 4N4GA 4O76A 4YY4A 5F5ZA 5CTLA 5COIA 5FE8A 4MR5A 5CQAA 5FFYA 2RO1A 5FH6A 4NYWA 4QYDA 5A85A 4J3IA 3U5NA 5CUGA 4ZQLA 4A9MA 5I80A 2DVSA 2DWWA 5CUDA 3P1DA 3UVDA 4A9IA 3U5OA 5KO4A 5CQ7A 4UYHA 5FFVA 3ZYUA 1WUGA 5D3NA 5HFQA 4YYHA 4QC3A 4LR6A 5II1A 4XY9A 5E7DA 4QR5A 4YADA 3JVLA 2RNXA 5FE2A 4O7CA 4XUBA 3LJWA 4UIYA 5CQ4A 2RS9B 5F1HA 4Z6HA 4MENA 5D0CA 4AKNA 2YEMA 3JVJA 3MUKA 5A5RA 5L8TA 1N72A 4YBSA 4CUUA 4YYDA 4CLBA 3QZTA 5HQ6A 5C89A 4OUFA 5DYUA 4KCXA 5EWVA 4MR4A 5LKUA 3P1CA 4QSPA 5HM0A 2WP2A 4LYWA 4QUUA 5DKHA 2YW5A 4UYDA 3I3JA 4XYAA 2GRCA 2H60A 4WIVA 4HXRA 4A9LA 5H1TA 3O37A 3O34A 3QZVA 5D3LA 3UW9A 4LYSA 4O7EA 4A9KA 5IBNA 4E96A 5IG6A 2G4AA 5ENGA 3MB4A 4TS8A 4Q0OA 3HMFA 3LQJA 2WP1A 4TU4A 5E9VA 5D3HA 4LC2A 5D3PA 4ALGA 5FE4A 4Z1SA 5I1QA 3IU5A 4BW1A 3MULA 4UIXA 4TT6A 5L98A 2E7NA 4NR4A 1X0JA 4IR4A 4Z1QA 4XUAA 5ENEA 4BW3A 4NUEA 4TYLA 5DX4A 4QSQA 5E9YA 5FG6A 2LSPB 4YYGA 5EQ1A 5E9LA 4J0SA 5HRXA 4PTBA 3UV4A 5L8UA 4A9FA 4NRBA 5CUEA 4TU6A 4YBMA 4O70A 5TCMA 5J0DA 5EU1A 5LUUA 4O7FA 2MJVB 5EWCA 5CQTA 5AD2A 5A5QA 4C66A 5E73A 4X2IA 3FKMX 4QSWA 5ENCA 3G0JA 5FB0A 1F68A 4UYFB 5KU3A 2E7OA 3UVYA 5CQ5A 5H1UA 4TT4A 5CQ3A 3LQIA 4IOQA 5L99A 4LZSA 4QR3A 5E9MA 1EQFA 4TZ2A 5HENA 4NR5A 4GPJA 2OSSA 5G4RA 4A9OA 5FE9A 3DAIA 4O72A 4IR3A 4CUTA 5ACYA 3P1EA 5ETBA 4QSVA 4C67A 2YYNA 5FG5A 2I7KA 4CURA 4UIUA 5C4QA 1ZS5A 4QC1A 4UIVA 4PCEA 4PKLA 4UITA 5HEMA 5I7XA 5BT5A 3O36A 5C85A 4HBXA 4QSRA 4KV1A 2R0SA 5CUAA 4WHWA 5EI4A 4A9HA 5IGMA 5C87A 4NR6A 2R0YA 4QSXA 2D9EA 5DKDA 4NUDA 5FH7A 4OGJA 5FG4A 4O77A 5A81A 5C8GA 4YC9A 4HXNA 5IGLA 4NRCA 2N9GA 4QEWA 5DYXA 5FE6A 4DONA 4QEVA 4NQNA 5I88A 5E0RA 5EISA 4YYNA 4O78A 4CFKA 3HMHA 5CUCA 3UV2A 2RI7A 2E3KA 4HBVA 4N4FA 5HFRA 3IU6A 3MXFA 3HMEA 3D7CA 5A5OA 5EP7A 4QSSA 5EV9A 2FSAA 5CQ6A 4BW4A 5CGPA 5EPSA 5CQ8A 5L96A 5CRMA 5EPRA 5A5NA 3U5JA 5CU8A 5HLSA 5KHMA 5HQ5A 5H1VA 4J1PA 4PCIA 3O35A 5DLXA 4ZC9A 4HXPA 4NS5A 4OGIA 4QY4A 4QEUA 3LQHA 5EK9A 5FE1A 5EICA 2RNYA 4NR8A 4MEQA 4QZSA 3S92A 5TB6A 4LZ2A 4A9NA 2R10A 3TLPA 5E9IA 4HBYA 4A9JA 5ENBA 4MEOA 5LJ0A 5KTXA 5D25A 3MQMA 5A5PA 5HJCA 4QSTA 4MR3A 5EVAA 4QB3A 5CUBA 5FE7A 4UIZA 5HELA 2L85A 5EGUA 2OUOA 4YY6A 4YYJA 2KTBB 5EWWA 5CPEA 4UIWA 5ENHA 2F6NA 5F63A 5I29A 4TZ8A 5CZGA 5KTWA 2RFJA 4N3WA 5IIDA 5D3SA 3RCWA 3ONIA 4O74A 4F3IA 2DVVA 2DVQA 5EWDA 5II2A 4ALHA 5EPBA 5F60A 4QBMA 5ENJA 5K29A 5AD3A 4LYIA 3G0LA 4IOOA 5HCLA 4NYXA 1JM4B 3SVFA 4N4HA 5I40A 4NUCA 5JI8A 4O7BA 5D7XA 5H85A 3GG3A 2RNWA 5HRVA 3JVKA 3LXJA 4IORA 2DVRA 4Y03A 2I8NA 1E6IA 5E74A 2YQDA 2YEKA 4LZRA 3Q2FA 1JSPB 4PS5A 4ZW1A 5DFDA 2DATA 4YAXA 4BW2A 5FDZA 2L84A 2L5EA 4WHUA 5A5SA 3UVXA 2YDWA 5LVQA 5BT3A 4TQNA 4XY8A 4LRGA 4YYMA 3P5OA 4TT2A 5F61A 4CUPA 4UYEA 4CUQA 4YH3A 5AMFA 5FBXA 4HXOA 3DWYA 5IGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D3J A;  4NR9 A;  5CP5 A;  3P1F A;  4NR7 A;  4O7A A;  4KV4 A;  5LVR A;  5A82 A;  4LDF A;  5I89 A;  5EM3 A;  3AQA A;  4J0R A;  3MB3 A;  3U5L A;  5LJ1 A;  5DFC A;  4UYF A;  5DBM A;  5LKZ A;  5FH8 A;  4NQM A;  5LKX A;  5E3G A;  4HXL A;  5KTU A;  4NYV A;  4BJX A;  5HQ7 A;  1WUM A;  4O75 A;  4QSU A;  4HXM A;  2OO1 A;  4NRA A;  5F62 A;  3U5M A;  5L97 A;  5D3T A;  5D3R A;  3U5P A;  5I86 A;  3NXB A;  4CFL A;  5DKC A;  2D82 A;  5CY9 A;  5ETD A;  5E3D A;  4Z93 A;  4TTE A;  3QZS A;  4IR6 A;  5F25 A;  4YAT A;  4NXJ A;  3SVG A;  5DW1 A;  4MEP A;  5DYA A;  5ENF A;  3AAD A;  4IR5 A;  5CS8 A;  5FB1 A;  2R0V A;  5D24 A;  5D26 A;  3K2J A;  3S91 A;  5I83 A;  2DKW A;  3JVM A;  5ENI A;  3UVW A;  5I7Y A;  4YAB A;  5C7N A;  4QYL A;  2YEL A;  4A9E A;  5LJ2 A;  4HBW A;  4QR4 A;  4PY6 A;  4UYG A;  5LKT A;  5G4S A;  4YH4 A;  4YK0 A;  5EWH A;  5FE3 A;  5A7C A;  4Q0N A;  5FFW A;  4YYI A;  4QUT A;  5F36 A;  5F2P A;  5HRW A;  5F1L A;  5BT4 A;  5CRZ A;  4QNS A;  5FE0 A;  5F3A A;  4YBT A;  5DLZ A;  5DW2 A;  3UV5 A;  5A83 A;  4HXK A;  5CFW A;  5DFB A;  5EA1 A;  4CUS A;  3O33 A;  4CL9 A;  4YYK A;  4N4I A;  5DYC A;  5FE5 A;  4MR6 A;  5JWM A;  5IGN A;  5DY7 A;  3SVH A;  4RVR A;  5AME A;  4HXS A;  3U5K A;  5E9K A;  3Q2E A;  4Z6I A;  2F6J A;  2NXB A;  4BHW A;  4FLP A;  4O71 A;  4N4G A;  4O76 A;  4YY4 A;  5F5Z A;  5CTL A;  5COI A;  5FE8 A;  4MR5 A;  5CQA A;  5FFY A;  2RO1 A;  5FH6 A;  4NYW A;  4QYD A;  5A85 A;  4J3I A;  3U5N A;  5CUG A;  4ZQL A;  4A9M A;  5I80 A;  2DVS A;  2DWW A;  5CUD A;  3P1D A;  3UVD A;  4A9I A;  3U5O A;  5KO4 A;  5CQ7 A;  4UYH A;  5FFV A;  3ZYU A;  1WUG A;  5D3N A;  5HFQ A;  4YYH A;  4QC3 A;  4LR6 A;  5II1 A;  4XY9 A;  5E7D A;  4QR5 A;  4YAD A;  3JVL A;  2RNX A;  5FE2 A;  4O7C A;  4XUB A;  3LJW A;  4UIY A;  5CQ4 A;  2RS9 B;  5F1H A;  4Z6H A;  4MEN A;  5D0C A;  4AKN A;  2YEM A;  3JVJ A;  3MUK A;  5A5R A;  5L8T A;  1N72 A;  4YBS A;  4CUU A;  4YYD A;  4CLB A;  3QZT A;  5HQ6 A;  5C89 A;  4OUF A;  5DYU A;  4KCX A;  5EWV A;  4MR4 A;  5LKU A;  3P1C A;  4QSP A;  5HM0 A;  2WP2 A;  4LYW A;  4QUU A;  5DKH A;  2YW5 A;  4UYD A;  3I3J A;  4XYA A;  2GRC A;  2H60 A;  4WIV A;  4HXR A;  4A9L A;  5H1T A;  3O37 A;  3O34 A;  3QZV A;  5D3L A;  3UW9 A;  4LYS A;  4O7E A;  4A9K A;  5IBN A;  4E96 A;  5IG6 A;  2G4A A;  5ENG A;  3MB4 A;  4TS8 A;  4Q0O A;  3HMF A;  3LQJ A;  2WP1 A;  4TU4 A;  5E9V A;  5D3H A;  4LC2 A;  5D3P A;  4ALG A;  5FE4 A;  4Z1S A;  5I1Q A;  3IU5 A;  4BW1 A;  3MUL A;  4UIX A;  4TT6 A;  5L98 A;  2E7N A;  4NR4 A;  1X0J A;  4IR4 A;  4Z1Q A;  4XUA A;  5ENE A;  4BW3 A;  4NUE A;  4TYL A;  5DX4 A;  4QSQ A;  5E9Y A;  5FG6 A;  2LSP B;  4YYG A;  5EQ1 A;  5E9L A;  4J0S A;  5HRX A;  4PTB A;  3UV4 A;  5L8U A;  4A9F A;  4NRB A;  5CUE A;  4TU6 A;  4YBM A;  4O70 A;  5TCM A;  5J0D A;  5EU1 A;  5LUU A;  4O7F A;  2MJV B;  5EWC A;  5CQT A;  5AD2 A;  5A5Q A;  4C66 A;  5E73 A;  4X2I A;  3FKM X;  4QSW A;  5ENC A;  3G0J A;  5FB0 A;  1F68 A;  4UYF B;  5KU3 A;  2E7O A;  3UVY A;  5CQ5 A;  5H1U A;  4TT4 A;  5CQ3 A;  3LQI A;  4IOQ A;  5L99 A;  4LZS A;  4QR3 A;  5E9M A;  1EQF A;  4TZ2 A;  5HEN A;  4NR5 A;  4GPJ A;  2OSS A;  5G4R A;  4A9O A;  5FE9 A;  3DAI A;  4O72 A;  4IR3 A;  4CUT A;  5ACY A;  3P1E A;  5ETB A;  4QSV A;  4C67 A;  2YYN A;  5FG5 A;  2I7K A;  4CUR A;  4UIU A;  5C4Q A;  1ZS5 A;  4QC1 A;  4UIV A;  4PCE A;  4PKL A;  4UIT A;  5HEM A;  5I7X A;  5BT5 A;  3O36 A;  5C85 A;  4HBX A;  4QSR A;  4KV1 A;  2R0S A;  5CUA A;  4WHW A;  5EI4 A;  4A9H A;  5IGM A;  5C87 A;  4NR6 A;  2R0Y A;  4QSX A;  2D9E A;  5DKD A;  4NUD A;  5FH7 A;  4OGJ A;  5FG4 A;  4O77 A;  5A81 A;  5C8G A;  4YC9 A;  4HXN A;  5IGL A;  4NRC A;  2N9G A;  4QEW A;  5DYX A;  5FE6 A;  4DON A;  4QEV A;  4NQN A;  5I88 A;  5E0R A;  5EIS A;  4YYN A;  4O78 A;  4CFK A;  3HMH A;  5CUC A;  3UV2 A;  2RI7 A;  2E3K A;  4HBV A;  4N4F A;  5HFR A;  3IU6 A;  3MXF A;  3HME A;  3D7C A;  5A5O A;  5EP7 A;  4QSS A;  5EV9 A;  2FSA A;  5CQ6 A;  4BW4 A;  5CGP A;  5EPS A;  5CQ8 A;  5L96 A;  5CRM A;  5EPR A;  5A5N A;  3U5J A;  5CU8 A;  5HLS A;  5KHM A;  5HQ5 A;  5H1V A;  4J1P A;  4PCI A;  3O35 A;  5DLX A;  4ZC9 A;  4HXP A;  4NS5 A;  4OGI A;  4QY4 A;  4QEU A;  3LQH A;  5EK9 A;  5FE1 A;  5EIC A;  2RNY A;  4NR8 A;  4MEQ A;  4QZS A;  3S92 A;  5TB6 A;  4LZ2 A;  4A9N A;  2R10 A;  3TLP A;  5E9I A;  4HBY A;  4A9J A;  5ENB A;  4MEO A;  5LJ0 A;  5KTX A;  5D25 A;  3MQM A;  5A5P A;  5HJC A;  4QST A;  4MR3 A;  5EVA A;  4QB3 A;  5CUB A;  5FE7 A;  4UIZ A;  5HEL A;  2L85 A;  5EGU A;  2OUO A;  4YY6 A;  4YYJ A;  2KTB B;  5EWW A;  5CPE A;  4UIW A;  5ENH A;  2F6N A;  5F63 A;  5I29 A;  4TZ8 A;  5CZG A;  5KTW A;  2RFJ A;  4N3W A;  5IID A;  5D3S A;  3RCW A;  3ONI A;  4O74 A;  4F3I A;  2DVV A;  2DVQ A;  5EWD A;  5II2 A;  4ALH A;  5EPB A;  5F60 A;  4QBM A;  5ENJ A;  5K29 A;  5AD3 A;  4LYI A;  3G0L A;  4IOO A;  5HCL A;  4NYX A;  1JM4 B;  3SVF A;  4N4H A;  5I40 A;  4NUC A;  5JI8 A;  4O7B A;  5D7X A;  5H85 A;  3GG3 A;  2RNW A;  5HRV A;  3JVK A;  3LXJ A;  4IOR A;  2DVR A;  4Y03 A;  2I8N A;  1E6I A;  5E74 A;  2YQD A;  2YEK A;  4LZR A;  3Q2F A;  1JSP B;  4PS5 A;  4ZW1 A;  5DFD A;  2DAT A;  4YAX A;  4BW2 A;  5FDZ A;  2L84 A;  2L5E A;  4WHU A;  5A5S A;  3UVX A;  2YDW A;  5LVQ A;  5BT3 A;  4TQN A;  4XY8 A;  4LRG A;  4YYM A;  3P5O A;  4TT2 A;  5F61 A;  4CUP A;  4UYE A;  4CUQ A;  4YH3 A;  5AMF A;  5FBX A;  4HXO A;  3DWY A;  5IGK A; 
#chains in the Genus database with same CATH topology
 5D3J A;  4NR9 A;  5CP5 A;  3P1F A;  4NR7 A;  4O7A A;  4KV4 A;  5LVR A;  5A82 A;  4LDF A;  5I89 A;  5EM3 A;  3AQA A;  4J0R A;  3MB3 A;  3U5L A;  5LJ1 A;  5DFC A;  4UYF A;  5DBM A;  5LKZ A;  5FH8 A;  4NQM A;  5LKX A;  5E3G A;  4HXL A;  5KTU A;  4NYV A;  4BJX A;  5HQ7 A;  1WUM A;  4O75 A;  4QSU A;  4HXM A;  2OO1 A;  4NRA A;  5F62 A;  3U5M A;  5L97 A;  5D3T A;  5D3R A;  3U5P A;  3VKG A;  5I86 A;  3NXB A;  4CFL A;  5DKC A;  2D82 A;  5CY9 A;  5ETD A;  5E3D A;  4Z93 A;  4AI6 A;  4TTE A;  3QZS A;  4IR6 A;  5F25 A;  4YAT A;  4NXJ A;  3SVG A;  5DW1 A;  4MEP A;  5DYA A;  5ENF A;  3AAD A;  4IR5 A;  5CS8 A;  5FB1 A;  2R0V A;  5D24 A;  5D26 A;  3K2J A;  3S91 A;  5I83 A;  2DKW A;  3JVM A;  5ENI A;  1PUO A;  3UVW A;  5I7Y A;  4YAB A;  5C7N A;  4QYL A;  2YEL A;  4A9E A;  5LJ2 A;  4HBW A;  4QR4 A;  4PY6 A;  4UYG A;  5LKT A;  5G4S A;  4YH4 A;  4YK0 A;  5EWH A;  5FE3 A;  5A7C A;  4Q0N A;  5FFW A;  4YYI A;  4QUT A;  5F36 A;  5F2P A;  5HRW A;  5F1L A;  5BT4 A;  5CRZ A;  4QNS A;  5FE0 A;  5F3A A;  3D1B A;  4YBT A;  5DLZ A;  5DW2 A;  3UV5 A;  5A83 A;  4HXK A;  5CFW A;  5DFB A;  5EA1 A;  4CUS A;  3O33 A;  4CL9 A;  4YYK A;  4N4I A;  5DYC A;  5FE5 A;  4MR6 A;  5JWM A;  5IGN A;  5DY7 A;  3SVH A;  4RVR A;  5AME A;  4HXS A;  3U5K A;  5E9K A;  3Q2E A;  4Z6I A;  2F6J A;  2NXB A;  4BHW A;  4FLP A;  4O71 A;  4N4G A;  4O76 A;  4YY4 A;  5F5Z A;  5CTL A;  5COI A;  5FE8 A;  4MR5 A;  5CQA A;  5FFY A;  2RO1 A;  5FH6 A;  4NYW A;  4QYD A;  5A85 A;  4J3I A;  3U5N A;  1ZKR A;  5CUG A;  4ZQL A;  4A9M A;  5I80 A;  2DVS A;  2DWW A;  5CUD A;  3P1D A;  3UVD A;  4A9I A;  3U5O A;  5KO4 A;  5CQ7 A;  4UYH A;  5FFV A;  3ZYU A;  1WUG A;  5D3N A;  5HFQ A;  4YYH A;  4QC3 A;  4LR6 A;  5II1 A;  4XY9 A;  5E7D A;  4QR5 A;  4YAD A;  3JVL A;  2RNX A;  5FE2 A;  4O7C A;  4XUB A;  3LJW A;  4UIY A;  5CQ4 A;  2RS9 B;  5F1H A;  4Z6H A;  4MEN A;  5D0C A;  4AKN A;  2YEM A;  3JVJ A;  3MUK A;  5A5R A;  5L8T A;  1N72 A;  4YBS A;  4CUU A;  4YYD A;  4CLB A;  3QZT A;  5HQ6 A;  5C89 A;  4OUF A;  5DYU A;  4KCX A;  5EWV A;  4MR4 A;  5LKU A;  3P1C A;  4QSP A;  5HM0 A;  2WP2 A;  4LYW A;  4QUU A;  2EJN A;  5DKH A;  3D1D A;  2YW5 A;  4UYD A;  3I3J A;  4XYA A;  2GRC A;  2H60 A;  4WIV A;  4HXR A;  4A9L A;  5H1T A;  3O37 A;  3O34 A;  3QZV A;  5D3L A;  3UW9 A;  4LYS A;  4O7E A;  4A9K A;  5IBN A;  4E96 A;  5IG6 A;  2G4A A;  5ENG A;  3MB4 A;  4TS8 A;  4Q0O A;  3HMF A;  3LQJ A;  2WP1 A;  4TU4 A;  5E9V A;  5D3H A;  4LC2 A;  5D3P A;  4ALG A;  5FE4 A;  4Z1S A;  5I1Q A;  3IU5 A;  4BW1 A;  3MUL A;  4UIX A;  4TT6 A;  5L98 A;  2E7N A;  4NR4 A;  1X0J A;  4IR4 A;  4Z1Q A;  4XUA A;  5ENE A;  4BW3 A;  4NUE A;  4TYL A;  5DX4 A;  4QSQ A;  5E9Y A;  5FG6 A;  2LSP B;  4YYG A;  5EQ1 A;  5E9L A;  4J0S A;  5HRX A;  4PTB A;  3UV4 A;  5L8U A;  4A9F A;  4NRB A;  5CUE A;  4TU6 A;  4YBM A;  4O70 A;  5TCM A;  5J0D A;  5EU1 A;  5LUU A;  4O7F A;  2MJV B;  5EWC A;  5CQT A;  5AD2 A;  5A5Q A;  4C66 A;  5E73 A;  4X2I A;  3FKM X;  4QSW A;  5ENC A;  3G0J A;  5FB0 A;  1F68 A;  4UYF B;  5KU3 A;  2E7O A;  3UVY A;  5CQ5 A;  5H1U A;  4TT4 A;  5CQ3 A;  3LQI A;  4IOQ A;  5L99 A;  4LZS A;  4QR3 A;  5E9M A;  1EQF A;  4TZ2 A;  5HEN A;  4NR5 A;  4GPJ A;  2OSS A;  5G4R A;  4A9O A;  5FE9 A;  3DAI A;  4O72 A;  4IR3 A;  4CUT A;  5ACY A;  3P1E A;  5ETB A;  4QSV A;  4C67 A;  2YYN A;  5FG5 A;  2I7K A;  4CUR A;  4UIU A;  5C4Q A;  1ZS5 A;  4QC1 A;  4UIV A;  4PCE A;  4PKL A;  4UIT A;  5HEM A;  5I7X A;  5BT5 A;  3O36 A;  5C85 A;  4HBX A;  4AKI A;  4QSR A;  4KV1 A;  2R0S A;  5CUA A;  4WHW A;  5EI4 A;  4A9H A;  5IGM A;  5C87 A;  4NR6 A;  2R0Y A;  4QSX A;  2D9E A;  5DKD A;  4NUD A;  5FH7 A;  4OGJ A;  5FG4 A;  4O77 A;  5A81 A;  5C8G A;  4YC9 A;  4HXN A;  5IGL A;  4NRC A;  2N9G A;  4QEW A;  5DYX A;  5FE6 A;  4DON A;  4QEV A;  4NQN A;  5I88 A;  5E0R A;  5EIS A;  4YYN A;  4O78 A;  4CFK A;  3HMH A;  5CUC A;  3UV2 A;  2RI7 A;  2E3K A;  4HBV A;  4N4F A;  5HFR A;  3IU6 A;  3MXF A;  3HME A;  3D7C A;  5A5O A;  4AKH A;  5EP7 A;  4QSS A;  5EV9 A;  2FSA A;  5CQ6 A;  4BW4 A;  5CGP A;  5EPS A;  5CQ8 A;  5L96 A;  5CRM A;  5EPR A;  5A5N A;  3U5J A;  5CU8 A;  5HLS A;  5KHM A;  5HQ5 A;  5H1V A;  4J1P A;  4PCI A;  3O35 A;  5DLX A;  4ZC9 A;  4HXP A;  4NS5 A;  4OGI A;  4QY4 A;  4QEU A;  3LQH A;  5EK9 A;  5FE1 A;  5EIC A;  2RNY A;  4NR8 A;  4MEQ A;  4QZS A;  3S92 A;  5TB6 A;  4LZ2 A;  4A9N A;  2R10 A;  3TLP A;  5E9I A;  4HBY A;  4A9J A;  3VKH A;  5ENB A;  4MEO A;  5LJ0 A;  5KTX A;  5D25 A;  3MQM A;  5A5P A;  5HJC A;  4QST A;  4MR3 A;  5EVA A;  4QB3 A;  5CUB A;  5FE7 A;  4UIZ A;  5HEL A;  2L85 A;  5EGU A;  2OUO A;  4YY6 A;  4YYJ A;  2KTB B;  5EWW A;  5CPE A;  4UIW A;  5ENH A;  2F6N A;  5F63 A;  5I29 A;  4TZ8 A;  5CZG A;  5KTW A;  2RFJ A;  4N3W A;  5IID A;  5D3S A;  3RCW A;  3ONI A;  4O74 A;  4F3I A;  2DVV A;  2DVQ A;  5EWD A;  5II2 A;  4ALH A;  5EPB A;  5F60 A;  4QBM A;  5ENJ A;  5K29 A;  5AD3 A;  4LYI A;  3G0L A;  4IOO A;  5HCL A;  4NYX A;  1JM4 B;  3SVF A;  4N4H A;  5I40 A;  4NUC A;  5JI8 A;  4O7B A;  5D7X A;  5H85 A;  3GG3 A;  2RNW A;  5HRV A;  3JVK A;  3LXJ A;  4IOR A;  2DVR A;  3ERR A;  4Y03 A;  2I8N A;  1E6I A;  5E74 A;  2YQD A;  2YEK A;  4LZR A;  3Q2F A;  1JSP B;  4PS5 A;  4ZW1 A;  5DFD A;  2DAT A;  4YAX A;  4BW2 A;  5FDZ A;  2L84 A;  2L5E A;  4WHU A;  5A5S A;  3UVX A;  2YDW A;  5LVQ A;  5BT3 A;  4AKG A;  4TQN A;  4XY8 A;  4LRG A;  4YYM A;  3P5O A;  4TT2 A;  5F61 A;  4CUP A;  4UYE A;  4CUQ A;  4YH3 A;  5AMF A;  5FBX A;  4HXO A;  3DWY A;  5IGK A; 
#chains in the Genus database with same CATH homology
 5D3J A;  4NR9 A;  5CP5 A;  3P1F A;  4NR7 A;  4O7A A;  4KV4 A;  5LVR A;  5A82 A;  4LDF A;  5I89 A;  5EM3 A;  3AQA A;  4J0R A;  3MB3 A;  3U5L A;  5LJ1 A;  5DFC A;  4UYF A;  5DBM A;  5LKZ A;  5FH8 A;  4NQM A;  5LKX A;  5E3G A;  4HXL A;  5KTU A;  4NYV A;  4BJX A;  5HQ7 A;  1WUM A;  4O75 A;  4QSU A;  4HXM A;  2OO1 A;  4NRA A;  5F62 A;  3U5M A;  5L97 A;  5D3T A;  5D3R A;  3U5P A;  5I86 A;  3NXB A;  4CFL A;  5DKC A;  2D82 A;  5CY9 A;  5ETD A;  5E3D A;  4Z93 A;  4TTE A;  3QZS A;  4IR6 A;  5F25 A;  4YAT A;  4NXJ A;  3SVG A;  5DW1 A;  4MEP A;  5DYA A;  5ENF A;  3AAD A;  4IR5 A;  5CS8 A;  5FB1 A;  2R0V A;  5D24 A;  5D26 A;  3K2J A;  3S91 A;  5I83 A;  2DKW A;  3JVM A;  5ENI A;  3UVW A;  5I7Y A;  4YAB A;  5C7N A;  4QYL A;  2YEL A;  4A9E A;  5LJ2 A;  4HBW A;  4QR4 A;  4PY6 A;  4UYG A;  5LKT A;  5G4S A;  4YH4 A;  4YK0 A;  5EWH A;  5FE3 A;  5A7C A;  4Q0N A;  5FFW A;  4YYI A;  4QUT A;  5F36 A;  5F2P A;  5HRW A;  5F1L A;  5BT4 A;  5CRZ A;  4QNS A;  5FE0 A;  5F3A A;  4YBT A;  5DLZ A;  5DW2 A;  3UV5 A;  5A83 A;  4HXK A;  5CFW A;  5DFB A;  5EA1 A;  4CUS A;  3O33 A;  4CL9 A;  4YYK A;  4N4I A;  5DYC A;  5FE5 A;  4MR6 A;  5JWM A;  5IGN A;  5DY7 A;  3SVH A;  4RVR A;  5AME A;  4HXS A;  3U5K A;  5E9K A;  3Q2E A;  4Z6I A;  2F6J A;  2NXB A;  4BHW A;  4FLP A;  4O71 A;  4N4G A;  4O76 A;  4YY4 A;  5F5Z A;  5CTL A;  5COI A;  5FE8 A;  4MR5 A;  5CQA A;  5FFY A;  2RO1 A;  5FH6 A;  4NYW A;  4QYD A;  5A85 A;  4J3I A;  3U5N A;  5CUG A;  4ZQL A;  4A9M A;  5I80 A;  2DVS A;  2DWW A;  5CUD A;  3P1D A;  3UVD A;  4A9I A;  3U5O A;  5KO4 A;  5CQ7 A;  4UYH A;  5FFV A;  3ZYU A;  1WUG A;  5D3N A;  5HFQ A;  4YYH A;  4QC3 A;  4LR6 A;  5II1 A;  4XY9 A;  5E7D A;  4QR5 A;  4YAD A;  3JVL A;  2RNX A;  5FE2 A;  4O7C A;  4XUB A;  3LJW A;  4UIY A;  5CQ4 A;  2RS9 B;  5F1H A;  4Z6H A;  4MEN A;  5D0C A;  4AKN A;  2YEM A;  3JVJ A;  3MUK A;  5A5R A;  5L8T A;  1N72 A;  4YBS A;  4CUU A;  4YYD A;  4CLB A;  3QZT A;  5HQ6 A;  5C89 A;  4OUF A;  5DYU A;  4KCX A;  5EWV A;  4MR4 A;  5LKU A;  3P1C A;  4QSP A;  5HM0 A;  2WP2 A;  4LYW A;  4QUU A;  5DKH A;  2YW5 A;  4UYD A;  3I3J A;  4XYA A;  2GRC A;  2H60 A;  4WIV A;  4HXR A;  4A9L A;  5H1T A;  3O37 A;  3O34 A;  3QZV A;  5D3L A;  3UW9 A;  4LYS A;  4O7E A;  4A9K A;  5IBN A;  4E96 A;  5IG6 A;  2G4A A;  5ENG A;  3MB4 A;  4TS8 A;  4Q0O A;  3HMF A;  3LQJ A;  2WP1 A;  4TU4 A;  5E9V A;  5D3H A;  4LC2 A;  5D3P A;  4ALG A;  5FE4 A;  4Z1S A;  5I1Q A;  3IU5 A;  4BW1 A;  3MUL A;  4UIX A;  4TT6 A;  5L98 A;  2E7N A;  4NR4 A;  1X0J A;  4IR4 A;  4Z1Q A;  4XUA A;  5ENE A;  4BW3 A;  4NUE A;  4TYL A;  5DX4 A;  4QSQ A;  5E9Y A;  5FG6 A;  2LSP B;  4YYG A;  5EQ1 A;  5E9L A;  4J0S A;  5HRX A;  4PTB A;  3UV4 A;  5L8U A;  4A9F A;  4NRB A;  5CUE A;  4TU6 A;  4YBM A;  4O70 A;  5TCM A;  5J0D A;  5EU1 A;  5LUU A;  4O7F A;  2MJV B;  5EWC A;  5CQT A;  5AD2 A;  5A5Q A;  4C66 A;  5E73 A;  4X2I A;  3FKM X;  4QSW A;  5ENC A;  3G0J A;  5FB0 A;  1F68 A;  4UYF B;  5KU3 A;  2E7O A;  3UVY A;  5CQ5 A;  5H1U A;  4TT4 A;  5CQ3 A;  3LQI A;  4IOQ A;  5L99 A;  4LZS A;  4QR3 A;  5E9M A;  1EQF A;  4TZ2 A;  5HEN A;  4NR5 A;  4GPJ A;  2OSS A;  5G4R A;  4A9O A;  5FE9 A;  3DAI A;  4O72 A;  4IR3 A;  4CUT A;  5ACY A;  3P1E A;  5ETB A;  4QSV A;  4C67 A;  2YYN A;  5FG5 A;  2I7K A;  4CUR A;  4UIU A;  5C4Q A;  1ZS5 A;  4QC1 A;  4UIV A;  4PCE A;  4PKL A;  4UIT A;  5HEM A;  5I7X A;  5BT5 A;  3O36 A;  5C85 A;  4HBX A;  4QSR A;  4KV1 A;  2R0S A;  5CUA A;  4WHW A;  5EI4 A;  4A9H A;  5IGM A;  5C87 A;  4NR6 A;  2R0Y A;  4QSX A;  2D9E A;  5DKD A;  4NUD A;  5FH7 A;  4OGJ A;  5FG4 A;  4O77 A;  5A81 A;  5C8G A;  4YC9 A;  4HXN A;  5IGL A;  4NRC A;  2N9G A;  4QEW A;  5DYX A;  5FE6 A;  4DON A;  4QEV A;  4NQN A;  5I88 A;  5E0R A;  5EIS A;  4YYN A;  4O78 A;  4CFK A;  3HMH A;  5CUC A;  3UV2 A;  2RI7 A;  2E3K A;  4HBV A;  4N4F A;  5HFR A;  3IU6 A;  3MXF A;  3HME A;  3D7C A;  5A5O A;  5EP7 A;  4QSS A;  5EV9 A;  2FSA A;  5CQ6 A;  4BW4 A;  5CGP A;  5EPS A;  5CQ8 A;  5L96 A;  5CRM A;  5EPR A;  5A5N A;  3U5J A;  5CU8 A;  5HLS A;  5KHM A;  5HQ5 A;  5H1V A;  4J1P A;  4PCI A;  3O35 A;  5DLX A;  4ZC9 A;  4HXP A;  4NS5 A;  4OGI A;  4QY4 A;  4QEU A;  3LQH A;  5EK9 A;  5FE1 A;  5EIC A;  2RNY A;  4NR8 A;  4MEQ A;  4QZS A;  3S92 A;  5TB6 A;  4LZ2 A;  4A9N A;  2R10 A;  3TLP A;  5E9I A;  4HBY A;  4A9J A;  5ENB A;  4MEO A;  5LJ0 A;  5KTX A;  5D25 A;  3MQM A;  5A5P A;  5HJC A;  4QST A;  4MR3 A;  5EVA A;  4QB3 A;  5CUB A;  5FE7 A;  4UIZ A;  5HEL A;  2L85 A;  5EGU A;  2OUO A;  4YY6 A;  4YYJ A;  2KTB B;  5EWW A;  5CPE A;  4UIW A;  5ENH A;  2F6N A;  5F63 A;  5I29 A;  4TZ8 A;  5CZG A;  5KTW A;  2RFJ A;  4N3W A;  5IID A;  5D3S A;  3RCW A;  3ONI A;  4O74 A;  4F3I A;  2DVV A;  2DVQ A;  5EWD A;  5II2 A;  4ALH A;  5EPB A;  5F60 A;  4QBM A;  5ENJ A;  5K29 A;  5AD3 A;  4LYI A;  3G0L A;  4IOO A;  5HCL A;  4NYX A;  1JM4 B;  3SVF A;  4N4H A;  5I40 A;  4NUC A;  5JI8 A;  4O7B A;  5D7X A;  5H85 A;  3GG3 A;  2RNW A;  5HRV A;  3JVK A;  3LXJ A;  4IOR A;  2DVR A;  4Y03 A;  2I8N A;  1E6I A;  5E74 A;  2YQD A;  2YEK A;  4LZR A;  3Q2F A;  1JSP B;  4PS5 A;  4ZW1 A;  5DFD A;  2DAT A;  4YAX A;  4BW2 A;  5FDZ A;  2L84 A;  2L5E A;  4WHU A;  5A5S A;  3UVX A;  2YDW A;  5LVQ A;  5BT3 A;  4TQN A;  4XY8 A;  4LRG A;  4YYM A;  3P5O A;  4TT2 A;  5F61 A;  4CUP A;  4UYE A;  4CUQ A;  4YH3 A;  5AMF A;  5FBX A;  4HXO A;  3DWY A;  5IGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...