3QZSA

Crystal structure of bptf bromo in complex with histone h4k16ac - form i
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
111
structure length
111
Chain Sequence
SVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTAIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of a Mononucleosomal Histone Modification Pattern by BPTF via Multivalent Interactions.
pubmed doi rcsb
molecule keywords Nucleosome-remodeling factor subunit BPTF
molecule tags Transcription/nuclear protein
source organism Homo sapiens
total genus 42
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3qzsA00
3JVKA 4NR4A 4QY4A 4YYMA 2I7KA 4YADA 2YELA 2RNYA 4HXLA 5C87A 4CUSA 5I7XA 5A5OA 5FG4A 5LVQA 4PS5A 5I7YA 4YAXA 4TT4A 5CZGA 2RI7A 5A82A 4NYXA 4O78A 3UV4A 5DX4A 4QSWA 5D25A 5F3AA 5E3DA 4N4GA 5DFBA 4IR4A 5G4SA 5LKUA 4NQMA 3O35A 5DY7A 3DAIA 4YYJA 3G0LA 4CURA 4NYVA 4C66A 5A5SA 5DFCA 5DKCA 4HXRA 4X2IA 5KHMA 5DW1A 4QSVA 5CS8A 5FH7A 5F1LA 2OO1A 4TT2A 4TQNA 4CFKA 4TYLA 2YEMA 4NXJA 5CFWA 3G0JA 5CQAA 3P1DA 5CU8A 5DBMA 5HELA 5C8GA 2YW5A 4QSRA 5EWHA 5F1HA 4OGJA 5E9LA 5D3HA 4UYFB 5EWCA 4NS5A 4QEWA 1ZS5A 4OGIA 5BT5A 5HEMA 4CL9A 5LVRA 4PCEA 2H60A 5CUAA 5FE1A 3QZSA 5HCLA 5JWMA 5C4QA 2E3KA 5FDZA 5HM0A 1E6IA 5E74A 5EPBA 5EICA 5A5PA 4XUBA 5TCMA 5I89A 3O33A 2DATA 5F62A 2YEKA 4BHWA 2OSSA 5L8UA 5A85A 4HXKA 3UVYA 4NR9A 5CY9A 5CUEA 4HBYA 4MEPA 4QZSA 4A9IA 4CUQA 1EQFA 3UVWA 4TZ2A 5KTXA 3ONIA 2R0YA 4UIYA 4LR6A 5J0DA 5F63A 4ZW1A 4YY4A 2DVVA 4MR4A 4O72A 4A9KA 5EQ1A 4MEQA 5G4RA 2YDWA 5AD3A 4A9JA 4A9LA 4QC1A 3I3JA 1X0JA 4MENA 4CUPA 4YYHA 4QSSA 5D7XA 5EA1A 4HXOA 5D3LA 5I86A 4O70A 5E9YA 4QBMA 4YH3A 3D7CA 3AADA 5E7DA 4LRGA 5L8TA 3LQIA 2RO1A 5EISA 2RS9B 4IR6A 4MR3A 4XYAA 3JVMA 5EPSA 3NXBA 4A9OA 5CQ4A 5AMEA 5FE2A 5D3RA 4E96A 5ETBA 3K2JA 2L5EA 2R0SA 5CTLA 5F61A 3U5KA 2G4AA 4YBMA 5FE0A 5HLSA 5I29A 5LJ2A 4ZC9A 4CUUA 4Z6IA 4J1PA 5E9MA 5AD2A 3LXJA 4FLPA 4O77A 3U5LA 4TU6A 4UYDA 4LZ2A 2F6JA 5IGKA 5FE6A 5EM3A 5EPRA 4CLBA 3P1CA 5IIDA 4KCXA 4UYEA 4LYIA 4O76A 4XUAA 5D3SA 5FE4A 5JI8A 4NQNA 5FFVA 4ZQLA 4N4HA 5H1VA 5I40A 4ALHA 5II2A 5CQ8A 5EGUA 4RVRA 4YYGA 5ENGA 5C89A 5DW2A 4YYNA 4A9NA 3U5PA 4NRAA 4BJXA 5EWDA 2KTBB 4NR5A 2DVRA 3JVJA 4QUTA 4UIVA 5ENEA 2MJVB 1JSPB 4LC2A 4QSQA 5L99A 4XY8A 5LJ1A 5CGPA 4QR3A 5II1A 2F6NA 5F2PA 4O7EA 5A83A 5COIA 4NUDA 4A9HA 2RNWA 5I1QA 5I80A 5ENFA 3U5MA 5DYAA 2E7OA 3S91A 2WP1A 5FE3A 4NRCA 3HMFA 4NUCA 5D0CA 2DWWA 5LKTA 1JM4B 4QC3A 4LYSA 3FKMX 5L96A 5ETDA 5LJ0A 2RNXA 4Q0OA 4NR7A 4LZSA 5DFDA 4YYIA 4NRBA 5E0RA 5HFRA 4YBSA 2WP2A 4BW1A 5A5NA 4NR6A 4TU4A 4YABA 5EVAA 4QEUA 4F3IA 5H1TA 4PKLA 4TTEA 5FB1A 4CFLA 3JVLA 4NR8A 5H1UA 4YBTA 4O7AA 3MXFA 3QZVA 2OUOA 5FE7A 4MEOA 5CQTA 5AMFA 5FFYA 4HXNA 5IGLA 4UIWA 2DVQA 2YQDA 5FFWA 4HBWA 4QSPA 4A9FA 4YC9A 4N4IA 4UIUA 5E9KA 5HFQA 3SVGA 2E7NA 5DKDA 5HJCA 5IGNA 5HRWA 3MUKA 4YY6A 5EK9A 4Z1SA 5L98A 4HBVA 3TLPA 5CQ3A 3UW9A 1F68A 3IU5A 4O7FA 3HMEA 4NUEA 5H85A 5EWVA 5L97A 5KU3A 3MB4A 5ENCA 5FBXA 4Z1QA 4IOOA 4HBXA 4HXSA 5DLZA 5F5ZA 4O71A 3UV5A 3UV2A 3SVHA 4O74A 5D3PA 3DWYA 5FG6A 5CUGA 5CUCA 5EU1A 3ZYUA 4YATA 5EWWA 5FE8A 5FG5A 4GPJA 3QZTA 2RFJA 4QSTA 4IORA 5HQ5A 4CUTA 4QUUA 5CRMA 5ACYA 2NXBA 4TT6A 5D3JA 3GG3A 4UIZA 5KTWA 3SVFA 4WHWA 5I83A 2D82A 5KTUA 5HENA 3P5OA 5F36A 5EI4A 5DYXA 5D24A 2N9GA 5IBNA 4J3IA 2I8NA 3U5NA 4QEVA 5EV9A 2R0VA 4NYWA 4J0RA 4XY9A 5C85A 4DONA 5CP5A 5DYUA 4TZ8A 5FE5A 5LKZA 5FH6A 4YYKA 4WHUA 2FSAA 5CQ5A 4YH4A 2D9EA 5LKXA 5LUUA 4KV1A 5D26A 2YYNA 5CUBA 3UVXA 5CRZA 5HRVA 5IG6A 2LSPB 4YK0A 4ALGA 5C7NA 4UYHA 4Z6HA 4OUFA 5ENJA 5HQ7A 4LYWA 5HRXA 3MQMA 5F25A 4QSUA 4N4FA 3O34A 4PCIA 5D3NA 5E9IA 4BW2A 2DKWA 4YYDA 3S92A 5FH8A 2L85A 4C67A 5TB6A 5IGMA 3LQJA 5FE9A 5DYCA 4IOQA 2GRCA 4QR4A 5I88A 5EP7A 5BT4A 4LDFA 5DLXA 3UVDA 4UYFA 4O7CA 4BW3A 3O36A 3O37A 5F60A 5ENBA 2L84A 4N3WA 5ENHA 3P1FA 5CQ6A 4O75A 5HQ6A 5E3GA 3P1EA 4O7BA 5DKHA 4MR6A 3Q2EA 5A5RA 3MULA 4QR5A 5ENIA 4PTBA 4J0SA 4UITA 1N72A 5KO4A 4MR5A 4PY6A 3LQHA 3U5JA 1WUGA 1WUMA 4WIVA 4A9MA 3HMHA 5FB0A 4HXPA 5D3TA 5BT3A 3AQAA 3Q2FA 5A7CA 3LJWA 4HXMA 4Q0NA 4UYGA 5CPEA 4TS8A 4QYLA 4AKNA 5K29A 5CUDA 4QNSA 4QYDA 4A9EA 5A81A 3RCWA 4IR5A 3IU6A 2DVSA 3U5OA 4UIXA 4Y03A 5CQ7A 2R10A 5E73A 3MB3A 4KV4A 4Z93A 4BW4A 4QSXA 5A5QA 4IR3A 5E9VA 4QB3A 4LZRA
chains in the Genus database with same CATH superfamily
3JVKA 4NR4A 4QY4A 4YYMA 2I7KA 4YADA 2YELA 2RNYA 4HXLA 5C87A 4CUSA 5I7XA 5A5OA 5FG4A 5LVQA 4PS5A 5I7YA 4YAXA 4TT4A 5CZGA 2RI7A 5A82A 4NYXA 4O78A 3UV4A 5DX4A 4QSWA 5D25A 5F3AA 5E3DA 4N4GA 5DFBA 4IR4A 5G4SA 5LKUA 4NQMA 3O35A 5DY7A 3DAIA 4YYJA 3G0LA 4CURA 4NYVA 4C66A 5A5SA 5DFCA 5DKCA 4HXRA 4X2IA 5KHMA 5DW1A 4QSVA 4AKHA 5CS8A 5FH7A 5F1LA 2OO1A 4TT2A 4TQNA 4CFKA 4TYLA 2YEMA 4NXJA 5CFWA 3G0JA 5CQAA 3P1DA 5CU8A 5DBMA 5HELA 5C8GA 2YW5A 4QSRA 5EWHA 5F1HA 4OGJA 5E9LA 5D3HA 4UYFB 5EWCA 4NS5A 4QEWA 1ZS5A 4OGIA 5BT5A 5HEMA 4CL9A 5LVRA 4PCEA 2H60A 5CUAA 5FE1A 3QZSA 5HCLA 5JWMA 5C4QA 2E3KA 5FDZA 5HM0A 1E6IA 5E74A 5EPBA 5EICA 5A5PA 4XUBA 5TCMA 5I89A 3O33A 2DATA 5F62A 2YEKA 4BHWA 2OSSA 5L8UA 5A85A 4HXKA 3UVYA 4NR9A 5CY9A 5CUEA 4HBYA 4MEPA 4QZSA 4A9IA 4CUQA 1EQFA 3UVWA 4TZ2A 5KTXA 3ONIA 2R0YA 4UIYA 4AKIA 4LR6A 5J0DA 5F63A 4ZW1A 4YY4A 2DVVA 4MR4A 4O72A 4A9KA 5EQ1A 4MEQA 5G4RA 2YDWA 5AD3A 4A9JA 4A9LA 4QC1A 3I3JA 3D1BA 1ZKRA 1X0JA 4MENA 4CUPA 4YYHA 4QSSA 5D7XA 5EA1A 4HXOA 5D3LA 5I86A 4O70A 5E9YA 4QBMA 4YH3A 3D7CA 3AADA 5E7DA 4LRGA 5L8TA 3LQIA 2RO1A 5EISA 2RS9B 4IR6A 4MR3A 4XYAA 3JVMA 5EPSA 3NXBA 4A9OA 5CQ4A 5AMEA 5FE2A 5D3RA 4E96A 5ETBA 3K2JA 2L5EA 2R0SA 5CTLA 5F61A 3U5KA 2G4AA 4YBMA 5FE0A 5HLSA 5I29A 5LJ2A 4ZC9A 4CUUA 4Z6IA 4J1PA 4AI6A 5E9MA 5AD2A 3LXJA 4FLPA 4O77A 3U5LA 4TU6A 4UYDA 4LZ2A 2F6JA 5IGKA 5FE6A 5EM3A 5EPRA 4CLBA 3P1CA 5IIDA 4KCXA 4UYEA 4LYIA 4O76A 4XUAA 5D3SA 5FE4A 5JI8A 4NQNA 4AKGA 5FFVA 4ZQLA 4N4HA 5H1VA 5I40A 4ALHA 5II2A 5CQ8A 5EGUA 4RVRA 4YYGA 5ENGA 5C89A 5DW2A 4YYNA 4A9NA 3U5PA 4NRAA 4BJXA 5EWDA 2KTBB 4NR5A 2DVRA 3JVJA 4QUTA 4UIVA 5ENEA 2MJVB 1JSPB 4LC2A 4QSQA 5L99A 4XY8A 5LJ1A 5CGPA 4QR3A 5II1A 2F6NA 5F2PA 4O7EA 5A83A 5COIA 4NUDA 4A9HA 2RNWA 5I1QA 5I80A 5ENFA 3U5MA 5DYAA 2E7OA 3S91A 2WP1A 5FE3A 4NRCA 3HMFA 4NUCA 5D0CA 2DWWA 5LKTA 1JM4B 4QC3A 4LYSA 3FKMX 5L96A 5ETDA 5LJ0A 2RNXA 4Q0OA 4NR7A 4LZSA 5DFDA 4YYIA 4NRBA 5E0RA 5HFRA 4YBSA 2WP2A 4BW1A 5A5NA 4NR6A 4TU4A 4YABA 5EVAA 4QEUA 4F3IA 5H1TA 4PKLA 4TTEA 5FB1A 4CFLA 3JVLA 4NR8A 5H1UA 4YBTA 4O7AA 3MXFA 3QZVA 2OUOA 5FE7A 4MEOA 5CQTA 5AMFA 3VKGA 5FFYA 4HXNA 5IGLA 4UIWA 2DVQA 2YQDA 5FFWA 4HBWA 4QSPA 4A9FA 4YC9A 4N4IA 4UIUA 5E9KA 5HFQA 3SVGA 2E7NA 5DKDA 5HJCA 5IGNA 5HRWA 3MUKA 4YY6A 3VKHA 5EK9A 4Z1SA 5L98A 4HBVA 3TLPA 5CQ3A 3UW9A 1F68A 3IU5A 4O7FA 3HMEA 4NUEA 5H85A 5EWVA 5L97A 5KU3A 3MB4A 5ENCA 5FBXA 4Z1QA 1PUOA 4IOOA 4HBXA 4HXSA 5DLZA 5F5ZA 4O71A 3UV5A 3UV2A 3SVHA 4O74A 5D3PA 3DWYA 5FG6A 5CUGA 5CUCA 5EU1A 3ZYUA 4YATA 5EWWA 5FE8A 5FG5A 4GPJA 3QZTA 2RFJA 4QSTA 4IORA 5HQ5A 4CUTA 4QUUA 5CRMA 5ACYA 2NXBA 4TT6A 5D3JA 3GG3A 4UIZA 5KTWA 3SVFA 4WHWA 5I83A 2D82A 5KTUA 5HENA 3P5OA 5F36A 5EI4A 5DYXA 5D24A 2N9GA 5IBNA 4J3IA 2I8NA 3U5NA 4QEVA 5EV9A 2R0VA 4NYWA 4J0RA 4XY9A 5C85A 4DONA 5CP5A 5DYUA 4TZ8A 5FE5A 5LKZA 5FH6A 4YYKA 4WHUA 2FSAA 5CQ5A 4YH4A 2D9EA 5LKXA 5LUUA 4KV1A 5D26A 2YYNA 5CUBA 3UVXA 5CRZA 5HRVA 5IG6A 2LSPB 4YK0A 4ALGA 5C7NA 4UYHA 4Z6HA 4OUFA 5ENJA 5HQ7A 4LYWA 5HRXA 3MQMA 5F25A 4QSUA 4N4FA 3O34A 4PCIA 5D3NA 5E9IA 4BW2A 2DKWA 4YYDA 3S92A 5FH8A 2L85A 4C67A 5TB6A 5IGMA 3LQJA 5FE9A 5DYCA 4IOQA 2GRCA 4QR4A 5I88A 5EP7A 5BT4A 4LDFA 5DLXA 3UVDA 4UYFA 4O7CA 4BW3A 3O36A 3O37A 5F60A 5ENBA 2L84A 4N3WA 5ENHA 3P1FA 5CQ6A 4O75A 5HQ6A 5E3GA 3P1EA 4O7BA 5DKHA 4MR6A 3ERRA 3Q2EA 5A5RA 3MULA 4QR5A 5ENIA 4PTBA 4J0SA 2EJNA 4UITA 1N72A 5KO4A 4MR5A 4PY6A 3LQHA 3D1DA 3U5JA 1WUGA 1WUMA 4WIVA 4A9MA 3HMHA 5FB0A 4HXPA 5D3TA 5BT3A 3AQAA 3Q2FA 5A7CA 3LJWA 4HXMA 4Q0NA 4UYGA 5CPEA 4TS8A 4QYLA 4AKNA 5K29A 5CUDA 4QNSA 4QYDA 4A9EA 5A81A 3RCWA 4IR5A 3IU6A 2DVSA 3U5OA 4UIXA 4Y03A 5CQ7A 2R10A 5E73A 3MB3A 4KV4A 4Z93A 4BW4A 4QSXA 5A5QA 4IR3A 5E9VA 4QB3A 4LZRA
chains in the Genus database with same CATH topology
3JVKA 4NR4A 4QY4A 4YYMA 2I7KA 4YADA 2YELA 2RNYA 4HXLA 5C87A 4CUSA 5I7XA 5A5OA 5FG4A 5LVQA 4PS5A 5I7YA 4YAXA 4TT4A 5CZGA 2RI7A 5A82A 4NYXA 4O78A 3UV4A 5DX4A 4QSWA 5D25A 5F3AA 5E3DA 4N4GA 5DFBA 4IR4A 5G4SA 5LKUA 4NQMA 3O35A 5DY7A 3DAIA 4YYJA 3G0LA 4CURA 4NYVA 4C66A 5A5SA 5DFCA 5DKCA 4HXRA 4X2IA 5KHMA 5DW1A 4QSVA 5CS8A 5FH7A 5F1LA 2OO1A 4TT2A 4TQNA 4CFKA 4TYLA 2YEMA 4NXJA 5CFWA 3G0JA 5CQAA 3P1DA 5CU8A 5DBMA 5HELA 5C8GA 2YW5A 4QSRA 5EWHA 5F1HA 4OGJA 5E9LA 5D3HA 4UYFB 5EWCA 4NS5A 4QEWA 1ZS5A 4OGIA 5BT5A 5HEMA 4CL9A 5LVRA 4PCEA 2H60A 5CUAA 5FE1A 3QZSA 5HCLA 5JWMA 5C4QA 2E3KA 5FDZA 5HM0A 1E6IA 5E74A 5EPBA 5EICA 5A5PA 4XUBA 5TCMA 5I89A 3O33A 2DATA 5F62A 2YEKA 4BHWA 2OSSA 5L8UA 5A85A 4HXKA 3UVYA 4NR9A 5CY9A 5CUEA 4HBYA 4MEPA 4QZSA 4A9IA 4CUQA 1EQFA 3UVWA 4TZ2A 5KTXA 3ONIA 2R0YA 4UIYA 4LR6A 5J0DA 5F63A 4ZW1A 4YY4A 2DVVA 4MR4A 4O72A 4A9KA 5EQ1A 4MEQA 5G4RA 2YDWA 5AD3A 4A9JA 4A9LA 4QC1A 3I3JA 1X0JA 4MENA 4CUPA 4YYHA 4QSSA 5D7XA 5EA1A 4HXOA 5D3LA 5I86A 4O70A 5E9YA 4QBMA 4YH3A 3D7CA 3AADA 5E7DA 4LRGA 5L8TA 3LQIA 2RO1A 5EISA 2RS9B 4IR6A 4MR3A 4XYAA 3JVMA 5EPSA 3NXBA 4A9OA 5CQ4A 5AMEA 5FE2A 5D3RA 4E96A 5ETBA 3K2JA 2L5EA 2R0SA 5CTLA 5F61A 3U5KA 2G4AA 4YBMA 5FE0A 5HLSA 5I29A 5LJ2A 4ZC9A 4CUUA 4Z6IA 4J1PA 5E9MA 5AD2A 3LXJA 4FLPA 4O77A 3U5LA 4TU6A 4UYDA 4LZ2A 2F6JA 5IGKA 5FE6A 5EM3A 5EPRA 4CLBA 3P1CA 5IIDA 4KCXA 4UYEA 4LYIA 4O76A 4XUAA 5D3SA 5FE4A 5JI8A 4NQNA 5FFVA 4ZQLA 4N4HA 5H1VA 5I40A 4ALHA 5II2A 5CQ8A 5EGUA 4RVRA 4YYGA 5ENGA 5C89A 5DW2A 4YYNA 4A9NA 3U5PA 4NRAA 4BJXA 5EWDA 2KTBB 4NR5A 2DVRA 3JVJA 4QUTA 4UIVA 5ENEA 2MJVB 1JSPB 4LC2A 4QSQA 5L99A 4XY8A 5LJ1A 5CGPA 4QR3A 5II1A 2F6NA 5F2PA 4O7EA 5A83A 5COIA 4NUDA 4A9HA 2RNWA 5I1QA 5I80A 5ENFA 3U5MA 5DYAA 2E7OA 3S91A 2WP1A 5FE3A 4NRCA 3HMFA 4NUCA 5D0CA 2DWWA 5LKTA 1JM4B 4QC3A 4LYSA 3FKMX 5L96A 5ETDA 5LJ0A 2RNXA 4Q0OA 4NR7A 4LZSA 5DFDA 4YYIA 4NRBA 5E0RA 5HFRA 4YBSA 2WP2A 4BW1A 5A5NA 4NR6A 4TU4A 4YABA 5EVAA 4QEUA 4F3IA 5H1TA 4PKLA 4TTEA 5FB1A 4CFLA 3JVLA 4NR8A 5H1UA 4YBTA 4O7AA 3MXFA 3QZVA 2OUOA 5FE7A 4MEOA 5CQTA 5AMFA 5FFYA 4HXNA 5IGLA 4UIWA 2DVQA 2YQDA 5FFWA 4HBWA 4QSPA 4A9FA 4YC9A 4N4IA 4UIUA 5E9KA 5HFQA 3SVGA 2E7NA 5DKDA 5HJCA 5IGNA 5HRWA 3MUKA 4YY6A 5EK9A 4Z1SA 5L98A 4HBVA 3TLPA 5CQ3A 3UW9A 1F68A 3IU5A 4O7FA 3HMEA 4NUEA 5H85A 5EWVA 5L97A 5KU3A 3MB4A 5ENCA 5FBXA 4Z1QA 4IOOA 4HBXA 4HXSA 5DLZA 5F5ZA 4O71A 3UV5A 3UV2A 3SVHA 4O74A 5D3PA 3DWYA 5FG6A 5CUGA 5CUCA 5EU1A 3ZYUA 4YATA 5EWWA 5FE8A 5FG5A 4GPJA 3QZTA 2RFJA 4QSTA 4IORA 5HQ5A 4CUTA 4QUUA 5CRMA 5ACYA 2NXBA 4TT6A 5D3JA 3GG3A 4UIZA 5KTWA 3SVFA 4WHWA 5I83A 2D82A 5KTUA 5HENA 3P5OA 5F36A 5EI4A 5DYXA 5D24A 2N9GA 5IBNA 4J3IA 2I8NA 3U5NA 4QEVA 5EV9A 2R0VA 4NYWA 4J0RA 4XY9A 5C85A 4DONA 5CP5A 5DYUA 4TZ8A 5FE5A 5LKZA 5FH6A 4YYKA 4WHUA 2FSAA 5CQ5A 4YH4A 2D9EA 5LKXA 5LUUA 4KV1A 5D26A 2YYNA 5CUBA 3UVXA 5CRZA 5HRVA 5IG6A 2LSPB 4YK0A 4ALGA 5C7NA 4UYHA 4Z6HA 4OUFA 5ENJA 5HQ7A 4LYWA 5HRXA 3MQMA 5F25A 4QSUA 4N4FA 3O34A 4PCIA 5D3NA 5E9IA 4BW2A 2DKWA 4YYDA 3S92A 5FH8A 2L85A 4C67A 5TB6A 5IGMA 3LQJA 5FE9A 5DYCA 4IOQA 2GRCA 4QR4A 5I88A 5EP7A 5BT4A 4LDFA 5DLXA 3UVDA 4UYFA 4O7CA 4BW3A 3O36A 3O37A 5F60A 5ENBA 2L84A 4N3WA 5ENHA 3P1FA 5CQ6A 4O75A 5HQ6A 5E3GA 3P1EA 4O7BA 5DKHA 4MR6A 3Q2EA 5A5RA 3MULA 4QR5A 5ENIA 4PTBA 4J0SA 4UITA 1N72A 5KO4A 4MR5A 4PY6A 3LQHA 3U5JA 1WUGA 1WUMA 4WIVA 4A9MA 3HMHA 5FB0A 4HXPA 5D3TA 5BT3A 3AQAA 3Q2FA 5A7CA 3LJWA 4HXMA 4Q0NA 4UYGA 5CPEA 4TS8A 4QYLA 4AKNA 5K29A 5CUDA 4QNSA 4QYDA 4A9EA 5A81A 3RCWA 4IR5A 3IU6A 2DVSA 3U5OA 4UIXA 4Y03A 5CQ7A 2R10A 5E73A 3MB3A 4KV4A 4Z93A 4BW4A 4QSXA 5A5QA 4IR3A 5E9VA 4QB3A 4LZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JVK A;  4NR4 A;  4QY4 A;  4YYM A;  2I7K A;  4YAD A;  2YEL A;  2RNY A;  4HXL A;  5C87 A;  4CUS A;  5I7X A;  5A5O A;  5FG4 A;  5LVQ A;  4PS5 A;  5I7Y A;  4YAX A;  4TT4 A;  5CZG A;  2RI7 A;  5A82 A;  4NYX A;  4O78 A;  3UV4 A;  5DX4 A;  4QSW A;  5D25 A;  5F3A A;  5E3D A;  4N4G A;  5DFB A;  4IR4 A;  5G4S A;  5LKU A;  4NQM A;  3O35 A;  5DY7 A;  3DAI A;  4YYJ A;  3G0L A;  4CUR A;  4NYV A;  4C66 A;  5A5S A;  5DFC A;  5DKC A;  4HXR A;  4X2I A;  5KHM A;  5DW1 A;  4QSV A;  5CS8 A;  5FH7 A;  5F1L A;  2OO1 A;  4TT2 A;  4TQN A;  4CFK A;  4TYL A;  2YEM A;  4NXJ A;  5CFW A;  3G0J A;  5CQA A;  3P1D A;  5CU8 A;  5DBM A;  5HEL A;  5C8G A;  2YW5 A;  4QSR A;  5EWH A;  5F1H A;  4OGJ A;  5E9L A;  5D3H A;  4UYF B;  5EWC A;  4NS5 A;  4QEW A;  1ZS5 A;  4OGI A;  5BT5 A;  5HEM A;  4CL9 A;  5LVR A;  4PCE A;  2H60 A;  5CUA A;  5FE1 A;  3QZS A;  5HCL A;  5JWM A;  5C4Q A;  2E3K A;  5FDZ A;  5HM0 A;  1E6I A;  5E74 A;  5EPB A;  5EIC A;  5A5P A;  4XUB A;  5TCM A;  5I89 A;  3O33 A;  2DAT A;  5F62 A;  2YEK A;  4BHW A;  2OSS A;  5L8U A;  5A85 A;  4HXK A;  3UVY A;  4NR9 A;  5CY9 A;  5CUE A;  4HBY A;  4MEP A;  4QZS A;  4A9I A;  4CUQ A;  1EQF A;  3UVW A;  4TZ2 A;  5KTX A;  3ONI A;  2R0Y A;  4UIY A;  4LR6 A;  5J0D A;  5F63 A;  4ZW1 A;  4YY4 A;  2DVV A;  4MR4 A;  4O72 A;  4A9K A;  5EQ1 A;  4MEQ A;  5G4R A;  2YDW A;  5AD3 A;  4A9J A;  4A9L A;  4QC1 A;  3I3J A;  1X0J A;  4MEN A;  4CUP A;  4YYH A;  4QSS A;  5D7X A;  5EA1 A;  4HXO A;  5D3L A;  5I86 A;  4O70 A;  5E9Y A;  4QBM A;  4YH3 A;  3D7C A;  3AAD A;  5E7D A;  4LRG A;  5L8T A;  3LQI A;  2RO1 A;  5EIS A;  2RS9 B;  4IR6 A;  4MR3 A;  4XYA A;  3JVM A;  5EPS A;  3NXB A;  4A9O A;  5CQ4 A;  5AME A;  5FE2 A;  5D3R A;  4E96 A;  5ETB A;  3K2J A;  2L5E A;  2R0S A;  5CTL A;  5F61 A;  3U5K A;  2G4A A;  4YBM A;  5FE0 A;  5HLS A;  5I29 A;  5LJ2 A;  4ZC9 A;  4CUU A;  4Z6I A;  4J1P A;  5E9M A;  5AD2 A;  3LXJ A;  4FLP A;  4O77 A;  3U5L A;  4TU6 A;  4UYD A;  4LZ2 A;  2F6J A;  5IGK A;  5FE6 A;  5EM3 A;  5EPR A;  4CLB A;  3P1C A;  5IID A;  4KCX A;  4UYE A;  4LYI A;  4O76 A;  4XUA A;  5D3S A;  5FE4 A;  5JI8 A;  4NQN A;  5FFV A;  4ZQL A;  4N4H A;  5H1V A;  5I40 A;  4ALH A;  5II2 A;  5CQ8 A;  5EGU A;  4RVR A;  4YYG A;  5ENG A;  5C89 A;  5DW2 A;  4YYN A;  4A9N A;  3U5P A;  4NRA A;  4BJX A;  5EWD A;  2KTB B;  4NR5 A;  2DVR A;  3JVJ A;  4QUT A;  4UIV A;  5ENE A;  2MJV B;  1JSP B;  4LC2 A;  4QSQ A;  5L99 A;  4XY8 A;  5LJ1 A;  5CGP A;  4QR3 A;  5II1 A;  2F6N A;  5F2P A;  4O7E A;  5A83 A;  5COI A;  4NUD A;  4A9H A;  2RNW A;  5I1Q A;  5I80 A;  5ENF A;  3U5M A;  5DYA A;  2E7O A;  3S91 A;  2WP1 A;  5FE3 A;  4NRC A;  3HMF A;  4NUC A;  5D0C A;  2DWW A;  5LKT A;  1JM4 B;  4QC3 A;  4LYS A;  3FKM X;  5L96 A;  5ETD A;  5LJ0 A;  2RNX A;  4Q0O A;  4NR7 A;  4LZS A;  5DFD A;  4YYI A;  4NRB A;  5E0R A;  5HFR A;  4YBS A;  2WP2 A;  4BW1 A;  5A5N A;  4NR6 A;  4TU4 A;  4YAB A;  5EVA A;  4QEU A;  4F3I A;  5H1T A;  4PKL A;  4TTE A;  5FB1 A;  4CFL A;  3JVL A;  4NR8 A;  5H1U A;  4YBT A;  4O7A A;  3MXF A;  3QZV A;  2OUO A;  5FE7 A;  4MEO A;  5CQT A;  5AMF A;  5FFY A;  4HXN A;  5IGL A;  4UIW A;  2DVQ A;  2YQD A;  5FFW A;  4HBW A;  4QSP A;  4A9F A;  4YC9 A;  4N4I A;  4UIU A;  5E9K A;  5HFQ A;  3SVG A;  2E7N A;  5DKD A;  5HJC A;  5IGN A;  5HRW A;  3MUK A;  4YY6 A;  5EK9 A;  4Z1S A;  5L98 A;  4HBV A;  3TLP A;  5CQ3 A;  3UW9 A;  1F68 A;  3IU5 A;  4O7F A;  3HME A;  4NUE A;  5H85 A;  5EWV A;  5L97 A;  5KU3 A;  3MB4 A;  5ENC A;  5FBX A;  4Z1Q A;  4IOO A;  4HBX A;  4HXS A;  5DLZ A;  5F5Z A;  4O71 A;  3UV5 A;  3UV2 A;  3SVH A;  4O74 A;  5D3P A;  3DWY A;  5FG6 A;  5CUG A;  5CUC A;  5EU1 A;  3ZYU A;  4YAT A;  5EWW A;  5FE8 A;  5FG5 A;  4GPJ A;  3QZT A;  2RFJ A;  4QST A;  4IOR A;  5HQ5 A;  4CUT A;  4QUU A;  5CRM A;  5ACY A;  2NXB A;  4TT6 A;  5D3J A;  3GG3 A;  4UIZ A;  5KTW A;  3SVF A;  4WHW A;  5I83 A;  2D82 A;  5KTU A;  5HEN A;  3P5O A;  5F36 A;  5EI4 A;  5DYX A;  5D24 A;  2N9G A;  5IBN A;  4J3I A;  2I8N A;  3U5N A;  4QEV A;  5EV9 A;  2R0V A;  4NYW A;  4J0R A;  4XY9 A;  5C85 A;  4DON A;  5CP5 A;  5DYU A;  4TZ8 A;  5FE5 A;  5LKZ A;  5FH6 A;  4YYK A;  4WHU A;  2FSA A;  5CQ5 A;  4YH4 A;  2D9E A;  5LKX A;  5LUU A;  4KV1 A;  5D26 A;  2YYN A;  5CUB A;  3UVX A;  5CRZ A;  5HRV A;  5IG6 A;  2LSP B;  4YK0 A;  4ALG A;  5C7N A;  4UYH A;  4Z6H A;  4OUF A;  5ENJ A;  5HQ7 A;  4LYW A;  5HRX A;  3MQM A;  5F25 A;  4QSU A;  4N4F A;  3O34 A;  4PCI A;  5D3N A;  5E9I A;  4BW2 A;  2DKW A;  4YYD A;  3S92 A;  5FH8 A;  2L85 A;  4C67 A;  5TB6 A;  5IGM A;  3LQJ A;  5FE9 A;  5DYC A;  4IOQ A;  2GRC A;  4QR4 A;  5I88 A;  5EP7 A;  5BT4 A;  4LDF A;  5DLX A;  3UVD A;  4UYF A;  4O7C A;  4BW3 A;  3O36 A;  3O37 A;  5F60 A;  5ENB A;  2L84 A;  4N3W A;  5ENH A;  3P1F A;  5CQ6 A;  4O75 A;  5HQ6 A;  5E3G A;  3P1E A;  4O7B A;  5DKH A;  4MR6 A;  3Q2E A;  5A5R A;  3MUL A;  4QR5 A;  5ENI A;  4PTB A;  4J0S A;  4UIT A;  1N72 A;  5KO4 A;  4MR5 A;  4PY6 A;  3LQH A;  3U5J A;  1WUG A;  1WUM A;  4WIV A;  4A9M A;  3HMH A;  5FB0 A;  4HXP A;  5D3T A;  5BT3 A;  3AQA A;  3Q2F A;  5A7C A;  3LJW A;  4HXM A;  4Q0N A;  4UYG A;  5CPE A;  4TS8 A;  4QYL A;  4AKN A;  5K29 A;  5CUD A;  4QNS A;  4QYD A;  4A9E A;  5A81 A;  3RCW A;  4IR5 A;  3IU6 A;  2DVS A;  3U5O A;  4UIX A;  4Y03 A;  5CQ7 A;  2R10 A;  5E73 A;  3MB3 A;  4KV4 A;  4Z93 A;  4BW4 A;  4QSX A;  5A5Q A;  4IR3 A;  5E9V A;  4QB3 A;  4LZR A; 
#chains in the Genus database with same CATH topology
 3JVK A;  4NR4 A;  4QY4 A;  4YYM A;  2I7K A;  4YAD A;  2YEL A;  2RNY A;  4HXL A;  5C87 A;  4CUS A;  5I7X A;  5A5O A;  5FG4 A;  5LVQ A;  4PS5 A;  5I7Y A;  4YAX A;  4TT4 A;  5CZG A;  2RI7 A;  5A82 A;  4NYX A;  4O78 A;  3UV4 A;  5DX4 A;  4QSW A;  5D25 A;  5F3A A;  5E3D A;  4N4G A;  5DFB A;  4IR4 A;  5G4S A;  5LKU A;  4NQM A;  3O35 A;  5DY7 A;  3DAI A;  4YYJ A;  3G0L A;  4CUR A;  4NYV A;  4C66 A;  5A5S A;  5DFC A;  5DKC A;  4HXR A;  4X2I A;  5KHM A;  5DW1 A;  4QSV A;  4AKH A;  5CS8 A;  5FH7 A;  5F1L A;  2OO1 A;  4TT2 A;  4TQN A;  4CFK A;  4TYL A;  2YEM A;  4NXJ A;  5CFW A;  3G0J A;  5CQA A;  3P1D A;  5CU8 A;  5DBM A;  5HEL A;  5C8G A;  2YW5 A;  4QSR A;  5EWH A;  5F1H A;  4OGJ A;  5E9L A;  5D3H A;  4UYF B;  5EWC A;  4NS5 A;  4QEW A;  1ZS5 A;  4OGI A;  5BT5 A;  5HEM A;  4CL9 A;  5LVR A;  4PCE A;  2H60 A;  5CUA A;  5FE1 A;  3QZS A;  5HCL A;  5JWM A;  5C4Q A;  2E3K A;  5FDZ A;  5HM0 A;  1E6I A;  5E74 A;  5EPB A;  5EIC A;  5A5P A;  4XUB A;  5TCM A;  5I89 A;  3O33 A;  2DAT A;  5F62 A;  2YEK A;  4BHW A;  2OSS A;  5L8U A;  5A85 A;  4HXK A;  3UVY A;  4NR9 A;  5CY9 A;  5CUE A;  4HBY A;  4MEP A;  4QZS A;  4A9I A;  4CUQ A;  1EQF A;  3UVW A;  4TZ2 A;  5KTX A;  3ONI A;  2R0Y A;  4UIY A;  4AKI A;  4LR6 A;  5J0D A;  5F63 A;  4ZW1 A;  4YY4 A;  2DVV A;  4MR4 A;  4O72 A;  4A9K A;  5EQ1 A;  4MEQ A;  5G4R A;  2YDW A;  5AD3 A;  4A9J A;  4A9L A;  4QC1 A;  3I3J A;  3D1B A;  1ZKR A;  1X0J A;  4MEN A;  4CUP A;  4YYH A;  4QSS A;  5D7X A;  5EA1 A;  4HXO A;  5D3L A;  5I86 A;  4O70 A;  5E9Y A;  4QBM A;  4YH3 A;  3D7C A;  3AAD A;  5E7D A;  4LRG A;  5L8T A;  3LQI A;  2RO1 A;  5EIS A;  2RS9 B;  4IR6 A;  4MR3 A;  4XYA A;  3JVM A;  5EPS A;  3NXB A;  4A9O A;  5CQ4 A;  5AME A;  5FE2 A;  5D3R A;  4E96 A;  5ETB A;  3K2J A;  2L5E A;  2R0S A;  5CTL A;  5F61 A;  3U5K A;  2G4A A;  4YBM A;  5FE0 A;  5HLS A;  5I29 A;  5LJ2 A;  4ZC9 A;  4CUU A;  4Z6I A;  4J1P A;  4AI6 A;  5E9M A;  5AD2 A;  3LXJ A;  4FLP A;  4O77 A;  3U5L A;  4TU6 A;  4UYD A;  4LZ2 A;  2F6J A;  5IGK A;  5FE6 A;  5EM3 A;  5EPR A;  4CLB A;  3P1C A;  5IID A;  4KCX A;  4UYE A;  4LYI A;  4O76 A;  4XUA A;  5D3S A;  5FE4 A;  5JI8 A;  4NQN A;  4AKG A;  5FFV A;  4ZQL A;  4N4H A;  5H1V A;  5I40 A;  4ALH A;  5II2 A;  5CQ8 A;  5EGU A;  4RVR A;  4YYG A;  5ENG A;  5C89 A;  5DW2 A;  4YYN A;  4A9N A;  3U5P A;  4NRA A;  4BJX A;  5EWD A;  2KTB B;  4NR5 A;  2DVR A;  3JVJ A;  4QUT A;  4UIV A;  5ENE A;  2MJV B;  1JSP B;  4LC2 A;  4QSQ A;  5L99 A;  4XY8 A;  5LJ1 A;  5CGP A;  4QR3 A;  5II1 A;  2F6N A;  5F2P A;  4O7E A;  5A83 A;  5COI A;  4NUD A;  4A9H A;  2RNW A;  5I1Q A;  5I80 A;  5ENF A;  3U5M A;  5DYA A;  2E7O A;  3S91 A;  2WP1 A;  5FE3 A;  4NRC A;  3HMF A;  4NUC A;  5D0C A;  2DWW A;  5LKT A;  1JM4 B;  4QC3 A;  4LYS A;  3FKM X;  5L96 A;  5ETD A;  5LJ0 A;  2RNX A;  4Q0O A;  4NR7 A;  4LZS A;  5DFD A;  4YYI A;  4NRB A;  5E0R A;  5HFR A;  4YBS A;  2WP2 A;  4BW1 A;  5A5N A;  4NR6 A;  4TU4 A;  4YAB A;  5EVA A;  4QEU A;  4F3I A;  5H1T A;  4PKL A;  4TTE A;  5FB1 A;  4CFL A;  3JVL A;  4NR8 A;  5H1U A;  4YBT A;  4O7A A;  3MXF A;  3QZV A;  2OUO A;  5FE7 A;  4MEO A;  5CQT A;  5AMF A;  3VKG A;  5FFY A;  4HXN A;  5IGL A;  4UIW A;  2DVQ A;  2YQD A;  5FFW A;  4HBW A;  4QSP A;  4A9F A;  4YC9 A;  4N4I A;  4UIU A;  5E9K A;  5HFQ A;  3SVG A;  2E7N A;  5DKD A;  5HJC A;  5IGN A;  5HRW A;  3MUK A;  4YY6 A;  3VKH A;  5EK9 A;  4Z1S A;  5L98 A;  4HBV A;  3TLP A;  5CQ3 A;  3UW9 A;  1F68 A;  3IU5 A;  4O7F A;  3HME A;  4NUE A;  5H85 A;  5EWV A;  5L97 A;  5KU3 A;  3MB4 A;  5ENC A;  5FBX A;  4Z1Q A;  1PUO A;  4IOO A;  4HBX A;  4HXS A;  5DLZ A;  5F5Z A;  4O71 A;  3UV5 A;  3UV2 A;  3SVH A;  4O74 A;  5D3P A;  3DWY A;  5FG6 A;  5CUG A;  5CUC A;  5EU1 A;  3ZYU A;  4YAT A;  5EWW A;  5FE8 A;  5FG5 A;  4GPJ A;  3QZT A;  2RFJ A;  4QST A;  4IOR A;  5HQ5 A;  4CUT A;  4QUU A;  5CRM A;  5ACY A;  2NXB A;  4TT6 A;  5D3J A;  3GG3 A;  4UIZ A;  5KTW A;  3SVF A;  4WHW A;  5I83 A;  2D82 A;  5KTU A;  5HEN A;  3P5O A;  5F36 A;  5EI4 A;  5DYX A;  5D24 A;  2N9G A;  5IBN A;  4J3I A;  2I8N A;  3U5N A;  4QEV A;  5EV9 A;  2R0V A;  4NYW A;  4J0R A;  4XY9 A;  5C85 A;  4DON A;  5CP5 A;  5DYU A;  4TZ8 A;  5FE5 A;  5LKZ A;  5FH6 A;  4YYK A;  4WHU A;  2FSA A;  5CQ5 A;  4YH4 A;  2D9E A;  5LKX A;  5LUU A;  4KV1 A;  5D26 A;  2YYN A;  5CUB A;  3UVX A;  5CRZ A;  5HRV A;  5IG6 A;  2LSP B;  4YK0 A;  4ALG A;  5C7N A;  4UYH A;  4Z6H A;  4OUF A;  5ENJ A;  5HQ7 A;  4LYW A;  5HRX A;  3MQM A;  5F25 A;  4QSU A;  4N4F A;  3O34 A;  4PCI A;  5D3N A;  5E9I A;  4BW2 A;  2DKW A;  4YYD A;  3S92 A;  5FH8 A;  2L85 A;  4C67 A;  5TB6 A;  5IGM A;  3LQJ A;  5FE9 A;  5DYC A;  4IOQ A;  2GRC A;  4QR4 A;  5I88 A;  5EP7 A;  5BT4 A;  4LDF A;  5DLX A;  3UVD A;  4UYF A;  4O7C A;  4BW3 A;  3O36 A;  3O37 A;  5F60 A;  5ENB A;  2L84 A;  4N3W A;  5ENH A;  3P1F A;  5CQ6 A;  4O75 A;  5HQ6 A;  5E3G A;  3P1E A;  4O7B A;  5DKH A;  4MR6 A;  3ERR A;  3Q2E A;  5A5R A;  3MUL A;  4QR5 A;  5ENI A;  4PTB A;  4J0S A;  2EJN A;  4UIT A;  1N72 A;  5KO4 A;  4MR5 A;  4PY6 A;  3LQH A;  3D1D A;  3U5J A;  1WUG A;  1WUM A;  4WIV A;  4A9M A;  3HMH A;  5FB0 A;  4HXP A;  5D3T A;  5BT3 A;  3AQA A;  3Q2F A;  5A7C A;  3LJW A;  4HXM A;  4Q0N A;  4UYG A;  5CPE A;  4TS8 A;  4QYL A;  4AKN A;  5K29 A;  5CUD A;  4QNS A;  4QYD A;  4A9E A;  5A81 A;  3RCW A;  4IR5 A;  3IU6 A;  2DVS A;  3U5O A;  4UIX A;  4Y03 A;  5CQ7 A;  2R10 A;  5E73 A;  3MB3 A;  4KV4 A;  4Z93 A;  4BW4 A;  4QSX A;  5A5Q A;  4IR3 A;  5E9V A;  4QB3 A;  4LZR A; 
#chains in the Genus database with same CATH homology
 3JVK A;  4NR4 A;  4QY4 A;  4YYM A;  2I7K A;  4YAD A;  2YEL A;  2RNY A;  4HXL A;  5C87 A;  4CUS A;  5I7X A;  5A5O A;  5FG4 A;  5LVQ A;  4PS5 A;  5I7Y A;  4YAX A;  4TT4 A;  5CZG A;  2RI7 A;  5A82 A;  4NYX A;  4O78 A;  3UV4 A;  5DX4 A;  4QSW A;  5D25 A;  5F3A A;  5E3D A;  4N4G A;  5DFB A;  4IR4 A;  5G4S A;  5LKU A;  4NQM A;  3O35 A;  5DY7 A;  3DAI A;  4YYJ A;  3G0L A;  4CUR A;  4NYV A;  4C66 A;  5A5S A;  5DFC A;  5DKC A;  4HXR A;  4X2I A;  5KHM A;  5DW1 A;  4QSV A;  5CS8 A;  5FH7 A;  5F1L A;  2OO1 A;  4TT2 A;  4TQN A;  4CFK A;  4TYL A;  2YEM A;  4NXJ A;  5CFW A;  3G0J A;  5CQA A;  3P1D A;  5CU8 A;  5DBM A;  5HEL A;  5C8G A;  2YW5 A;  4QSR A;  5EWH A;  5F1H A;  4OGJ A;  5E9L A;  5D3H A;  4UYF B;  5EWC A;  4NS5 A;  4QEW A;  1ZS5 A;  4OGI A;  5BT5 A;  5HEM A;  4CL9 A;  5LVR A;  4PCE A;  2H60 A;  5CUA A;  5FE1 A;  3QZS A;  5HCL A;  5JWM A;  5C4Q A;  2E3K A;  5FDZ A;  5HM0 A;  1E6I A;  5E74 A;  5EPB A;  5EIC A;  5A5P A;  4XUB A;  5TCM A;  5I89 A;  3O33 A;  2DAT A;  5F62 A;  2YEK A;  4BHW A;  2OSS A;  5L8U A;  5A85 A;  4HXK A;  3UVY A;  4NR9 A;  5CY9 A;  5CUE A;  4HBY A;  4MEP A;  4QZS A;  4A9I A;  4CUQ A;  1EQF A;  3UVW A;  4TZ2 A;  5KTX A;  3ONI A;  2R0Y A;  4UIY A;  4LR6 A;  5J0D A;  5F63 A;  4ZW1 A;  4YY4 A;  2DVV A;  4MR4 A;  4O72 A;  4A9K A;  5EQ1 A;  4MEQ A;  5G4R A;  2YDW A;  5AD3 A;  4A9J A;  4A9L A;  4QC1 A;  3I3J A;  1X0J A;  4MEN A;  4CUP A;  4YYH A;  4QSS A;  5D7X A;  5EA1 A;  4HXO A;  5D3L A;  5I86 A;  4O70 A;  5E9Y A;  4QBM A;  4YH3 A;  3D7C A;  3AAD A;  5E7D A;  4LRG A;  5L8T A;  3LQI A;  2RO1 A;  5EIS A;  2RS9 B;  4IR6 A;  4MR3 A;  4XYA A;  3JVM A;  5EPS A;  3NXB A;  4A9O A;  5CQ4 A;  5AME A;  5FE2 A;  5D3R A;  4E96 A;  5ETB A;  3K2J A;  2L5E A;  2R0S A;  5CTL A;  5F61 A;  3U5K A;  2G4A A;  4YBM A;  5FE0 A;  5HLS A;  5I29 A;  5LJ2 A;  4ZC9 A;  4CUU A;  4Z6I A;  4J1P A;  5E9M A;  5AD2 A;  3LXJ A;  4FLP A;  4O77 A;  3U5L A;  4TU6 A;  4UYD A;  4LZ2 A;  2F6J A;  5IGK A;  5FE6 A;  5EM3 A;  5EPR A;  4CLB A;  3P1C A;  5IID A;  4KCX A;  4UYE A;  4LYI A;  4O76 A;  4XUA A;  5D3S A;  5FE4 A;  5JI8 A;  4NQN A;  5FFV A;  4ZQL A;  4N4H A;  5H1V A;  5I40 A;  4ALH A;  5II2 A;  5CQ8 A;  5EGU A;  4RVR A;  4YYG A;  5ENG A;  5C89 A;  5DW2 A;  4YYN A;  4A9N A;  3U5P A;  4NRA A;  4BJX A;  5EWD A;  2KTB B;  4NR5 A;  2DVR A;  3JVJ A;  4QUT A;  4UIV A;  5ENE A;  2MJV B;  1JSP B;  4LC2 A;  4QSQ A;  5L99 A;  4XY8 A;  5LJ1 A;  5CGP A;  4QR3 A;  5II1 A;  2F6N A;  5F2P A;  4O7E A;  5A83 A;  5COI A;  4NUD A;  4A9H A;  2RNW A;  5I1Q A;  5I80 A;  5ENF A;  3U5M A;  5DYA A;  2E7O A;  3S91 A;  2WP1 A;  5FE3 A;  4NRC A;  3HMF A;  4NUC A;  5D0C A;  2DWW A;  5LKT A;  1JM4 B;  4QC3 A;  4LYS A;  3FKM X;  5L96 A;  5ETD A;  5LJ0 A;  2RNX A;  4Q0O A;  4NR7 A;  4LZS A;  5DFD A;  4YYI A;  4NRB A;  5E0R A;  5HFR A;  4YBS A;  2WP2 A;  4BW1 A;  5A5N A;  4NR6 A;  4TU4 A;  4YAB A;  5EVA A;  4QEU A;  4F3I A;  5H1T A;  4PKL A;  4TTE A;  5FB1 A;  4CFL A;  3JVL A;  4NR8 A;  5H1U A;  4YBT A;  4O7A A;  3MXF A;  3QZV A;  2OUO A;  5FE7 A;  4MEO A;  5CQT A;  5AMF A;  5FFY A;  4HXN A;  5IGL A;  4UIW A;  2DVQ A;  2YQD A;  5FFW A;  4HBW A;  4QSP A;  4A9F A;  4YC9 A;  4N4I A;  4UIU A;  5E9K A;  5HFQ A;  3SVG A;  2E7N A;  5DKD A;  5HJC A;  5IGN A;  5HRW A;  3MUK A;  4YY6 A;  5EK9 A;  4Z1S A;  5L98 A;  4HBV A;  3TLP A;  5CQ3 A;  3UW9 A;  1F68 A;  3IU5 A;  4O7F A;  3HME A;  4NUE A;  5H85 A;  5EWV A;  5L97 A;  5KU3 A;  3MB4 A;  5ENC A;  5FBX A;  4Z1Q A;  4IOO A;  4HBX A;  4HXS A;  5DLZ A;  5F5Z A;  4O71 A;  3UV5 A;  3UV2 A;  3SVH A;  4O74 A;  5D3P A;  3DWY A;  5FG6 A;  5CUG A;  5CUC A;  5EU1 A;  3ZYU A;  4YAT A;  5EWW A;  5FE8 A;  5FG5 A;  4GPJ A;  3QZT A;  2RFJ A;  4QST A;  4IOR A;  5HQ5 A;  4CUT A;  4QUU A;  5CRM A;  5ACY A;  2NXB A;  4TT6 A;  5D3J A;  3GG3 A;  4UIZ A;  5KTW A;  3SVF A;  4WHW A;  5I83 A;  2D82 A;  5KTU A;  5HEN A;  3P5O A;  5F36 A;  5EI4 A;  5DYX A;  5D24 A;  2N9G A;  5IBN A;  4J3I A;  2I8N A;  3U5N A;  4QEV A;  5EV9 A;  2R0V A;  4NYW A;  4J0R A;  4XY9 A;  5C85 A;  4DON A;  5CP5 A;  5DYU A;  4TZ8 A;  5FE5 A;  5LKZ A;  5FH6 A;  4YYK A;  4WHU A;  2FSA A;  5CQ5 A;  4YH4 A;  2D9E A;  5LKX A;  5LUU A;  4KV1 A;  5D26 A;  2YYN A;  5CUB A;  3UVX A;  5CRZ A;  5HRV A;  5IG6 A;  2LSP B;  4YK0 A;  4ALG A;  5C7N A;  4UYH A;  4Z6H A;  4OUF A;  5ENJ A;  5HQ7 A;  4LYW A;  5HRX A;  3MQM A;  5F25 A;  4QSU A;  4N4F A;  3O34 A;  4PCI A;  5D3N A;  5E9I A;  4BW2 A;  2DKW A;  4YYD A;  3S92 A;  5FH8 A;  2L85 A;  4C67 A;  5TB6 A;  5IGM A;  3LQJ A;  5FE9 A;  5DYC A;  4IOQ A;  2GRC A;  4QR4 A;  5I88 A;  5EP7 A;  5BT4 A;  4LDF A;  5DLX A;  3UVD A;  4UYF A;  4O7C A;  4BW3 A;  3O36 A;  3O37 A;  5F60 A;  5ENB A;  2L84 A;  4N3W A;  5ENH A;  3P1F A;  5CQ6 A;  4O75 A;  5HQ6 A;  5E3G A;  3P1E A;  4O7B A;  5DKH A;  4MR6 A;  3Q2E A;  5A5R A;  3MUL A;  4QR5 A;  5ENI A;  4PTB A;  4J0S A;  4UIT A;  1N72 A;  5KO4 A;  4MR5 A;  4PY6 A;  3LQH A;  3U5J A;  1WUG A;  1WUM A;  4WIV A;  4A9M A;  3HMH A;  5FB0 A;  4HXP A;  5D3T A;  5BT3 A;  3AQA A;  3Q2F A;  5A7C A;  3LJW A;  4HXM A;  4Q0N A;  4UYG A;  5CPE A;  4TS8 A;  4QYL A;  4AKN A;  5K29 A;  5CUD A;  4QNS A;  4QYD A;  4A9E A;  5A81 A;  3RCW A;  4IR5 A;  3IU6 A;  2DVS A;  3U5O A;  4UIX A;  4Y03 A;  5CQ7 A;  2R10 A;  5E73 A;  3MB3 A;  4KV4 A;  4Z93 A;  4BW4 A;  4QSX A;  5A5Q A;  4IR3 A;  5E9V A;  4QB3 A;  4LZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...