3QZUA

Crystal structure of bacillus subtilis lipase a 7-fold mutant; the outcome of directed evolution towards thermostability
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
180
structure length
180
Chain Sequence
EHNPVVMVHGIGGASFNFAGIKSYLVSQGWSQNDLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGDALPGTDPNQKILYTSIYSSADDIVMNCLSRLDGARNVQIHGVGHMGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biophysical characterization of mutants of Bacillus subtilis lipase evolved for thermostability: Factors contributing to increased activity retention.
pubmed doi rcsb
molecule keywords Lipase estA
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 68
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2011-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qzuA00
2WIGA 5C81A 4FWBA 3VJLA 2J3DA 1FFEA 1ZD4A 3D5EA 2XQIA 4WDRA 5A2GA 3W2TA 5A71A 2YASA 3FBWA 4QDUA 3AINA 2XQKA 3STTA 5F4ZA 1WCYA 5ALQA 3C43A 3FWHA 2Y1KA 5DYYA 2WJ6A 2WLSA 2PUJA 1MTZA 2O2GA 5LZ7A 1XQWA 5KBYA 2BAGA 2Y2UA 1HL7A 4EY6A 5AK3A 3WK4A 3VVMA 5AM4A 3IVMA 5LZ8A 1EVEA 5DYWA 1YA4A 1XKTA 1UKBA 4KE8A 2WIJA 3QVMA 1LPMA 1XZJA 1W52X 4Y2RA 4LXGA 5AHXA 3KSRA 5K3EA 5KWJA 1AMNA 2GBGA 4QA9A 1ZJ4A 3H2KA 1EB8A 4J0KA 1XQYA 1J1IA 1MN6A 4K6HA 1MPXA 2XMSA 3DYVA 4X7BA 2OGTA 4Q3KA 2DQZA 2ACKA 2QT9A 4UBIA 3OURA 2JEZA 2R11A 1CVLA 1QZ3A 1LNSA 2J4FA 1QLWA 1VXOA 2CMFA 4ZV7A 3HSSA 2GBFA 1BROA 4NVRA 2G4LA 5JADA 1DQYA 1XRQA 5BWBA 5LIPA 1IMJA 1XFDA 1DQZA 1R9NA 3I2FA 3QPDA 2QOEA 3BWXA 4OU5A 5AK6A 3W9UA 1JT2A 2JEYA 3BJRA 4X92A 4H7DA 3F9CA 3D3NA 5JASA 1UOQA 1L7RA 1ZJ5A 1K63A 4OB8A 2B20A 1CUYA 3DQZA 2FJPA 3EQ7A 3K2IA 4X71A 3ESAA 3I28A 2XQFA 2WTNA 1VZ3A 4Y2JA 3G02A 2WFLB 1BCRA 2RHTA 1A8SA 4U2DA 3PICA 4Q05A 4N8EA 2QJRA 4CIBA 1BEZA 1D07A 3O4GA 1LPOA 5JAOA 3AZPA 1MAAA 1AGYA 1AURA 4V2IA 4G4JA 3DNMA 4B83A 1F6WA 4IH1A 1ZOIA 3C6YA 2WHQA 4CCWA 3C6BA 4X6YA 5AKLA 4AMYA 1XZEA 1L7QA 4AX4A 4W1SA 2JGEA 4C89A 2FX5A 2X8BA 3O4HA 5CRIA 5CXUA 1H23A 1E3QA 3QMVA 1YA8A 3LS2A 4FBLA 3WI7A 2I3DA 3AIKA 2V98A 2QTBA 3R0VA 4WY8A 4DIUA 1TK3A 5JATA 3C5WP 2DHCA 1C4XA 1HBJA 1A8UA 2RIPA 5JD6A 5K3FB 2ZYHA 5JARA 3WMRA 3FNBA 3FSGA 5FLKA 5H3HA 4C88A 2PSEA 1SCKA 1IUOA 3DJYA 5ALGA 4PQEA 4U2EA 1XZLA 4BBZA 1AKNA 1XQXA 2WUFA 3FLBA 4H7FA 1OILA 4ETWA 1JU3A 5AKXA 1QFSA 4BB0A 5YASA 1HPLA 1QIEA 1AUOA 1E8DA 1P0QA 3VISA 2DQYA 3R3VA 4B81A 3DKRA 2ONCA 3OOSA 3RARA 2PVSA 3C8DA 3AIOA 3WKDA 2WJ4A 2WHPA 2XQGA 3H19A 3JWEA 5K3BA 1XKLA 1QO9A 2QMQA 4U2CA 3MVEA 3WWCA 4ARAA 4GEGA 2YXPX 3CCBA 4FLMA 2B61A 2PSFA 5C8VA 2QZPA 4Q3OA 3PF8A 1N8SA 4NS4A 5CMLA 2RGUA 2PU5A 3HEAA 3WKAA 4ZV9A 2QXTA 1TKRA 2WU4A 1O6GA 2XMRA 3IBTA 1EX9A 1VXRA 1HLGA 1QIGA 4MXDA 3ZLVA 3WKCA 1XRPA 3WWOA 2Z3WA 1WHSA 3ESCA 3C70A 3OC0A 4LYDA 4YASA 4GWLA 4FDMA 3CN7A 3TEJA 4B9EA 2PBLA 4IH4A 3VXKA 2ZJFA 4BZWA 2HADA 1E8MA 4OD0A 1USWA 1DT5A 1UFOA 2JGFA 5K3CA 4IH9A 2DHDA 4AO7A 3KOOA 4INZA 1WB4A 1BN6A 3BIXA 3H2IA 1K4YA 5ISMA 4HXFB 3WK9A 3R3WA 1CPYA 4L3WA 2VF2A 4FNMA 1MNQA 3ANSA 3R3YA 3V9AA 5LKRA 4EB0A 4QLAA 3V1NA 4BP9A 5D3ZA 3PUIA 1AQLA 1CUBA 4BZZA 3WKEA 4XVCA 2HIHA 2XMDA 4AQDA 3U1TA 1CUXA 3QH4A 3JYHA 3S8YA 5ALMA 3SWWA 5I7UA 1IUNA 2QUBA 1YS2X 3A70A 3I6ZA 1BEEA 5JAUA 2PU7A 3RKSA 2CZQA 3VJKA 1TCBA 2ZYIA 2QS9A 1YR2A 2I3ZA 4DMKA 5LZ4A 3ICWA 4W1PA 3W04A 4G8DA 1ZD2P 4B80A 1J06A 5HF5A 5DJ5A 5IKXA 2BJHA 1O6FA 2Q0XA 4Y2VA 3FOBA 3GZJA 5HFAA 2AJ8A 1VLQA 2BUAA 4DLNA 3D59A 2PPLA 5AP9A 2OGSA 2D0DA 4Q34A 3H04A 3HRHA 2V9ZA 2RONA 2WQZA 3C6XA 1PV1A 5AI8A 1H22A 5AICA 5ESRA 2JGJA 4AN1A 3D0KA 1CUJA 1TAHA 3IULA 2XMCA 2BUBA 4X91A 1CR6A 4B7ZA 1WOMA 2HU8A 2HA3A 2ECFA 1T4MA 2WFZA 4QDZA 3NUZA 2OCIA 1UWCA 3RK4A 2HA6A 2VT7A 5DWDA 2YYSA 1ZD3A 5AJHA 3SK0A 3BL8A 1K6EA 2ZSHA 3PF9A 1EXWA 4BC1A 3WK6A 5JZBA 2VQ6A 6YASA 2O7RA 4MEAA 3FSGD 2PM8A 4DTCA 4GI1A 1P0MA 2XUIA 5AKGA 3G0BA 4O08A 4L0CA 1Z68A 1DX6A 1QTIA 1UK9A 3V1LA 1UKAA 3A6ZA 5K5EA 3DS8A 4C4YA 5ALTA 3ESDA 5IH7A 4AMZA 5EHZA 3PE6A 2OAGA 5ALHA 2WUDA 1QGED 4LXIA 3WL6A 5CT9A 4BE9A 3B12A 3H18A 1CFJA 1XLVA 2OQVA 4JYPA 4B9AA 2ES4A 2WG1A 2VEOA 2Z3ZA 1FJ2A 2DSNA 4K5QA 4L9AA 4N8SA 1QFMA 4PSDA 4OSEA 5AM1A 1RWQA 3QPAA 1A88A 4TGLA 1GXSA 2XUPA 1XRRA 5CW2A 1EVQA 3G0GA 3M3DA 4GLBA 3WK7A 3QZUA 3FYUA 1UOOA 3GELA 2PX6A 2JBWA 1JMYA 4GBGA 4KEAA 4G9EA 5ALIA 4HS9A 5CURA 5AO9A 3V1MA 2I78A 4AZ0A 4PO3X 1CUVA 5DTIA 1CLEA 5AK4A 1CQWA 2XDWA 4WFKA 3WA7A 1U2EA 1ZI8A 2XMZA 1ETHA 4QZVA 5IVIA 5KWIA 3MGAA 5AH0A 5HZGA 4J03A 2OPHA 1XZDA 3F96A 1SC9A 4OB6A 3G0DA 4S0XA 5FKJA 1SCIA 1EDBA 4BATA 3G9UA 4X6XA 3M83A 3HC7A 5IVHA 5K3AA 4UPDA 5EHQA 2K2QB 5T4HA 4DNPA 4Z49A 2HA0A 3OPMA 3VVLA 1CUHA 2VTVA 4PV7A 1WB5A 4DNOA 1THTA 4LYEA 4KAFA 1L7AA 3L1JA 5ALYA 2XT0A 3I2IA 4H7EA 2GYUA 2WHRA 2WKWA 4WFIA 1SFRA 3WYDA 5JAHA 4DMFA 1CUGA 5JZ9A 4J0CA 3ESBA 5HF9A 1PJAA 4BRZA 1MNAA 4HRXA 3HLKA 3MUOA 3PUHA 1UXOA 3WWDA 4OPMA 1ZD5A 4ZREA 1W6RA 2O2IA 4YPVA 1DT3A 3WJ2A 4IQ4A 1XZCA 3ZLTA 5FUMA 4J0HA 4E15A 3G9ZA 4B82A 2G5PA 1EDDA 5AM3A 1UT6A 2WFMA 1EK2A 4C4ZA 1A7UA 3WYNA 2E3JA 2WG0A 3STUA 2DFPA 4H18A 4BP8A 2R8BA 4DYHA 3IUJA 2B9VA 5CT5A 5FP0A 4CCYB 1GQRA 1UZAA 4F21A 4EHBA 4TPKA 3WA6A 3STVA 3WWPA 2O7VA 1R4ZA 3F8SA 2C58A 1DU4A 5A7GA 3ED1A 4C6HA 4H7IA 2HFJA 4G5XA 1CRLA 1GZ7A 2WFLA 3WLAA 3IUNA 1IVYA 3KXPA 5JAPA 4J0DA 4W9RA 5CBKA 1H2WA 1R88A 4Y2UA 3I2HA 4Q3LA 1XZFA 3EQ8A 4MYDA 1IZ8A 2EDCA 1DINA 2IIVA 3L1HA 4F60A 4ZRDA 1F0PA 5HK8A 4CI9A 1VOTA 4QDXA 4M0FA 2JGMA 3HI4A 4C4XA 2I03A 2ZYRA 4P9NA 4UBJA 4WCVA 3VDXA 2WU3A 3C5VA 5JD4A 1XZIA 2WUEA 1QJ4A 1B41A 5AKKA 5E4TA 4K6GA 4CIAA 3V1KA 4EA6A 4WJLA 4IHAA 3E3AA 3H2GA 1PFQA 4Y2QA 3B3QA 3F67A 1X2EA 1YCDA 4JH0A 5JYCA 5K3FA 4AXBA 1LPNA 4X94A 2XB6A 3QBJA 5DNVA 4OYLA 3HACA 2AXEA 4X3CA 1EI9A 1YB6A 2OCGA 4JYMA 1Y7IA 4RPCA 4Q1VA 5JANA 5ALZA 3K6KA 5BWCA 3E4DA 1XZKA 2HU5A 5ALSA 4BC0A 1OCEA 3EQ9A 4HTAA 2XUJA 4Y2PA 4KR0A 4MWSA 2OCLA 1XZBA 1XLUA 1KU6A 4KRYA 4J7AA 3GUUA 1QIIA 5AI9A 5I8PA 3NWOA 1YAJA 3DDUA 1NU6A 4HVTA 3D2AA 2B4KA 3H2JA 2HRQA 4A16A 4BAZA 2BUCA 4UBNA 2H1IA 3QPCA 1QIMA 4Y2SA 3HABA 1CUEA 5AOCA 4HRYA 5AKZA 3FVTA 1W75A 3HYSA 1GPNA 5FPPA 3QYJA 3DOHA 2OXEA 2J3QA 3IIIA 4CG2A 4Y2XA 5FV4A 3WK8A 2G5TA 2GYVA 3G0IA 3JW8A 5CH3A 3O4IA 4Y2YA 3LLCA 3OM8A 2DHEA 4OU4A 3ZI7A 1ZGCA 4UUQA 5HQ3B 1ZIXA 5CTAA 4J0JA 1JU4A 1T2NA 3C87A 4DMCA 3PFCA 3UUEA 1QONA 4Y2TA 4JUIA 3DCNA 2Y6UA 4DSZA 5HCUA 2BGNA 2XUHA 4RGYA 2HA2A 5T4FA 1P0PA 1WPXA 2QJWA 4RE5A 3AJAA 3G0CA 2XMQA 3D7RA 3MUNA 1GKKA 2XUOA 3SX4A 5FXMA 3TGLA 3F98A 1ZIYA 1TCCA 2WG2A 3FLAA 2H7XA 3F97A 2H7CA 4X90A 1QE3A 5AKHA 5FPQA 2HFKA 2VAVA 1IUPA 4U2FA 4X6UA 4X95A 3RM3A 3N2ZB 1FFBA 5AM0A 1CUDA 1QIHA 4XJVA 1ISPA 1VE6A 3BJMA 1ZI9A 3EF3A 4EUSA 1UK7A 3D2CA 5E4JA 4DGQA 2VJCA 3STYA 5AOAA 1DWOA 4C87A 1Q83A 3L1IA 2VJAA 3IB3A 3RLIA 2UZ0A 3W06A 3TJMA 4WY5A 2OGZA 2VA9A 1W1IA 4EY4A 2JGLA 1JFRA 4CG1A 3WK5A 2BCEA 4ZGBA 4P93A 2C0PA 1ODCA 4BE4A 3GBSA 3GA7A 2C5FA 5E2IA 3HJUA 4LIPD 1LLFA 5ALVA 1UKCA 1VZ2A 5SYNA 1QTRA 3WIBA 4KE9A 3IUMA 4BCCA 3CXUA 5IVKA 2WM2A 1LZLA 1TQHA 1MAHA 2JIDA 3T52A 4FMPA 3Q8WA 1VE7A 4G4IA 3T4UA 4ZI5A 1N5MA 3PDCA 4UHDA 2EEPA 3FCXA 3DL4A 1WHTA 3BXPA 5ALNA 1E5TA 3DD5A 1UK8A 3M81A 2OQIA 4ROTA 1MX9A 4F5ZA 4FKBA 4MQMA 3G7NA 4EZIA 2XUKA 4PW0A 3WL8A 4B0PA 3DL7A 2ROQA 5AOBA 5HKBA 3NOXA 2HM7A 4FOLA 1WPRA 5JALA 3C6ZA 2PSJA 3QM1A 1F8UA 1YAHA 3E0XA 3LCRA 1HDEA 1H2ZA 3EBLA 3K9BA 1LGYA 3HZOA 1DTEA 5LYYA 4BTLA 4ITVA 4NZZA 2WTMA 3O95A 1CUAA 4MJ3A 5DNWA 1E8NA 3AILA 4J3JA 1AZWA 4KACA 4OUKX 4UBLA 2PKYX 1SCQA 3ILSA 3O4JA 1MJ5A 4EY7A 3LP5A 3OG9A 5AKEA 4GECA 1Y7HA 1GPLA 1KEZA 5LLSA 5AIAA 5HKAA 1EH5A 2Z8XA 1DX4A 5DTJA 3H17A 1QIJA 4H7HA 3AZOA 1EA5A 2XUQA 5CH8A 3WL5A 4B85A 1B6GA 3R3UA 2XUDA 4ZWNA 1ZI6A 2CUTA 4JEIA 1QIFA 4UHCA 1YS1X 1C7JA 1EDEA 2ZSIA 1CIJA 1XZAA 3ZV7A 3AZQA 5ALLA 1ORVA 1VKHA 2ZJ7A 4LXHA 2XE4A 4P08A 4UBMA 5K3DA 5AIBA 3W9BA 1BE0A 1ACLA 3FYUC 5FRDA 1BCSA 4FFWA 5BV7A 1HQDA 1IZ7A 2BGRA 4XWGA 2WSLA 4X00A 7YASA 5EHNA 5AI4A 2HA7A 4QNNA 3V48A 1XQVA 3YASA 4FTWA 2XMBA 2C0QA 1QO7A 1WB6A 1YASA 4AO6A 2W6CX 2IITA 2DR0A 3O9VA 3QMWA 2AJBA 2XQJA 5D3KA 1ZICA 4M0MA 2QUAA 2XMGA 4QLOA 3A2LA 4A5SA 2AJDA 3I2JA 3H2HA 5LP1A 4N5IX 1GQSA 3I6MA 4KE7A 2BKLA 1G66A 4M0EA 4MQLA 3EIOA 5C8XA 1EINA 3R40A 3DKKA 3H0CA 5EI5A 3PI6A 3N0TA 1DWPA 4AO8A 2OCKA 1P0IA 3TRDA 1QOZA 3QITA 1JKMA 2C7BA 3G8YA 3ZLUA 5LKAA 3BDIA 4CCYA 5J3JA 1CUUA 1ZGBA 4BAGA 2HDWA 5DNUA 1XZHA 1KU0A 1MT3A 2CJPA 4BVLA 4GHWA 4E46A 4QDOA 3U0VA 4FNGA 3I2GA 5JD5A 3OTQA 5ALKA 2RI6A 3BDVA 3NGMA 2FJ0A 1GKLA 2YH2A 2VT6A 4OB7A 4RE6A 2H9YA 1G5FA 4Y9SA 4OYYA 3ZWQA 3WWEA 4MEBA 4X85A 1YSCA 2XUFA 3WZLA 5EIEA 5EFZA 5HFNA 2QRUA 4H35A 3I6YA 4DNFA 5JIBA 2BFNA 1EHYA 5IVDA 1BS9A 4G8CA 4AZ3A 5A6VA 3D4LA 2J4CA 4W1QA 3I1YA 1CEXA 1TRHA 1W4LA 1LPSA 1THGA 2QM0A 1RYYA 4HXGA 1UOPA 4OCZA 3BF8A 4D9JA 4Y7DA 4WFJA 4KJXA 4FLFA 4G8BA 3CCCA 4ARBA 3O0DA 4B0OA 1Q0ZA 4L72A 3C45A 3DYIA 5HF6A 4H0CA 4GW3A 3ZPXA 1J07A 5AI0A 1H2XA 4EY5A 4NMWA 1U65A 4QDTA 2HU7A 1E89A 4FLEA 4BCDA 1FSSA 3IDAA 4QE3A 1K8QA 4UFNA 2WJ3A 1OXMA 1R50A 3W05A 1U8EA 5AM2A 4HXEB 4B84A 2X5XA 2XLCA 3BIWA 1AC5A 1CUSA 1CUFA 1F0NA 3ANTA 1MO2A 1M33A 4QEKA 3BE8A 3FVRA 2QXUA 3M82A 1NU8A 4ZXFA 2OG1A 4E11A 5AM5A 4KYVA 3VJMA 1VA5A 5ALEA 4J0GA 1EK1A 3AFIA 4YK7A 2LIPA 3DEAA 4N5HX 4Q82A 4BDSA 4GXNA 1BU8A 2XUAA 1CUIA 2JF0A 5FOQA 4EBBA 2XUGA 1FFDA 2WUGA 5EGNA 4BVKA 1LBTA 5C7YA 4MYSA 5A7FA 4DNQA 4W1RA 5EHXA 4PF1A 4PSUA 4KAJA 4B6GA 4G4GA 4HAIA 4CFSA 1TCAA 1R1DA 2Y6VA 2WILA 3LIIA 2DCMA 1XZMA 1GPKA 5AK5A 4KRXA 4MWTA 2WHPB 5CH5A 4IO0A 5T4BA 3AUKA 2JGKA 3GFFA 2EDAA 5D7BA 2OAEA 4HZGA 5BOVA 5HQ3A 3IURA 2V96A 5LZ2A 3A2NA 1JMKC 5KREA 3LIPA 1E66A 2GZSA 5ALOA 5E4YA 2X76A 1X70A 3KDAA 1CUZA 5AKJA 3E1GA 1AX9A 4WDQA 4I3FA 4J0IA 4DMHA 2XLBA 1ODSA 2IX9A 1XROA 1Y37A 1R3DA 3PFBA 1MU0A 1FFAA 5ALRA 3I2KA 4P92A 4AB1A 1EB9A 2V97A 2GYWA 4I4CA 4X97A 2HL6A 1GGVA 5A7HA 3B5EA 4A23A 4UHHA 2ZYSA 4FFVA 5DLPA 1LZKA 3C8HA 4N8DA 4H7JA 4W63A 2RAUA 2HRRA 4XX1A 1LPPA 5ALXA 1A8QA 4UFOA 4KAAA 2QVBA 2ZJ6A 3KWJA 3GROA 1LPBB 2GZRA 1CQZA 3ICVA 5SYMA 3WQHA 1MX5A 4YX9A 1ACJA 1N5RA 2FUKA 3A2MA 5AI5A 4RNCA 5CT8A 1XRLA 1DWQA 1I6WA 2CB9A 2HA4A 2PSDA 2Z8ZA 2OLEA 4JNCA 2P8SA 4I19A 2VATA 2H7YA 2CEKA 1K5PA 5D6OA 3H1AA 5HF8A 4G1FA 3G9TA 3STWA 2VSQA 4BTVA 3STXA 3Q0TA 3R41A 5A62A 2ACEA 4X93A 1UK6A 1C7IA 2AJLI 5FDFA 2ORYA 3R3XA 2Y2VA 5ALUA 2G63A 3P2MA 4BRSA 4U2GA 2WIDA 3KD2A 4LHEA 1YB7A 3FYTA 3WKBA 1BN7A 1S8OA 2WIKA 1NX9A 5AI6A 5ALJA 1RP1A 2VAXA 3DLTA 1JJBA 1H2YA 2O2HA 3FLEA 1XRNA 3HXKA 4UHEA 1Q0RA 4F0JA 5C8ZA 2WIFA 1MX1A 3SC2A 4AN0A 3WIOA 4BDTA 1J2EA 1W76A 4H7KA 2GBIA 1R9MA 1CUWA 2VJBA 3FCYA 5HK9A 4EY8A 5EIAA 4FHZA 1XRMA 5CT4A 4DM7A 4KE6A 4GDMA 2QKYA 1JI3A 4QWWA 1ODTC 3R3ZA 2D5LA 4UBKA 4PSCA 4DSAA 3H1BA 2PSHA 2CBGA 1U4NA 2W22A 5LZ5A 5DYTA 4BYMA 3O9MA 5JZSA 3IA2A 2VJDA 5ALDA 3FAKA 1BRTA 4LKOA 3X3HA 3WL7A 3QMMA 4CG3A 2PL5A 2AJCA 1ORWA 3DOIA 4BAUA 2C4HA 2RHWA 2QR5A 1SOMA 5ALWA 1G4HA 3KWFA 2HHAA 4U2BA 4G9GA 4K6KA 4UFPA 1CV2A 3VKFA 1XLWA 5AKYA 2GBCA 1FFCA 3S2ZA 1WM1A 2PUHA 4PNZA 4E14A 1QIDA 1GT6A 1JJFA 4FBMA 5T4EA 1LPAB 2ZVDA 5ALPA 2XI4A 4QWMA 5AKIA 3I1IA 5CT6A 1VA4A 4TVKA 5I9IA 5ALFA 4UBOA 3WJ1A 1HKHA 2NW6A 1X2BA 1TIBA 3BF7A 4C01A 4UHBA 1JJIA 1QIKA 4BCBA 5LZ9A 5CXXA 1G42A 2HA5A 4XIIA 1VJ5A 3G9XA 3CN9A 3FYUB 1CUCA 2CKMA 1Q84A 2Z5GA 2C5GA 1N1MA 3D2BA 3WZMA 1LBSA 3IUQA 1XZGA 3AIMA 3UMJA 3UUFA 4H77A 5EIHA 2JGIA 4K2AA 4UHFA 4BVJA
chains in the Genus database with same CATH superfamily
3R24A 1GCOA 1KNQA 2ZS8A 4MUIA 3EXG1 2XVAA 2HSZA 4B3XA 3KJIA 4FIDA 1GPDG 4FWBA 2IUUA 5FJIA 4D4HA 1LB1B 1ZD4A 1GSHA 3G13A 3G2JA 3U3KA 2XQIA 1BVHA 1JLLA 3PKZA 4CKEB 4LXQA 5A2GA 2YZMA 4KQKA 5ARDA 5ECYA 5EPOA 3LTEA 4QDUA 3AINA 1ZY2A 5TC4A 5BSHA 3B51X 5HOEA 5ITWA 1TA9A 3JARB 3STTA 4WBNF 8AT1A 1F4VA 1AXEA 2O2XA 4ENSA 3M0EA 4HMOA 3O1HB 3J81k 4B3FX 2AMVA 1II0A 3CZ4A 4E7PA 3PE3A 2GPTA 4ZVKA 4U9HS 4JVMA 2DY0A 1V5FA 2PH3A 4BN5A 3T35A 4ATNA 3GJ3A 4QXAA 5GONF 3C43A 1E3LA 3DBOB 3R3SA 3FWHA 3OZUA 5BSRA 4HKTA 4QBTA 2R65A 5EJ7A 1GQQA 1HSOA 3M2PA 5GV7A 3HXQA 4XUEA 2WPDA 4KIJA 3AVOA 4KO8A 2X0NA 2PUJA 2ZTVA 4WKPA 2FY8A 4CLDA 1CF9A 1A5AB 3GAZA 4EHLA 1PZEA 5KBYA 1OFGA 4TKVB 1P5FA 3MWKA 4FT4A 3L0OA 1IN6A 2FN3A 1XD2B 4XWAA 5FPSA 2XA1A 3GI1A 3LYLA 3W1EA 1ST2A 4JL5A 2OLJA 2H85A 2O4CA 1MQSA 3ENVA 2RKWA 2JLBA 2YJ3A 4LJ5A 5E1OA 4CI0B 3RC9A 3VVMA 3CKKA 4Q4LA 1MD9A 3KYDB 4P5EA 4BMNA 3TQFA 4IIHA 2PUBA 4MIKA 4D6XA 2YYZA 3Q8MA 1ND5A 4HOYA 16PKA 4G5RA 4FGJA 3CISA 4C7OB 4W4TA 1DTWA 3M4XA 3E18A 3STHA 4RTSA 3WGUA 4V0NA 2OECA 3DF7A 4NJMA 4YPOA 4F5EA 2FW9A 1AQIA 4CU2A 1VHTA 1NVWQ 3BIFA 4IYRA 2J6HA 2EV9A 3NBQA 4DZZA 1C7ZA 3QVMA 4AIIA 2R8XA 5IAAA 1OASA 1S2MA 1XZJA 1JUDA 2OD7A 3FGNA 4WADA 4N7JA 1P60A 3ZDZB 2BTEA 2EGGA 3C5HA 1UM8A 2IY9A 2B4QA 2WBLC 4FD3A 3O91A 3CVWA 2IXEA 2O52A 3BIJA 2CHVA 5AW2A 2CLOB 4TZ6A 3KSRA 1X0XA 5KWJA 2PJZA 1AMNA 1SHJA 4CM5A 1TF2A 4TXMA 1E2MA 2GBGA 2ZRAA 3ENQA 2GZ3A 3K8OE 3JQPA 5BWMA 4J0KA 2C3PA 1CK4A 4CLOB 1J1IA 2JD1A 4RENA 3L6CA 5D87A 2XMSA 2AEMA 3DYVA 4DXAA 1P7YA 4X7BA 1GNRA 3S5UA 4JT8A 3H3JA 1FJGB 3GGCA 2ACKA 2QRJA 3PGKA 5BMVF 3U3XA 1UKZA 2J5RA 2OUIA 5DW0A 4EA6A 1XP8A 4V38A 4YJ2F 3A58B 1T5LA 2JEZA 1X7WB 2TSYB 5TGZA 4DIOA 3SU8A 1HL3A 1DBIA 1AUXA 2IZ0A 4J07A 4IEEA 1G21A 1NE2A 2BELA 2CMFA 4OH1A 3GG9A 4BO6A 1FRFS 4ZV7A 3VDQA 4EGCB 5IKMA 1HNWB 3V2GA 4IFIA 2FWRA 3AESB 3G8DA 4Q1EA 1JHAA 5EMLA 5DX0A 5K3SA 1YJXA 4DUGD 4B40A 1ZA2A 1Z75A 3DXYA 3CF6R 1DRWA 3D4BA 3F4LA 4U7WA 2P6PA 4R2JA 2D5IA 3S2SA 3OZTA 3G2PA 3OM1A 1BDBA 2QEQA 3BCHA 1F14A 3T3MB 4EX6A 4J0EA 1DQYA 4WTOA 5L4SA 3R0JA 5LIPA 1IMJA 1QFJA 1WP9A 2M2IA 2XBUA 2LDXA 3E3NA 3I2FA 4AMVA 4YQFA 2E4WA 1X7XB 3OOJA 4XQGA 1F0KA 2QOEA 3BWXA 3JYNA 1Q0SA 4YO8A 5FYDA 3FH0A 4U7DA 1MHTA 1JWLA 2VDLB 5EMJA 3EJ6A 3CEJA 4M1ZA 3JQ7B 2ZS7A 2IVFA 4NCJA 4X7RA 1RAEA 1NM5C 2YTZA 3OX2A 1ZVJA 1NF8A 2VHEA 3TZKA 2E85A 2YXNA 3EIUA 4TRMA 4RLQA 2HC9A 1RMYA 2JEYA 2N1MA 3BD9A 3BKXA 3PGXA 3Q9NA 3TECE 1JEYB 4AY6A 3C3KA 3I2YX 5TGTA 1YKGA 2XY4A 3F9CA 3VX3A 2V7WA 4J0QA 4EJSC 1KP2A 1K63A 2QGFA 4ZVRA 1YFJA 4Y1RB 1NVAA 2W4MA 2GILA 5TEVA 1WZNA 5BWNA 3W9SA 5JZVA 4PRKA 4H4DA 5DI3B 3CRNA 2GZAA 3I05A 3ML1A 3N2NA 3EJWA 2AOUA 4J7CA 2NP6A 2QY6A 4X71A 1A04A 3UTCA 2VCEA 2XQFA 3MGBA 4IJ6A 1O97D 1VZ3A 3P96A 3VPHA 1Q12A 4AD8A 3EGDB 4OLFA 3IS3A 2GDJA 3QSGA 4QPPA 2GVDC 2C9YA 2B36A 4AP9A 4HYEA 4BUCA 2Q2QA 4RD3A 1EGMB 3G02A 3I3OA 4QEZA 4EJ6A 3P9RA 5L4NA 2IUYA 1BCRA 3SE7A 2IT1A 4HTFB 1XTJA 1YQXA 1AUPA 1CRWG 4XUGB 1A8SA 1WDTA 2Q3DA 3O5AA 3WAJA 2OD9A 1X7ZB 2VDWB 1LRJA 2QUIA 2DUWA 1GIAA 1Z13A 1ZSNA 2I8LA 1BEZA 1D07A 1O6BA 1SG6A 3E81A 3G8CA 3O4GA 2H08A 4JKIA 1DS6A 3RK1A 4ASUD 5B7PA 1VIMA 2O7NA 4MR8B 1IOZA 3ZDDA 2YYAA 1AURA 1XAIA 1BH2A 2FZWA 2XNKA 1AIPA 2XWBF 3A26A 3BGSA 4JJ4A 4MRNA 1PKXA 1FRQA 1MIOA 5TQ2B 4B83A 2CNNA 5KQPA 1K3TA 4TS3A 3ZWVA 2FWPA 4WJKB 2WHQA 4K9PA 3QQPA 4MQFA 2PGDA 2VDRB 3HKDA 3O47A 3SHTA 3IILA 4X6YA 4B4VA 1QH0A 1FFYA 5E6UB 2G28A 4B6EA 1MKYA 1SVLA 3CLKA 1VM6A 2WWFA 1NRIA 2XSZA 3MCTA 2X8BA 3O4HA 4HNQA 3E3MA 4MVYA 2Q3BA 1WDLA 1H23A 1QP8A 3DOJA 4P3PA 1E3QA 4HFNA 3AHJA 3C74A 1KOJA 3LY7A 5DVZA 3DPUA 4UM5A 4Z9YA 3WI7A 5KTNA 4C43A 3DDZX 4RWEA 4F11A 3AWDA 4I5FA 4OHFA 4TKUA 1BXGA 3VR2D 4PY2A 3HYLA 4JEMA 1K7XB 1QYDA 5JAIA 5IWCA 3P7MA 1NRXA 1V71A 2ZE8A 5WRFA 1TK3A 5JATA 3F7OA 2X7HA 1PFVA 3W5IA 4AJHA 4TQAA 1C4XA 3R5SA 1PNOA 3OQJA 1NRWA 2O3TA 3KZNA 2WSBA 2ZYHA 5JARA 5LZ9A 1I30A 3TQCA 1M72A 3NCTA 3WMRA 3U3RA 2GPYA 4Z4FA 2JHPA 1RSZA 2ILVA 1X8XA 2ZS9A 5BVHB 1NXOA 5TVKA 4TVSA 3E5HA 5D51S 2ZXFA 5FLKA 4E5NA 1T2VA 4Y18A 4C88A 5H4GA 2QDKA 4HWPA 1R4MA 3N1UA 4Y6GB 1SCKA 5AVJA 3RVQA 3G0HA 3CR7A 3E48A 1DC7A 1VLZA 3PRJA 1KVSA 3ZX5A 5IWAB 4PFJA 1OJLA 3ETJA 4ZT6A 1XQXA 1U0JA 3PRKE 1JU3A 4E22A 1XDWA 3OLZA 1QFSA 3ZBQA 4LGMA 5IEJA 5YASA 1NJGA 3IOMA 3TLMA 3WGYA 3NX4A 2EYUA 1P0QA 3BTVA 1JG6A 4MVJM 3D54D 1WUKS 2C1EA 3C1UA 2YKGA 1JB9A 1UFVA 2DQYA 4M8LA 1VGVA 1FU7A 2HMTA 4XR4A 4EKDA 1M34E 3SKXA 3RU3A 4E6PA 4JVNA 2ONCA 4I7EA 4KFTA 3RARA 4N48A 3LFUA 4CMAA 4E33A 1TD1A 1E2QA 3HWX1 1ZLXA 3DT8A 1ISFA 2WHPA 2FSIA 3EUWA 3ILYA 3RDPA 1D7AA 3WLIA 3BXFA 1JDSA 1KDPA 1RZUA 2E48A 2P40A 1L5HB 3RS2A 5JH7F 1QO9A 3KYCB 2CCGA 4JSRA 2OXIA 5KJ1A 2O8FB 3MVEA 3WWCA 3ER6A 5FA6A 2IF2A 2V7BA 4FHGA 4DA4A 1IBLB 1GSIA 2YJ5A 4IMIB 4GEGA 4C20A 3VSDA 1M76A 1OF1A 2B61A 4L02A 1F48A 3MJEA 4Q3BA 4RY8A 2QZPA 3K1AB 2Q5JA 1BKYA 3U19A 4ZQBA 3ELYA 1PJ2A 4CMIB 3NDBB 1N6PA 3HEAA 2PU5A 1WDKA 3WKAA 4E5SA 3SY8A 4M1TA 3UIEA 5HW0A 3BE6A 3S2YA 5LQJA 2Q5CA 2A9RA 3L7MA 4IDFA 3ZHVA 5DBFA 2A0WA 1M2VB 3UK2A 2WU4A 2JFOA 1O4WA 3KQLA 3GFPA 1E2HA 2DKFA 3MHPA 3ESQA 4W9MC 1O6GA 2JRLA 3DMFA 5LLDA 1Z7EA 4RETA 5BYBA 4MV7A 3PHLA 5HHTA 1GRQA 1QIGA 2ZUTA 2DOKA 3SDBA 2JEOA 3HV0A 3I23A 1WXQA 2D74A 2ZROA 3KJFA 1VPTA 4JQCA 4S1NA 1MOZA 3WWOA 1EUQA 1PVVA 4K46A 5ELMA 1PZHA 3ZV4A 3OC0A 4YB8A 1ZGHA 1S3GA 2GTHA 1WSBA 2ZITA 1OFIA 4PO1A 4LYHA 2C54A 4KDCA 5LQCA 5J1SB 1YFLA 4JSTA 4DV6B 4CIXA 1NW9B 4KNWA 1U1GA 3CN7A 3DLCA 2ERXA 2BSAA 2PDAA 4K86A 1GP2A 3TEJA 3ZU3A 4FHFA 4PG5A 2XD4A 2B1QA 4HEJA 1TA4A 4BZWA 1ZIDA 2COEA 1T8UA 1E8MA 1DVRA 4MW4A 4M1MA 4V0LA 4RACA 2D0OB 3TBFA 3QX3A 2QNIA 2P79A 1WXEA 4MWZA 1OH8A 4NQRA 4LZPA 3N2YA 1Y34E 2YVLA 2DHDA 2IYRA 2OORA 3IAHA 3W4KA 4EA7A 1DNPA 1JIUA 1RHMA 1SXJE 3EASA 1UL1X 1NL3A 4HUQA 3LPLA 3S1AB 3K6SA 2PUFA 2V0GA 2IE8A 2MYUA 1BN6A 3BIXA 2E1RA 1YTUA 4P0TA 4GYWA 2PR2A 2PV7A 3JQBA 4NCHA 1NTRA 2Z2IA 3ND6A 3PR2B 4INOA 5P8WA 1D2HA 5ISMA 3HZHA 4HXFB 2D2FA 3ROXA 3QW4B 4RIHA 4BO3A 1J70A 1RWMA 5B1YA 5TT1A 1K66A 2VF2A 1MNQA 1JXMA 3HKCB 1DFGA 2R6FA 4HBZA 4M60A 3ANSA 1RM3A 3R3YA 1E3EA 4DR6B 1P2BA 4D4JA 4W5OA 2QTHA 4OQFA 4I2NA 3H11A 4EB0A 2JAPA 3GFGA 3NP7A 3WIDA 4UZEA 2XKAA 4PLHA 2HBZA 4IEFB 2CB0A 3AEQB 3JD3A 3PC2A 3PUIA 1DAPA 4LNHA 3G49A 1PUJA 3MRSA 3Q7RA 4J3FA 4KQIA 1S3IA 2CCKA 1AGPA 3D8NA 1RQ2A 4K81B 4RY9A 1WRBA 3SVTA 4F5WA 4XVCA 4BS9A 1F8XA 4NE2A 4R1NA 2XMDA 3U7RA 2I2WA 4BECA 3DV2A 5ITZB 1EQAA 3R2JA 3LT1A 3K1YA 4UD2A 3RFTA 2NTVA 1MVNA 4XD2A 5KC9A 1ML3A 5I7WA 3LUJA 4WHMA 1RLTA 5CA0F 2R48A 4FPXA 5ALMA 4Z0TA 4D43A 1WG8A 3HR8A 2XITA 5IS2A 2QUBA 4JBYA 1Q19A 1Q7EA 3E9YA 3KUDA 4KK3A 1SULA 5FEMA 5JAUA 3A3YA 3ZBUA 1T4GA 3D0QA 1RE0A 1NF3A 2JLYA 2ZYIA 2OV6A 3FPAA 4OA8A 5K51A 3JAWB 1MJHA 2I22A 1G1AA 4S1VA 2OCXA 3GFRA 3RC1A 5LZ4A 3ICWA 2QXYA 3IE2A 1D5WA 1H1LB 3FHCB 5CVTA 1ZRMA 1AS3A 1GTSA 1ZD2P 4UKDA 1OGIA 1LDMA 5HF5A 4KUHA 3SXJA 2CXOA 3UKJA 4KLAA 4CG0A 1ILWA 4A92A 3LV8A 1Y3HA 5GJWC 3NC0C 1TM5E 3CEPB 4QGHA 3G88A 3QTTA 2QX6A 3AFMA 4KKXB 2VQFB 1K4KA 5L9AA 2G1PA 4Y2VA 5DASA 2WHXA 3FOBA 5AJUA 2JKZA 3CNBA 3Q6IA 1GUFA 4Y3UA 2GFIA 1H5NA 3EDYA 3SC4A 4UMDA 4MQEA 1PYDA 1QGUA 2CNBA 2E18A 5FFMA 2QF7A 5EXTA 5CLJA 2OFFA 4P81A 3HV2A 5AP9A 1TRKA 2QI9F 2OGSA 4A2QA 1AB5A 3BPSA 1L9XA 3ZJYA 5E7JA 4A82A 2J3EA 1PS9A 2YWJA 3LLMA 2PLNA 3TR0A 5CEEA 2Q9UA 5AI8A 1H22A 5SV2A 4UNIA 3VPBA 5CDTA 1N6KA 1H4SA 5AXBA 3N8GA 2OKCA 1UADA 3RJTA 1CUJA 2GK7A 3FRJA 4GH5A 5JSFA 2XMCA 2CZCA 3TI9A 2BHSA 4O4JF 2HR1A 2IDMA 1CR6A 2WWIA 4B7ZA 4AROA 2J0UA 2Q5IA 2HU8A 3PUVA 5JYDA 4R3UC 2JGAA 5GZ1A 4ONEA 3HYNA 3UAOA 4IIJA 5A04A 5DM70 4I1PA 4LZLA 2WFZA 4ON9A 4WW0A 1P0FA 3S55A 4YCBA 5A9RA 1X1BA 4LSGA 1JKJB 5KI6A 4R05A 1J39A 3EISA 3IIJA 3D6FA 4NHOA 5T3UA 1CRZA 4A0GA 3GPLA 1PDVA 1KORA 2ZQYA 4K0KB 3LUBA 1RRPA 1ZD8A 1YNOA 2F17A 5DP1A 1KAMA 3R9IA 4MCIA 2HRCA 5BSWA 1ORDA 4JJ6A 1B8UA 1HDCA 1NYLA 3SP1A 3LLUA 2QZJA 3QNWA 5AJHA 3ZXYA 1H2EA 3IKMB 3VO8A 2I2BA 1S0UA 3KT3A 2Y0CA 2FMIA 2QJTA 4Z9BA 1GG9A 2ZSHA 5BPFA 2BD0A 5IJ9B 4Y6LA 3ETGA 5F5LA 4L16A 1Q7GA 3UT5B 2B8JA 5TLSA 1YQWA 5GV8A 3F0TA 4GXTA 4WH0A 3IHLA 3VR0A 3E22A 2JJ2A 3RSHA 3WGNA 1DRVA 2RCNA 3ZWYA 4B8ZA 3K0SA 4IXDA 4HB2A 5JC8A 1UC8A 5K0NA 4MEAA 3FSGD 2PM8A 2AUMA 2QRKA 3HO6A 2NO6A 4L9SA 1KDOA 1XXHE 1MC1A 2JJ1A 2G0NA 4KL8S 2OV3A 2R00A 5IEBA 4LG1A 3GVCA 2NU7A 3FDZB 4M1YA 4DTCA 1HK7A 1UPBA 3LQQA 2I87A 4OHXA 1CB7A 3EXHB 3RJZA 3G0BA 4N3BA 1P7PA 1E4EA 4JJ8A 1X13A 1VRVA 5F33A 3RKUA 4IOJA 4NMLA 3U3JA 1ZMOA 4RHFA 3WFIA 2J09A 3C97A 4L8VA 1E77A 3EXIA 1HZJA 2VJLA 3PYXA 1EMDA 3DOEA 3TM5A 1PGPA 1C7RA 3WICA 4K87A 2JJ8A 4FDTA 2VJMA 3D64A 4PWYA 3GOQA 2LCQA 4F8YA 1RPZA 2ZJ2A 3PVCA 3R6TA 3WMGA 4EKIA 1N3LA 4RQBA 1W8DA 1TKCA 5TR9A 3HNOA 1E7YA 4LVCA 3B48A 2YWRA 3DZBA 4HX5A 1DMRA 1T9DA 1F7VA 3ZK8A 3EEIA 1QE0A 1Y5LA 2YINC 3ORYA 4GP7A 4C4YA 2QENA 2VZEA 3E5MA 3THSA 1T6XA 4OJNA 3A27A 1XEAA 1E9EA 4DNXA 4GGMX 4AMZA 5K0JA 5KJCA 2PLWA 5TQVA 3PE6A 3RVOA 3RYIB 4EB8A 3CY6A 1QGED 2D1YA 1N0HA 2ZOSA 3K96A 4BBPA 4LCBA 1OPXA 5CT9A 2HQBA 1HEYA 3V2UA 2F3SA 4D5GA 4CCAA 1JDBB 3JPYA 4OHOA 1NASA 2MOKA 3GOHA 2BFWA 4GOXA 1US8A 1G3QA 3IT0A 5TNXA 3L0PA 1IDN1 3DE6X 4JQSA 1YVPA 5TSDA 3EVTA 1L5FA 1XLVA 1JA1A 2PTHA 2VYND 2X13A 3NVAA 3O94A 2HDHA 4FQ7A 4LV5B 1XNJA 4JYPA 4PSAA 2CKDA 3GN2A 3MT0A 3T7JA 2WZBA 1ENPA 4NZYA 1UMKA 1DBWA 4I4TF 1NOKA 3LC1O 1BMFD 3LDGA 4H6WA 4N0MA 3ZE7A 5HR5A 4L9AA 1HETA 4QJ4A 4N4AA 4KQXA 4Z0NA 1QFMA 1D8AA 4YGXB 3D81A 5AM1A 4PG8A 4ZI2A 2CNDA 4OOEA 3SSMA 4CETA 4BUJA 2AQKA 1YQTA 4M9QA 2W11A 3QFCA 2ZRIA 3RBXA 2NUAA 4A15A 1HR0B 3QVVA 3Q8KA 3RTAA 2B9EA 3SXUA 2CHFA 2WT8A 6Q21A 1XRRA 4JLUA 4OFXA 2X3UA 3B89A 3HKEB 4J94A 5EINA 4ZJYA 2HZBA 1Z0FA 2PXHA 2X42A 5F3RA 5IDVA 3IAS6 3LDHA 2EFYA 3G0GA 3P0EA 4XFJA 1ZDMA 4DCVA 4LQCA 5CK4A 2B5OA 3LC0A 4K6CA 3KSDO 4HLDA 1JYSA 5E3HA 2HQSA 3D7KA 3DBHB 3NHFA 1KO5A 3TSCA 4GO1A 2J59A 3GELA 3LHSA 1Q7CA 1ODLA 1JILA 1OX5A 1E59A 1TVEA 2G76A 2JBWA 1EP1B 1UUFA 1XKQA 2ETXA 2QV7A 4UXIA 4M9XA 4HS9A 3EMDA 5ALIA 4ZVVA 4BQOA 4DMLA 4ETNA 5L51A 1V2GA 3KE8A 1G3MA 1YFKA 4JLNA 4OHVA 3V4RA 1TTTA 3TVTA 1DDOA 2YZNA 2NTEA 3ZH2A 3T7EA 5JTUA 4Z3OA 4GUAA 2FSFA 3MWEA 1CLEA 2ZSUA 1CQWA 4NE9A 1MV8A 3FMFA 2P0AA 2O19A 1W9MA 1VQ1A 3DE1X 4GRDA 4NCNA 4HWTA 1QH9A 2D4AA 2XMZA 1A8PA 4D3DA 2BM9A 4FKZA 5SZIA 2FSSA 4N0DA 2P77A 3HY4A 1FLDA 1DP4A 3DTVA 3UGTA 3JX9A 4A4DA 1FEZA 4IHJF 4BO2A 3N53A 2X40A 3ZHSA 2JDID 4X65B 5CNIA 2VK1A 1CW2B 2AT1A 4MPJA 5ILOA 2J32A 2Q5OA 4PPFA 4XGNA 4ZAZA 3V42A 5JNRA 1ZVKA 3FPEA 2IHYA 2BHNA 4GP9A 4Z99A 4S0XA 1SCIA 3VAYA 4DABA 1Z4KA 1Y4SA 4JC5A 3TOZA 1IVSA 4F04A 4UMFA 2ZRGA 3GZ4A 4IP0A 1K98A 3M83A 3IEMA 1UP7A 1Y1TA 4G6ZA 3HC7A 1ADYA 4NYMQ 3CONA 5L3QA 3KPUA 5IJZA 4K2HA 4ECEA 2Q7OE 4M9SA 3Q87B 4TMXA 1J9EA 5H81A 2QAGA 1II9A 2QVZX 3UYLA 2E4VA 2K2QB 1G19A 1P4RA 2ZWMA 2A4MA 2HDOA 2XOKA 1UCFA 1T36B 3OZDA 4DQDA 4DNPA 4YP1A 4XVHA 4UUNA 3HZZA 1KQFA 4OHMA 1L8OA 2G5CA 2VP5A 2IH5A 3RC8A 13PKA 4I9FA 5JI3E 3VVLA 1YRAA 3IMGA 2IRWA 5FL7A 4P0QB 2ZUWA 3SM3A 3B85A 4KVGA 1KHHA 4ND3A 1QK5A 1EEHA 2OWDA 2WNIA 2FG5A 3DAYA 4GBED 1THTA 4P3NA 5JECA 4LOAA 3QVXA 4H0NA 2OM2A 3CX8A 4PZAA 2FUEA 4LYEA 1ZJWA 2HEGA 3TE6A 4DWJA 1AZTA 1KI1A 4RPGA 4CM9A 1J33A 4RW0A 3K9FC 1L7AA 1QVZA 4KPUA 4LKRA 4XQCA 4F2DA 4IV5A 3J81A 1E2IA 1CDZA 1UBTS 1YGPA 2QDXA 2GJAA 3TW6A 3WLQA 3EPRA 3I2IA 2CVQA 3FNHA 3RKRA 4LYAA 4JMPA 4H7EA 2GN8A 3WB1A 2QK4A 3VYTB 3AJDA 2LNDA 4JI4B 4Z4EA 1NN3A 2AHRA 3QEKA 3AUSA 3P9ZA 4IYJA 4FZ3A 4D4IA 4NYJR 4P83A 5EJAA 1DOAA 2WKWA 1F5SA 2ZT5A 1M6EX 1DBRA 2HDNB 1NVGA 4B3CA 3F4BA 5CLIA 4DV0B 1T2DA 2V6MA 2WLTA 5HTOA 5E1MA 1I0LA 4YAGA 4GVLA 4ZQCB 1AK9A 1U5CA 3SR3A 2RGXA 1OX6A 3OFJA 4LHZA 4P7GA 4TT3D 5EUBA 2FMTA 4G0OA 5B4UA 2WVAA 2J4DA 1PJAA 2AI3A 4YJ3A 4ZVMA 1KYXA 3E2MA 1M73E 3IHWA 5F7ZA 4O2BF 2XXAA 3HA5A 4FNOA 4IIXA 2EF1A 2W8ZA 1YZUA 2C7VA 3D3WA 3RC7A 4NFYA 2VT3A 3KRTA 3I73A 4WLOA 3TEMA 1CZKA 5CDGA 1IN7A 3ROMA 1ZD5A 3IR6A 1NBME 1O58A 3NM5A 4HVLA 5J4HA 3P2YA 3E84A 4QEDA 3PR1A 3BGIA 1ARZA 1UBLS 1UMDB 3GQBB 3VQTA 4YPVA 3ZLTA 4PLGA 4FWTA 5FUMA 4CL8A 3OZGA 1FCJA 2ZJYA 3ZTTA 1E9DA 3DWFA 4B82A 5JEEA 4UOEA 1Y6FA 4XD7A 4YRMA 4J1QA 1TW3A 2GT1A 4KRGA 5JXJA 2WZDA 3GAFA 2BRUA 2W2LD 3ASZA 4W5WA 1UT6A 3ANYB 5ILGA 1C5KA 1BJKA 3F90A 4LOKA 3LY5A 4D26A 1RXVA 1A7UA 1GPWB 1TLFA 2W98A 2WG0A 4PZCA 1I3CA 2DULA 4E0BA 2XYQA 4X3PA 3TL6A 1A5BB 5I3CA 2BLNA 1NV8A 1PW7A 2PMCA 5K0LA 2ZB4A 5EKTA 3HA2A 3I01M 3STUA 3ZKWA 1QMPA 4XYMA 2NADA 1NQOA 2DFPA 3AXTA 4NU6A 4BP8A 4DYHA 2ZIXA 3UT6A 2A1TR 5LP6C 1BXKA 2B9VA 2H57A 5KKAA 2X0KA 3F1KA 2C07A 2Z5LA 5K6TA 2ZIFA 1JDVA 4JGGA 3CWQA 2ZSFA 3ONFA 3TUJC 3VC7A 1QYIA 1SK9A 4NMHA 4KZPA 3S4YA 1KHTA 1RRCA 2J8ZA 5FHQA 1T5BA 4LISA 3T3NA 3EBOA 1XDDA 2FR0A 1U28C 3FUCA 3OTIA 3ZWBA 3STVA 4PNPA 4QOIA 2C5SA 2O7VA 2XTMA 1VSUA 2PZFA 1DU4A 1MB9A 2VWHA 4OQZA 1ATZA 2V6IA 5LUBA 3NHUA 4OQQA 4ZT5A 2FA9A 4ETIA 1NQWA 4CV2A 1NW5A 4ABTA 4R31A 4H7IA 5KHAA 1NAHA 3USES 3VUFA 1AQYA 2CLLB 1GL9B 2J7KA 2WFLA 4LF9B 3IUNA 3VPAA 5KOIA 4M0LA 2LV8A 3KXPA 1JEJA 2H7VA 1E1LA 3FHJA 2GA9A 3NJRA 5JS7A 3GJYA 3M6FA 5FA8A 3SEQA 2ASVA 4JZYA 5DM60 4CHTA 4F1WA 1BHJA 2FOIA 2PK3A 2XEDA 4W9RA 4B6JA 5CBKA 2HGZA 3R3HA 3K8YA 1R88A 3FGPA 1XJ5A 3AK4A 2VJNA 2APJA 4D8YA 1YE3A 4Q3LA 4F2HA 2GZHA 1MORA 3K70C 2F64A 3A9WA 1MOQA 3K5WA 2EG9A 1U81A 2EJTA 1NJSA 1JXOA 2EGHA 3H2SA 4HFRA 3ZDQA 5K0CA 3KKZA 1C0EA 1U2DA 1H5UA 2NGRA 3F7MA 1XCPA 4TYQA 1VOTA 4C5CA 4ZICA 5K6AC 2ST1A 1FVOA 4P3XA 3HH8A 1L5GB 4UNPA 4DB4A 1YULA 2BFDB 1Y4ZA 1GN8A 2I99A 4Q9KA 5DLYA 2VPWA 2MINB 1MDBA 4P54A 2BEJA 2WT4A 2BR5A 3KELA 1RYEA 1P9NA 3DL2A 4P9NA 3UC9A 3GPIA 1E7SA 4OHWA 4WCVA 4P3OA 1E1QD 4K9NA 3C14C 1Y3BE 1ISIA 4FZRA 3JYPA 3IHTA 4LSZA 4UM9D 1AU9A 4HLCA 5CX1B 2NYUA 1TYAE 5E4TA 4D74A 2FCAA 3N8IA 3Q12A 1H66A 3REOA 1W5TA 3OLVA 3MOIA 4AWAA 1LX6A 3RRJA 5JWOA 1SCJA 1P4HA 2A0KA 3C7TA 3G2OA 2A8YA 3EMKA 3OIUA 3P2IA 1HE4A 1PRYA 4P35A 1PFQA 3MWLA 3TXAA 3GEDA 3VR5H 3ZUGA 2W2KB 2B2NA 2D3WA 3ZHBA 1PEAA 2Z2KA 1K9SA 2BKEA 3B3QA 2KLHA 1FLNA 3Q3VA 4P2GA 5DULA 4ZIRA 1JFSA 1PR2A 1YCDA 2GAFA 4Q39A 5K3FA 2BFFA 4OJKA 3ZCXA 3MLBA 2VPTA 4PX3A 3QBJA 3UTDA 1OYVA 8LDHA 1LX7A 1UFKA 4RH3A 1PVDA 1QFXA 2FGKA 3K7EA 4HL6A 4JC8A 4WXMA 4X3CA 1M34A 1YQEA 3NRBA 2PGAA 1UAYA 4L8YA 3WFJA 1SOVA 2ZUUA 3X1ZA 1I0ZA 5LUAA 3CINA 1QH1A 4YCAA 5KNCA 4JYMA 1Y7IA 4RVDA 4ZO7A 4Q1VA 1YV9A 1B26A 3KHSA 4QRIA 3CMMA 5B2FA 1JH8A 2OFXA 3E4DA 4Q19A 2A1UB 4W9NC 3I9MA 1TJPB 1XXLA 3GNLA 1C2TA 2H29A 3B8HA 4HTAA 4IDQA 4LDJA 5DISB 5J9FA 3S2GA 4A91A 4Y2PA 4GPAA 4FFPA 4PN7A 4KR0A 3CC8A 3KSZO 4MWSA 3IL2A 2OCLA 4TV8F 4L6CA 3TLBA 1XLUA 1KU6A 3O2QB 4KRYA 3UMVA 1Q0QA 3ROGA 1GD1O 3GUUA 1ZRNA 4NICA 2Z8YM 2FEPA 3WMWA 3LG2A 3KOWA 2C2WA 1MRZA 1V35A 1T3ZA 2PZJA 1H0RA 4FB4A 3NWOA 3UPTA 1VI2A 2O3QA 1YAJA 4E07A 1NN0A 1CRPA 2H0AA 2C4TA 1C1XB 2FR8C 4OXXA 2AH5A 3RB8A 3PFWO 1L4GA 1Q0PA 3DDUA 4EI9A 4LC0A 3U61B 4NXMB 2YZ7A 1NU6A 4FMCF 3HY6A 2FF7A 2J9FB 3D2AA 3FWNA 4RABA 2O59A 1RCFA 3DBRA 4BFTA 4QNRA 4MR7B 5DHSA 5DDIP 1L1QA 3DVRX 3GWZA 3NBAA 2HRQA 3A4MA 3UPUA 2PY6A 1GNSA 2FETA 2XNSA 1KZ7B 4UBNA 4ZT4A 1UBOS 1FFSA 3NHKA 1WZIA 4CM8B 1FOEB 3QPCA 1XN4A 1U5BA 1QIMA 5TS2A 3I1JA 2BMEA 1WW8A 2H5JA 3S2EA 3UYKA 3WNVA 2PBZA 2L19A 3C5EA 1QRUA 5CD1A 3CH7A 1B6RA 1FNCA 1JQJC 3F47A 2VXCA 1Y80A 2R6CA 5NULA 1VYTA 3T0IA 4LRYA 4NENB 4KQMA 3FVTA 2WK1A 1OGJA 3QNUA 2QD3A 2VOEA 3HYSA 3D3QA 3OEED 4N7RA 4FU0A 4D8WA 3NM4A 4GM4A 4C08A 5DYNA 2H54A 2IS2A 3PCTA 3HGTA 3LFHA 2ZKIA 5FPPA 1N2JA 4ZT7A 2EP5A 4D9GA 3TW8A 4AQYB 2BP7A 1V7QA 2OXEA 1QYXA 4WA7A 5DU2A 1IHXA 3L8ZA 1KPIA 1V3UA 1FSPA 3IJEB 1W88B 1U2GA 1ZOOA 2PKEA 5AJVB 4BNUA 2QWXA 4XXHA 3ZJTA 4I4IA 4XARA 4EG6A 3Q7QA 2A7XA 5J1TB 5K1ZA 4KFUA 2FQ1A 2NO1A 3SHWA 1AA6A 2V1UA 4CG2A 4MV4A 3FLMA 1SZCA 3MTBA 1MO6A 5FV4A 2PT6A 2IXFA 2IP1A 1QV9A 1B8PA 2JS7A 2W37A 2XE6A 3IYLW 3KJEA 3LZCA 4LY6A 3SFVA 1QAQA 2IYWA 3UAVA 4R2XA 3JW8A 4UNRA 3KU4A 3ENWA 2NLOA 3CO5A 5CH3A 4DMGA 4IWNA 5C4IA 3O4IA 4Y2YA 5KNDA 1NVBA 4CM7A 3OM8A 2P2YA 2FPIB 1R8QA 4XAQA 1SBTA 4MYUA 1SRRA 2QGNA 3JQFA 4JYBA 1K5GA 4TRRA 3MHTA 4Q1FA 4N41A 3S81A 2WP0A 1U0OC 3N0RA 1Z0AA 2Z2YA 3RS8A 4PCUA 3IP7A 3BE4A 4JBLA 5C8DA 5K8UA 1DRKA 1AQ6A 1C3OA 4LY3A 4OLJA 5CTAA 4YRGA 1KE1A 3P32A 4LRQA 3U5TA 1WXXA 2B7BA 1YIAA 2PV0A 3DZJA 3U6BA 2Q7XA 4LGCA 3E58A 1JU4A 3VA7A 3EZXA 6ADHA 3PFCA 2A3RA 1L7MA 4U7GA 1EQ2A 1NATA 2QD2A 3CKLA 3DFKA 2IOQA 3IVCA 3P20A 3FKSD 1M1YA 2ALJA 2AMJA 4KW7A 4DEXA 3BL6A 5THKA 3UO8B 1GVHA 2VZ8A 2GPJA 3DCNA 5F1OA 1FU8A 2GHQA 2VUIB 1S7CA 3MMXA 2EP7A 1KVUA 5C18A 2P90A 3GRYA 2FSUA 4YJHB 5KVAA 2XODA 4MRMB 4Y1FA 5KX5F 1UXIA 2C82A 2HA2A 4UOQA 2OQRA 4EG0A 4OREX 5LYJB 3RABA 5T4FA 3ZD9A 1CJCA 1P0PA 1T3HA 2K4MA 5CUQA 2C7QA 1ZP6A 1GITA 2MSCB 4GBJA 3CVOA 4DYVA 5BSKA 3GLIA 1AF7A 3G89A 5DCWA 2G36A 5DBHX 1FS5A 3E4CA 5BSFA 2F62A 2XMQA 3H99A 5CR9A 3WDSA 5BN4A 1B43A 4QPZA 3ROFA 4FW8A 5GVSA 2PZGA 3KS9A 1S2NA 3ZE2B 3IO5A 5KJ6A 3ZVNA 4HGPA 2XEXA 3F98A 5B64A 1T29A 4CEHA 3RIHA 1NW6A 1TNDA 2FN7A 2YL2A 5E8RA 3DV0B 1Z06A 1LWOA 1J0DA 1Q3KA 4J8PA 4BO0A 5KINB 4YRRA 2QTZA 1OC4A 1Y3CE 2PL1A 2H7CA 1TJ3A 1Z36A 1W2HA 1YDHA 2HFKA 3CJQA 1NQAO 2J3KA 5D85A 4A6XA 1VFNA 4R6XA 4WLVA 4X6UA 5T6BA 4X95A 1PYOA 2VR1A 1ZNZA 5EERA 5EZYB 3PNPA 3MMZA 2WMOB 4EJ2A 1B14A 5EJ5A 2Z09A 4ZJPA 3IP5A 3DYBA 3SHVA 2JFYA 3GFBA 2EKZA 3ZBPA 2PBRA 5ENDA 4E5PA 3U5ZB 4YEDA 1ZAKA 4DN6A 3MAJA 3ILVA 2J07A 4G0YA 1USIA 1YQ9A 3LPNA 3TLEA 4EUSA 4ZYLA 3ZE6A 1MRSA 2F1JA 4PZ0A 5E4JA 3FOZA 2BZGA 5T8KC 4EHIA 3T9EA 5D3MB 4KOEC 1I2MA 3IQFA 2VJCA 3STYA 1EFRD 1HE5A 3X1WA 4JLMA 5GZ3A 4ZZ3A 1DHRA 4HLUA 5AW8A 1SMKA 2QB5A 4JJEA 3L1IA 1LI5A 4FYXA 5DHFA 5E3IA 4DAOA 1VKRA 2DRIA 1DC6A 2VHVA 1JIXA 1RM0A 3REQA 4NBKA 1HG1A 3G8BA 3Q2OA 4L2IA 4WXHA 5HRUA 3AR2A 4G26A 2OGZA 2VSXA 2XDQA 6GPBA 1U2QA 1W59A 1W1IA 2VA9A 1OY1A 2V5VA 3NHBA 3OJLA 4H0FA 2SECE 1M6HA 4EY4A 1ZR2A 3P5BA 4L08A 1O03A 2JGLA 1JFRA 2QT0A 3KZ1E 1K3UB 2FEMA 3TLGB 4ZGBA 1ZQ1A 3EVFA 4JY7A 2GARA 1ZCJA 2VHQA 1H3EA 4KXVA 4KUGA 1G3IA 4XFKA 2HPVA 5D00A 3H83A 2O8BB 1PR1A 3WNBA 1QRRA 2VAWA 3Q88A 2AXPA 5EWJB 1XXHA 2PJDA 1Y7TA 4LIPD 2VPQA 4B6RA 1UBGA 4HB0A 3PHGA 4BO9A 5D7NA 4DCSA 3T7SA 4N3GA 1UKCA 3LKVA 3DLBA 1YZ3A 1QTRA 3RQSA 1N5LA 1SIOA 1ECBA 1YIDA 4KE9A 3VRHA 1R12A 2OY0A 4RMJA 5I9TA 1GA4A 3SSAA 3WL5A 4C7BA 2LKDA 3MMNA 3E35A 2P4EA 3HU3A 5IVKA 3LCCA 3ZJVA 1XMSA 1Z39A 4RKQA 3B8EA 1VMEA 5DHQA 2E49A 2O8CB 5KOJA 4L6IA 4QOEA 5DYIA 3TR6A 1XAHA 2AD5A 1TF5A 3PB3A 1QH8A 3VH4A 5BP7A 1W49A 1K75A 4YRDA 3T52A 1SXQA 4GOLD 3AHGA 3K0FA 2V7EA 4NOKA 3HDGA 1HYQA 3DAGA 1VE7A 3HY3A 4J1NA 5B55A 1IHDA 4V24A 2COKA 1SM4A 2WJHA 3LF1A 2I55A 2QT1A 1NJ5A 3A3PA 1GTRA 5KKCA 3DL4A 5F9MA 1Z5WA 2JFFA 1FJHA 4LXYA 3ZV5A 5EA2A 4KGXA 5DGTA 2DCUA 1E5TA 4ZOAA 4GWGA 3MJSA 2AA3A 3DD5A 4JZKA 2XA9A 3P9CA 3VPSA 4EECA 5IDXA 5JJBA 1ABBA 4F4JA 1NR5A 2OQIA 4W5RA 4ROTA 1X74A 1JECA 4F5ZA 5ES4B 3RR2A 2J7PA 3WV4A 4H15A 1IWBB 1P2VA 3UG7A 5CBPA 5FPHA 4L74A 4YNBA 3HSYA 4OP2A 1J0CA 3G7NA 4A8TA 1YC2A 3WL8A 1X1TA 5B30A 1QHGA 3E70C 4K9OA 4LWOA 3U09A 1QDLB 3DL7A 4HCJA 5AOBA 2HTFA 3RYHA 3TQIA 3AF5A 4LK2A 4NATA 3BMCB 3OIYA 5DK6A 4MR9A 4Z51A 1G4AE 3ADDA 821PA 1EK0A 3NOXA 2NYVA 2FSVA 4HEA6 3VU9B 4A6EA 4F46A 1PWZA 3GLIE 4ARSA 2BWJA 2RGGA 4P22A 5JMWA 4D3YA 1THMA 1LI7A 4GPBA 1PL7A 5KZMB 3FIJA 3A04A 3L07A 1QQAA 5JALA 5FUWA 4D81A 3LWZA 3IAS1 5H8WA 5CDUA 1YAHA 4BLVA 4H59A 1HDEA 1SCUA 1EX6A 1QOQB 5JCOA 4EPTA 2EZUA 1WUYA 3IQWA 4BO5A 4Z53A 2PUVA 4KG7A 3HB5X 3MM4A 1DAFA 2F3RA 1LGYA 1LW7A 2RCYA 2RBKA 2CF5A 3HZOA 3T3IA 4CXMA 1OV4A 2H0QA 2A94A 2BFCB 4O8CA 1NSFA 4NZZA 3EWAA 3O95A 3Q8LA 4PZEA 1J9GA 3NEPX 4KC0A 1ECJA 1GPYA 4W5HA 1LY1A 4ZD6A 1RHQA 3AILA 4A03A 2IHVA 4CU5A 1PX2A 1N2HA 3QWHA 2P9QA 3DBLA 3MRXA 4HC4A 5D5PA 4C4OA 3ZWNA 1R00A 2GVZC 4HNAA 3VKVA 3AR3A 4R1TA 4MYTA 2HX1A 4XSGA 3W8DA 3L4JA 2ZRMA 5TQJA 1YDGA 1P2UA 1AKWA 4GXQA 4QXPA 1UJNA 1WU8A 4OUKX 4RC9A 4S1WA 4JWKA 1SCQA 2XNDD 1RIFA 4KQGA 4CQMB 1KAEA 3O4JA 4F4FA 4XX0B 3Q7SA 4BGEA 3DAPA 5IULC 2Q4EA 3G23A 2QN7A 4CDNA 2W9XA 4D9NA 2WVHA 1EFHA 1R3UA 5EWLB 4KHPB 1GPLA 1Y9AA 5LA6A 2KI5A 2JANA 4D82A 1ESEA 1K2VN 1C4KA 3AO0B 4D9KA 2INGX 3BQ9A 3GVIA 3KQYA 3TOSA 4BJ5A 2GEUA 3VU0A 3KB1A 1FP2A 4FFMA 1PE0A 4YHHB 2WWHA 1NLUA 2FPMA 2IDJA 5SY9A 1Y5NA 1KFJB 4CV0A 1ZWLA 2EJBA 2JVKA 2IYLD 4NI5A 2M1XA 3ZY2A 5K9ZA 4ACAA 1EZ1A 1L3BA 1EFPA 1NW7A 3AKDA 3H17A 4FE3A 1BO6A 2O48X 3S7ZA 4EAAA 2IHJA 4CLHA 4H7HA 1DSSG 5KTPA 3QE3A 4C03A 1M2HA 3V4SA 4KFCA 1SWVA 1MT0A 4M6WA 2PZ8A 3QJYA 1ECFA 3C4QA 3HXPA 2C2XA 4C1BA 3RAGA 1FSFA 1Q7TA 5FWYA 2X8JA 2BFPA 3PTLA 2XUDA 4BGDA 4OAQA 1HKUA 1Z5GA 3ZWKA 5L45A 1G2PA 3DGFC 3CSSA 3S99A 3BQMB 5E9AA 4AURA 1WCIA 3N05A 2QAJA 3NFRA 3N7TA 1JG4A 1XWIA 3C7KA 5DHPA 5SY6A 4NIMA 1DKUA 4CQNA 3FTNA 1P6QA 4WNIA 1W6UA 1HDXA 4G37A 1S8AA 3B6MA 4DLKA 3KX2A 2JCBA 1UODA 5GADl 2XWQA 3ABIA 2IELA 3GU3A 1G7CA 1PU2A 2P5TB 3EDOA 4LAFA 4AULA 1TTHA 4LXHA 1WCV1 3AM3A 2GI4A 1G5PA 3GARA 1VYHA 5HS6A 2G5GX 3NEAA 2IU6A 2C9DA 1N8KA 3DMTC 3IPAA 4UBMA 5CDHA 3PQ7A 3TEFA 2AR9A 5EXXA 1SU4A 1W85A 5AK0A 1GGHA 4BX8A 2QW0X 4JKYA 3KTAB 3EG9B 1CQPA 3PFHA 4E2FA 1Z73A 5JAMA 4FFWA 5JQGF 4JXXA 2NO5A 2E6KA 2BEWA 3NHPA 4Q7MB 5LOVF 2RGDA 2V7QD 3JXEA 1KZYC 4RD6A 2O8EB 3IP6A 3P0RA 1KYTA 1ZM2A 3PUWA 3UAXA 4FM9A 5IRCD 3CLTD 3KJXA 2WSLA 7YASA 2O0MA 5FFNA 4EF6A 2RHBA 1X1QA 4C06A 4F4CA 2O20A 3ICOA 4PZ9A 1GAJA 4RS3A 2QTRA 5HKKD 2HA7A 3ZHTA 3UWOA 1SIBE 1JLLB 4L5JA 2Y0BA 1W93A 3SIRA 2A1IA 3KUUA 4LJ8A 4HWRA 1VHJA 3LHIA 1U9JA 1RZ3A 1N5DA 2QA5A 1N1EA 3Q5DA 5IDYA 4P80A 4FSHA 4HSGA 4L4RA 3PHIA 3S5JA 4BGUA 1Q50A 4MZDA 4C5AA 2GX6A 3J80A 1A2QA 1JT9A 4AO6A 1YOVA 2IITA 1W5BA 5AHWA 4CN8A 3K0CC 4TZKA 2R3SA 2HJRA 2O5VA 3W5SA 2WR8A 7ABPA 3FJYA 3QLVC 1NBMA 2AJBA 4JP8A 3D3EA 2XQJA 1EUDA 5D3KA 3FZYA 1KBOA 4EW3A 4OJTA 2REXB 3O31A 2VN8A 3MT7A 3R20A 2OV8A 3T41A 3O8RA 1I6MA 3WGGA 1FUKA 5FWXA 3W3ZB 2E7ZA 2H0RA 3MAAC 3I2JA 4NK5A 1BGXT 3H2HA 1J99A 1ZUNA 3OESA 4DWWA 3DO6A 1GQSA 2R0QC 2CC2A 4RJIA 2O1EA 4LA4A 3K5PA 3I6MA 3LT5A 2X9VA 5C46F 1ADFA 1M3SA 1J24A 2GXSA 1FUIA 1IPHA 3P97A 5DN6A 1U2ZA 2ANCA 1RR6A 3DFZA 4BYGA 4B4OA 2VHUA 2LE0A 4F71A 4LVNA 4ZT3A 4J0FA 4DL9A 3KJNA 3MZ0A 2K7FA 4EHKA 1DTWB 4AUEA 1ICIA 4BVEA 4YUYA 1VRWA 4IJUA 4M0EA 1MGOA 3LLVA 3CWZA 4FHCA 4NJMB 4V0RA 2A5FA 4A2PA 4RV4A 3FB4A 3WP1B 4ZAWA 3FCCA 3D8RA 4ERNA 4FWIB 5HMMA 1SVUA 1H42A 3ENKA 3FW1A 4R1LA 1U3VA 1O3YA 3V33A 5U1PA 4N47A 1NM5A 1C2YA 1S1MA 5AJXA 1R6BX 3A9RA 3PI6A 3PV0A 3N0TA 5AVQA 5KWVA 4J49A 1WY5A 1L5ZA 4JSYA 3B1ZA 4INPA 3WGVA 2VXYA 4CDMA 1I2AA 4U7JA 1RWOA 1EAYA 2CHUA 1NDUA 1NX6A 1VSTA 1P0IA 1F51E 2OCKA 2ZIAA 3QFHA 4MMYB 1B1AA 4LWZA 4EJSA 2C7BA 1E79D 3EFEA 3G8YA 5DNEA 4E5KA 3DLHA 3AVYA 2XGMA 1XWWA 3PXAA 2B78A 5LKAA 4QFCA 5B53A 1QQ7A 2W5UA 2YJZA 1H8HA 3CIFA 2BN4A 4C4PA 3OTOB 3I1FA 3KU1A 1J25A 1DCKA 1QO0D 3EFHA 1FTGA 1NTOA 2WB2A 2FEKA 4L4YA 1HYHA 2FZVA 1CUUA 4UTOA 2C5AA 2WU8A 2A5YB 3IOCA 4D92A 5FWNA 2V6JA 1CD5A 4TRNA 1IZZA 3NNDA 1XZHA 2IZ1A 5GPBA 1QVAA 2I66A 3RU7A 3U0VA 1ZL0A 2X9LA 3UC5A 2B3DA 1OXTA 2X86A 1E6UA 3A3NA 2K5UA 3D6UA 3I2GA 1P5ZB 4R0NA 4HDSA 1G21B 3CUSA 4KHZA 1PWEA 5JD5A 3NDIA 5A4FS 5HS4A 2FJ0A 2IEYA 2P69A 1GKLA 2QIOA 3GCWA 3ODGA 4UEQA 1MC5A 2CJFA 2YH2A 5FA5A 3T3DA 5A0VA 1QHEA 3KAPA 4RE6A 2AG8A 5U4QA 4EW1A 1K0FA 2H9YA 4Z7QB 1G5FA 1GSOA 4GOMD 4QDKA 3AF0A 2OZLA 4BQNA 1WETA 3BMQA 3G2NA 3WWEA 2ENWA 2ONZA 3DR3A 5E1DA 5IVPA 2IU4A 2Y4NA 3KVNA 5EIEA 2BGMA 5EFZA 3A1UA 4QIHA 2AG6A 5HFNA 4F4HA 1UT5A 2QBYB 4MK4A 1SURA 1U63A 2NG1A 2QSZA 1MR3F 3MBIA 3OT5A 4Q01A 5HIMA 4YJDA 1MAUA 2GK3A 3W5JA 3DFUA 1PF7E 2Q8NA 2UKDA 2X9QA 3CUUA 2AHOA 4LJLA 3M4ZA 4YCSA 4KR7A 5BQXA 1Z82A 4PNEA 1K8ZB 1NULA 2AVDA 5JIBA 1GV0A 3B6IA 5IVDA 2D5CA 4BLOA 1CJMA 3NVKI 3GT4A 4R69A 3PXBA 5CXSA 3UV7A 4BU1A 4ZCMA 4YCMA 5GTDA 3RADC 3D4LA 2WF9A 1SQSA 1TMKA 1Z35A 2J4CA 1D3AA 2OBNA 1W46A 3FBTA 2AKAB 3O1JC 3DMHA 2H4YA 1LPSA 3Q3HA 4NZOA 2JB9A 1THGA 1EP3B 2G8NA 3SNHA 4MLDA 1E5QA 4GI3A 3TDNA 3KKLA 1IHPA 3N87A 4Q93A 3AJEA 3I72A 3LK6A 3I4CA 3A4YA 4K3VA 5AHRA 4BNGA 1JZSA 1P17A 2JFUA 2G77B 3BF8A 3F6PA 4NG4A 3C8MA 1F4LA 1Z4NA 3L8YA 4KJXA 4CQMD 4AW9A 2FZCA 4EPYA 5KVVA 1Q6ZA 4R2IA 3VR4H 4I6JA 1BCRB 3ELDA 3FTCA 1CR4A 2V45A 4KMRA 2NPOA 2CV1A 1PZNA 1RBYA 2PZEA 4HYQA 4IX9A 4L72A 1I2ZA 8GPBA 2Q3LA 2PT9A 1XD8A 2V0CA 2VS1A 3SZRA 3QBDA 4TL6A 3GEBA 4GW3A 3ZPXA 3UJDA 5IX8A 2R6AA 2BC9A 4KO3S 1WD7A 3ZWDA 2CVPA 3KQSA 3S2IA 1DPGA 1HH4A 3FVQA 1IVNA 1RYDA 1MIOB 3FFXA 3QNMA 1JWBB 5E7IA 4QULA 3ZHZA 2WQ7A 1CCWA 2XE7A 1K8QA 4GYKA 2WJ3A 1OXMA 1YI0A 2I7CA 2Y0PA 3W05A 2C31A 3U7GA 2HPAA 3HKDB 4NG5A 4L5YA 1O94D 2OXFA 3BIWA 4MUAA 1Z4MA 3IBGA 5AW3A 2V8OA 1C3XA 2A2ZA 2O0LA 1CUFA 1F0NA 3C39A 4YI5A 4ETMA 3RO7A 1MO2A 1VPDA 2ZSDA 4WKNA 3FFBA 2CL5A 2DC1A 3KEGA 1XMIA 5DGHA 4LJ7A 4Q4JA 2F1RA 4A2CA 5EZSA 2W6MA 4QTTB 2JHAA 1YHYA 1NU8A 2OR3A 4NABA 3SFZA 1P29A 1W96A 4Q24A 4E11A 3VU3A 3FNGA 4RNDB 1LJ8A 3VR6A 1SXHA 2QX9A 4I14A 1OJ7A 4PZLA 4J0GA 1BXGB 4TKUB 2V3WA 3VTAA 3AFIA 1EVJA 3RV3A 2B0CA 2LIPA 1T8PA 1SXIA 4MGZR 5K01A 3ZHXA 4LQ4A 4C6RA 3HBMA 4M1OA 2ZJOA 1WBBA 4GXNA 1NN5A 3UJ8A 1BU8A 1WF3A 5HIKA 4PLYA 1U90A 1QCCA 2P27A 2C88A 2BKUA 2OENG 3UMRA 1FFDA 1ADGA 1EWRA 5BOSB 1E7WA 3BWDD 3T5PA 5KNDH 1U9YA 3OPYA 2UVQA 1Z9BA 4MYSA 4A5OA 2POQX 5A7FA 5C7YA 1R4MB 1PT6A 1GRNA 4RTNA 4GVPA 3VO2A 1J0XO 3DT9A 3TCNA 4DNQA 1GDTA 3F3MA 5M3BA 3I5YA 4EKEA 2PGIA 3PVZA 1PK7A 4KAJA 3EGCA 5JE8A 3RJ9A 4DCTA 4ZGGA 4JCCA 4HAIA 2W2QA 4BV9A 4IRXA 1P2SA 2EVWX 3KZKA 4IKEA 1AHPA 1E2BA 2JLXA 4IV0A 4XIGS 2WILA 3IT1A 3S6JA 4LJ9A 2DCMA 2D4HA 4GPD1 4EHJA 1GPKA 3CLVA 1RHUA 2GPNA 3MRVA 1O95D 4KRXA 4BO7A 4RLFA 3ILHA 2WHPB 1RJEA 1PG0A 1IN5A 4FKMA 4QHTA 2BEVA 3L0DA 1TGVA 4ZDKA 1P9LA 2CSXA 4RQAA 1L5QA 3ENNA 1M54A 5T4BA 3AUKA 1LS1A 3RJ5A 3GFFA 3AIIA 2AW5A 3WYFA 4DG9A 2JFXA 1G7RA 3G3EA 1IOVA 3OP1A 1DI0A 1VDMA 2B5VA 5G0TA 3CSUA 3P4YA 1TJYA 1Z63A 4R2HA 1OXUA 3ODPA 5BNWA 2A58A 1UZLA 4ZEOA 4MW9A 1PO7A 2P2LA 5DNDA 1FXWA 5FBQB 3IDSA 4Y6OA 1QF7A 2R7MA 1UH5A 2IJGX 3IURA 4H9GA 3ZYZA 2V96A 1EAMA 3GRRA 4BU0A 2JIBA 3I5XA 1E66A 1K8XB 2GZSA 2ZYGA 1O0BA 1A5TA 2HO5A 2IHBA 4LGVA 5EJ8A 3OQ1A 1H9CA 4QUEA 2JVIA 2O3SA 5DB4A 4PC7A 4JNKA 2PXCA 4DMHA 4G0NA 2Q2VA 2VPYA 4R8SA 2UUCB 3MCUA 3RRBA 4R1QA 2X0FA 3X2FA 4RCZA 4LJYA 3OCUA 2VP9A 3GXOA 2RHGB 3IE0A 4CKWA 3TJZA 5L40A 1ZVMA 1MU0A 5DM4A 1N2OA 1TB4A 4I50A 3ZJ4A 4CL0A 2IPLA 3TQOA 3T94A 3CLSC 1E6EA 1KSFX 1UBCA 1WBJB 3FYDA 1ISMA 3HXLA 5AKXA 3WGHA 1U1EA 1Z8DA 2RHJA 2X4IA 3DZGA 2VTDA 2YVQA 1M7HA 3NBFA 4I4CA 4NNJA 3VM6A 2HL6A 1E6LA 4E94A 1YHZA 1SO8A 3PPIA 4PPGA 3QPVA 1RYMA 1DIOB 1OBCA 2A86A 1LVHA 4TTSA 4F6RA 1NPTO 2H9IA 4UHHA 3ZDYB 5DLPA 3A2KA 1K4MA 3C8HA 3DHWC 5CA1A 3SYLA 1RKUA 2YRWA 2ZE6A 5AW5A 4XM0A 5C7LO 4LI3X 1UWLA 1VIDA 3E9EA 2HBQA 1I1HA 4HUQB 3K6SB 1GPAA 2P7IA 3CB2A 3GRKA 3OFVA 4QBIA 1NR7A 2RAUA 5KQSA 3NRJA 3TN7A 1L8XA 1LPPA 4RTJA 1KQ3A 3AUXA 1UINA 1PCXA 1XAGA 3T5DA 3LBYA 1IHUA 2ISSD 3DE7X 1XNGA 3A3OA 1COWA 4QXRA 3SF8A 1AZSC 2B6HA 4QRDA 4ENPA 3GCXA 2OILA 3CJTA 3ZHCA 3KSAC 4R54A 2RHOA 3NC1C 2W2NA 3H11B 2YHSA 3KWLA 2L0XA 5AI5A 4WFQA 5DMXA 2GO1A 2G25A 4OI1A 4B4UA 3ZD7A 2G09A 4CFZA 3RVLA 4I9GA 1M2NA 4GOJA 2QLFA 3ANLA 1E96A 4PQRA 2OLEA 3H42B 3VO9A 1YR1A 1BJRE 4R7GA 5D86A 4C7KA 1Z4IA 2H7YA 1FP1D 4D46A 1XJ0A 1G8MA 2QR3A 2YDYA 1L7BA 1X9IA 1CQIA 3H1AA 1IULA 3HBFA 4ICIA 2I4TA 1GA1A 2WKSA 3G9TA 1A8HA 1DIAA 2O2YA 4ISBA 4XZ3A 4RK1A 4CM1A 2VSQA 1BDJA 4A9AA 1F17A 3D6VA 1BTOA 3DCIA 3DDNA 3M4YA 1CFZA 4H3SA 1JHYA 4W82A 4J4TA 3TK1A 5I7OA 4OAOA 3LYHA 1UK6A 3L5KA 2AJLI 3IDZA 1RAAA 1E4YA 5LQSA 3VC3A 4ZHQA 4PRLA 5MF6A 4L6AA 2ORYA 2PKQO 2I6TA 1N57A 2GTPA 2RK3A 3G9QA 1FDOA 4OQLA 1AKEA 1K68A 1N9GA 4V3CA 3LO8A 1KSGA 1D4AA 1PLKA 1SXGA 3R3XA 1EGHA 2I34A 2ZJZA 3CGWA 3EULA 2OMEA 3PUJA 4QQ8A 4TTVA 4UJ5A 3EVCA 1EHIA 4YMHA 3PC7A 5HSGA 1CZUA 5J43A 1XV5A 1ZD9A 3CNNA 1TPYA 4YRJA 2ESRA 2G63A 4FMBB 4ALKA 1BWSA 3KR1A 1NUTA 1C3EA 1PL8A 1UJ2A 2HYDA 4JHXA 5EZ6B 3RUDA 1CJBA 2WIDA 3D1JA 1Z2NX 3KD2A 2NO4A 5CLHA 3W4JA 3WZ2A 3ZX4A 4A36A 3FSRA 3WXBA 3CEMA 2Q1SA 4MQEB 5AVSA 3UV6A 3CURA 3RVNA 1QGUB 4UHKA 4BNMA 1E1CA 1WO8A 2VAXA 3CLTC 4DIMA 3FPKA 3QEMA 1E2LA 4F9TA 3DLTA 2GAOA 3AKEA 2YWGA 2O2HA 3PQCA 4QT0A 5EHGA 4HUTA 1WPGA 3L3BA 4EZBA 2O05A 5CJPA 1Z88A 1OD6A 4HAZA 1Q0RA 2FWJA 4BNZA 1Q0TA 2TMYA 1RBZA 4IIEA 2NMVA 1QSGA 2EJVA 1Z29A 4EUEA 2DTXA 2QRNA 3ASYA 3NJ4A 4NNOA 1MX1A 3SC2A 4II7A 2VHCA 2J0UB 2Z9BA 2H11A 4MI3A 2FRDC 2JCGA 3A6FA 5ADUS 1W44A 5B3LA 2NU9A 1YK1A 2NZVG 3PEUA 4IIJB 1EUZA 4M7RA 5HDQA 3W34A 1RLUA 1Z5UA 1J2EA 1ECLA 4UAGA 3K2EA 4RKRA 1ISJA 2PLRA 3FVVA 4L85A 5JAOA 4HEA1 3QWBA 1GZUA 1CUWA 1G41A 1WJGA 1RXUA 4UNSA 5HX7A 5KYYA 2VH1A 3MW8A 2H3EA 5EIAA 1NC3A 3T5MA 4BMSA 4YT5A 4G5OA 3R7WA 1XRMA 1C9DB 2W0SA 4TLEA 1EQUA 1IXKA 3IEIA 2FK8A 3KP1A 5P21A 3SD7A 4Q21A 3K35A 2PMWB 2ZBPA 2H2AA 4DUGA 3PPYA 1Z6QA 2HZ7A 4KE6A 3I37X 4MLZA 4ENVA 5JV5A 1UBFA 2HLHA 4GX5A 1YDEA 3RPEA 5JJIA 2F8MA 1VP9A 1PSDA 4PLWA 3E22B 1NUSA 3DT6A 4RIGA 1R8SA 5FBHA 1I2BA 1U3WA 3BH0A 1N6HA 3BGDA 1JE0A 1S2IA 4RA6A 1GG8A 3ZQ4A 5KTRA 2I9PA 4PSCA 1CERA 2KJQA 4ZQGA 3SHFA 3ZIAD 4ZEVA 5I7HA 4KVAA 4I55F 3MSCA 2IL1A 2NU7B 2AX4A 1XPUA 3KZMA 3DE0X 3QEJA 4GX0A 2QI9C 3DCYA 4HB4A 1AJEA 4MVJP 3V1YA 2V3CC 1WA5A 4G24A 3NIDB 4W5QA 5CX4A 3HPRA 5J2UA 3I9OA 2PX8A 3IA2A 2ZDGA 4N6OA 2FWIA 3IQDB 1E4EB 1ODKA 5A4MS 1E0AA 1SUDA 4R1UA 3FAKA 2ZEJA 3EXIB 2D1FA 4M46A 1RHKA 5D6NA 2BGLA 3TQQA 3W1VA 2IODA 2VEDA 4HNGA 4RL6A 3NBXX 2EBFX 2PYIA 4P36A 1CS0A 3PKIA 2VNSA 3EIEA 2VJMB 4OXNA 4CDGA 2PL5A 4QFBA 4PC3A 3W6ZA 4HGNA 1ZR4A 2OHOA 4YDRA 2CV2A 1GCIA 1F6DA 1OI3A 2C4HA 3RUIA 3H5NA 1G6Q1 3QGMA 1SOMA 2RGBA 2W6ZA 2WJIA 3ND7A 4MS1A 5ALWA 2O2DA 5L3ZA 2L69A 1H6DA 2W6NA 5DCLA 3K72B 1TD9A 3P0JA 3T1OA 3W2FA 4O3FA 1VB5A 2DLNA 3EGXA 4ND5A 4ZQIA 1UEIA 3MILA 3SIPA 1QPBA 1CV2A