3QZUA

Crystal structure of bacillus subtilis lipase a 7-fold mutant; the outcome of directed evolution towards thermostability
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
180
structure length
180
Chain Sequence
b'EHNPVVMVHGIGGASFNFAGIKSYLVSQGWSQNDLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGDALPGTDPNQKILYTSIYSSADDIVMNCLSRLDGARNVQIHGVGHMGLLYSSQVNSLIKEGLNGGGQNTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase estA
molecule tags Hydrolase
source organism Bacillus subtilis subsp. subtilis
publication title Biophysical characterization of mutants of Bacillus subtilis lipase evolved for thermostability: Factors contributing to increased activity retention.
pubmed doi rcsb
total genus 68
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2011-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qzuA00
2PSFA 1THGA 4YPVA 1CUVA 2HA5A 2HIHA 3O9VA 2YH2A 4Y2VA 5AI5A 4M0EA 5AK5A 4WJLA 4RE5A 3EQ8A 4OCZA 5SYMA 3KSRA 3RKSA 4GBGA 4X85A 5AK4A 5DNWA 3AIMA 4AMYA 2QM0A 5ALKA 4B82A 4Q3KA 3TJMA 1ZI9A 2QOEA 5FP0A 2XMRA 1IVYA 3E3AA 4H77A 3GA7A 5JZ9A 4GHWA 4LIPD 2ROQA 2PL5A 1XROA 5I7UA 1IUPA 1E8MA 2XUKA 2QS9A 4AZ3A 2I3ZA 5JYCA 5HCUA 4J0IA 1HQDA 4K6KA 4C4YA 4RPCA 1OCEA 3R3ZA 3A70A 1WHSA 4EUSA 1UKBA 2XUHA 4UPDA 2WU3A 3G0IA 3H17A 3DOIA 2V98A 5IVDA 5ALSA 3ESAA 4GDMA 2UZ0A 2VAXA 5ALHA 3G0CA 1CUGA 1SFRA 4G4IA 2WLSA 4OYYA 3WL7A 4B85A 3DQZA 2GBCA 1FJ2A 2WHPA 2QT9A 2QJRA 3GELA 5DNVA 1YAJA 2ECFA 4BAZA 2OCLA 1CQWA 4A5SA 5T4BA 1JI3A 3WKCA 4B9AA 3DS8A 4Y2SA 3ESBA 5FRDA 3ANSA 4K6HA 5D7BA 3WKBA 3STXA 1PV1A 2QZPA 4HRXA 3I2JA 1CUHA 4U2GA 1CVLA 2J4FA 4UBLA 3H2GA 5BOVA 4HXGA 3KXPA 5FV4A 1FSSA 5C7YA 1FFCA 3I2KA 3EQ9A 4AO7A 4EY5A 4KYVA 4FFVA 1UXOA 5FDFA 1W1IA 3DDUA 5K5EA 1QIFA 2RAUA 2BUBA 2Z3ZA 3BJMA 4BP8A 4DIUA 4WFKA 2VATA 4JEIA 1QFMA 3H0CA 1EDDA 1MT3A 1AKNA 4FBLA 3PFCA 2OXEA 3H1AA 1TCBA 5ALXA 1XRPA 3QPAA 1O6GA 2G5PA 2PPLA 2R11A 2OPHA 3ZV7A 3IB3A 4CCYB 1CUSA 5FLKA 2XUOA 3KDAA 1LPMA 3LCRA 4XVCA 5EHZA 4Y2XA 4X94A 2VT7A 2PSHA 4KAAA 1E89A 3H1BA 1ZD2P 5CT8A 2V97A 1W4LA 2GYUA 3WK9A 2XE4A 2GBFA 2X76A 3NOXA 5DYWA 3QMWA 4X97A 4YK7A 5KWJA 4X92A 4BTVA 5DTIA 3L1HA 2QUBA 2HA3A 1JKMA 2PSEA 2ORYA 3BDVA 5ALPA 5A2GA 5JAUA 3PICA 4Y2YA 5ALJA 3FVTA 1CQZA 3G9ZA 3UUFA 1C4XA 2VEOA 1A8QA 2B20A 4F60A 2CKMA 5AK6A 1P0MA 3DL7A 2ZYHA 4J0DA 5JALA 1NU8A 2BJHA 1KEZA 2H7CA 2WIFA 4J0HA 5CT6A 1LZKA 4N5HX 2FUKA 4B83A 1Q84A 4QWWA 1OILA 2XT0A 2BUCA 5CTAA 1ZOIA 4K6GA 2QKYA 1ETHA 1YB6A 2VA9A 1TKRA 2XDWA 4I3FA 2AJCA 5ALYA 4UFPA 1H22A 4M0MA 2VAVA 1JMYA 5HQ3B 3E0XA 3JW8A 2WFLB 3OPMA 1H2YA 3LP5A 2FX5A 3C45A 3WJ2A 1Q0ZA 1R3DA 4MYDA 2XI4A 2JEYA 1U4NA 1ZJ4A 5DJ5A 2HM7A 3H19A 2XUPA 3WWEA 2OGZA 1T2NA 1TIBA 4B0PA 5AO9A 3VVLA 4LYDA 1J06A 4FLEA 4KE9A 4XWGA 1U8EA 1G66A 1WM1A 4F5ZA 5AKHA 1LPPA 2HRRA 3O95A 1WCYA 1UK9A 5CW2A 4DTCA 1H2ZA 2CMFA 4U2FA 4W1QA 1EDEA 3R3WA 4JYPA 1QO7A 4CFSA 1GPKA 1UKAA 4B84A 3PF8A 1DQYA 4PSCA 3UMJA 4OYLA 3H2HA 1EX9A 4KRXA 3H2IA 3I6YA 1XKTA 2H7XA 4X00A 1FFDA 2IIVA 4UBIA 3WKDA 3BJRA 1R1DA 3F98A 3W2TA 4K5QA 4WCVA 4DNQA 1EXWA 2FJ0A 4KACA 3HRHA 1E8NA 2CJPA 2HRQA 3WIBA 4AN1A 3P2MA 2I3DA 3DL4A 1AUOA 4E11A 1TCAA 4NZZA 4BE4A 1VA5A 2PKYX 2J3QA 4BVLA 2G5TA 4DNPA 3WYNA 2D0DA 4H7IA 2WTMA 2Z3WA 4KR0A 3Q0TA 4X71A 4W1PA 3ZLVA 3STUA 1ACLA 4H18A 4CG3A 1BROA 3H04A 5EI5A 3HJUA 2PU5A 3BIWA 2C4HA 5LKAA 1LPBB 1MO2A 2OCKA 1I6WA 3AINA 2WILA 4BATA 3WLAA 1DU4A 5A71A 4CCYA 3BXPA 4UHEA 1JJFA 4UHDA 1MU0A 2BGRA 3STWA 3DYVA 4FMPA 3DD5A 3NGMA 3WK4A 3KOOA 3WKEA 2WM2A 4MWSA 4B81A 1RP1A 2WIDA 4IHAA 3WQHA 5CH3A 3VISA 3B12A 1JU3A 4AN0A 4P93A 4FNMA 1YB7A 1AURA 1Y7IA 2BAGA 1WB6A 2V96A 1QE3A 3DOHA 5FXMA 3D59A 5C8ZA 5ALEA 4QLAA 3YASA 1MX1A 4U2BA 4Z49A 2PSJA 3WKAA 2WQZA 3N0TA 2JGJA 5AKIA 5HKAA 5BWBA 5C8XA 4RNCA 2AJ8A 1DTEA 1EK1A 4FFWA 3OTQA 3KWFA 5HF5A 5K3AA 1ZGCA 1ISPA 3R3YA 5C8VA 5KBYA 3PE6A 1XZIA 3QITA 1LGYA 2XUFA 3G9XA 3QPCA 1XQVA 4C88A 4MJ3A 4AX4A 5IKXA 4Q82A 4DSAA 2JIDA 2GZSA 2ZYSA 3DKKA 2GZRA 4C4ZA 1P0QA 2C0QA 5EGNA 4BAUA 3PI6A 3O0DA 4FHZA 1ZICA 3R0VA 2XMZA 3C6BA 2XMQA 4EBBA 4MEAA 4ROTA 1VJ5A 5JAOA 2OG1A 2H9YA 4YX9A 1E66A 2CEKA 5ALQA 2WIGA 1B41A 4DNOA 1CR6A 1XZLA 1PFQA 1L7RA 3M83A 1VZ3A 3L1JA 2ACKA 4F21A 3AUKA 2Z8ZA 1N1MA 4E46A 3FNBA 1AZWA 2Y6UA 1MAAA 2JBWA 3STYA 1CUDA 1XLVA 5LZ8A 5ISMA 3C43A 3VKFA 3GUUA 1L7QA 3CXUA 2O7RA 1TQHA 1E3QA 1LBTA 4GW3A 1J1IA 5JARA 4ITVA 4MXDA 1QIEA 1TAHA 4UBJA 5HK9A 1G42A 2BGNA 5LP1A 5A7GA 3V48A 3G7NA 4JNCA 3FBWA 2WUGA 4X6UA 1F0PA 3BF8A 4PQEA 4FKBA 2O2IA 4GXNA 1CUZA 3ZPXA 3WYDA 5CT4A 3G9TA 2XUGA 1XZMA 1YS2X 4N8SA 4O08A 5AM5A 3I2HA 3LS2A 2VJBA 3WK8A 2OGTA 4QWMA 2W6CX 2HL6A 4G9GA 5AM4A 4GI1A 3STVA 4EZIA 2IX9A 3DEAA 1VA4A 1CIJA 3K6KA 4FWBA 5DYYA 2PVSA 4FTWA 2JGKA 4CG2A 3G0GA 3BE8A 5AM3A 4K2AA 5DWDA 1CV2A 3R3XA 5T4EA 2P8SA 4GLBA 1Z68A 1H23A 4CIAA 3ESCA 2XMBA 3F8SA 4UHBA 3A2LA 1P0IA 4RE6A 3DKRA 3VJMA 4U2DA 4Q05A 2DFPA 2PM8A 3E1GA 1CEXA 1XLWA 5HKBA 1HKHA 1K63A 2BCEA 5K3EA 5JD6A 4AO8A 1JFRA 1EDBA 1IMJA 4L9AA 3WL5A 2V9ZA 4LHEA 3WL6A 1U2EA 1EA5A 1PJAA 5A62A 2HADA 5AM2A 4X95A 3TEJA 3DJYA 2CZQA 4QDUA 5DYTA 3WA6A 1CUCA 1WB5A 2C0PA 2RHWA 1Y37A 3ICVA 2C5GA 2BFNA 5CT5A 2Z8XA 1TRHA 5ALNA 2OAGA 3HLKA 2IITA 1EINA 3F96A 4QNNA 4N5IX 1CUUA 4IO0A 1F8UA 1SC9A 5CMLA 4MWTA 2Y2UA 4WY8A 2RONA 5K3BA 4ARBA 1QIIA 3R40A 2Y2VA 1NX9A 4X6YA 1EVEA 2DHCA 4H7DA 5LZ7A 4B6GA 5ALTA 5ALWA 1USWA 5JD4A 4HRYA 3WMRA 3AZOA 5D3ZA 3AIKA 1CUWA 3IUJA 2ZJ7A 4ZXFA 2RHTA 2HA2A 2YYSA 5FOQA 3HZOA 3IA2A 1MNAA 3NWOA 1UFOA 2VJAA 3HYSA 2GBIA 2WU4A 3T4UA 3D2BA 5JAHA 4EB0A 4DNFA 5AKXA 4ZREA 4PSDA 1UOOA 2DHEA 3WZMA 1EI9A 1EK2A 3GBSA 3AIOA 3HC7A 4NS4A 3R3VA 4WFIA 4N8DA 3WA7A 4EY7A 1ODCA 1CUIA 4CI9A 1XRRA 2VT6A 2WG1A 4FOLA 3S8YA 4QDTA 4D9JA 2PU7A 1XZEA 5JASA 3DNMA 3F97A 1QIJA 4AO6A 1CLEA 5LIPA 1DT3A 1YSCA 2GYWA 4PNZA 2OGSA 4FLMA 2DQZA 1YA4A 4L3WA 3RM3A 4Y2TA 1SOMA 4X90A 5AP9A 1ORVA 2WFZA 4Y2UA 5T4FA 1W75A 3GFFA 1S8OA 4H0CA 5DTJA 3BWXA 5AKYA 5ALFA 3O9MA 4E15A 3FLEA 1XZDA 5CH5A 2X8BA 5IVHA 1A8UA 3KWJA 5HQ3A 5A7FA 4DLNA 1HDEA 1GQSA 2H1IA 5JANA 5AOBA 4H7EA 4FNGA 4QA9A 4Q3OA 4AQDA 3I1YA 4Q34A 1UKCA 2BKLA 5C81A 1XZCA 3FYUB 1UWCA 3QMVA 3W05A 4PF1A 2WJ3A 4PW0A 7YASA 3AZPA 3C8HA 4BYMA 4U2EA 3V1LA 3H18A 1DT5A 3AFIA 2HA7A 4C89A 5K3FA 4FBMA 4LXGA 4WDQA 3WK5A 4UBOA 4S0XA 2ZSIA 5HF9A 1QIHA 2HU7A 2ZSHA 2WFMA 2WIJA 1J2EA 3C5WP 3IBTA 3CN7A 5LYYA 4DM7A 3CCCA 3IVMA 3ED1A 3HSSA 5HF6A 1W52X 3G0BA 4OSEA 3ZI7A 3BIXA 2K2QB 5E2IA 2JF0A 5CBKA 2GBGA 3R3UA 4XX1A 4Y9SA 2WKWA 4NVRA 3I6MA 1XQWA 3WZLA 3N2ZB 2XMGA 1VXRA 5EHNA 1UK7A 4FDMA 1AQLA 4MYSA 3PUHA 3G0DA 5CH8A 5JAPA 3MGAA 1SCIA 2XMDA 1R4ZA 5ALRA 5LKRA 3NUZA 3FYUA 2ZJFA 1RWQA 4EA6A 4PO3X 1MN6A 4BVJA 2ZJ6A 2WJ4A 1LPOA 2ONCA 3VVMA 1CUBA 3CN9A 4L72A 4AB1A 5I9IA 1ZI8A 3H2JA 1VKHA 3OG9A 2PSDA 4V2IA 2HHAA 3MUOA 1ZIXA 3CCBA 3K2IA 3G8YA 4BRZA 1Q83A 3ZWQA 1M33A 4BB0A 1GQRA 1G4HA 2OLEA 3TGLA 4HAIA 2OCIA 4W63A 4G9EA 4BCDA 5BWCA 1DX4A 2Y1KA 5AI4A 4UHHA 4Q1VA 2XUAA 5AKJA 2GYVA 4ZI5A 1HBJA 1A8SA 3QBJA 4GWLA 3M3DA 1QO9A 2Y6VA 1A88A 1BN7A 3V1MA 2QXUA 4LXIA 4G4JA 3T52A 4TPKA 1QIKA 3DYIA 4IQ4A 4QDOA 3C70A 4G8CA 3WWPA 3WWOA 4B7ZA 1IUOA 1SCQA 3QPDA 1HLGA 5AIAA 2DSNA 2HA0A 1QIDA 1QGED 2C5FA 3QYJA 4ETWA 1XKLA 2O7VA 2VSQA 4H35A 5JZBA 1BEEA 1LBSA 2XMCA 5A6VA 4H7KA 2J4CA 2YXPX 4KJXA 4TGLA 5LZ5A 1BEZA 2DHDA 4J0CA 3C6YA 1C7JA 3M81A 2CUTA 2I03A 4WFJA 1BCRA 1DX6A 1ZGBA 4GECA 3K9BA 4H7HA 5ALVA 2PUJA 3V9AA 2OQVA 1XLUA 4MQMA 3OURA 3D2AA 5LZ2A 1KU6A 4QDZA 2VTVA 2E3JA 1LPNA 1Q0RA 3FSGD 5AKKA 4BC1A 3C87A 5E4JA 4P9NA 3SC2A 2PBLA 2WTNA 2QJWA 5FKJA 3QVMA 3PF9A 4UUQA 3ESDA 5J3JA 2VQ6A 4IH1A 3E4DA 2NW6A 2XUJA 5JZSA 4E14A 5KREA 4BBZA 4FLFA 2YASA 1EHYA 4W1SA 1K8QA 1MPXA 4Q3LA 5AJHA 4I19A 5ALIA 2PUHA 3HI4A 2WUDA 4JUIA 1K4YA 5ALDA 3D5EA 1W6RA 1F0NA 2XQJA 2ZYIA 1XZHA 4X3CA 3FWHA 1TK3A 2DQYA 4BP9A 4UHFA 3KD2A 2AXEA 1GPLA 4Y7DA 4AXBA 3R41A 4HZGA 1SCKA 3FYTA 1FFAA 2LIPA 4ZGBA 5ALOA 2OQIA 1THTA 4DMHA 3M82A 4UBKA 5FUMA 1GPNA 1XRNA 3B5EA 1N8SA 3QH4A 2VJCA 5JATA 3BL8A 3PDCA 4DMKA 2JEZA 5AIBA 1FFBA 1FFEA 2AJBA 1EB8A 4KE6A 5HK8A 4A16A 1R50A 2WSLA 5IVIA 5LZ9A 3TRDA 1XZAA 4J0KA 1AGYA 2ZVDA 1VLQA 4BZWA 3FYUC 1QZ3A 2JGEA 2JGMA 1VE6A 3LIIA 1QTIA 5AOCA 1ORWA 2RI6A 4JH0A 4ZV7A 4XJVA 3RARA 4LKOA 3DLTA 3W04A 5AH0A 1GXSA 1XZJA 3IUQA 2WHRA 3OC0A 1EB9A 4KE8A 3MVEA 3QM1A 3ZLUA 2HFJA 5FPPA 2Z5GA 3ILSA 4HXFB 1AX9A 5AKLA 5ALUA 3O4HA 3I2FA 5IVKA 4BRSA 2XB6A 3AZQA 3O4JA 5JADA 4PSUA 3D0KA 4ZV9A 3W9BA 3IIIA 4DMCA 3C6ZA 3GZJA 4W1RA 1MAHA 4BDTA 1RYYA 4KRYA 3WK6A 3O4IA 3O4GA 1XRMA 1DQZA 3VXKA 1LLFA 1JMKC 3STTA 4C01A 4QDXA 1GKLA 1QTRA 3EIOA 1QIGA 5AM1A 2XUIA 1J07A 5JD5A 4UFNA 5E4YA 3WWCA 3W9UA 4W9RA 4HTAA 5AI9A 1Y7HA 5EFZA 1GT6A 4NMWA 4M0FA 4BCCA 4BTLA 2XQGA 1YASA 5AKEA 1MNQA 4N8EA 4P08A 4DMFA 1AC5A 2R8BA 2WJ6A 3ANTA 4INZA 4A23A 3HABA 2QUAA 1L7AA 3A2MA 1GKKA 3WJ1A 1C7IA 1MJ5A 1JU4A 2FJPA 1ZJ5A 1UOQA 4L0CA 2AJDA 1E8DA 2XLCA 3C8DA 2QTBA 5EIHA 3ICWA 3S2ZA 4CCWA 1CUXA 3V1KA 4B9EA 1HL7A 3IUMA 1OXMA 1UOPA 5ALLA 5AOAA 3WK7A 1JJIA 3I2GA 2RIPA 5T4HA 1K6EA 4P92A 3F67A 4MQLA 4BDSA 3FLAA 3QZUA 4J03A 1F6WA 3H2KA 2RGUA 5E4TA 1MX5A 2B61A 2I78A 5AK3A 4KAFA 1CUJA 4DSZA 1CPYA 1EH5A 2OAEA 4XIIA 1DWPA 2WUEA 2W22A 4OB7A 4QLOA 1ZD3A 2DR0A 1LNSA 1T4MA 1EVQA 1R88A 1X2EA 2D5LA 2XQKA 3QMMA 3F9CA 2EEPA 1XQYA 3A2NA 1WB4A 1CUEA 3GROA 3G02A 5ESRA 5K3FB 4H7JA 2OCGA 4MEBA 1ZI6A 4QZVA 1ACJA 3RK4A 3I2IA 1IUNA 5K3CA 5LZ4A 5EHXA 1X70A 1NU6A 2HA6A 3FCXA 5AI6A 3ZLTA 4G4GA 5AKGA 5CXUA 3WIOA 1BU8A 2HA4A 3BDIA 3HACA 5HFNA 1JJBA 3PUIA 1XFDA 1CUAA 3JYHA 2QVBA 3I28A 4GEGA 6YASA 3U1TA 1XZFA 2HDWA 2WHPB 4TVKA 2C7BA 2HFKA 3FLBA 3HXKA 1WPXA 2HU8A 1XZGA 1UZAA 4ZWNA 1GZ7A 1O6FA 3X3HA 1QLWA 1G5FA 4Y2PA 5ALMA 1XRLA 3FVRA 4Y2JA 1LZLA 1WPRA 3RLIA 3IURA 1HPLA 5LLSA 2XUQA 3SX4A 2PX6A 2Q0XA 4KAJA 4U2CA 4OU5A 1JT2A 4BAGA 1WOMA 4OPMA 5HZGA 3D2CA 5EHQA 4OD0A 5CURA 3W06A 4C87A 2ACEA 5KWIA 1XZKA 4OB8A 1N5RA 3A6ZA 2DCMA 4OUKX 1H2XA 2J3DA 4BC0A 2X5XA 4CIBA 5D3KA 1XRQA 2CB9A 5AICA 3I6ZA 2G4LA 4Y2RA 1XQXA 2AJLI 3V1NA 3D7RA 3AJAA 2CBGA 4X91A 3IUNA 3L1IA 1X2BA 2H7YA 1CUYA 4X7BA 2HU5A 3Q8WA 2VJDA 4C4XA 2B4KA 4F0JA 3G9UA 5ALGA 4KE7A 4IH4A 1XZBA 4UBMA 4LYEA 5YASA 2JGIA 4ARAA 1DWQA 4AMZA 1VE7A 4UBNA 4WY5A 3HEAA 3U0VA 3LIPA 3WWDA 1BCSA 3MUNA 1LPSA 1P0PA 5EIAA 4HVTA 1QONA 2O2HA 1ZIYA 2WHQA 3VJKA 2WFLA 3BF7A 4C6HA 2BUAA 3SWWA 1A7UA 4OU4A 2ZYRA 5I8PA 1BS9A 3FCYA 3OM8A 1LPAB 4EY4A 3OOSA 4HS9A 3UUEA 1QFSA 4BVKA 3D3NA 5F4ZA 5K3DA 5AI0A 1K5PA 1U65A 4DYHA 2JGLA 4YASA 4JYMA 5HF8A 4LXHA 1AMNA 1N5MA 3DCNA 3IDAA 4G1FA 2ES4A 4J7AA 1UK6A 4RGYA 1R9MA 1GGVA 1BRTA 1VZ2A 5JIBA 1W76A 1MTZA 1ODTC 2C58A 4J3JA 4KEAA 4B80A 3SK0A 4UHCA 1CUFA 1CFJA 5AM0A 5CXXA 4G5XA 4EHBA 5D6OA 1VXOA 3WI7A 5CT9A 3FSGA 3EF3A 3D4LA 1QOZA 5AI8A 3AILA 4BCBA 1YA8A 3FAKA 1WHTA 1IZ8A 2XQFA 1E5TA 4CG1A 1KU0A 1DWOA 4G8BA 3B3QA 5BV7A 2QR5A 1YAHA 5HFAA 1ZD4A 4EY8A 2B9VA 1CRLA 2WG0A 3WL8A 5IH7A 2WG2A 4ZRDA 1YCDA 1YR2A 4G8DA 2QRUA 2VF2A 4B0OA 5EIEA 3C5VA 1R9NA 2WIKA 4X93A 4Y2QA 5AKZA 1ODSA 2QXTA 1DINA 1D07A 3EBLA 1YS1X 1B6GA 5DNUA 2WUFA 4PV7A 4WDRA 4AZ0A 2EDCA 2XLBA 4I4CA 4UFOA 5A7HA 5FPQA 4BZZA 3I1IA 4QE3A 2XUDA 3IULA 4IH9A 3VDXA 3C6XA 1BE0A 1ZD5A 1H2WA 1TCCA 1QIMA 3FOBA 1MX9A 1IZ7A 5H3HA 3EQ7A 4H7FA 2QMQA 3PFBA 2G63A 3JWEA 5ALZA 1QJ4A 4X6XA 3LLCA 5CRIA 4J0JA 1UK8A 2XQIA 4QEKA 2XMSA 3VJLA 2EDAA 1BN6A 2O2GA 5SYNA 4EY6A 4OB6A 1UT6A 4HXEB 2JGFA 4DGQA 4BE9A 1VOTA 5DLPA 5AHXA 4J0GA
chains in the Genus database with same CATH superfamily
1F0KA 1DJOA 1GG9A 5KTYA 1U7PA 1O3YA 1LDNA 1N3LA 1THGA 2FN7A 1SKYB 2PSFA 1PLJA 2XEXA 3DTTA 4FHFA 3DEKA 3ZE0B 5LMZA 2PUAA 2HIHA 1IBCA 2Q3DA 2WC1A 4X1YA 3RJTA 2BM9A 3H7AA 4MVJE 4RF3A 2FLKA 2PFGA 1HFJA 3EVZA 2DR2A 1IHDA 1X15A 1GU0A 1HE4A 2ZLBA 1CR1A 4CTKA 4S04A 2WF9A 2AR0A 1A9XA 2JJ1A 4G67A 5J2TA 3HLTA 3RU7A 2MSEB 1FRFS 5T3YA 5AK4A 1JHOA 2WQ6A 2TS1A 1L1QA 4AMYA 4GYJA 1I3LA 5DM4A 4UOEA 3GNSA 4LQ4A 4RSHA 1M2KA 4JB3A 2XKKA 1H4QA 2AK3A 4UTOA 1VLJA 4GKJB 1VRVA 3DKPA 2I7DA 3IIKA 1OKKA 4HFJA 5TGDA 4COOA 2JLQA 2XA9A 2QOEA 5DGTA 1KGSA 3T15A 1NW9B 3I6IA 4ALJA 1QQ6A 3EW7A 1DAKA 4DC0A 2QVGA 2H1VA 3Q11A 1JAIA 1MRSA 3BMNB 2GM3A 3Q0EA 2ZJ5A 3VPGA 1K68A 3FUTA 4D8YA 4O3MA 3T3NA 4WX2B 4C03A 1XOIA 1K86A 3E3AA 5CLHA 4PIPA 1R0KA 4ZT3A 3GA7A 5JZ9A 1BC5A 2BM8A 4OY3A 4EKEA 2Y76A 1QHEA 5FHQA 4EG7A 1XCPA 3OWXA 3M5WA 1CXZA 1O5OA 2ODAA 3GD5A 4LJ4A 4NL4H 4HDSB 1FP7A 5I7UA 1IUPA 2EYQA 1PW7A 1QWSA 2VPQA 2XUKA 2AGVA 1SHLA 1KH3A 3T9EA 3U4CA 2WP0A 3GLHA 3ONWA 3SN6A 1HSOA 2WAYA 2W6IA 3GA0A 3QX7A 5CDTA 5IC4A 4ZK6A 1Q7EA 2P9GA 3IGFA 5EZSA 1TGYA 2IK8A 3QHAA 2BFOA 3X1ZA 3BZUA 3JARA 4NZMA 5JQWA 4B6EA 3AVXA 5BMOA 1N9GA 4AJ1A 3IXMA 1R10A 1LD3A 1D03A 1L4NA 5IDQA 1YKSA 3KKLA 5K6AA 3BRWA 5BN5B 1M2GA 1ZK4A 2BEJA 1OCEA 2GPSA 3CZRA 1EESA 3R3ZA 4C07A 1I6LA 1MXFA 4C0AC 3A70A 1WHSA 2IPMA 4JQYA 5CJ2A 5CDUA 4W9MC 3AVUA 4M98A 3GNLA 4YAKA 3NC1C 4MPDA 1M9NA 2FX2A 5EP3A 3G0IA 3H17A 3NDBB 5B1YA 5GP1A 2M9MA 3VO8A 4NYMQ 1W36C 1V25A 4B3RB 5JI2E 1GY8A 1J6UA 2R8XA 5IVDA 1MB2A 5ALSA 3F8TA 4ECAA 4BUCA 1KERA 1VYUA 3NVKI 1GV1A 1JAZA 3I12A 3WQBA 3NIWA 3REFA 3OH8A 4O5OA 4U63A 3IXQA 3IOCA 4GIBA 5DP2A 1E1NA 4MW5A 4P0TA 1DAHA 2R6HA 2UYHA 1E20A 1SFRA 4EL5A 3CISA 2VZEA 3LDFA 4OIFA 4B85A 5KNCA 2A0YA 4MCJA 2OE2A 2GBCA 1D5WA 1FJ2A 3U3KA 1RSZA 3B89A 2OB1A 5AVVA 1XJQA 2QT9A 3G5LA 2H2HA 2Z5FA 3DBVO 5F52A 3PX3A 2GPJA 1I24A 3C85A 4OF4A 3NXSA 1A9RA 1CT9A 4PPNA 2GBPA 2DG2A 1XQ1A 3N5CA 5I6DA 1QTQA 2GVDC 2FSGA 2BGJA 2ZUBA 2R2AA 3DO5A 5FR2A 4RPJA 1EQ2A 3ZGYA 4Q03A 2OCLA 3PZRA 5EKUA 4JWKA 2FXIA 2PUCA 1XMQB 3EZ2A 4B6PA 4KGXA 4D45A 1ZVQA 1AKRA 2BGGA 3L1UA 1MAVA 4JMLA 5GMOA 3OMLA 3UKJA 2NYVA 3X2FA 1HTWA 3FKQA 3GLKA 2UDPA 4WXRA 4M54A 3MJTA 1Y8ZA 3NHMA 4AC9A 3ITNA 1ECFA 2D7JA 4GMXA 3T7RA 3LOQA 3HHEA 4US2R 4QU0A 1YBAA 4NPHA 1A77A 5D7BA 3WKBA 3RKRA 5IUJC 3ZUPA 5DK4A 1SBCA 2XE8A 2I62A 3RR2A 3L7MA 2CE2X 3TLJA 1RRGA 2Y1EA 2OZPA 5JRDS 1KPGA 1NVUQ 2VNSA 3GOHA 4BKPA 2G4VA 1JKFA 4JGBA 4GVLA 4P4GA 3WDSA 1JV2B 3WRVA 1MEOA 1CVLA 2FPOA 1TM2A 1MV5A 3NS7A 2CL7X 4D6XA 3FOWA 1ZOOA 1TTPB 1N2XA 3C3YA 2FW7A 4QFMA 4HWSA 3ZEAA 2GD6A 4LZOA 5I7WA 2C1ZA 2BTQB 3D7LA 1JEOA 2ZI5A 4H31A 4Z1MA 3K20A 3N9IA 3KQLA 1GILA 1DKNA 3FPSA 3IQXA 4PCLA 1FJXA 1KMNA 3I2KA 4WADA 3C97A 2XVMA 4DJDC 5HW0A 2VXYA 2YJZA 5A0TA 3A1VA 2A7QA 3GLUA 4EY5A 3SX0A 1KJYA 1N2IA 2A9JA 3L8CA 1X1CA 1N1DA 3A27A 1XMSA 3RW9A 3T12A 2I9PA 3GJ3A 3OPYB 4J2OA 1K4MA 1VBNA 3DDUA 4Z0HO 1RJEA 2HDNB 3FUVA 3ELUA 2ACWA 4KTTE 2IDKA 3OIDA 2EBWA 1KO5A 3HA5A 4MUHA 5DHQA 3RQSA 1RIIA 1QIFA 2OVBA 3N8IA 4OFWA 3O7MA 1NXQA 3BJMA 2QZZA 2QY6A 1OVGA 1KDTA 1YJBA 4BP8A 3UAXA 5JQGA 2VXOA 3HVUA 2YN4A 4TMWA 4AAYA 1V37A 3C3BA 2EGHA 4CMBA 1S0UA 3TL2A 1YR9A 1GFIA 2E1RA 2XZDA 1RXVA 3PFHA 1RYZA 4JEIA 2GXAA 4FCCA 1U2GC 3L6CA 1X8LA 4U7PB 3V7WA 3IPRA 2G9UA 4M1QA 3BKWA 3PFCA 4Z4GA 2P9YA 1H2BA 5E8RA 1JFSA 3VR5H 1PV4A 4ZEMA 1T8UA 1QDEA 2CFTA 3ZHVA 4BJ3A 2P40A 1PKXA 2XGMA 1T8RA 3KTAB 3VZQA 1F4VA 1ZL0A 4IVQA 3U13A 3V48A 2II6A 3JQ9A 4W4TA 2DFNA 3SHVA 2A58A 2NOAA 2YOHA 3PC3A 2DQ4A 3R3HA 4WUTA 2MR5A 5ER9A 3MOGA 3NXKA 1XVIA 1LQ2A 1G8GA 2HK7A 3FCCA 2QP3A 5K2MA 4ZCMA 1SB8A 4PZ0A 3A6FA 2R44A 3KV1A 4NU5A 1JWBB 3PC8C 1O6BA 4MRAA 1IWPB 2OHJA 4FFOA 1IH8A 3UMCA 1KHHA 4WBNA 4XVCA 2FF5A 3QTLA 5BSGA 2I6SA 2A9RA 4A82A 3CF6R 4M89A 1M1XB 4AZTA 1O8CA 3THSA 1QU3A 1SY7A 3THRA 2NYAA 4JJGA 4CQJA 2VT7A 1L7NA 3JQ7A 1KFCB 2L0XA 4KITB 2G5GX 1E2NA 1UEIA 4FX2A 1GPJA 1VYHA 1R0YA 1OI7A 2C4TA 1K75A 5B2EA 3LKBA 1AF7A 3EYAA 3JQ8B 3VNAA 1YVPA 1OLSA 3WLMA 5F9MA 1YH3A 2VSXA 3OJLA 4UNRA 1CHDA 5A9TA 4KW7A 3IVCA 5G4KA 2LDXA 4CYMA 4G1CA 5KNBA 1KRHA 2V0CA 4Q6WA 5IYZB 2OYSA 2QV0A 1DAIA 2AR9A 1C1XB 3PFNA 3NOXA 2REQA 2G08A 2GKGA 4OTZA 3A0UA 1EXMA 4PRZA 3LCMA 4X97A 4YK7A 3V4LA 3S28A 4JOQA 2IHJA 1N2GA 1ZMRA 5FWDA 1AKQA 2PUTA 4NIMA 4UXHA 2V6BA 1ENPA 4IOKA 4LWOA 3U48A 4ZZIA 1W29A 1KK1A 2RBKA 1N9GB 1P45A 2ZJZA 3ETLA 4TV8A 1ZMXA 4BFTA 5LYJB 4RKRA 2ORYA 1P5RA 1D1QA 2QVZX 2ZPUA 5G40A 4B35A 1SO8A 2P2LA 1TEZA 2ZIFA 4NE2A 4PNPA 2FETA 4M9CA 4R83A 2RHDA 5F77A 5A2GA 1VCIA 4HLQB 2GJ4A 3OPQA 4XJXA 1H4SA 2I2DA 5KJFA 3ME5A 2UXDB 4Y2YA 2CFRA 2P27A 3FVTA 4R68A 3UXYA 4AP5A 4EJ6A 3P4YA 5MFZA 4L5IA 2J6IA 3M6MD 1NP7A 4JYZA 1G17A 1JEQA 4AS3A 3RIMA 2NXWA 4RDCA 3HDYA 3MWGA 1L5KA 5AK6A 3WLRA 5KC9A 5K05A 3GLHE 4FOOA 1KZ9A 4LFCB 2JJMA 5LQKA 5EKXA 1DO0A 4GLOA 1F2VA 3L6BA 3P7MA 3N07A 2PV0A 2HLDA 2VTBB 2H3EA 4OHFA 2IZ0A 1OZHA 2BJHA 3QEMB 3E22A 4QEZA 4RHUA 3ENZA 4R69A 1AK2A 3MRXA 2OV6A 3SAJA 4BFCA 2IUFA 4MHOA 4XWKA 3O2QB 1PQ4A 2MR6A 5KAMA 1TU3A 1P6XA 2FUKA 5EWMB 2FK7A 2MINA 1VPDA 1ZOIA 3N8DA 4K6GA 4K9DA 4UREA 3RVDA 3IL2A 4EPYA 1XAJA 1PX0A 3O1IC 1BVRA 3VSCA 2GZHA 4RJTA 5I7RA 1G0NA 4JT9A 3M6FA 4OLBA 1J2JA 1EBBA 1OTXA 2ZRAA 5KOYA 2ZPAA 5GGYA 4EHHA 2GDJA 5B1IA 1X74A 4LK3A 1K3UB 3DBLB 4M8SA 1H22A 2XOEA 2R6DA 3OCYA 4B3JA 1JDNA 3PPIA 2J5BA 2JI9A 2VAVA 3LGSA 3O8BA 2FOXA 4UASA 5KSPA 3E0XA 5BQ5A 4DCMA 3LUDA 2UZ4A 5DX1A 4O2LA 1Z2OX 1FE8A 3IP7A 4BMYA 4WKNA 3KRTA 2W6ID 1UMBA 4C08A 4ER7A 2NV6A 1IONA 5EWLB 2H08A 4AP9A 3SHOA 1A2KC 1WF6A 1E1RA 3LP5A 3EZFA 1Z3CA 1E79A 1Q0ZA 3AUAA 3C6QA 4KOAA 4HNAA 2XI4A 2PD4A 4XGIA 2JEYA 4HNQA 4C7BA 2D5IA 3RVRA 3AHEA 3QLTA 2HM7A 3SXUB 4QRIA 2PPVA 2VRBA 3HFRA 3M6XA 5FL7D 4Q3NA 1D2GA 1U3DA 4L6IA 3DV9A 1QR6A 4YV2A 4E7PA 5IJAA 4ZTZB 1EVLA 2C5AA 1GCIA 1R3UA 4J94A 1HQYE 1TM4E 4RYDA 3ANXA 5AO9A 2ZIZA 1JX6A 4WNIA 3DPIA 1L7VC 3K9LA 4ZEOA 2PT9A 4GXRA 1DRVA 2ZYVX 5IBRA 4FLEA 4GDFA 4XWGA 3N70A 3N28A 1VSUA 1O87A 2WMNB 4AKTA 2O54A 2NTYC 4JUDX 4XARA 1RZRD 2VCYA 2PCJA 2J3JA 1LPPA 4KBYA 5CW2A 3HCNA 4YREA 3ZDFA 3ZEIA 4DTCA 3QYAA 2R6AA 3KAKA 1ONPA 1VL1A 1SHUX 1SC1A 4U2FA 4YUZA 4LG1A 1BU5A 3PEUA 4GP7A 4KPUA 2IQ5A 4JYPA 2ZDQA 2PBRA 4R01A 1U7ZA 2C4WA 2NPIA 4XB1A 4GGMX 221PA 2ZSJA 3G6KA 3OC6A 4PIVA 1IWOA 1DQYA 2BMVA 4PSCA 3H2HA 2SCUB 1EX9A 4QULA 3KFVA 1XKTA 1KYQA 3AF0A 2H7XA 5F7ZA 2HRDA 4X00A 1M8FA 4EJ0A 1Z8NA 4FGKA 2IIVA 1O08A 2V4UA 3BRQA 5LXTF 3A3NA 1QAQA 2IU6A 3IILA 4FEYA 3EMKA 2CUZA 3QHPA 4K5QA 4YACA 1QC5A 3NAZA 4C3ZA 4WCVA 1FOEB 2TMYA 2FJ0A 5TPWB 2LCFA 1C81A 1H1TA 2QTVB 2WTBA 1VP9A 2Q6LA 4OMCA 5KSWB 5DYIA 3U3RA 2O7QA 2JLVA 1YQTA 1H0SA 4C2TA 1GN9A 5LA6A 1IY0A 4HCJA 1PD0A 3RHZA 1PL8A 3TUZC 2O19A 6CHYA 3CWQA 1JHAA 2BFWA 3QXGA 4PAGA 5H16A 3SR4A 2H0AA 2I3DA 4FOPA 3PNQA 1D04A 3VGJA 1AUOA 3EWSA 4G0MA 5JSQA 3S1AA 3GLGB 3LBIA 1XA4A 4YPOA 5CA0F 4FE7A 4O4HF 1L5WA 3WYCA 4NZZA 5ILOA 4BE4A 1Z88A 3ZJTA 3SYLA 5BOSA 2R6ZA 1XWIA 1EHCA 2XJ4A 3WP0A 2FZGA 3AR8A 5TF0A 4ZZ0A 5IM4F 4CHTA 3PNPA 2O14A 2J3QA 4BVEA 2G5TA 4F85A 1Z38A 3RASA 3FCEA 1X86B 3ROXA 5LQJA 2QD3A 1T15A 1UZNA 2OXIA 5LQRA 2CSUA 2BC9A 1Z22A 4RTRA 3DTVB 2NQTA 4BFXA 1M0TA 2G9RA 4D80A 2BFFB 2HIGA 5LDDC 3NI2A 4FZ3A 3JQEA 3R3JA 3O3NB 5CNIA 4F3RA 4ISCA 1QNLA 3WFZA 5DCUA 5AVWA 1I33A 3V4RA 3MT7A 4LZJA 8ADHA 4J8PA 1AIPA 1CDZA 3T9CA 4CG3A 1RI3A 1BROA 5EI5A 4UUNA 1IPFA 1E1MA 1GGNA 3HJUA 3M0EA 2BZGA 3U3OA 1VHWA 2PU5A 4K8RB 4WXEA 2HWWA 3BIWA 3JD0A 3TG2A 3IBCA 2P67A 4FX5A 4GM4A 1OYOA 4NBNA 1KEVA 1LPBB 3D5TA 1L5GB 4RDXA 1ESNA 1MZVA 2HCTA 2OCKA 2R1UA 3FOEC 2DU8A 1L1EA 4D3FA 4ND1A 4BGUA 3CX3A 4TS4A 2Z0MA 1UMKA 5AW0A 2JLXA 3CE9A 1CNFA 4CKZA 4WVLA 4CCYA 5KOIA 1R6BX 1N0HA 3BXPA 5IF9A 3H3XA 4DCNA 4G0YA 2YWXA 5C4IA 1NX6A 4UMEA 3H4TA 5KHAA 4WBSA 1E2PA 1DAMA 1VCMA 3E5MA 4L1KA 4J6FA 3VU1A 4GEKA 4WN3A 2CZGA 4YRLA 3JVVA 1DTWB 1OC4A 3VI4B 4FMPA 4ERXA 4M0UA 1ZH6A 3BTSA 3D6JA 3TCNA 3NGMA 3U80A 2GEBA 2HLPA 3QXXA 2GFIA 3KG2A 1O0BA 4MDFA 1GCGA 3UF0A 4BU1A 2DVMA 2HLDD 3P71T 3V4PB 2IYWA 4JI6B 3VNQA 2WIDA 4JNKA 5AVOA 1U1EA 3PUZA 4RETA 2V0GA 2V7QA 4LEIA 2IXAA 3B12A 2I3GA 3DZ8A 1EK0A 4HAVA 4HMQA 1YJXA 4O2AB 1RI5A 2YV5A 4FGZA 3NC4A 4MRSA 4MHTA 1YB5A 4GLLA 2LVBA 5T64A 1E6MA 2FSHA 4I36A 4HWRA 5E0KB 3AF2A 3VZBA 1UR5A 2Q5QA 1Z0DA 4X45A 1U9JA 4ZAWA 2Q07A 4JKOA 4FHGA 1JPNA 1M5UA 2V96A 1QGZA 2IEDA 2VEDA 3FM9A 1QE3A 2FZ5A 2UVQA 3PDUA 3D59A 4MVJP 4N0DA 4QODA 5FXMA 3RS4A 4UJ5A 2XAUA 3L6EA 3HVHA 4FCTA 4P4SA 2H2IA 4DLUA 2ZSEA 3EMBA 2HV9A 3L5KA 4PCAA 4WKPA 1DXQA 3A0RB 3VC3A 1TZKA 4R2JA 4BS9A 4ZOCA 1ENOA 1MX1A 4NBKA 2QAGA 3RU3A 1Y1QA 1N25A 2A35A 3HRKA 3KE8A 3JS5A 4XQ0A 2WQZA 2NVBA 2WWIA 5DLDA 3ZE8A 3OY7A 3MGCA 2EVWX 2RJOA 5DEOA 4A9AA 1KWKA 3JQPA 1K98A 4PEVA 3A25A 1JW9B 4B4WA 1EAMA 1TCUA 3LDHA 1G38A 1C4WA 2ZP1A 5U4QA 1J8MF 1ZK2A 4HGYA 4NF2A 4XR4A 4DS3A 1VJCA 4DANA 4HN4B 4RVNA 5C8XA 4ZTUB 1QVZA 1DRKA 1DTEA 4I1OA 3QUSA 4OLFA 1ICIA 2C4VA 5KDLA 4Z4CA 4ER0A 2NNLD 1ZGCA 3QV2A 3LLMA 4RJJA 3PJFA 3QP9A 1ISPA 3R3YA 5KBYA 4LY9A 3RFFA 4BLWA 1X39A 4R0NA 1A50B 1DFIA 2OTCA 2I2WA 2WZQA 1LGYA 4MK4A 3ZHUA 2GPBA 4Q39A 4R84A 1L5OA 4XCXA 1R15A 1KZ6A 2IYLD 4GAEA 2JG3A 2WU8A 3G9XA 2P9TA 2OWEA 1TVEA 4ISBA 5HCIA 3FNIA 2OMEA 3ES9A 4E07A 4AX4A 2WSSD 3JD4A 3M3PA 3RHFA 1K6IA 4H2DA 3G8DA 4XOUA 1DIRA 4OAOA 1E59A 4DSAA 1GPDG 4FR0A 5DSTA 5LA6F 5TARA 1MH1A 1SHZA 2BEUB 2GZSA 4JVMA 4RGVA 7ABPA 2KYRA 4DRXA 2PMKA 3ZDCA 2HUNA 3GG9A 5IZCA 1Y8QB 3RC7A 3UXHA 4C4ZA 1P0QA 2C0QA 5EGNA 1BRMA 2QORA 2D5AA 1UDWA 2VCEA 3BZWA 3PK0A 4F3YA 3QEBZ 1RPTA 1XVAA 1OFTA 1YE5A 1SCUA 1MJHA 3RS0A 3EIEA 3AM3A 2WJYA 5KDDA 4XJTA 3WBFA 2GR9A 1HM5A 4TL9A 2CD7A 3R0VA 1MTOA 1UFRA 5FLEX 1OT5A 3ADPA 1K6XA 1A8IA 4E2YA 3TSAA 1PWHA 2BISA 4JP2A 3ZVLA 4EBBA 3OEEA 4MZDA 1VHQA 2DE0X 3O94A 1PZHA 3DE4X 1GQ2A 1FMFA 2CMHA 5E2AA 5E1OA 2H9YA 3B53X 4AF8A 1SXIA 2JATA 3E3MA 2L69A 5I9LA 3C6MA 3A06A 3ML1A 2I3BA 2PWYA 1OA1A 1MG0A 3E2MA 4JJIA 5FT9A 2WIGA 2QD5A 2I4NA 5CM9C 1W85B 1HMPA 1N33B 1MOSA 1JNYA 4KIUA 4E5NA 3ZQ4A 4R2MA 5BRJA 5LQDA 3ZHTA 1P62B 2PKRA 2NZWA 2JFPA 2Q3LA 4IMPA 3VKWA 1M7GA 3ANYB 1VZ3A 3M83A 3GGCA 4QOSA 1XEWX 5K2OA 4BNNA 1Z0AA 1QFXA 3I0ZA 3AK4A 1RVDA 5D51S 3RH0A 1GSOA 2BY4A 1Z82A 3FOAA 3FZGA 3PGKA 1O8BA 5EC8A 2Z8ZA 4E46A 4OJQA 3L6OO 4N41A 1PDOA 3M4JA 3AKEA 5D2CA 4RPIA 2DKNA 4K0RA 4M76B 3UJPA 2Y6UA 2RCNA 3GK3A 3VSAA 3T3GA 4PGMA 1EWVA 4FDTA 2FPMA 3TRFA 4UM7A 2I54A 3IOYA 1FDRA 2Z56A 4JQSA 1BE1A 1DJQA 1II8B 3PPVA 1XPOA 2CFIA 3VR2A 3C43A 3DBHA 2O7RA 2BP7A 3TZLA 1JG6A 2CXNA 4TRRA 5J4HA 1Y4DE 1E3QA 4K6FA 3E84A 3RYIB 2HSDA 4ITVA 1XJ5A 4JJEA 4Q37A 4C7XA 1DC7A 1N9ZA 4YLGA 4XLZA 1U0BB 1QIEA 4URYR 4JR1A 1YUBA 4QJ3A 1F7UA 2B1GA 3O4VA 4U3JA 2D5CA 2BGNA 4DQLA 5LP1A 5KTNA 2FMXA 4QVGA 1IY9A 2GFQA 4P2GA 4PNHA 3CW8X 2H65A 2P78A 3G7NA 1N5DA 5GM2A 3LC1O 1P4AA 3LYUA 4IIXA 1TJ5A 1C7QA 2YWBA 4COKA 1ULTA 2WUGA 4AWBA 4L51A 1OT3A 1AHHA 5KI6A 3S70A 2O1SA 3HVRA 3TSOA 5CB8A 3AB3A 2QTFA 4H16A 2AIRA 3AFMA 5G0VA 1IUKA 2W11A 3E5NA 3KL4A 4FKBA 2YC2C 3RG2A 4D8XA 5DM2A 4Q1EA 3ZPXA 2JFUA 4JJ4A 5BYAA 2ZCUA 4OBBA 2AMVA 2H29A 2X8LA 4RHCA 3UVEA 3I2HA 4AZSA 1UEXC 2IHZA 4M7WA 3UK7A 3TGWA 5D3QA 1RC1A 1Z7YA 2R7AA 5LN1A 1NVDA 5L7TA 4RO0A 1EP2B 1SIBE 1MVNA 1R6DA 2OGTA 2RGXA 4DZRA 3QK7A 1YDMA 5DCWA 5JWOA 5DBIA 2JKZA 1SWWA 4O0MA 2L82A 2W6CX 4QLBA 5GIOE 2QMZA 3DZFA 5K7SA 3STVA 3DVQX 2YQ4A 5TV2A 4UD6A 2QD4A 4A91A 4ASUD 1ESEA 2ZAYA 3QKUA 3A9SA 4O4JF 4LA4A 4GS5A 4TTJA 1AO0A 1T3HA 4ATNA 2RHJA 4WN9A 3K9CA 3HYRA 4GT1A 1QK5A 4B31A 5KU1A 1H93A 1N6LA 4IUCS 4EM6A 5DYYA 1U90A 1WUKS 3A32A 3FDXA 1RAIA 3QX9A 1PAUA 4CWAA 3KV3O 1J24A 2OZKA 3O8NA 3FJ1A 3IJ5A 4CM8A 1XB2A 1RXUA 3FIJA 2AHOA 3NWBA 5C0OE 4YAOA 2CNDA 5CIQA 1P2GA 4GLBA 5HOQA 2EZ4A 1FBNA 2G1UA 4E13A 1OH5A 3GRYA 1URPA 2IPXA 4DLRA 3AM4A 4WGFA 4MB2A 1XJWA 5LVAA 1QB8A 2PMDA 1XEAA 4S24A 4D3XA 1GP2A 3Q7SA 1PD1A 3DKRA 1Y4AE 4FE3A 1IL0A 2PWZA 1R4MB 1YZQA 2AN4A 1GFZA 1UDAA 1YQUA 2XF8A 3BFKA 2AK2A 2H07A 3GB9A 2V6JA 2BKEA 5EGSA 4CEHB 3A1EA 5BQOA 4BB9A 2PR2A 2BMJA 2QZJA 2VDQB 4Q7LA 5DLEA 1HYGA 3Q85A 4YI5A 3ROTA 1P9RA 4Q1DA 5HKBA 2DLDA 3WO0A 5IAOA 2IS6A 2BCEA 2Z2IA 4WKGA 3SKXA 2EZUA 4AO8A 4CR6A 3ZQJA 1EDBA 2IXDA 4L9AA 2J3MA 2ORED 2QP9X 2J3IA 3WXMA 2VDMB 3S2FA 3E23A 4DT1B 4WASA 4HDKB 3OOEA 3VR2D 1GL7A 1E6LA 1QQ7A 2VDVE 2W6MA 1UJBA 1GNLA 4LHEA 1E1DA 1K9VF 3DLPX 5H83A 1GAEO 4M0CA 3DA8A 4BQNA 4AMVA 3FMFA 3ZHRA 3PNBA 4DSNA 4F4UA 5JZVA 4E5MA 2HWYA 2QRKA 3E5RA 2M2IA 3CZ9A 5CA1B 1TGVA 4DLYA 1PUIA 1UBEA 3CPJB 5DYTA 1ZJ6A 4B3SB 3KPVA 1A04A 3JXEA 1ZU5A 3AFHA 3S3TA 4DV1B 1ZW6A 3TKLA 1H65A 3ZWYA 4ITUA 1N0VC 1ISHA 1CUCA 5B7NA 5K0CA 4D9BA 4FW8A 2QN1A 3JZAA 1HEYA 3ABRB 4D5GA 3NWPA 3U2QA 1A97A 1YFLA 2R4TA 3AJ8A 1Y37A 4LNUB 4LJ9A 3ICVA 1XC7A 3AI3A 4LE2A 1M1ZA 2C5GA 2XE6A 3LXUX 2VF7A 3PFKA 2UYCA 13PKA 1VTKA 2ZVJA 4OGFA 5GIPE 4CEIB 2FN8A 4H27A 4ZVQA 3UAYA 4F2DA 1RD4A 3HU1A 721PA 1JEYA 2BFAA 2AF3C 5I9SA 1E0JA 1TRHA 1W0CA 2C95A 3BGVA 3GFPA 5ALNA 3UWDA 1GZ5A 5CFZA 2ZETA 1GWNA 2A14A 2QYSA 2YHIB 3FWNA 1JZSA 5SZJA 5H4HA 1H1LB 3CVOA 4TLEA 3F96A 1Y1LA 4OP3A 3CVWA 3JX9A 3KTDA 1AQJA 2A33A 4JZKA 2A92A 3CUUA 5DOZA 3T1NA 1E18A 2HLNA 1KYVA 2QA5A 5TY0A 4EGCB 5CB6A 1SC9A 4GVPA 2V7WA 5HDBB 2OOSA 3H2YA 2Y2UA 3PTLA 1RWVA 2PS0A 2YZ2A 3CKMA 1EEHA 7ADHA 1V2HE 2IHVA 2RONA 1E2DA 3DE0X 5K3BA 3DZGA 2NVUB 3R40A 1ZCZA 3AUYA 5K0LA 2LBPA 1U3VA 3VR3D 1SHTX 1JHZA 2FWPA 2GO7A 3EQ2A 2UVPB 4IIYA 1SAYA 2HRCA 1B76A 5HRCA 4UAUA 1OQAA 3K0AB 5EKDA 4MUMA 2M6KA 5EP4A 4AJNA 3D6TB 1J4AA 4UW9A 1Q74A 2DBZA 3WGLA 3DCYA 4E1AA 3RAFC 1RYMA 3FFAA 1GZHB 4CEHA 4Z4QA 1AUXA 2O2CA 4JT2A 5CIWA 3OT1A 2ZBQA 3MHTA 1JHXA 2R4QA 3ESRA 3R7DA 1T9GS 3AXSA 3IUJA 2HGZA 3QFRA 3JZDA 2ZJ7A 2AR7A 3Q6NA 1T91A 2RHTA 5E6SB 1FZTA 5J4VA 2OO7A 3HZOA 3IA2A 3V3KA 1KJNA 4Y2GA 1IBKB 2HT6A 1AXGA 4YP7A 4C78A 3TTUA 2OFWA 2VJAA 1F2TA 1L8AA 2WU4A 1XCMA 1JJAA 1MB9A 3EMVA 4JT4A 5FBRB 4GOXA 4CM5A 3LWZA 1TQ6A 2H9IA 3NTXA 4M36A 4PSDA 1UOOA 4RLFA 4D8UA 1GG5A 4I6GA 2DHEA 4ZVTA 2IFTA 2AI3A 2OCAA 3OJ0A 1Y1RA 1WG8A 1S4QA 3GRCA 3OTHA 4P82A 2OFOA 5JPIA 4KPYA 2D6FA 5IUKC 3FCUB 2IS1A 3HC7A 2PGIA 3K8OE 4Z3KA 1C9DB 5BP7A 3AF6A 1HDOA 3BHJA 4N8DA 1YZTA 4HN9A 1RCTE 2Q1UA 5IT4A 2GM9A 4NXNB 3OP1A 4EHIA 1LF5A 4GI5A 1YUNA 5EJ7A 4Z7JA 2X0NA 1HFKA 2FHPA 3NHFA 2VT6A 1PR6A 1V5WA 2KE5A 2WG1A 5H9WA 1H9AA 2IYTA 1YL5A 1MGPA 3AETA 3CRZA 3OJEA 1XRSB 1EQAA 1FYEA 4NNPA 3H86A 4D9JA 3UB3A 1OA0A 1OWNA 3A4VA 4Q9KA 3B1XA 1JQDA 4FDUA 5JASA 5H68A 3KR9A 2HQRA 4JHXA 3DNMA 1E98A 4ZI3A 4LC1A 1JA9A 3HVKA 2WV7A 4UMDA 1OOEA 3F97A 3FIUA 1NYQA 1QIJA 2HHJA 4KGDA 5I7VA 1CLEA 2FQQA 2Z4SA 2Y1FA 3CJTA 3WGGA 4MVYA 2HJRA 3KU1A 3WGUA 5KIAA 1DT3A 2UZ3A 1QH0A 5G1OA 1D2MA 2VAPA 1KO1A 4ZYZA 3C15C 2RK6A 4YDSA 4NZYA 1GCUA 2IW3A 3NT2A 1NULA 1W48A 4PNZA 3USES 4UTRA 2FPUA 4QG3A 3L7JA 1YA4A 3OI7A 4L3WA 1XT6A 3AF5A 2F67A 5DXJA 5EUQB 4YCSA 4CKWA 3D3JA 4CF3A 5CB4B 5JLJA 4Y2TA 3PC6A 5A02A 1NDQA 3WSWA 3ZU4A 2XHZA 3FJYA 4KDEA 1ORVA 2V59A 1E6CA 3JQRA 1Q21A 3K9QO 4IDNA 4OHWA 3WC4A 2DT5A 4V39A 4H0CA 3UIEA 3WGMA 5KJ6A 2JD2A 2VT3A 3M2PA 3SF8A 3GMDA 1AUVA 3O3OB 2KW5A 4NBWA 2WWVD 5IAGA 5ALFA 2DBRA 5F3WB 3H5IA 3O9MA 3PNVA 1AHIA 4WA8A 1SBZA 3ZU5A 4TWJA 1WV0A 4Q3EA 1PJBA 3WMWA 3KQMA 4LY6A 2VOEA 4EK9A 5IVHA 3RO7A 1FJHA 3LUHA 4PQRA 4EKIA 5CVTA 2P0YA 1JFLA 1YKGA 4HQKA 5A7FA 3V3TA 1JHVA 4AROA 4FFMA 5A0VA 1U0OC 2G77B 3I6QA 4O2RA 5FNZA 1H0HA 3BEDA 2BGKA 4P54A 2QYOA 4LSWA 2O8FA 2H1IA 4JLMA 1C0IA 5AOBA 5JANA 3QF4A 1P1KA 2CYBA 3CRMA 2TECE 1I7DA 1T5BA 1ZIDA 4ZVPA 3F4BA 5FQOA 3I1YA 2ZJOA 2C77A 4E3ZA 4HK4A 5C81A 2FOLA 2VHZA 3N58A 4GGOA 5JSHA 5J2UA 3FYUB 4BLSA 1D2AA 3L18A 3QMVA 2FFBA 3W05A 4AJKA 2V3VA 3C7KA 1KMHA 3RJ5A 2GCNA 4GOOD 4PY2A 3VR5D 2FX3A 3K09C 3OLQA 3KKOA 2GN9A 4QT0A 5FBLB 1M8PA 1H2FA 1LC3A 4BLPA 4U2EA 5I7SA 2VXBA 1MOZA 4HXYA 1UZMA 2ONYA 3EB9A 4ROSA 2QRQA 3KK0A 5EJ9A 5IZCC 5H8WA 3HB5X 3ABQB 3BMXA 1B8VA 1KWGA 3GVPA 2FUEA 5I7EA 2QWXA 1J5XA 4HBGA 1ZD1A 4WDQA 2I34A 4F86A 3ETNA 1N5JA 2GEDA 5M04A 3A9WA 2YXLA 1U8AA 4S0XA 1PGJA 2BGLA 1M8KA 1TD1A 3F3KA 4OI0A 5BV8A 1IK4A 4EB6A 4X0EA 4YAIA 2VNHA 3HE3A 4URXR 1J2EA 3MRSA 3PP8A 3MS7A 3PWKA 3NBMA 5KSZA 3GGDA 1J09A 4DM7A 3GDGA 2DETA 1X8KA 1EP3B 3ED1A 3K4QA 1I5EA 2ZRDA 3DXZA 1SWVA 3KELA 5BYKA 4U2KA 3IB6A 4KMSA 2Y1WA 2O0MA 1W52X 4JKYA 5HHTA 1CEYA 1U04A 1CWUA 2ACVA 3AERB 4ZOBA 3D8TA 2EU8A 3Q7EA 4ND4A 4PG7A 2X1MA 3BIXA 2FDXA 4Z86A 1FSFA 2I6GA 4JS0A 3R23A 1KR2A 5FFMA 5BN3A 4TYQA 1V45E 4GPD1 1OFHA 3K9NA 3RUFA 2O0JA 1GEGA 2Y8EA 1N6RA 1LFAA 3RRNA 4TTVA 2Q2WA 4XX1A 3WWYA 2JD0A 3ZKWB 5FLYA 5GVSA 1RWOA 1E2IA 1YJ5A 3JWGA 4YRQA 4REQB 3TM4A 1LF0A 3D7SA 3I6MA 4TWBA 2F1IA 3RT9A 5CDFE 1GRRA 3BH7A 4LISA 5F7JA 5JSKA 1ZS9A 1XEFA 1XQWA 3WZLA 3JAKA 5ITZB 1M7HA 2DTXA 1ZONA 4HZUA 2F9LA 4YCAA 5F73A 1KNQA 2CVOA 3K9GA 3ADDA 4BLVA 1ZGHA 2P62A 3TYXA 3VR4A 1F7VA 3NLLA 3DLHA 1O6ZA 1PS8A 1UF9A 2N75A 3L4SO 4DE5A 1PFVA 3K6SA 1KBQA 1PL7A 4R7TA 4C7MA 1TZ2A 1WXDA 1YT5A 2AXPA 1CRZA 5CX4A 2I0FA 1AQLA 5EJ5A 2HQOA 2Y1GA 1I51A 4ZMRA 3MGAA 1SCIA 3GRKA 5IK2A 3V4ZA 1XMIA 3W9YA 4Y1GA 4EGSA 3EPHA 4I55B 3MMNA 3NHKA 4XTRA 4IFEA 4I99A 2MOKA 5ALRA 5DOVA 4UNSA 3TNFA 5JJ5A 1LVGA 1NN3A 1NY5A 1JSRA 3M3DA 3FYUA 2ZJFA 4MEJA 2Q99A 3UUWA 2VUIB 1MN6A 1I13A 2AHRA 3KCNA 3AUJB 4CIVA 2B7CA 4BV9A 2ZJ6A 2J5KA 2WJ4A 5AXCA 1KTIA 4W8HA 5GZ6A 1LPOA 3I37X 2DULA 2ONCA 3GAFA 4MS1A 4FUQA 3VVMA 4AJ9A 4DCGA 4DV7B 4IGAA 3VKVA 1R0CA 1G6Q1 2C3UA 1YJ8A 6REQA 5DIZA 3W5HA 3RADC 3P5SA 1EP1B 4AB1A 3TFQA 1R4NB 1ZI8A 5I9IA 3ETDA 1U8XX 4QU5A 1UXKA 3NCHA 3NHBA 2PKQO 4NBLA 1THMA 1CDDA 1JDVA 3EOZA 3QU2A 5G4KB 4B3IA 2G8LA 1KQ3A 3PT9A 3MK31 3SJCA 1T5SA 3SJZA 4AJLA 1CY0A 3D4OA 3T5GA 4F1JA 3ZXIA 3PXGA 3MUOA 4MVJH 2X0FA 4UXJA 3IR5A 3CCBA 2B82A 2HJWA 3IVRA 3G8YA 4RABA 4RD4A 4DVJA 2NPOA 2FRVA 1E3WA 2OFXA 3NHPA 5J23A 4H4DA 3IP9A 3JYOA 3ZWQA 2G1KA 4QYSA 5TEWA 1O6CA 1QGOA 4DMGA 1XU9A 3QKRA 4L5CA 5FOXA 4CV0A 5TLSA 5COAA 4DAEA 3C4VA 3ESXA 1Z28A 1IRXA 1QH1B 2W0MA 5FADA 5CXQA 3KKQA 3WB1A 2ODWA 2OLEA 3WGKA 1SCJA 5GV7A 4A2PA 2O3UA 3HR4A 4Z2YA 2OCIA 2C2MA 5IK2D 1DAOA 2UXCB 4JLPA 3RNLA 3T9AA 5BWCA 1ZNZA 2EL9A 1UCFA 3QE3A 3ZIAD 4TYNA 1VL2A 4IS2A 4UTXA 3BTUA 1QYVA 3A1NA 4UHHA 2XUAA 2R00A 1RMTA 4PAMA 4UUMA 2BEVA 3PEVA 1ISMA 1X1EA 4M9UA 1LNZA 5TC4A 5TRTA 4W9NA 1A8SA 2IXGA 1EM6A 4LXQA 3L7LA 4QOEA 5JBIA 1QU2A 4QM7A 5ESDA 3AFNA 4MWCA 2VP5A 3R44A 4KQ6A 1NVEA 3ZI4A 1QO9A 1MC5A 3GARA 1A88A 3KQQA 2EWMA 1CD5A 2YIMA 3DBRA 5FB3A 5JXIA 3AQIA 4E3WA 3LL4A 3RVJA 5JPDA 3INTA 1QO0A 2FQ1A 3BIJA 2C2YA 4HH4A 4IPTA 2QXUA 2AFHE 4ANFA 4G4JA 4US0R 1BXRB 3D4IA 4LDZA 4NJEB 3GHYA 1D4ZA 1L5RA 1QIKA 2ZS8A 2VHVA 3EGOA 2F3QA 2W2VA 4ZJZA 821PA 2H8GA 4L7VA 3GW8A 1L7MA 4ND2A 1X14A 1PJ3A 2JLBA 1MCZA 4K6CA 2Q9CA 4NE7A 4IIVA 3ABOB 2WD8A 1RAFA 2H5LA 4R8LA 1YNOA 4I50A 4NMXB 3K05A 1SCQA 1RPAA 1EGVB 2AOTA 2PRYA 2VTKA 1HLGA 3PD0A 5LCXA 4MV5A 4XVHA 2P9CA 3P0EA 5AHKA 3HU5A 2C59A 2J59A 3GEEA 1HDCA 3IJRA 4JU9A 1QIDA 4KGZA 4ZDJA 5F7XA 4OXIA 2FU5C 2V55B 5FI5A 4BXOB 1ECJA 2WU0A 1QGED 1P80A 1QH8B 1WW2A 2DHRA 3OX4A 4PO1A 2D0PB 1LFDB 3M1YA 4PYIA 1NY6A 1G1AA 5DLQC 3RKUA 3CUSA 4CMAA 4E5VA 1G6OA 4O4LB 4ETWA 5TQ0A 2A1TR 3PENA 1LTQA 4X7PA 5FF9A 3SCZA 4LDAA 4K46A 3OF2A 4H7KA 4YN3A 1MJGM 4Z7OB 1KO7A 1ULZA 4GR4A 1N92A 4KJXA 1QK3A 1LY1A 4FQ7A 1E58A 1RHUA 1U63A 1S6YA 1WXIA 1DXYA 1YQXA 3TNLA 3ADKA 4J0CA 4QREA 2A5YB 1C7JA 1R8SA 1Z4IA 3GJ4A 4HDRA 5A0FA 1UPCA 1MFPA 4HAZA 4WFJA 4N0MA 2G1JA 3N0VA 1BDIA 3UOWA 2LD4A 3PNYA 1JHQA 4NBRA 3I92A 4V3CA 2A78A 3ZW7A 2XNDA 3NT5A 3CLSD 1YOVA 3UKDA 3O0TA 1TADA 1E3WB 3QV1A 4H7HA 5ALVA 3ZCUA 1VHDA 4RM2A 2ZRKA 3V9AA 4A1OA 5CEJA 4FPXA 3A31A 4OOFA 5I4CA 3EVGA 4PM4A 1PDWA 2B8JA 1OTHA 3OURA 4D4GA 3W6OA 5LZ2A 3C4QA 2FMTA 3B1KA 1JR3E 4E2ZA 1DEOA 4ENTA 5EUBA 3WNVA 4PG6A 4QDZA 3C3WA 3B85A 4ZJPA 2E3JA 3N0WA 3ZD6A 1W5SA 4IRMA 3T0IA 3N1UA 1LX7A 5AKKA 4AI6A 2FZLA 1RPNA 2FFJA 1RC0A 6GPBA 2B35A 1B3RA 3EN0A 4B17A 1JEJA 3RJ9A 5KJ1A 4HGOA 1NVVQ 4KQHA 4ZARA 3DE7X 1AZTA 2GEKA 2WTNA 4PINA 1TQ2A 3I32A 3MPUA 1RRMA 2VA8A 3FRJA 4CNQA 3TJRA 5I9NA 3B3AA 2OHOA 4YAEA 3OJCA 1PZFA 3F5QA 1S7CA 3QVMA 4AKEA 3C7TA 4EUKA 1K08A 4KK3A 2IYPA 3QBVA 4MR8A 3W3AD 3ESDA 3HGMA 4C0QC 1I2MA 2VQ6A 3IBGA 2C5BA 4IH1A 4PPFA 3E4DA 1I2AA 1CZUA 3SXUA 4BZQA 2NW6A 4FN5A 1JF8A 3UJ8A 1N2ZA 2VH5R 2Z57A 3IP1A 5FOSA 3M6UA 4CL0A 1BXRA 3V8RA 5BW4A 5IDXA 3OPYA 1XFAA 2HEGA 3F9IA 2ESRA 3ABSB 2IS2A 1EHYA 3ZTWA 3ZW8A 3JASA 2WWYA 1HDRA 2WAXA 2FG5A 5JECA 4N7BA 4Q3LA 3JZMA 1Q16A 5ALIA 3OLWA 4TSFA 3EZ7A 1TUBA 1U99A 1NQ5A 3GBPA 1G8YA 2C83A 4G9BA 1WXXA 3S68A 4LSZA 2ZWPA 3RSGA 3DEZA 4P58A 5HEKA 1UBLS 4O5AA 1W5FA 1W44A 4ERNA 3R5TA 4E5PA 1YRYE 5IUNC 1N6HA 4OHKA 1OJ7A 3H8VA 3R8XA 4DL9A 3D5EA 1U9ZA 3R7AA 2AOUB 1U11A 3UK1A 3C98A 2C5HA 1XDDA 2FZVA 2XQJA 4OREX 5DNAA 4KXVA 3CSSA 2Z6AA 1XZHA 2HF8A 4CGYA 3AHJA 1ZCFA 2G07A 1BTOA 4X3CA 1NZFA 2WEKA 3PE3A 4PZZA 4XYBA 3C1UA 2QN6A 4XYEA 5I01A 3B6ZA 1S3IA 3AT1A 1PZNA 1GPLA 4AXBA 4HZGA 1SCKA 3BWDD 1UINA 1VMEA 1F9AA 3L8ZA 2QX8A 5ALOA 4OLJA 2OQIA 3F6CA 3HKCA 4LYAA 1OJLA 1P4RA 2FWAA 1DB3A 3E53A 3M82A 1GADO 4KQCA 4L4ZA 5FJJA 1P4SA 1KEWA 4IHKA 4GI2A 4RLQA 1BKDR 1U1IA 2HB6A 2PAAA 4ZXPA 2I4MA 2GD0A 1GEEA 4OI4A 3DJFA 4TYYA 1MAUA 4L8VA 2ZI3A 2QMHA 4YDHB 4BFYA 5KNBD 1F3LA 4H4EA 4N49A 3KFLA 8AT1A 2ALJA 2X77A 3ZWKA 4D0NA 3I9FA 3N2EA 3TGPA 1LA2A 4NAVA 3ZXUB 4ENPA 2J6BA 2ORVA 1R6XA 5JS8A 1J39A 1H8HD 2AJBA 2B3TA 2P8JA 2LPMA 2XD4A 4L95C 5LZ9A 4IJVA 4B4DA 4DQKA 5BVHB 1AXEA 4WA7A 1HSZA 3VPBA 4ZVNA 1SIUA 2ZYAA 3O2JA 1FRNA 2A59A 3GUHA 5IXJA 4EJFA 1GXSB 3U5ZB 1WP4A 5B1DA 1XZNA 1RS0A 4OATA 4WIAA 5GGXA 3FVQA 5BORA 5KJEA 3GUVA 3LIIA 3DNPA 2YJ6A 3ZUGA 3CUTA 4YJ2B 3PS9A 3QMPA 3LH5A 2V4MA 4QX6A 2W58A 4XOIA 4PXSA 4ZV7A 5I9TA 1FYFA 4BWGA 1L0BA 1W4RA 4K05A 4LOLA 4QVKA 4OI1A 3T7JA 5JDIC 2PSSA 3K9WA 5JEEA 1KFBB 4NEHB 3DR3A 3SYTA 2AZXA 1S2NA 1V7QA 3BGOS 4LECA 2X1LA 5DTRA 1NASA 3RRXA 1ZCBA 1H5UA 2AEEA 1JYFA 2IIQA 1EZZA 2HRZA 2Q6TA 1EFRA 4LVUA 1SRQA 4MR7B 3TW8B 1V16A 3HXMA 2P1ZA 2P6UA 2VHWA 3N8GA 4TV9B 1FFSA 2COUA 3L41A 4IVRA 3W2FA 5FOUA 1WCWA 5EE3A 2NAFA 3QU5A 2APJA 2NUPB 2Z5GA 4MRMB 5FPPA 2CMDA 2G9ZA 5GPBA 3GGJA 2PZBA 1ULHA 1FQWA 2FFQA 2EW8A 4LYYA 3BPSA 4DG9A 1NVVR 1KH1A 1SH7A 4MV8A 4XUEA 1G3IA 2I6QA 2AQHA 1E9DA 2P9QA 1H94A 2VRWA 3AZQA 3O4JA 4QYTA 3VC7A 5JADA 4L5JA 1E61A 3MMSA 3H2SA 3IIIA 2PZEA 1AHNA 4K3UA 5FUQA 1NR7A 4DMCA 5A5GA 2QGZA 1P1FA 5A3SA 1H8ED 2BZ0A 1Q77A 1VDZA 1XNQB 2I5PO 2BFDB 2C2XA 2RHHA 2H06A 1IQPA 1D1SA 3BE5A 4MGIR 1Z17A 3V7YA 3F3SA 1HFWA 1DLIA 2O2JA 3D9QX 3I01M 4HWPA 4BDTA 4WZAB 3DB1A 3O4GA 3I9V1 3MWDA 4E33A 4EVSA 7MDHA 1V4NA 3D1JA 2O1XA 1BOFA 1V3UA 2VSOA 3C3DA 4Y6QA 1DQZA 1R5JA 2HDHA 2VWHA 3T99A 1NVMB 4LUCA 5L3QA 4HZIA 1J22A 1JMKC 1IM8A 1R27A 2O8CA 1QTRA 3C4JA 5JFGA 1DL5A 1XMOB 3LM8A 4LJLA 3FKSA 4YAWA 5KMGB 4OQXA 1YQQA 3P45A 1H1LA 3LCVB 1HGXA 4A03A 4OYHA 5BN4B 1ZM9A 3ZDRA 3SD7A 1DPGA 4OYRA 5KNCD 3PSAA 3BMQA 1LJUA 1KI2A 1EMDA 3CB2A 5A1TA 1XVUA 3EXIA 2QLLA 3U1VA 2XUIA 3K3PA 4U7DA 2NP6A 4E4YA 5DKFA 4M1OA 1WPQA 4RZ3A 2Z1DA 1GPUA 1VB5A 4GVXA 1KK2A 4HDMA 3S27A 4OSOA 4HTAA 2WTAA 4F04A 3SYKA 2Z83A 2PQ0A 3W2GA 4UE6A 1A7AA 2R00C 4UZFA 1KY4A 4O4JA 4BCCA 1U94A 4I50B 1B4DA 5IKOA 3TWOA 1QP7A 4W5HA 3DL0A 3O92A 2XB9A 1N0WA 4G1BA 2CT8A 3ZZTA 2FP4A 1S3SA 2IV2X 4P08A 2A5FA 3AYZB 4ZO8A 3CS3A 5FTWA 5JVDB 1U3TA 2JGDB 1AC5A 3ANTA 3PPYA 1P7VA 2PT6A 4BNTA 4INZA 5EHIA 3R9XA 4OIMA 5CFPA 3IR6A 3A2MA 1QGUB 1HG0A 3FI0A 2MSLA 3ZOKA 1KJ8A 2EW1A 2EJCA 3T7DA 4DA9A 4J1SA 1LJLA 1KI7A 2X3UA 2ZBRA 2VYCA 1MJ5A 5PNTA 1Y82A 3QPWA 1YFJA 3KSUA 2W8ZA 4JHLA 2FJPA 2VPTA 1NJ6A 3I9JA 3QY9A 2PA3A 5K45A 3E1SA 2QTZA 3HSYA 2LR0A 4D57A 4DWJA 1AA9A 4BTEA 1DAEA 3MSCA 4K9KA 1XDWA 1C30B 3N7TA 1RQ7A 5JAIA 4JB2A 4LXTA 2H92A 2QQFA 2RJNA 1FW8A 3NAMA 2QTBA 3QWHA 4OK5A 1BWQA 1GIAA 2DWCA 3H1FA 1AQUA 1U02A 1FRVA 1ZBDA 4MKFA 5EIHA 5F33A 3VBEA 4BMPB 4ASUA 1ZM3A 3IDFA 3D02A 1YMVA 3FH0A 3LAWA 1WW3A 1B93A 2A94A 3G5TA 4EMUA 3BHNA 2E4AA 3II6X 3INGA 4NNOA 2W7TA 3GI1A 3K0AA 2DPGA 3LPCA 2AYYA 1RWMA 1KK0A 1VP3A 2Y99A 1KL7A 2W48A 5TB5A 2WWGA 3SBDA 4MGZR 1BQ4A 2GXQA 1K6EA 2JAQA 2X3FA 3K16A 4QGBA 1GUDA 3F67A 3K4PA 5CLIA 4EHDA 3TOZA 5LP6B 1TZCA 3DMPA 1M1YE 2KLBA 1UP6A 4HSEA 3BCSA 1UJMA 3RC3A 1ID1A 1XTBA 3BH6A 4G4SP 5AK3A 1RQPA 2FOIA 5F5XA 2GILA 1LXCA 1EH5A 3LNCA 3MRVA 1IJBA 4HH1A 4F7DA 2DFLA 4L22A 5H3LA 4K86A 3REQB 4ARUA 4G5HA 4IDDA 5BSMA 1CHNA 4B3GA 1NAIA 3W5IA 4CU5A 4M7RA 3TW8A 3K0BA 4OK3A 4ZALA 5LNK1 4GI7A 3PD1A 2OY0A 1Z9BA 1M76A 1UXJA 1QVRA 3AL3A 3QMMA 1IEWA 2QQGA 2Y77A 2Q5HA 1QM5A 5EJGA 5J5VA 1Z34A 3O8CA 4B4UA 1PJLA 4EJSA 1XQYA 3A2NA 1MAWA 3LECA 4JI5B 3ER8A 3U62A 3DV2A 1MH9A 2HY7A 1OV6A 2AW5A 4H7JA 1M2JA 2A0WA 2FW8A 3GEDA 3FKSD 3LPDA 4E5KA 2C9BA 3AUFA 4XD7D 4DCPA 3FUWA 4WNAB 2VQDA 1ACJA 1RQRA 3CNBA 1WE2A 3QW4B 5EJFA 4BQRA 2VR1A 4D3SA 4NWIA 3TNDA 1W5TA 2JLSA 3NX4A 1WSWA 4OLAA 1NMXA 1WQ3A 3TTWA 3ZDQA 3GLGE 3FF4A 3TB6A 3B1VA 3MCTA 3VPFA 1PFGA 3M9XA 3FYDA 1BHJA 4QUIA 5CK5A 5K3CA 4DABA 1PT5A 1YGPA 2BHLA 4DARA 3GRVA 3HH8A 3QRWA 1Z36A 2F17A 3FCXA 5DO9A 2I33A 4XW2A 4D41A 2J6CA 3BBPA 1RZ3A 2P9EA 2R66A 1JKJB 2OHVA 2RB5A 4X41A 1IB6A 4TVBA 4D25A 3TO5A 1S3FA 2Y4NA 2YFQA 1LLCA 2HA4A 4YNBA 4D92A 4TXLA 5HFNA 4EYGA 2YVUA 4IF4A 2EZ9A 1DBWA 4W8GA 3UT6A 4KVFA 3OJFA 1K7XB 4AFNA 4QPNA 1GTL1 3TTYA 1CR0A 4KXYA 5DGIA 3TZHA 4RY9A 1AG9A 1QDUA 2Z9BA 1B8NA 4XTCS 2HRBA 1QZTA 4P4NA 1PP4A 3L7NA 5AHWA 4AMBA 5KYXA 2J46A 4ZEWA 4E2XA 4JITA 1LBHA 2JIBA 1KKMA 1TKAA 4XPIB 5L3SB 1PSWA 3O8DA 4UKDA 4IHJB 4JDPA 3RGGA 3HXKA 3J7TA 2GN1A 1I3MA 4A2CA 3JU3A 4MB0A 4WXYB 2AWNA 3M1AA 1RXEA 3N0XA 1ODFA 1VI2A 1X38A 5A5FA 2Z98A 2HJVA 5JJIA 3IP5A 3AG6A 1BWSA 1UAGA 1II9A 1NC1A 1PK9A 2ONZA 1GZ7A 1TO1E 1JR3A 4CJXA 5J2TB 1KMCA 4G5GA 1HZZA 1G5FA 1AK9A 4O4IA 4PX3A 1SG9A 5SICE 2ERYA 4OHBA 2C9MA 3NOVA 2QT1A 3Q9NA 4Q5IA 3FVRA 4Y2JA 1WX1A 5ALMA 5B57C 4PFKA 1JWAB 2VHXA 2J9ZB 1SU6A 1WPRA 2FP4B 1E96A 2I6UA 4PN7A 4X20B 3JZFA 3FDFA 2QAGB 4PHGA 4BNIA 1IOWA 4C76A 2NSHA 4B6QA 3C16C 4C5AA 4A15A 1P7YA 2Z08A 2PGLA 1ZH0A 4ONEA 2BFBA 4Z9BA 1XU4A 3SX4A 4P7KA 1DKMA 1HKUA 1E0DA 1ZCJA 2IHYA 2KI5A 3GRZA 3LZCA 1I6MA 1TF2A 3O93A 2V7PA 4H3HB 4LBWA 5EOVA 4MKGA 2CDRA 3QA3E 3R7FA 2J3HA 1Y1SA 4DT1A 3KS9A 3L0DA 1JT2A 1BGWA 3UV7A 2AEJA 3AEZA 3ON5A 5B6IA 1F3OA 4TMYA 3EPPA 2H4WA 2P9ZA 4CM1A 3D2CA 1OB5A 3OQBA 4K9NA 3PFFA 1V95A 2DP4E 3L07A 1QUEA 1SVOA 3PJEA 4BQPA 1Y42X 4OB8A 4WOKA 3WJ7A 1KEPA 2XF2A 1YHNA 5EHGA 5A4KA 2X14A 2REQB 1H2XA 1JGTA 2B37A 3I5AA 1JA0A 4HDNB 4AG6A 3ZJVA 4MA0A 5KNDA 3OQNA 3G3EA 1FFXB 5FH9A 2OSBA 3UICA 4DIOA 4C2BA 3EVEA 2CB9A 1Y3CE 4YRKA 3AU9A 5CVVA 3T34A 3SSMA 1R00A 3ONEA 1W19A 5CBPA 4AMGA 3UMMA 2G4LA 4LBZA 2FHSA 2FW9A 4XSGA 3MWLA 4Y2RA 3WGOA 2VNIA 2Y92A 4R9UC 2DUMA 1XR3A 5EKTA 3V1NA 1FXWA 1A5ZA 2B92A 1HNNA 2X4GA 1CQJA 1IHXA 2CBGA 1LRLA 2BKXA 3L1IA 3WRXC 4BKUA 1X2BA 2H7YA 2J85A 1CUYA 3LXMA 4JENA 1HQCA 5CW1A 5FWYA 4TMTA 5BVGB 2NN3C 4MDYA 5THXA 1P60A 3SOPA 1FFWA 2HJ9A 4DY4A 3TB4A 3WYFA 2C7RA 2A67A 4L4SA 4NP6A 4RXUA 2RDMA 2WMYA 2ZWAA 2ZZKA 2QRVA 4LMBA 4R2IA 1FLDA 3Q40A 1G8JA 1WMBA 4F0JA 1Q1ZA 2FFHA 1VYTA 3GIDA 3A3OA 4GG1A 2GCGA 4IH4A 4IDBA 5A4IS 5F9FA 1XZBA 3RTAA 2XTNA 4LHWA 3O47A 2CUKA 2PY6A 1Z2EA 2ZSKA 4KQJA 4LYEA 4MV7A 5YASA 3KSAC 2DBQA 2JFXA 3IVXA 3BILA 4HGPA 1DC6A 1SXGA 2J30A 4L0MA 1B7GO 3SSNA 1CDOA 4CMGA 4DTIA 1I4EB 1DWQA 4AMZA 4CIYA 3GLIB 4CQNA 4OMDA 5KKAA 3U31A 3WMFA 4HDOB 5D8DA 4HWTA 4WK4B 2TSYB 3H99A 2HXGA 3PKZA 3HEAA 4O63O 4PG8A 3UMVA 2XNSA 2M6RA 2RGYA 3H0EA 2BR4A 3TF5A 5EFOA 2C2KA 4N7RA 4AQYB 1T0JB 4XB6B 1VJRA 2PYDA 4IDAA 1ECGA 5EA2A 3QJYA 4OH7A 1FYXA 4Q4DA 2ID7A 5HILA 1YE8A 3K8YA 5CA0A 4EAQA 1LPSA 4QGHA 2JB9A 3NOQA 3LYHA 3PRYA 4HMOA 5EKSA 2IWHA 2G9QA 1SA0B 3H5TA 3RS5A 4DQVA 1P0PA 3TSYA 5C53B 2WF8A 4BNHA 3BXZA 1QONA 4UMVA 1KJQA 4LJ7A 4Z9XA 1G20A 1C9YA 1XF9A 3DYBA 2WF5A 3VJKA 3H05A 4OU4A 3SPXA 1ZITA 2O20A 3B2NA 2ZYRA 4MW1A 4UEQA 1FP6A 4X1IA 3X1MA 5IARA 4B74A 4EKNB 3DDNA 2BEUA 2C1EA 2VKQA 4JROA 2G04A 3R5JA 1LPAB 3G68A 3RT1A 3SJ7A 1M8GA 2YW9A 3CUVA 1KNXA 4UPVA 2QBYB 2G0NA 4JVOA 3OZUA 4ILKA 4F56A 1RIFA 4N03A 3Q4GA 3QUBA 3IEXA 2AA3A 2FQWA 5EZ6B 3SOZA 3DBRB 3INYA 1E3SA 3AERA 2N42A 2FG7C 2Q4BA 1B43A 1HRDA 1WJGA 2HF9A 2PN1A 4MIKA 1FRQA 1WXEA 2WYVA 1F60A 3NFYA 4G36A 5A9SA 4LQLA 1NNLA 4YASA 1MG5A 3NRBA 4YJGA 3I52A 4ER5A 4RK5A 1H0KA 4PZEA 2HSGA 3ZU2A 4G1FA 2FE4A 1KAHA 1XK6A 1L8OA 1PQUA 2PX8A 2W98A 1JQJC 3E9MA 4FNAA 2ZIXB 4NJMB 1SXJD 4TN1A 5E6SA 3RDPA 3RSQA 3C3KA 3NJ8A 3Q2OA 1R9MA 1WU8A 2Q4TA 3R5XA 4IJMA 4FU0A 4UD2A 5AMXA 3VU9B 5JWHA 4CTJA 1W76A 1DDIA 1ODTC 2WABA 4H0FA 1AKWA 4J3JA 4X24A 4CG0A 1LLUA 3DOEA 2DFDA 3SK0A 4DA4A 1IOVA 2XECA 2PLRA 1AQYA 2NACA 3EC1A 2Z2JA 5TQ0B 5E1DA 4DV5B 2HYIC 2JGRA 1TMYA 3RRYA 2RHMA 3F1LA 5CXXA 4TRJA 3NNDA 3DHWC 1K7EB 3CLTC 3RC1A 2J87A 3H11B 5AQEA 4E7OA 3B78A 3BMOB 4HWOA 5A04A 4PAOA 4MQFB 5FHRA 1STOA 1QG2A 3L82B 2HQBA 2HBQA 3EJWA 3SJUA 2FWMX 2FR0A 1M5TA 1EE1A 4GZLA 3AHFA 2LWIA 4NFYA 5CT9A 3FSGA 5WRFA 5K03A 3D4LA 1KZHA 2F1HA 2Z58A 5CJJA 1VJ1A 1SXJB 3ZDZB 2V65A 1UBGA 2J7PD 3ESYA 5SZHB 5AI8A 5A6SA 1Q7RA 4HNSA 3WDKA 4UVDA 1IZYA 3GLQA 4BCBA 1N6OA 1BIFA 1WHTA 2ZG6A 3LKVA 3TQOA 1IZ8A 2AXNA 4ZDKA 4HYYA 2L2QA 5GOTA 5AW5A 3SEFA 5EUCA 4PRKA 3F2VA 1D9ZA 2BDUA 1Z6YA 2O2EA 4WE3A 4WZBB 4YALA 4ZCPA 4OX9B 3KXIA 2VNAA 1YBFA 5F1YA 1DHTA 2M98A 3F7NA 5LA6B 4YY3B 4URHA 5L4SA 4KI0A 5C1IA 3FOZA 2FPPB 3ENVA 4KBGA 4KU4A 4GX1A 4GR9A 4NABA 1LVUA 1KOLA 1KAEA 3GA5A 2C5EA 3HUFA 5GONF 3WL8A 1P75A 4NKRA 3UT5A 3P9QA 3VYSB 1NQWA 3WFIA 4WD3A 2AD1A 4ZO6A 2IEIA 3RUHA 4PNEA 3CH6A 5ES4B 2VF2A 4YRRA 5ER6A 2WBLC 1JDSA 2DWPA 2A9QA 1DEKA 2BE9A 2V5VA 3RSHA 2D8AA 5FEUA 4CLRB 1BDHA 4HVAA 3S6JA 2VJQA 3ZBPA 1I7NA 4FONA 2OQ2A 1B0AA 1NMSA 1EGAA 3SZ3A 1JL3A 3WTCA 4YQYA 1PLLA 2X5JO 1G2OA 4L8YA 4NU6A 1FU4A 1IQ0A 5BV2P 3G0OA 3ZWWA 4Z54A 5DM70 1DEHA 3ZGZA