3QZVA

Crystal structure of bptf phd-linker-bromo in complex with histone h4k12ac peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
b'KLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleosome-remodeling factor subunit BPTF
publication title Recognition of a Mononucleosomal Histone Modification Pattern by BPTF via Multivalent Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/nuclear protein
total genus 57
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2011-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3qzvA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3qzvA01
5FH7A 5D25A 2G45A 4NRCA 2DVSA 4NXJA 4QEWA 5KTWA 2EGPA 1XWHA 4R2YA 4WA6A 4UYHA 4QSRA 5L97A 1WESA 2M6MA 5A7CA 5CGPA 5IGLA 5CZGA 3JVLA 5FBXA 5A5SA 5KH9A 4AP4A 5KH3A 2WP1A 4O7EA 3O33A 5LKUA 1WEVA 2JMIA 2WP2A 4NQNA 5ETBA 5I89A 4GNDA 5EWWA 1WEOA 1EQFA 4HXPA 5F1LA 4R8PK 4UIYA 2DATA 5D1KB 2R0YA 4YBSA 5CUBA 5A5PA 3M62A 4XI1A 4MR4A 4O7BA 3IU5A 2RNWA 5JI8A 2LGKA 2VPEA 5H9MA 5LKXA 5CS8A 3U5LA 2KWNA 2F42A 5DLZA 4AUQB 4UP5A 2E6RA 4QSQA 4Y03A 4PS5A 4HXOA 5F25A 3T6RA 4MR5A 4O64A 1FBVA 2OO1A 4HXLA 4RVRA 3SOUA 5FG6A 2K17A 5EYAF 5F61A 5I7YA 2PNXA 2F6NA 2YEMA 5A83A 3UVDA 2LXHC 1JSPB 3G0JA 5I40A 5EP7A 3HTKC 4LZSA 3SVFA 1WGMA 5CQ8A 2EODA 2LGLA 3HCUA 5DY7A 5D3JA 5F62A 3ZVYA 2OSSA 2MJVB 4QSSA 2L84A 5F1HA 4OGIA 4A0CD 4YYNA 4N4FA 5L8TA 4O76A 5EU1A 5E9LA 3U5JA 2L80A 3QZVA 5HJCA 5A5NA 5CQ3A 4QF3A 4O7FA 4NR6A 4TU4A 4QBMA 2K1JA 2L75A 5CQ6A 2LV9A 3O36A 3L11A 4PKLA 2E7NA 5DFDA 2YREA 5FERA 5ENJA 3MXFA 4TYLA 1F68A 4NR4A 3KNVA 4ZW1A 4WIVA 2N9GA 2RI7A 5FG4A 4PCIA 2YSMA 3P5OA 5EVAA 5FE3A 5L98A 4O78A 3N9LA 4O71A 5FE8A 2H0DB 5DYUA 5CPEA 4MEQA 2JMJA 2VJFB 4YADA 3TLPA 1BORA 4ZQLA 2KWKA 2YHOA 5TDWA 5B75A 5HENA 4FO9A 5LCWB 3JVJA 4OUFA 3QZSA 2H0DA 5F2PA 4KCXA 2YSJA 3FKMX 2VJFA 3U5NA 3SHBA 2QJ0A 4L58A 3M99A 5LJ2A 4A9NA 5F5ZA 5DKAA 1LDKC 4HXRA 4QC1A 4QSPA 5G4SA 3I3JA 5HRWA 5D1MB 4O74A 3AADA 1K2FA 1WEMA 5A81A 2EA6A 3KQIA 5DYAA 5TDRA 3RPGB 5L96A 2YT5A 4BW4A 1G25A 5BT4A 2KGGA 1WUMA 4O72A 5E0RA 4CL9A 2KYUA 3NG2A 5D7XA 2K4DA 2ECTA 1E6IA 2ECWA 4NUDA 4N4HA 4IC3A 1N72A 5F3AA 1VD4A 5TB6A 5E9KA 2VPBA 3UV5A 4AVXA 4MR6A 4N4IA 3PHDA 3ONIA 1WEPA 2LQ6A 4J1PA 2IDAA 2L85A 4LDFA 4QUUA 3UVXA 3N9OA 4YYIA 4GNFA 3L1XA 5CUDA 5IIDA 2LSPB 5HQ6A 5JWMA 5BT3A 5G05B 3RCWA 4IOQA 5DFBA 4TT6A 5A85A 1LDJB 5IG6A 3O34A 4B86C 4YY4A 4X3GA 2KIZA 4YBMA 5EWDA 4S3OB 4LRGA 5ENHA 3U5OA 5JG6A 5L8UA 4LC2A 4BBQA 2FUUA 2I8NA 5D3HA 4YYMA 3GV4A 1WEUA 4YYHA 4LR6A 4XY9A 2KGIA 4QSVA 2MT5A 2NAAA 4GB0A 4HBYA 3ZYQA 4A9HA 4Z6HA 2KU3A 5DINA 5DYCA 1N87A 5FE9A 1F62A 5EQ1A 5DKDA 2CKLA 2E3KA 4ALHA 5AIUA 4MEPA 4QR5A 2Y43A 3LQIA 4J0RA 4NUEA 1JM4B 5CUCA 5B79A 4NYXA 5H85A 3GG3A 5AMFA 2VP7A 1JM7A 2I50A 4TKPB 4BHWA 2RS9B 1MM2A 4YYDA 3ZYUA 1Z2QA 5AITA 3LQJA 5LUUA 3UV2A 4CUTA 4ZDTA 5FE0A 5AD3A 1VYXA 4NS5A 4HBXA 1WEQA 2M85A 4Z1SA 2LGGA 4WHWA 4MSXA 5HELA 4V3KC 4Z93A 5HRVA 4A9MA 5J0DA 1FP0A 2I7KA 3O70A 4ZC9A 4QF2A 4C67A 5C85A 1JM7B 4LYWA 5FFWA 4QSWA 5DFCA 3MQMA 5D3TA 5HEMA 5CTLA 5HFRA 4KV1A 4GNEA 4PTBA 2YQDA 5KHMA 2BAYA 2M1RA 3IHPA 4CLBA 2PUYA 3MULA 1ZS5A 2CT2A 4A9KA 2G43A 5J3XA 1WILA 3T7LA 3RTRB 2RO1A 4Q0NA 5ETDA 3MUKA 5LKTA 2FSAA 4YYJA 2KWOA 5LJ1A 4NR7A 4O75A 5C8GA 2YW5A 4NQMA 5L99A 3QZTA 5EK9A 5E74A 2UZGA 4HXSA 5IGMA 2OXQC 2YURA 3K2JA 5I86A 4BW2A 5LVQA 1X4JA 4IR4A 1HYJA 3ZPVE 5KO4A 3DAIA 4NRBA 2G6QA 3PUQA 5FEYA 4O7CA 2MNZA 4QY4A 4V3LC 3ZNIA 5E9VA 2QICA 5HFQA 5I3LA 1U6GB 2JMDA 3ZPV1 5EWCA 4A4BA 4YK0A 3SVHA 1WEEA 4I7DA 2ECNA 5FE1A 5TCMA 4XUBA 2E6SA 3MHHA 4FIPA 4YAXA 4O77A 5EPRA 5E7DA 3HMHA 5D0CA 3U5PA 4YBTA 4A49A 5FG5A 3O35A 3AQAA 5CQ5A 4Z1QA 3ZTGA 4N4GA 4WHUA 3MB4A 4NR5A 2YQMA 3EB5A 4GPJA 5FE4A 2R0SA 1Z6UA 4YYKA 5I29A 2R0VA 4BJXA 5F63A 4TZ8A 5D3PA 1T1HA 2L5UA 5CU8A 5FE6A 4IC2A 5DX4A 4P5OB 5ENIA 5C4QA 5CQTA 3EB6A 2YYRA 5FH8A 3N9QA 2OUOA 2E7OA 2KR4A 4CUPA 4F52B 3C5KA 5AMEA 2CSYA 4BW3A 4TZ2A 4UIWA 4UYGA 3PURA 5A82A 3DPLR 4IORA 5LVRA 5II1A 3O7AA 1RMDA 1WE9A 5FB1A 3I2DA 2DVRA 2G4AA 2MUMA 2HYED 5A5QA 4FLPA 4WZ2A 2MA5A 1WUGA 4AYCB 4NR9A 4XYAA 5K29A 5FH6A 4LADB 5CQAA 5I1QA 3N9NA 4PY6A 5FB0A 4FJCA 4ZUXU 3O37A 3ZVZB 5C89A 2RFJA 5IGKA 2VJEB 5EI4A 4AYCA 3LXJA 2D82A 4TT2A 1WFKA 2VNFA 4HXNA 4R7EA 4X2IA 1V87A 4LK9A 5D3RA 4Q6FA 3KV6A 3Q2FA 4N3WA 4J0SA 4LKAA 2H60A 2RSDA 3RPGC 5CFWA 2C2VS 3U5MA 5TABA 4XUAA 4QNSA 4J3IA 5AD2A 2VJEA 2LXPC 2XB1A 3HMEA 5G4RA 5FE7A 5C87A 2LDRA 4CFLA 2Y1NA 4B7YC 5B8DA 5COIA 2D8SA 2YYNA 5ENBA 4NN2A 5E9MA 5ENFA 4TT4A 5C7NA 4UP0A 3UVWA 4MVTA 5H1VA 5C13A 2Y1MA 4UIVA 5FE5A 4WZ3B 4QUTA 4A9EA 5EV9A 2KWJA 3FL2A 3HCTA 4I7CA 5CP5A 5KTUA 5D3NA 5IGNA 3V43A 1X0JA 2L0BA 1JOCA 3C6WA 3JVKA 4QR3A 4WZ0A 4CCGX 5EA1A 1IYMA 2YUCA 4W4UA 4LZRA 4NYVA 4IR3A 3P1FA 1WIMA 2ECVA 5G04B 4QB3A 5TRBA 4TS8A 5EISA 3LRQA 2YELA 1HYIA 5CQ4A 4S3OC 2ZETC 5EM3A 5HQ7A 4LYIA 5LJ0A 5IBNA 2JRJA 4UIUA 2L5EA 4F3IA 4YH3A 1WENA 2L43A 1VFYA 4LLBA 2MD8C 4PCEA 4YH4A 2LGVA 4TU6A 2R10A 2YHNA 2DVQA 5CRMA 2ECJA 4NUCA 2KFTA 5FFYA 3GL6A 2ECIA 3P1DA 4Q0OA 4DONA 5E3DA 1DVPA 4CUSA 5D24A 4XY8A 4BW1A 2NXBA 4QSUA 3IU6A 1Z60A 5DLXA 4UITA 4LZ2A 5D1LB 1ZBDB 2MIQA 4NRAA 4YYGA 2YEKA 2RNYA 3UW9A 2VPGA 2D9EA 5EPBA 5CY9A 5D26A 2YU4A 4A9IA 5ENEA 4YABA 5LKZA 2LRIC 5TBNA 4HXMA 5HCLA 5H1TA 3M63A 4Z6IA 3SOXA 1WEWA 5C11A 5HQ5A 4QYDA 4A9FA 3U5KA 4ALGA 4LYSA 5EWVA 3KV5A 5FFVA 1E4UA 5I80A 4MEOA 2MNYA 5B76A 4AKNA 2DWWA 5FDZA 1X4UA 3Q2EA 3HCSA 5CUGA 4UYDA 5II2A 5H1UA 3N9PA 5EPSA 3LJWA 2KTBB 4TTEA 5DBMA 5KU3A 2XEUA 3LQHA 4CURA 2QIZA 3VK6A 4CUQA 4A9JA 5FE2A 2MA6A 2GRCA 5B78A 5ACYA 3MB3A 3HMFA 5CUEA 4UYFB 5HLSA 4QZSA 4O70A 2KE1A 3JVMA 1MM3A 5E73A 3SVGA 3DWYA 5F60A 4UIXA 4QSXA 4C9ZA 4C66A 5A5OA 3UV4A 3S92A 3D7CA 4IR6A 5DW1A 2LN0A 4NYWA 4UYFA 4IR5A 4OGJA 4CUUA 2C2LA 4A4CA 5CQ7A 4GNGA 5DW2A 4E96A 5CRZA 4CFKA 4QSTA 1CHCA 2VPDA 4PPEA 4YATA 4HBWA 4QR4A 2K16A 2F6JA 4MENA 4A9OA 4QEVA 5I88A 3N9MA 4A9LA 4UI9B 4YC9A 5G0FA 4O7AA 5KH7A 3L1ZB 2KREA 4I7BA 2AN6A 4CA1A 4HBVA 5DKHA 2ECGA 3G0LA 2DKWA 4UYEA 4IOOA 4KV4A 4UIZA 5I7XA 4HXKA 2DVVA 2YQLA 3ASLA 3P1EA 5BT5A 4L7XA 5HM0A 2CSZA 1X4IA 5F36A 5B77A 5A5RA 3DQVR 4QYLA 4QC3A 5ENCA 5CUAA 2HDPA 3UVYA 5E9YA 5HRXA 3S91A 5ENGA 5EGUA 5D3LA 2YW8A 4MR3A 5KTXA 4NR8A 2CKLB 3SOWA 4YY6A 5E3GA 2DX8A 2FUIA 5D3SA 3NXBA 4LJNA 4TQNA 2MD7B 3MHSA 2RNXA 5DYXA 2M3HA 4FK5A 5EICA 5E9IA 5EWHA 2YDWA 5DKCA 3P1CA 5I83A 4QEUA
chains in the Genus database with same CATH superfamily
5FH7A 2XP0A 5D25A 2G45A 4NRCA 2DVSA 4NXJA 4QEWA 5KTWA 2EGPA 1XWHA 2MKEA 4R2YA 4UYHA 4WA6A 4QSRA 5L97A 1ZKRA 1WESA 5A7CA 5CGPA 5IGLA 2JUNA 2M6MA 5CZGA 3JVLA 5FBXA 5A5SA 5KH9A 4AP4A 5KH3A 2WP1A 4O7EA 3O33A 5LKUA 1WEVA 2JMIA 2OWAA 2WP2A 4NQNA 5ETBA 5I89A 4GNDA 5EWWA 1WEOA 1EQFA 4HXPA 5F1LA 2L7PA 4R8PK 4UIYA 2DATA 5D1KB 2R0YA 4YBSA 5CUBA 5A5PA 3M62A 4XI1A 4MR4A 4O7BA 3IU5A 2RNWA 5JI8A 2LGKA 2VPEA 5H9MA 5LKXA 5CS8A 3U5LA 2KWNA 2F42A 5DLZA 4AUQB 4UP5A 2E6RA 4QSQA 4Y03A 4PS5A 4HXOA 5F25A 3T6RA 4MR5A 4O64A 2FFWA 1FBVA 2OO1A 4HXLA 4RVRA 3SOUA 5FG6A 2CONA 2K17A 5EYAF 5F61A 5I7YA 2PNXA 2F6NA 2YEMA 5A83A 3UVDA 2LXHC 3PLWA 1JSPB 3G0JA 5I40A 5EP7A 3HTKC 4LZSA 3SVFA 1WGMA 5CQ8A 2EODA 2LGLA 3HCUA 5DY7A 5D3JA 5F62A 3ZVYA 2OSSA 2MJVB 4QSSA 2L84A 5F1HA 4OGIA 4A0CD 4YYNA 4N4FA 5L8TA 3LVQE 4O76A 5EU1A 5E9LA 3U5JA 2L80A 3QZVA 5HJCA 5A5NA 5CQ3A 4QF3A 4O7FA 4NR6A 4TU4A 4QBMA 2K1JA 2L75A 5CQ6A 2LV9A 3KDEC 3O36A 3L11A 4PKLA 2E7NA 5DFDA 5SVIB 2YREA 5FERA 5ENJA 3MXFA 4TYLA 1MBMA 1F68A 4NR4A 3KNVA 4ZW1A 4WIVA 2N9GA 2RI7A 5FG4A 4PCIA 2YSMA 3P5OA 5EVAA 5FE3A 5L98A 4O78A 3N9LA 4O71A 5FE8A 5SVIA 2H0DB 5DYUA 5CPEA 4MEQA 2JMJA 2VJFB 3M7KA 4YADA 3TLPA 4QQ4A 1BORA 4ZQLA 2KWKA 2YHOA 5TDWA 5B75A 5HENA 4FO9A 5LCWB 3JVJA 4OUFA 3QZSA 2H0DA 5F2PA 4KCXA 2YSJA 3FKMX 2VJFA 3U5NA 3SHBA 2QJ0A 4L58A 3M99A 5LJ2A 4A9NA 5F5ZA 5DKAA 1LDKC 4HXRA 4QC1A 4QSPA 4O62A 5G4SA 3I3JA 5HRWA 5D1MB 4O74A 3AADA 1K2FA 1WEMA 5A81A 2EA6A 3KQIA 5DYAA 4OGEA 5TDRA 5L96A 2YT5A 4BW4A 1G25A 5BT4A 2KGGA 1WUMA 4O72A 5E0RA 4CL9A 2KYUA 3NG2A 4AKHA 5D7XA 2K4DA 2ECTA 1E6IA 3D1DA 2ECWA 4NUDA 4N4HA 4IC3A 1N72A 5F3AA 1VD4A 5TB6A 5E9KA 2VPBA 3UV5A 4AVXA 4MR6A 4N4IA 3PHDA 3ONIA 1WEPA 2LQ6A 4J1PA 2IDAA 2L85A 4LDFA 4QUUA 3UVXA 3N9OA 4YYIA 4GNFA 3L1XA 5CUDA 5IIDA 2LSPB 5HQ6A 5JWMA 5BT3A 5G05B 3RCWA 4IOQA 5DFBA 4TT6A 5A85A 1LDJB 5IG6A 3O34A 2D8UA 2DJAA 4B86C 4YY4A 4X3GA 2KIZA 4YBMA 5EWDA 4S3OB 4LRGA 5ENHA 3U5OA 5JG6A 5L8UA 4LC2A 4BBQA 2FUUA 2I8NA 5D3HA 4YYMA 3GV4A 1WEUA 4YYHA 4LR6A 4XY9A 2KGIA 4H9DA 4QSVA 2MT5A 2NAAA 4GB0A 4HBYA 3ZYQA 4A9HA 4Z6HA 2KU3A 5DINA 5DYCA 1N87A 5FE9A 1F62A 5EQ1A 5DKDA 2CKLA 2E3KA 4ALHA 5AIUA 4MEPA 4QR5A 2Y43A 3LQIA 4J0RA 4NUEA 1JM4B 5CUCA 2XOYA 4NYXA 5B79A 5H85A 3GG3A 5AMFA 2VP7A 1JM7A 2I50A 4TKPB 4BHWA 2RS9B 1MM2A 4YYDA 3ZYUA 1Z2QA 5AITA 3LQJA 5LUUA 3UV2A 4CUTA 4ZDTA 5FE0A 5AD3A 1VYXA 4NS5A 4HBXA 1WEQA 2M85A 4Z1SA 2LGGA 4WHWA 4MSXA 5HELA 4V3KC 4Z93A 5HRVA 4A9MA 5J0DA 1FP0A 2I7KA 3O70A 4ZC9A 4QF2A 4C67A 5C85A 1JM7B 4LYWA 5FFWA 4QSWA 5DFCA 3MQMA 3O47A 5D3TA 5HEMA 5CTLA 5HFRA 4KV1A 4GNEA 4PTBA 2YQDA 5KHMA 3VKGA 2BAYA 2M1RA 4CLBA 3IHPA 2PUYA 3MULA 1ZS5A 2CT2A 4A9KA 2G43A 5J3XA 1WILA 3T7LA 3RTRB 2RO1A 4Q0NA 5ETDA 3MUKA 5LKTA 3FANA 2FSAA 4YYJA 2KWOA 5LJ1A 4NR7A 4O75A 5C8GA 3LDYA 2YW5A 4NQMA 5L99A 3QZTA 5EK9A 5E74A 2UZGA 4HXSA 5IGMA 2OXQC 2YURA 3K2JA 5I86A 4BW2A 5LVQA 1X4JA 4IR4A 1HYJA 3ZPVE 3RPGB 5KO4A 3DAIA 4NRBA 2G6QA 3PUQA 5FEYA 4O7CA 2MNZA 4QY4A 4V3LC 3ZNIA 5E9VA 4AKIA 5HFQA 2QICA 5I3LA 1U6GB 2JMDA 3JUEA 3ZPV1 5EWCA 4A4BA 4YK0A 3SVHA 3FM8C 1WEEA 4I7DA 2ECNA 5FE1A 5TCMA 4XUBA 2E6SA 3MHHA 4FIPA 4YAXA 4O77A 5EPRA 5E7DA 3HMHA 5D0CA 3U5PA 4YBTA 4A49A 5FG5A 3O35A 3AQAA 5CQ5A 4Z1QA 3ZTGA 4N4GA 4WHUA 1PUOA 3MB4A 4NR5A 2YQMA 3EB5A 4GPJA 5FE4A 2R0SA 1Z6UA 4YYKA 5I29A 2R0VA 4BJXA 5F63A 4TZ8A 5D3PA 1T1HA 2L5UA 5CU8A 5FE6A 2CSVA 4IC2A 5DX4A 4P5OB 5ENIA 5C4QA 5CQTA 2EXUA 3EB6A 2YYRA 3DDTA 5FH8A 3N9QA 2OUOA 2E7OA 2KR4A 4CUPA 4F52B 3C5KA 5SVYA 5AMEA 2EGMA 2CSYA 4BW3A 1DCQA 4TZ2A 4UIWA 4UYGA 3PURA 5A82A 3DPLR 4IORA 5LVRA 5II1A 3O7AA 1RMDA 1WE9A 5FB1A 3I2DA 2DVRA 2G4AA 2IQJA 2MUMA 2HYED 5A5QA 4FLPA 4WZ2A 2MA5A 1WUGA 4AYCB 4NR9A 4XYAA 5K29A 5FH6A 4LADB 5CQAA 5I1QA 2P57A 2M13A 3N9NA 3FAOA 4PY6A 5FB0A 4FJCA 4ZUXU 3O37A 3E2DA 3ZVZB 5C89A 2RFJA 2LAUA 5IGKA 2VJEB 5EI4A 4AYCA 3LXJA 2D82A 4TT2A 1WFKA 2VNFA 4HXNA 2JM3A 4R7EA 4X2IA 4OGCA 1V87A 4LK9A 5D3RA 4Q6FA 3KV6A 3Q2FA 4N3WA 4J0SA 4LKAA 2H60A 2RSDA 3RPGC 5CFWA 3VKHA 2C2VS 3U5MA 3FEHA 5TABA 4XUAA 4QNSA 4J3IA 5AD2A 2VJEA 2LXPC 2XB1A 3HMEA 5G4RA 5FE7A 5C87A 2LDRA 4CFLA 2Y1NA 4B7YC 5B8DA 5COIA 2D8SA 2YYNA 5ENBA 4NN2A 5E9MA 5ENFA 4TT4A 5C7NA 4UP0A 3UVWA 4MVTA 5H1VA 5C13A 2Y1MA 4UIVA 5FE5A 4WZ3B 4QUTA 4A9EA 5EV9A 2KWJA 2YVRA 3FL2A 3HCTA 4I7CA 5CP5A 5KTUA 5D3NA 5IGNA 3V43A 1X0JA 2L0BA 1JOCA 3C6WA 3JVKA 4QR3A 4WZ0A 4CCGX 5EA1A 1IYMA 2YUCA 4F1PA 4W4UA 4LZRA 4NYVA 4IR3A 3P1FA 1WIMA 2ECVA 5G04B 4QB3A 5TRBA 4TS8A 5EISA 3LRQA 2YELA 1HYIA 5CQ4A 4S3OC 2ZETC 2XOZA 5EM3A 5HQ7A 4LYIA 5LJ0A 5IBNA 2JRJA 4UIUA 2L5EA 2EJNA 4YH3A 4F3IA 1WENA 1VFYA 2L43A 4LLBA 2MD8C 4PCEA 4YH4A 2LGVA 4TU6A 2R10A 2YHNA 2DVQA 5CRMA 2ECJA 4NUCA 2KFTA 5FFYA 5SVXA 3GL6A 2ECIA 3P1DA 4Q0OA 4DONA 5E3DA 1DVPA 4CUSA 5D24A 3DWDA 4XY8A 4BW1A 2NXBA 4QSUA 3IU6A 1Z60A 5DLXA 4UITA 4LZ2A 5D1LB 1ZBDB 2MIQA 4NRAA 4YYGA 2YEKA 2RNYA 2KKXA 3UW9A 2VPGA 2D9EA 5EPBA 3D1BA 5CY9A 5D26A 2YU4A 4A9IA 3Q1DA 5ENEA 4YABA 5LKZA 2LRIC 5TBNA 4HXMA 5HCLA 5H1TA 3M63A 4Z6IA 3SOXA 1WEWA 5C11A 5HQ5A 4QYDA 4A9FA 3U5KA 4ALGA 2FD4A 4LYSA 5EWVA 3T9KA 3KV5A 5FFVA 1E4UA 5I80A 4MEOA 2MNYA 5B76A 4AKNA 2DWWA 5FDZA 1X4UA 2RR4A 3Q2EA 3HCSA 5CUGA 4UYDA 5II2A 5H1UA 2XOCA 2KKYA 3N9PA 5EPSA 3LJWA 2KTBB 4TTEA 5DBMA 5KU3A 2XEUA 3LQHA 4CURA 2QIZA 3VK6A 4CUQA 4A9JA 5FE2A 2MA6A 2GRCA 5B78A 5ACYA 3MB3A 3HMFA 5CUEA 4UYFB 5HLSA 4QZSA 4O70A 2KE1A 3JVMA 1MM3A 5E73A 2CRRA 3SVGA 3DWYA 5F60A 4UIXA 4QSXA 4C9ZA 4C66A 5A5OA 3UV4A 3S92A 3D7CA 4IR6A 5DW1A 2LN0A 2DSMA 4NYWA 4UYFA 3ERRA 4IR5A 4OGJA 4CUUA 4AKGA 2C2LA 4A4CA 5CQ7A 4GNGA 5DW2A 4E96A 5CRZA 4CFKA 3FJUB 4QSTA 1CHCA 2VPDA 2CRWA 4PPEA 4YATA 4HBWA 4AI6A 3LVRE 4QR4A 2K16A 4Z0RA 2F6JA 4MENA 4A9OA 4QEVA 5I88A 3N9MA 4A9LA 4UI9B 4YC9A 5G0FA 4O7AA 5KH7A 3L1ZB 2KREA 4I7BA 2AN6A 3SUBA 4CA1A 4HBVA 5DKHA 2ECGA 3G0LA 2DKWA 3LJUX 4UYEA 3MDBC 4IOOA 4Z0OA 4KV4A 4UIZA 5I7XA 4HXKA 2DVVA 2YQLA 3ASLA 3P1EA 5BT5A 4L7XA 5HM0A 2CSZA 1X4IA 5F36A 5B77A 3H7HA 5A5RA 3DQVR 4QYLA 4QC3A 5ENCA 5CUAA 2HDPA 3UVYA 5E9YA 5HRXA 3S91A 5ENGA 5EGUA 5D3LA 2YW8A 4MR3A 5KTXA 5K3QA 4NR8A 2B0OE 2CKLB 3SOWA 4YY6A 5E3GA 2DX8A 2FUIA 5D3SA 3NXBA 4LJNA 4TQNA 2MD7B 3MHSA 2E61A 2RNXA 5DYXA 2M3HA 4FK5A 5EICA 5E9IA 5EWHA 2YDWA 5DKCA 3P1CA 5I83A 4QEUA
chains in the Genus database with same CATH topology
5FH7A 5D25A 2G45A 4NRCA 2DVSA 4NXJA 4QEWA 5KTWA 2EGPA 1XWHA 4R2YA 4WA6A 4UYHA 4QSRA 5L97A 1WESA 2M6MA 5A7CA 5CGPA 5IGLA 5CZGA 3JVLA 5FBXA 5A5SA 5KH9A 4AP4A 5KH3A 2WP1A 4O7EA 3O33A 5LKUA 1WEVA 2JMIA 2WP2A 4NQNA 5ETBA 5I89A 4GNDA 5EWWA 1WEOA 1EQFA 4HXPA 5F1LA 4R8PK 4UIYA 2DATA 5D1KB 2R0YA 4YBSA 5CUBA 5A5PA 3M62A 4XI1A 4MR4A 4O7BA 3IU5A 2RNWA 5JI8A 2LGKA 2VPEA 5H9MA 5LKXA 5CS8A 3U5LA 2KWNA 2F42A 5DLZA 4AUQB 4UP5A 2E6RA 4QSQA 4Y03A 4PS5A 4HXOA 5F25A 3T6RA 4MR5A 4O64A 1FBVA 2OO1A 4HXLA 4RVRA 3SOUA 5FG6A 2K17A 5EYAF 5F61A 5I7YA 2PNXA 2F6NA 2YEMA 5A83A 3UVDA 2LXHC 1JSPB 3G0JA 5I40A 5EP7A 3HTKC 4LZSA 3SVFA 1WGMA 5CQ8A 2EODA 2LGLA 3HCUA 5DY7A 5D3JA 5F62A 3ZVYA 2OSSA 2MJVB 4QSSA 2L84A 5F1HA 4OGIA 4A0CD 4YYNA 4N4FA 5L8TA 4O76A 5EU1A 5E9LA 3U5JA 2L80A 3QZVA 5HJCA 5A5NA 5CQ3A 4QF3A 4O7FA 4NR6A 4TU4A 4QBMA 2K1JA 2L75A 5CQ6A 2LV9A 3O36A 3L11A 4PKLA 2E7NA 5DFDA 2YREA 5FERA 5ENJA 3MXFA 4TYLA 1F68A 4NR4A 3KNVA 4ZW1A 4WIVA 2N9GA 2RI7A 5FG4A 4PCIA 2YSMA 3P5OA 5EVAA 5FE3A 5L98A 4O78A 3N9LA 4O71A 5FE8A 2H0DB 5DYUA 5CPEA 4MEQA 2JMJA 2VJFB 4YADA 3TLPA 1BORA 4ZQLA 2KWKA 2YHOA 5TDWA 5B75A 5HENA 4FO9A 5LCWB 3JVJA 4OUFA 3QZSA 2H0DA 5F2PA 4KCXA 2YSJA 3FKMX 2VJFA 3U5NA 3SHBA 2QJ0A 4L58A 3M99A 5LJ2A 4A9NA 5F5ZA 5DKAA 1LDKC 4HXRA 4QC1A 4QSPA 5G4SA 3I3JA 5HRWA 5D1MB 4O74A 3AADA 1K2FA 1WEMA 5A81A 2EA6A 3KQIA 5DYAA 5TDRA 3RPGB 5L96A 2YT5A 4BW4A 1G25A 5BT4A 2KGGA 1WUMA 4O72A 5E0RA 4CL9A 2KYUA 3NG2A 5D7XA 2K4DA 2ECTA 1E6IA 2ECWA 4NUDA 4N4HA 4IC3A 1N72A 5F3AA 1VD4A 5TB6A 5E9KA 2VPBA 3UV5A 4AVXA 4MR6A 4N4IA 3PHDA 3ONIA 1WEPA 2LQ6A 4J1PA 2IDAA 2L85A 4LDFA 4QUUA 3UVXA 3N9OA 4YYIA 4GNFA 3L1XA 5CUDA 5IIDA 2LSPB 5HQ6A 5JWMA 5BT3A 5G05B 3RCWA 4IOQA 5DFBA 4TT6A 5A85A 1LDJB 5IG6A 3O34A 4B86C 4YY4A 4X3GA 2KIZA 4YBMA 5EWDA 4S3OB 4LRGA 5ENHA 3U5OA 5JG6A 5L8UA 4LC2A 4BBQA 2FUUA 2I8NA 5D3HA 4YYMA 3GV4A 1WEUA 4YYHA 4LR6A 4XY9A 2KGIA 4QSVA 2MT5A 2NAAA 4GB0A 4HBYA 3ZYQA 4A9HA 4Z6HA 2KU3A 5DINA 5DYCA 1N87A 5FE9A 1F62A 5EQ1A 5DKDA 2CKLA 2E3KA 4ALHA 5AIUA 4MEPA 4QR5A 2Y43A 3LQIA 4J0RA 4NUEA 1JM4B 5CUCA 5B79A 4NYXA 5H85A 3GG3A 5AMFA 2VP7A 1JM7A 2I50A 4TKPB 4BHWA 2RS9B 1MM2A 4YYDA 3ZYUA 1Z2QA 5AITA 3LQJA 5LUUA 3UV2A 4CUTA 4ZDTA 5FE0A 5AD3A 1VYXA 4NS5A 4HBXA 1WEQA 2M85A 4Z1SA 2LGGA 4WHWA 4MSXA 5HELA 4V3KC 4Z93A 5HRVA 4A9MA 5J0DA 1FP0A 2I7KA 3O70A 4ZC9A 4QF2A 4C67A 5C85A 1JM7B 4LYWA 5FFWA 4QSWA 5DFCA 3MQMA 5D3TA 5HEMA 5CTLA 5HFRA 4KV1A 4GNEA 4PTBA 2YQDA 5KHMA 2BAYA 2M1RA 3IHPA 4CLBA 2PUYA 3MULA 1ZS5A 2CT2A 4A9KA 2G43A 5J3XA 1WILA 3T7LA 3RTRB 2RO1A 4Q0NA 5ETDA 3MUKA 5LKTA 2FSAA 4YYJA 2KWOA 5LJ1A 4NR7A 4O75A 5C8GA 2YW5A 4NQMA 5L99A 3QZTA 5EK9A 5E74A 2UZGA 4HXSA 5IGMA 2OXQC 2YURA 3K2JA 5I86A 4BW2A 5LVQA 1X4JA 4IR4A 1HYJA 3ZPVE 5KO4A 3DAIA 4NRBA 2G6QA 3PUQA 5FEYA 4O7CA 2MNZA 4QY4A 4V3LC 3ZNIA 5E9VA 2QICA 5HFQA 5I3LA 1U6GB 2JMDA 3ZPV1 5EWCA 4A4BA 4YK0A 3SVHA 1WEEA 4I7DA 2ECNA 5FE1A 5TCMA 4XUBA 2E6SA 3MHHA 4FIPA 4YAXA 4O77A 5EPRA 5E7DA 3HMHA 5D0CA 3U5PA 4YBTA 4A49A 5FG5A 3O35A 3AQAA 5CQ5A 4Z1QA 3ZTGA 4N4GA 4WHUA 3MB4A 4NR5A 2YQMA 3EB5A 4GPJA 5FE4A 2R0SA 1Z6UA 4YYKA 5I29A 2R0VA 4BJXA 5F63A 4TZ8A 5D3PA 1T1HA 2L5UA 5CU8A 5FE6A 4IC2A 5DX4A 4P5OB 5ENIA 5C4QA 5CQTA 3EB6A 2YYRA 5FH8A 3N9QA 2OUOA 2E7OA 2KR4A 4CUPA 4F52B 3C5KA 5AMEA 2CSYA 4BW3A 4TZ2A 4UIWA 4UYGA 3PURA 5A82A 3DPLR 4IORA 5LVRA 5II1A 3O7AA 1RMDA 1WE9A 5FB1A 3I2DA 2DVRA 2G4AA 2MUMA 2HYED 5A5QA 4FLPA 4WZ2A 2MA5A 1WUGA 4AYCB 4NR9A 4XYAA 5K29A 5FH6A 4LADB 5CQAA 5I1QA 3N9NA 4PY6A 5FB0A 4FJCA 4ZUXU 3O37A 3ZVZB 5C89A 2RFJA 5IGKA 2VJEB 5EI4A 4AYCA 3LXJA 2D82A 4TT2A 1WFKA 2VNFA 4HXNA 4R7EA 4X2IA 1V87A 4LK9A 5D3RA 4Q6FA 3KV6A 3Q2FA 4N3WA 4J0SA 4LKAA 2H60A 2RSDA 3RPGC 5CFWA 2C2VS 3U5MA 5TABA 4XUAA 4QNSA 4J3IA 5AD2A 2VJEA 2LXPC 2XB1A 3HMEA 5G4RA 5FE7A 5C87A 2LDRA 4CFLA 2Y1NA 4B7YC 5B8DA 5COIA 2D8SA 2YYNA 5ENBA 4NN2A 5E9MA 5ENFA 4TT4A 5C7NA 4UP0A 3UVWA 4MVTA 5H1VA 5C13A 2Y1MA 4UIVA 5FE5A 4WZ3B 4QUTA 4A9EA 5EV9A 2KWJA 3FL2A 3HCTA 4I7CA 5CP5A 5KTUA 5D3NA 5IGNA 3V43A 1X0JA 2L0BA 1JOCA 3C6WA 3JVKA 4QR3A 4WZ0A 4CCGX 5EA1A 1IYMA 2YUCA 4W4UA 4LZRA 4NYVA 4IR3A 3P1FA 1WIMA 2ECVA 5G04B 4QB3A 5TRBA 4TS8A 5EISA 3LRQA 2YELA 1HYIA 5CQ4A 4S3OC 2ZETC 5EM3A 5HQ7A 4LYIA 5LJ0A 5IBNA 2JRJA 4UIUA 2L5EA 4F3IA 4YH3A 1WENA 2L43A 1VFYA 4LLBA 2MD8C 4PCEA 4YH4A 2LGVA 4TU6A 2R10A 2YHNA 2DVQA 5CRMA 2ECJA 4NUCA 2KFTA 5FFYA 3GL6A 2ECIA 3P1DA 4Q0OA 4DONA 5E3DA 1DVPA 4CUSA 5D24A 4XY8A 4BW1A 2NXBA 4QSUA 3IU6A 1Z60A 5DLXA 4UITA 4LZ2A 5D1LB 1ZBDB 2MIQA 4NRAA 4YYGA 2YEKA 2RNYA 3UW9A 2VPGA 2D9EA 5EPBA 5CY9A 5D26A 2YU4A 4A9IA 5ENEA 4YABA 5LKZA 2LRIC 5TBNA 4HXMA 5HCLA 5H1TA 3M63A 4Z6IA 3SOXA 1WEWA 5C11A 5HQ5A 4QYDA 4A9FA 3U5KA 4ALGA 4LYSA 5EWVA 3KV5A 5FFVA 1E4UA 5I80A 4MEOA 2MNYA 5B76A 4AKNA 2DWWA 5FDZA 1X4UA 3Q2EA 3HCSA 5CUGA 4UYDA 5II2A 5H1UA 3N9PA 5EPSA 3LJWA 2KTBB 4TTEA 5DBMA 5KU3A 2XEUA 3LQHA 4CURA 2QIZA 3VK6A 4CUQA 4A9JA 5FE2A 2MA6A 2GRCA 5B78A 5ACYA 3MB3A 3HMFA 5CUEA 4UYFB 5HLSA 4QZSA 4O70A 2KE1A 3JVMA 1MM3A 5E73A 3SVGA 3DWYA 5F60A 4UIXA 4QSXA 4C9ZA 4C66A 5A5OA 3UV4A 3S92A 3D7CA 4IR6A 5DW1A 2LN0A 4NYWA 4UYFA 4IR5A 4OGJA 4CUUA 2C2LA 4A4CA 5CQ7A 4GNGA 5DW2A 4E96A 5CRZA 4CFKA 4QSTA 1CHCA 2VPDA 4PPEA 4YATA 4HBWA 4QR4A 2K16A 2F6JA 4MENA 4A9OA 4QEVA 5I88A 3N9MA 4A9LA 4UI9B 4YC9A 5G0FA 4O7AA 5KH7A 3L1ZB 2KREA 4I7BA 2AN6A 4CA1A 4HBVA 5DKHA 2ECGA 3G0LA 2DKWA 4UYEA 4IOOA 4KV4A 4UIZA 5I7XA 4HXKA 2DVVA 2YQLA 3ASLA 3P1EA 5BT5A 4L7XA 5HM0A 2CSZA 1X4IA 5F36A 5B77A 5A5RA 3DQVR 4QYLA 4QC3A 5ENCA 5CUAA 2HDPA 3UVYA 5E9YA 5HRXA 3S91A 5ENGA 5EGUA 5D3LA 2YW8A 4MR3A 5KTXA 4NR8A 2CKLB 3SOWA 4YY6A 5E3GA 2DX8A 2FUIA 5D3SA 3NXBA 4LJNA 4TQNA 2MD7B 3MHSA 2RNXA 5DYXA 2M3HA 4FK5A 5EICA 5E9IA 5EWHA 2YDWA 5DKCA 3P1CA 5I83A 4QEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FH7 A;  5D25 A;  2G45 A;  4NRC A;  2DVS A;  4NXJ A;  4QEW A;  5KTW A;  2EGP A;  1XWH A;  4R2Y A;  4WA6 A;  4UYH A;  4QSR A;  5L97 A;  1WES A;  2M6M A;  5A7C A;  5CGP A;  5IGL A;  5CZG A;  3JVL A;  5FBX A;  5A5S A;  5KH9 A;  4AP4 A;  5KH3 A;  2WP1 A;  4O7E A;  3O33 A;  5LKU A;  1WEV A;  2JMI A;  2WP2 A;  4NQN A;  5ETB A;  5I89 A;  4GND A;  5EWW A;  1WEO A;  1EQF A;  4HXP A;  5F1L A;  4R8P K;  4UIY A;  2DAT A;  5D1K B;  2R0Y A;  4YBS A;  5CUB A;  5A5P A;  3M62 A;  4XI1 A;  4MR4 A;  4O7B A;  3IU5 A;  2RNW A;  5JI8 A;  2LGK A;  2VPE A;  5H9M A;  5LKX A;  5CS8 A;  3U5L A;  2KWN A;  2F42 A;  5DLZ A;  4AUQ B;  4UP5 A;  2E6R A;  4QSQ A;  4Y03 A;  4PS5 A;  4HXO A;  5F25 A;  3T6R A;  4MR5 A;  4O64 A;  1FBV A;  2OO1 A;  4HXL A;  4RVR A;  3SOU A;  5FG6 A;  2K17 A;  5EYA F;  5F61 A;  5I7Y A;  2PNX A;  2F6N A;  2YEM A;  5A83 A;  3UVD A;  2LXH C;  1JSP B;  3G0J A;  5I40 A;  5EP7 A;  3HTK C;  4LZS A;  3SVF A;  1WGM A;  5CQ8 A;  2EOD A;  2LGL A;  3HCU A;  5DY7 A;  5D3J A;  5F62 A;  3ZVY A;  2OSS A;  2MJV B;  4QSS A;  2L84 A;  5F1H A;  4OGI A;  4A0C D;  4YYN A;  4N4F A;  5L8T A;  4O76 A;  5EU1 A;  5E9L A;  3U5J A;  2L80 A;  3QZV A;  5HJC A;  5A5N A;  5CQ3 A;  4QF3 A;  4O7F A;  4NR6 A;  4TU4 A;  4QBM A;  2K1J A;  2L75 A;  5CQ6 A;  2LV9 A;  3O36 A;  3L11 A;  4PKL A;  2E7N A;  5DFD A;  2YRE A;  5FER A;  5ENJ A;  3MXF A;  4TYL A;  1F68 A;  4NR4 A;  3KNV A;  4ZW1 A;  4WIV A;  2N9G A;  2RI7 A;  5FG4 A;  4PCI A;  2YSM A;  3P5O A;  5EVA A;  5FE3 A;  5L98 A;  4O78 A;  3N9L A;  4O71 A;  5FE8 A;  2H0D B;  5DYU A;  5CPE A;  4MEQ A;  2JMJ A;  2VJF B;  4YAD A;  3TLP A;  1BOR A;  4ZQL A;  2KWK A;  2YHO A;  5TDW A;  5B75 A;  5HEN A;  4FO9 A;  5LCW B;  3JVJ A;  4OUF A;  3QZS A;  2H0D A;  5F2P A;  4KCX A;  2YSJ A;  3FKM X;  2VJF A;  3U5N A;  3SHB A;  2QJ0 A;  4L58 A;  3M99 A;  5LJ2 A;  4A9N A;  5F5Z A;  5DKA A;  1LDK C;  4HXR A;  4QC1 A;  4QSP A;  5G4S A;  3I3J A;  5HRW A;  5D1M B;  4O74 A;  3AAD A;  1K2F A;  1WEM A;  5A81 A;  2EA6 A;  3KQI A;  5DYA A;  5TDR A;  3RPG B;  5L96 A;  2YT5 A;  4BW4 A;  1G25 A;  5BT4 A;  2KGG A;  1WUM A;  4O72 A;  5E0R A;  4CL9 A;  2KYU A;  3NG2 A;  5D7X A;  2K4D A;  2ECT A;  1E6I A;  2ECW A;  4NUD A;  4N4H A;  4IC3 A;  1N72 A;  5F3A A;  1VD4 A;  5TB6 A;  5E9K A;  2VPB A;  3UV5 A;  4AVX A;  4MR6 A;  4N4I A;  3PHD A;  3ONI A;  1WEP A;  2LQ6 A;  4J1P A;  2IDA A;  2L85 A;  4LDF A;  4QUU A;  3UVX A;  3N9O A;  4YYI A;  4GNF A;  3L1X A;  5CUD A;  5IID A;  2LSP B;  5HQ6 A;  5JWM A;  5BT3 A;  5G05 B;  3RCW A;  4IOQ A;  5DFB A;  4TT6 A;  5A85 A;  1LDJ B;  5IG6 A;  3O34 A;  4B86 C;  4YY4 A;  4X3G A;  2KIZ A;  4YBM A;  5EWD A;  4S3O B;  4LRG A;  5ENH A;  3U5O A;  5JG6 A;  5L8U A;  4LC2 A;  4BBQ A;  2FUU A;  2I8N A;  5D3H A;  4YYM A;  3GV4 A;  1WEU A;  4YYH A;  4LR6 A;  4XY9 A;  2KGI A;  4QSV A;  2MT5 A;  2NAA A;  4GB0 A;  4HBY A;  3ZYQ A;  4A9H A;  4Z6H A;  2KU3 A;  5DIN A;  5DYC A;  1N87 A;  5FE9 A;  1F62 A;  5EQ1 A;  5DKD A;  2CKL A;  2E3K A;  4ALH A;  5AIU A;  4MEP A;  4QR5 A;  2Y43 A;  3LQI A;  4J0R A;  4NUE A;  1JM4 B;  5CUC A;  5B79 A;  4NYX A;  5H85 A;  3GG3 A;  5AMF A;  2VP7 A;  1JM7 A;  2I50 A;  4TKP B;  4BHW A;  2RS9 B;  1MM2 A;  4YYD A;  3ZYU A;  1Z2Q A;  5AIT A;  3LQJ A;  5LUU A;  3UV2 A;  4CUT A;  4ZDT A;  5FE0 A;  5AD3 A;  1VYX A;  4NS5 A;  4HBX A;  1WEQ A;  2M85 A;  4Z1S A;  2LGG A;  4WHW A;  4MSX A;  5HEL A;  4V3K C;  4Z93 A;  5HRV A;  4A9M A;  5J0D A;  1FP0 A;  2I7K A;  3O70 A;  4ZC9 A;  4QF2 A;  4C67 A;  5C85 A;  1JM7 B;  4LYW A;  5FFW A;  4QSW A;  5DFC A;  3MQM A;  5D3T A;  5HEM A;  5CTL A;  5HFR A;  4KV1 A;  4GNE A;  4PTB A;  2YQD A;  5KHM A;  2BAY A;  2M1R A;  3IHP A;  4CLB A;  2PUY A;  3MUL A;  1ZS5 A;  2CT2 A;  4A9K A;  2G43 A;  5J3X A;  1WIL A;  3T7L A;  3RTR B;  2RO1 A;  4Q0N A;  5ETD A;  3MUK A;  5LKT A;  2FSA A;  4YYJ A;  2KWO A;  5LJ1 A;  4NR7 A;  4O75 A;  5C8G A;  2YW5 A;  4NQM A;  5L99 A;  3QZT A;  5EK9 A;  5E74 A;  2UZG A;  4HXS A;  5IGM A;  2OXQ C;  2YUR A;  3K2J A;  5I86 A;  4BW2 A;  5LVQ A;  1X4J A;  4IR4 A;  1HYJ A;  3ZPV E;  5KO4 A;  3DAI A;  4NRB A;  2G6Q A;  3PUQ A;  5FEY A;  4O7C A;  2MNZ A;  4QY4 A;  4V3L C;  3ZNI A;  5E9V A;  2QIC A;  5HFQ A;  5I3L A;  1U6G B;  2JMD A;  3ZPV 1;  5EWC A;  4A4B A;  4YK0 A;  3SVH A;  1WEE A;  4I7D A;  2ECN A;  5FE1 A;  5TCM A;  4XUB A;  2E6S A;  3MHH A;  4FIP A;  4YAX A;  4O77 A;  5EPR A;  5E7D A;  3HMH A;  5D0C A;  3U5P A;  4YBT A;  4A49 A;  5FG5 A;  3O35 A;  3AQA A;  5CQ5 A;  4Z1Q A;  3ZTG A;  4N4G A;  4WHU A;  3MB4 A;  4NR5 A;  2YQM A;  3EB5 A;  4GPJ A;  5FE4 A;  2R0S A;  1Z6U A;  4YYK A;  5I29 A;  2R0V A;  4BJX A;  5F63 A;  4TZ8 A;  5D3P A;  1T1H A;  2L5U A;  5CU8 A;  5FE6 A;  4IC2 A;  5DX4 A;  4P5O B;  5ENI A;  5C4Q A;  5CQT A;  3EB6 A;  2YYR A;  5FH8 A;  3N9Q A;  2OUO A;  2E7O A;  2KR4 A;  4CUP A;  4F52 B;  3C5K A;  5AME A;  2CSY A;  4BW3 A;  4TZ2 A;  4UIW A;  4UYG A;  3PUR A;  5A82 A;  3DPL R;  4IOR A;  5LVR A;  5II1 A;  3O7A A;  1RMD A;  1WE9 A;  5FB1 A;  3I2D A;  2DVR A;  2G4A A;  2MUM A;  2HYE D;  5A5Q A;  4FLP A;  4WZ2 A;  2MA5 A;  1WUG A;  4AYC B;  4NR9 A;  4XYA A;  5K29 A;  5FH6 A;  4LAD B;  5CQA A;  5I1Q A;  3N9N A;  4PY6 A;  5FB0 A;  4FJC A;  4ZUX U;  3O37 A;  3ZVZ B;  5C89 A;  2RFJ A;  5IGK A;  2VJE B;  5EI4 A;  4AYC A;  3LXJ A;  2D82 A;  4TT2 A;  1WFK A;  2VNF A;  4HXN A;  4R7E A;  4X2I A;  1V87 A;  4LK9 A;  5D3R A;  4Q6F A;  3KV6 A;  3Q2F A;  4N3W A;  4J0S A;  4LKA A;  2H60 A;  2RSD A;  3RPG C;  5CFW A;  2C2V S;  3U5M A;  5TAB A;  4XUA A;  4QNS A;  4J3I A;  5AD2 A;  2VJE A;  2LXP C;  2XB1 A;  3HME A;  5G4R A;  5FE7 A;  5C87 A;  2LDR A;  4CFL A;  2Y1N A;  4B7Y C;  5B8D A;  5COI A;  2D8S A;  2YYN A;  5ENB A;  4NN2 A;  5E9M A;  5ENF A;  4TT4 A;  5C7N A;  4UP0 A;  3UVW A;  4MVT A;  5H1V A;  5C13 A;  2Y1M A;  4UIV A;  5FE5 A;  4WZ3 B;  4QUT A;  4A9E A;  5EV9 A;  2KWJ A;  3FL2 A;  3HCT A;  4I7C A;  5CP5 A;  5KTU A;  5D3N A;  5IGN A;  3V43 A;  1X0J A;  2L0B A;  1JOC A;  3C6W A;  3JVK A;  4QR3 A;  4WZ0 A;  4CCG X;  5EA1 A;  1IYM A;  2YUC A;  4W4U A;  4LZR A;  4NYV A;  4IR3 A;  3P1F A;  1WIM A;  2ECV A;  5G04 B;  4QB3 A;  5TRB A;  4TS8 A;  5EIS A;  3LRQ A;  2YEL A;  1HYI A;  5CQ4 A;  4S3O C;  2ZET C;  5EM3 A;  5HQ7 A;  4LYI A;  5LJ0 A;  5IBN A;  2JRJ A;  4UIU A;  2L5E A;  4F3I A;  4YH3 A;  1WEN A;  2L43 A;  1VFY A;  4LLB A;  2MD8 C;  4PCE A;  4YH4 A;  2LGV A;  4TU6 A;  2R10 A;  2YHN A;  2DVQ A;  5CRM A;  2ECJ A;  4NUC A;  2KFT A;  5FFY A;  3GL6 A;  2ECI A;  3P1D A;  4Q0O A;  4DON A;  5E3D A;  1DVP A;  4CUS A;  5D24 A;  4XY8 A;  4BW1 A;  2NXB A;  4QSU A;  3IU6 A;  1Z60 A;  5DLX A;  4UIT A;  4LZ2 A;  5D1L B;  1ZBD B;  2MIQ A;  4NRA A;  4YYG A;  2YEK A;  2RNY A;  3UW9 A;  2VPG A;  2D9E A;  5EPB A;  5CY9 A;  5D26 A;  2YU4 A;  4A9I A;  5ENE A;  4YAB A;  5LKZ A;  2LRI C;  5TBN A;  4HXM A;  5HCL A;  5H1T A;  3M63 A;  4Z6I A;  3SOX A;  1WEW A;  5C11 A;  5HQ5 A;  4QYD A;  4A9F A;  3U5K A;  4ALG A;  4LYS A;  5EWV A;  3KV5 A;  5FFV A;  1E4U A;  5I80 A;  4MEO A;  2MNY A;  5B76 A;  4AKN A;  2DWW A;  5FDZ A;  1X4U A;  3Q2E A;  3HCS A;  5CUG A;  4UYD A;  5II2 A;  5H1U A;  3N9P A;  5EPS A;  3LJW A;  2KTB B;  4TTE A;  5DBM A;  5KU3 A;  2XEU A;  3LQH A;  4CUR A;  2QIZ A;  3VK6 A;  4CUQ A;  4A9J A;  5FE2 A;  2MA6 A;  2GRC A;  5B78 A;  5ACY A;  3MB3 A;  3HMF A;  5CUE A;  4UYF B;  5HLS A;  4QZS A;  4O70 A;  2KE1 A;  3JVM A;  1MM3 A;  5E73 A;  3SVG A;  3DWY A;  5F60 A;  4UIX A;  4QSX A;  4C9Z A;  4C66 A;  5A5O A;  3UV4 A;  3S92 A;  3D7C A;  4IR6 A;  5DW1 A;  2LN0 A;  4NYW A;  4UYF A;  4IR5 A;  4OGJ A;  4CUU A;  2C2L A;  4A4C A;  5CQ7 A;  4GNG A;  5DW2 A;  4E96 A;  5CRZ A;  4CFK A;  4QST A;  1CHC A;  2VPD A;  4PPE A;  4YAT A;  4HBW A;  4QR4 A;  2K16 A;  2F6J A;  4MEN A;  4A9O A;  4QEV A;  5I88 A;  3N9M A;  4A9L A;  4UI9 B;  4YC9 A;  5G0F A;  4O7A A;  5KH7 A;  3L1Z B;  2KRE A;  4I7B A;  2AN6 A;  4CA1 A;  4HBV A;  5DKH A;  2ECG A;  3G0L A;  2DKW A;  4UYE A;  4IOO A;  4KV4 A;  4UIZ A;  5I7X A;  4HXK A;  2DVV A;  2YQL A;  3ASL A;  3P1E A;  5BT5 A;  4L7X A;  5HM0 A;  2CSZ A;  1X4I A;  5F36 A;  5B77 A;  5A5R A;  3DQV R;  4QYL A;  4QC3 A;  5ENC A;  5CUA A;  2HDP A;  3UVY A;  5E9Y A;  5HRX A;  3S91 A;  5ENG A;  5EGU A;  5D3L A;  2YW8 A;  4MR3 A;  5KTX A;  4NR8 A;  2CKL B;  3SOW A;  4YY6 A;  5E3G A;  2DX8 A;  2FUI A;  5D3S A;  3NXB A;  4LJN A;  4TQN A;  2MD7 B;  3MHS A;  2RNX A;  5DYX A;  2M3H A;  4FK5 A;  5EIC A;  5E9I A;  5EWH A;  2YDW A;  5DKC A;  3P1C A;  5I83 A;  4QEU A; 
#chains in the Genus database with same CATH topology
 5FH7 A;  2XP0 A;  5D25 A;  2G45 A;  4NRC A;  2DVS A;  4NXJ A;  4QEW A;  5KTW A;  2EGP A;  1XWH A;  2MKE A;  4R2Y A;  4UYH A;  4WA6 A;  4QSR A;  5L97 A;  1ZKR A;  1WES A;  5A7C A;  5CGP A;  5IGL A;  2JUN A;  2M6M A;  5CZG A;  3JVL A;  5FBX A;  5A5S A;  5KH9 A;  4AP4 A;  5KH3 A;  2WP1 A;  4O7E A;  3O33 A;  5LKU A;  1WEV A;  2JMI A;  2OWA A;  2WP2 A;  4NQN A;  5ETB A;  5I89 A;  4GND A;  5EWW A;  1WEO A;  1EQF A;  4HXP A;  5F1L A;  2L7P A;  4R8P K;  4UIY A;  2DAT A;  5D1K B;  2R0Y A;  4YBS A;  5CUB A;  5A5P A;  3M62 A;  4XI1 A;  4MR4 A;  4O7B A;  3IU5 A;  2RNW A;  5JI8 A;  2LGK A;  2VPE A;  5H9M A;  5LKX A;  5CS8 A;  3U5L A;  2KWN A;  2F42 A;  5DLZ A;  4AUQ B;  4UP5 A;  2E6R A;  4QSQ A;  4Y03 A;  4PS5 A;  4HXO A;  5F25 A;  3T6R A;  4MR5 A;  4O64 A;  2FFW A;  1FBV A;  2OO1 A;  4HXL A;  4RVR A;  3SOU A;  5FG6 A;  2CON A;  2K17 A;  5EYA F;  5F61 A;  5I7Y A;  2PNX A;  2F6N A;  2YEM A;  5A83 A;  3UVD A;  2LXH C;  3PLW A;  1JSP B;  3G0J A;  5I40 A;  5EP7 A;  3HTK C;  4LZS A;  3SVF A;  1WGM A;  5CQ8 A;  2EOD A;  2LGL A;  3HCU A;  5DY7 A;  5D3J A;  5F62 A;  3ZVY A;  2OSS A;  2MJV B;  4QSS A;  2L84 A;  5F1H A;  4OGI A;  4A0C D;  4YYN A;  4N4F A;  5L8T A;  3LVQ E;  4O76 A;  5EU1 A;  5E9L A;  3U5J A;  2L80 A;  3QZV A;  5HJC A;  5A5N A;  5CQ3 A;  4QF3 A;  4O7F A;  4NR6 A;  4TU4 A;  4QBM A;  2K1J A;  2L75 A;  5CQ6 A;  2LV9 A;  3KDE C;  3O36 A;  3L11 A;  4PKL A;  2E7N A;  5DFD A;  5SVI B;  2YRE A;  5FER A;  5ENJ A;  3MXF A;  4TYL A;  1MBM A;  1F68 A;  4NR4 A;  3KNV A;  4ZW1 A;  4WIV A;  2N9G A;  2RI7 A;  5FG4 A;  4PCI A;  2YSM A;  3P5O A;  5EVA A;  5FE3 A;  5L98 A;  4O78 A;  3N9L A;  4O71 A;  5FE8 A;  5SVI A;  2H0D B;  5DYU A;  5CPE A;  4MEQ A;  2JMJ A;  2VJF B;  3M7K A;  4YAD A;  3TLP A;  4QQ4 A;  1BOR A;  4ZQL A;  2KWK A;  2YHO A;  5TDW A;  5B75 A;  5HEN A;  4FO9 A;  5LCW B;  3JVJ A;  4OUF A;  3QZS A;  2H0D A;  5F2P A;  4KCX A;  2YSJ A;  3FKM X;  2VJF A;  3U5N A;  3SHB A;  2QJ0 A;  4L58 A;  3M99 A;  5LJ2 A;  4A9N A;  5F5Z A;  5DKA A;  1LDK C;  4HXR A;  4QC1 A;  4QSP A;  4O62 A;  5G4S A;  3I3J A;  5HRW A;  5D1M B;  4O74 A;  3AAD A;  1K2F A;  1WEM A;  5A81 A;  2EA6 A;  3KQI A;  5DYA A;  4OGE A;  5TDR A;  5L96 A;  2YT5 A;  4BW4 A;  1G25 A;  5BT4 A;  2KGG A;  1WUM A;  4O72 A;  5E0R A;  4CL9 A;  2KYU A;  3NG2 A;  4AKH A;  5D7X A;  2K4D A;  2ECT A;  1E6I A;  3D1D A;  2ECW A;  4NUD A;  4N4H A;  4IC3 A;  1N72 A;  5F3A A;  1VD4 A;  5TB6 A;  5E9K A;  2VPB A;  3UV5 A;  4AVX A;  4MR6 A;  4N4I A;  3PHD A;  3ONI A;  1WEP A;  2LQ6 A;  4J1P A;  2IDA A;  2L85 A;  4LDF A;  4QUU A;  3UVX A;  3N9O A;  4YYI A;  4GNF A;  3L1X A;  5CUD A;  5IID A;  2LSP B;  5HQ6 A;  5JWM A;  5BT3 A;  5G05 B;  3RCW A;  4IOQ A;  5DFB A;  4TT6 A;  5A85 A;  1LDJ B;  5IG6 A;  3O34 A;  2D8U A;  2DJA A;  4B86 C;  4YY4 A;  4X3G A;  2KIZ A;  4YBM A;  5EWD A;  4S3O B;  4LRG A;  5ENH A;  3U5O A;  5JG6 A;  5L8U A;  4LC2 A;  4BBQ A;  2FUU A;  2I8N A;  5D3H A;  4YYM A;  3GV4 A;  1WEU A;  4YYH A;  4LR6 A;  4XY9 A;  2KGI A;  4H9D A;  4QSV A;  2MT5 A;  2NAA A;  4GB0 A;  4HBY A;  3ZYQ A;  4A9H A;  4Z6H A;  2KU3 A;  5DIN A;  5DYC A;  1N87 A;  5FE9 A;  1F62 A;  5EQ1 A;  5DKD A;  2CKL A;  2E3K A;  4ALH A;  5AIU A;  4MEP A;  4QR5 A;  2Y43 A;  3LQI A;  4J0R A;  4NUE A;  1JM4 B;  5CUC A;  2XOY A;  4NYX A;  5B79 A;  5H85 A;  3GG3 A;  5AMF A;  2VP7 A;  1JM7 A;  2I50 A;  4TKP B;  4BHW A;  2RS9 B;  1MM2 A;  4YYD A;  3ZYU A;  1Z2Q A;  5AIT A;  3LQJ A;  5LUU A;  3UV2 A;  4CUT A;  4ZDT A;  5FE0 A;  5AD3 A;  1VYX A;  4NS5 A;  4HBX A;  1WEQ A;  2M85 A;  4Z1S A;  2LGG A;  4WHW A;  4MSX A;  5HEL A;  4V3K C;  4Z93 A;  5HRV A;  4A9M A;  5J0D A;  1FP0 A;  2I7K A;  3O70 A;  4ZC9 A;  4QF2 A;  4C67 A;  5C85 A;  1JM7 B;  4LYW A;  5FFW A;  4QSW A;  5DFC A;  3MQM A;  3O47 A;  5D3T A;  5HEM A;  5CTL A;  5HFR A;  4KV1 A;  4GNE A;  4PTB A;  2YQD A;  5KHM A;  3VKG A;  2BAY A;  2M1R A;  4CLB A;  3IHP A;  2PUY A;  3MUL A;  1ZS5 A;  2CT2 A;  4A9K A;  2G43 A;  5J3X A;  1WIL A;  3T7L A;  3RTR B;  2RO1 A;  4Q0N A;  5ETD A;  3MUK A;  5LKT A;  3FAN A;  2FSA A;  4YYJ A;  2KWO A;  5LJ1 A;  4NR7 A;  4O75 A;  5C8G A;  3LDY A;  2YW5 A;  4NQM A;  5L99 A;  3QZT A;  5EK9 A;  5E74 A;  2UZG A;  4HXS A;  5IGM A;  2OXQ C;  2YUR A;  3K2J A;  5I86 A;  4BW2 A;  5LVQ A;  1X4J A;  4IR4 A;  1HYJ A;  3ZPV E;  3RPG B;  5KO4 A;  3DAI A;  4NRB A;  2G6Q A;  3PUQ A;  5FEY A;  4O7C A;  2MNZ A;  4QY4 A;  4V3L C;  3ZNI A;  5E9V A;  4AKI A;  5HFQ A;  2QIC A;  5I3L A;  1U6G B;  2JMD A;  3JUE A;  3ZPV 1;  5EWC A;  4A4B A;  4YK0 A;  3SVH A;  3FM8 C;  1WEE A;  4I7D A;  2ECN A;  5FE1 A;  5TCM A;  4XUB A;  2E6S A;  3MHH A;  4FIP A;  4YAX A;  4O77 A;  5EPR A;  5E7D A;  3HMH A;  5D0C A;  3U5P A;  4YBT A;  4A49 A;  5FG5 A;  3O35 A;  3AQA A;  5CQ5 A;  4Z1Q A;  3ZTG A;  4N4G A;  4WHU A;  1PUO A;  3MB4 A;  4NR5 A;  2YQM A;  3EB5 A;  4GPJ A;  5FE4 A;  2R0S A;  1Z6U A;  4YYK A;  5I29 A;  2R0V A;  4BJX A;  5F63 A;  4TZ8 A;  5D3P A;  1T1H A;  2L5U A;  5CU8 A;  5FE6 A;  2CSV A;  4IC2 A;  5DX4 A;  4P5O B;  5ENI A;  5C4Q A;  5CQT A;  2EXU A;  3EB6 A;  2YYR A;  3DDT A;  5FH8 A;  3N9Q A;  2OUO A;  2E7O A;  2KR4 A;  4CUP A;  4F52 B;  3C5K A;  5SVY A;  5AME A;  2EGM A;  2CSY A;  4BW3 A;  1DCQ A;  4TZ2 A;  4UIW A;  4UYG A;  3PUR A;  5A82 A;  3DPL R;  4IOR A;  5LVR A;  5II1 A;  3O7A A;  1RMD A;  1WE9 A;  5FB1 A;  3I2D A;  2DVR A;  2G4A A;  2IQJ A;  2MUM A;  2HYE D;  5A5Q A;  4FLP A;  4WZ2 A;  2MA5 A;  1WUG A;  4AYC B;  4NR9 A;  4XYA A;  5K29 A;  5FH6 A;  4LAD B;  5CQA A;  5I1Q A;  2P57 A;  2M13 A;  3N9N A;  3FAO A;  4PY6 A;  5FB0 A;  4FJC A;  4ZUX U;  3O37 A;  3E2D A;  3ZVZ B;  5C89 A;  2RFJ A;  2LAU A;  5IGK A;  2VJE B;  5EI4 A;  4AYC A;  3LXJ A;  2D82 A;  4TT2 A;  1WFK A;  2VNF A;  4HXN A;  2JM3 A;  4R7E A;  4X2I A;  4OGC A;  1V87 A;  4LK9 A;  5D3R A;  4Q6F A;  3KV6 A;  3Q2F A;  4N3W A;  4J0S A;  4LKA A;  2H60 A;  2RSD A;  3RPG C;  5CFW A;  3VKH A;  2C2V S;  3U5M A;  3FEH A;  5TAB A;  4XUA A;  4QNS A;  4J3I A;  5AD2 A;  2VJE A;  2LXP C;  2XB1 A;  3HME A;  5G4R A;  5FE7 A;  5C87 A;  2LDR A;  4CFL A;  2Y1N A;  4B7Y C;  5B8D A;  5COI A;  2D8S A;  2YYN A;  5ENB A;  4NN2 A;  5E9M A;  5ENF A;  4TT4 A;  5C7N A;  4UP0 A;  3UVW A;  4MVT A;  5H1V A;  5C13 A;  2Y1M A;  4UIV A;  5FE5 A;  4WZ3 B;  4QUT A;  4A9E A;  5EV9 A;  2KWJ A;  2YVR A;  3FL2 A;  3HCT A;  4I7C A;  5CP5 A;  5KTU A;  5D3N A;  5IGN A;  3V43 A;  1X0J A;  2L0B A;  1JOC A;  3C6W A;  3JVK A;  4QR3 A;  4WZ0 A;  4CCG X;  5EA1 A;  1IYM A;  2YUC A;  4F1P A;  4W4U A;  4LZR A;  4NYV A;  4IR3 A;  3P1F A;  1WIM A;  2ECV A;  5G04 B;  4QB3 A;  5TRB A;  4TS8 A;  5EIS A;  3LRQ A;  2YEL A;  1HYI A;  5CQ4 A;  4S3O C;  2ZET C;  2XOZ A;  5EM3 A;  5HQ7 A;  4LYI A;  5LJ0 A;  5IBN A;  2JRJ A;  4UIU A;  2L5E A;  2EJN A;  4YH3 A;  4F3I A;  1WEN A;  1VFY A;  2L43 A;  4LLB A;  2MD8 C;  4PCE A;  4YH4 A;  2LGV A;  4TU6 A;  2R10 A;  2YHN A;  2DVQ A;  5CRM A;  2ECJ A;  4NUC A;  2KFT A;  5FFY A;  5SVX A;  3GL6 A;  2ECI A;  3P1D A;  4Q0O A;  4DON A;  5E3D A;  1DVP A;  4CUS A;  5D24 A;  3DWD A;  4XY8 A;  4BW1 A;  2NXB A;  4QSU A;  3IU6 A;  1Z60 A;  5DLX A;  4UIT A;  4LZ2 A;  5D1L B;  1ZBD B;  2MIQ A;  4NRA A;  4YYG A;  2YEK A;  2RNY A;  2KKX A;  3UW9 A;  2VPG A;  2D9E A;  5EPB A;  3D1B A;  5CY9 A;  5D26 A;  2YU4 A;  4A9I A;  3Q1D A;  5ENE A;  4YAB A;  5LKZ A;  2LRI C;  5TBN A;  4HXM A;  5HCL A;  5H1T A;  3M63 A;  4Z6I A;  3SOX A;  1WEW A;  5C11 A;  5HQ5 A;  4QYD A;  4A9F A;  3U5K A;  4ALG A;  2FD4 A;  4LYS A;  5EWV A;  3T9K A;  3KV5 A;  5FFV A;  1E4U A;  5I80 A;  4MEO A;  2MNY A;  5B76 A;  4AKN A;  2DWW A;  5FDZ A;  1X4U A;  2RR4 A;  3Q2E A;  3HCS A;  5CUG A;  4UYD A;  5II2 A;  5H1U A;  2XOC A;  2KKY A;  3N9P A;  5EPS A;  3LJW A;  2KTB B;  4TTE A;  5DBM A;  5KU3 A;  2XEU A;  3LQH A;  4CUR A;  2QIZ A;  3VK6 A;  4CUQ A;  4A9J A;  5FE2 A;  2MA6 A;  2GRC A;  5B78 A;  5ACY A;  3MB3 A;  3HMF A;  5CUE A;  4UYF B;  5HLS A;  4QZS A;  4O70 A;  2KE1 A;  3JVM A;  1MM3 A;  5E73 A;  2CRR A;  3SVG A;  3DWY A;  5F60 A;  4UIX A;  4QSX A;  4C9Z A;  4C66 A;  5A5O A;  3UV4 A;  3S92 A;  3D7C A;  4IR6 A;  5DW1 A;  2LN0 A;  2DSM A;  4NYW A;  4UYF A;  3ERR A;  4IR5 A;  4OGJ A;  4CUU A;  4AKG A;  2C2L A;  4A4C A;  5CQ7 A;  4GNG A;  5DW2 A;  4E96 A;  5CRZ A;  4CFK A;  3FJU B;  4QST A;  1CHC A;  2VPD A;  2CRW A;  4PPE A;  4YAT A;  4HBW A;  4AI6 A;  3LVR E;  4QR4 A;  2K16 A;  4Z0R A;  2F6J A;  4MEN A;  4A9O A;  4QEV A;  5I88 A;  3N9M A;  4A9L A;  4UI9 B;  4YC9 A;  5G0F A;  4O7A A;  5KH7 A;  3L1Z B;  2KRE A;  4I7B A;  2AN6 A;  3SUB A;  4CA1 A;  4HBV A;  5DKH A;  2ECG A;  3G0L A;  2DKW A;  3LJU X;  4UYE A;  3MDB C;  4IOO A;  4Z0O A;  4KV4 A;  4UIZ A;  5I7X A;  4HXK A;  2DVV A;  2YQL A;  3ASL A;  3P1E A;  5BT5 A;  4L7X A;  5HM0 A;  2CSZ A;  1X4I A;  5F36 A;  5B77 A;  3H7H A;  5A5R A;  3DQV R;  4QYL A;  4QC3 A;  5ENC A;  5CUA A;  2HDP A;  3UVY A;  5E9Y A;  5HRX A;  3S91 A;  5ENG A;  5EGU A;  5D3L A;  2YW8 A;  4MR3 A;  5KTX A;  5K3Q A;  4NR8 A;  2B0O E;  2CKL B;  3SOW A;  4YY6 A;  5E3G A;  2DX8 A;  2FUI A;  5D3S A;  3NXB A;  4LJN A;  4TQN A;  2MD7 B;  3MHS A;  2E61 A;  2RNX A;  5DYX A;  2M3H A;  4FK5 A;  5EIC A;  5E9I A;  5EWH A;  2YDW A;  5DKC A;  3P1C A;  5I83 A;  4QEU A; 
#chains in the Genus database with same CATH homology
 5FH7 A;  5D25 A;  2G45 A;  4NRC A;  2DVS A;  4NXJ A;  4QEW A;  5KTW A;  2EGP A;  1XWH A;  4R2Y A;  4WA6 A;  4UYH A;  4QSR A;  5L97 A;  1WES A;  2M6M A;  5A7C A;  5CGP A;  5IGL A;  5CZG A;  3JVL A;  5FBX A;  5A5S A;  5KH9 A;  4AP4 A;  5KH3 A;  2WP1 A;  4O7E A;  3O33 A;  5LKU A;  1WEV A;  2JMI A;  2WP2 A;  4NQN A;  5ETB A;  5I89 A;  4GND A;  5EWW A;  1WEO A;  1EQF A;  4HXP A;  5F1L A;  4R8P K;  4UIY A;  2DAT A;  5D1K B;  2R0Y A;  4YBS A;  5CUB A;  5A5P A;  3M62 A;  4XI1 A;  4MR4 A;  4O7B A;  3IU5 A;  2RNW A;  5JI8 A;  2LGK A;  2VPE A;  5H9M A;  5LKX A;  5CS8 A;  3U5L A;  2KWN A;  2F42 A;  5DLZ A;  4AUQ B;  4UP5 A;  2E6R A;  4QSQ A;  4Y03 A;  4PS5 A;  4HXO A;  5F25 A;  3T6R A;  4MR5 A;  4O64 A;  1FBV A;  2OO1 A;  4HXL A;  4RVR A;  3SOU A;  5FG6 A;  2K17 A;  5EYA F;  5F61 A;  5I7Y A;  2PNX A;  2F6N A;  2YEM A;  5A83 A;  3UVD A;  2LXH C;  1JSP B;  3G0J A;  5I40 A;  5EP7 A;  3HTK C;  4LZS A;  3SVF A;  1WGM A;  5CQ8 A;  2EOD A;  2LGL A;  3HCU A;  5DY7 A;  5D3J A;  5F62 A;  3ZVY A;  2OSS A;  2MJV B;  4QSS A;  2L84 A;  5F1H A;  4OGI A;  4A0C D;  4YYN A;  4N4F A;  5L8T A;  4O76 A;  5EU1 A;  5E9L A;  3U5J A;  2L80 A;  3QZV A;  5HJC A;  5A5N A;  5CQ3 A;  4QF3 A;  4O7F A;  4NR6 A;  4TU4 A;  4QBM A;  2K1J A;  2L75 A;  5CQ6 A;  2LV9 A;  3O36 A;  3L11 A;  4PKL A;  2E7N A;  5DFD A;  2YRE A;  5FER A;  5ENJ A;  3MXF A;  4TYL A;  1F68 A;  4NR4 A;  3KNV A;  4ZW1 A;  4WIV A;  2N9G A;  2RI7 A;  5FG4 A;  4PCI A;  2YSM A;  3P5O A;  5EVA A;  5FE3 A;  5L98 A;  4O78 A;  3N9L A;  4O71 A;  5FE8 A;  2H0D B;  5DYU A;  5CPE A;  4MEQ A;  2JMJ A;  2VJF B;  4YAD A;  3TLP A;  1BOR A;  4ZQL A;  2KWK A;  2YHO A;  5TDW A;  5B75 A;  5HEN A;  4FO9 A;  5LCW B;  3JVJ A;  4OUF A;  3QZS A;  2H0D A;  5F2P A;  4KCX A;  2YSJ A;  3FKM X;  2VJF A;  3U5N A;  3SHB A;  2QJ0 A;  4L58 A;  3M99 A;  5LJ2 A;  4A9N A;  5F5Z A;  5DKA A;  1LDK C;  4HXR A;  4QC1 A;  4QSP A;  5G4S A;  3I3J A;  5HRW A;  5D1M B;  4O74 A;  3AAD A;  1K2F A;  1WEM A;  5A81 A;  2EA6 A;  3KQI A;  5DYA A;  5TDR A;  3RPG B;  5L96 A;  2YT5 A;  4BW4 A;  1G25 A;  5BT4 A;  2KGG A;  1WUM A;  4O72 A;  5E0R A;  4CL9 A;  2KYU A;  3NG2 A;  5D7X A;  2K4D A;  2ECT A;  1E6I A;  2ECW A;  4NUD A;  4N4H A;  4IC3 A;  1N72 A;  5F3A A;  1VD4 A;  5TB6 A;  5E9K A;  2VPB A;  3UV5 A;  4AVX A;  4MR6 A;  4N4I A;  3PHD A;  3ONI A;  1WEP A;  2LQ6 A;  4J1P A;  2IDA A;  2L85 A;  4LDF A;  4QUU A;  3UVX A;  3N9O A;  4YYI A;  4GNF A;  3L1X A;  5CUD A;  5IID A;  2LSP B;  5HQ6 A;  5JWM A;  5BT3 A;  5G05 B;  3RCW A;  4IOQ A;  5DFB A;  4TT6 A;  5A85 A;  1LDJ B;  5IG6 A;  3O34 A;  4B86 C;  4YY4 A;  4X3G A;  2KIZ A;  4YBM A;  5EWD A;  4S3O B;  4LRG A;  5ENH A;  3U5O A;  5JG6 A;  5L8U A;  4LC2 A;  4BBQ A;  2FUU A;  2I8N A;  5D3H A;  4YYM A;  3GV4 A;  1WEU A;  4YYH A;  4LR6 A;  4XY9 A;  2KGI A;  4QSV A;  2MT5 A;  2NAA A;  4GB0 A;  4HBY A;  3ZYQ A;  4A9H A;  4Z6H A;  2KU3 A;  5DIN A;  5DYC A;  1N87 A;  5FE9 A;  1F62 A;  5EQ1 A;  5DKD A;  2CKL A;  2E3K A;  4ALH A;  5AIU A;  4MEP A;  4QR5 A;  2Y43 A;  3LQI A;  4J0R A;  4NUE A;  1JM4 B;  5CUC A;  5B79 A;  4NYX A;  5H85 A;  3GG3 A;  5AMF A;  2VP7 A;  1JM7 A;  2I50 A;  4TKP B;  4BHW A;  2RS9 B;  1MM2 A;  4YYD A;  3ZYU A;  1Z2Q A;  5AIT A;  3LQJ A;  5LUU A;  3UV2 A;  4CUT A;  4ZDT A;  5FE0 A;  5AD3 A;  1VYX A;  4NS5 A;  4HBX A;  1WEQ A;  2M85 A;  4Z1S A;  2LGG A;  4WHW A;  4MSX A;  5HEL A;  4V3K C;  4Z93 A;  5HRV A;  4A9M A;  5J0D A;  1FP0 A;  2I7K A;  3O70 A;  4ZC9 A;  4QF2 A;  4C67 A;  5C85 A;  1JM7 B;  4LYW A;  5FFW A;  4QSW A;  5DFC A;  3MQM A;  5D3T A;  5HEM A;  5CTL A;  5HFR A;  4KV1 A;  4GNE A;  4PTB A;  2YQD A;  5KHM A;  2BAY A;  2M1R A;  3IHP A;  4CLB A;  2PUY A;  3MUL A;  1ZS5 A;  2CT2 A;  4A9K A;  2G43 A;  5J3X A;  1WIL A;  3T7L A;  3RTR B;  2RO1 A;  4Q0N A;  5ETD A;  3MUK A;  5LKT A;  2FSA A;  4YYJ A;  2KWO A;  5LJ1 A;  4NR7 A;  4O75 A;  5C8G A;  2YW5 A;  4NQM A;  5L99 A;  3QZT A;  5EK9 A;  5E74 A;  2UZG A;  4HXS A;  5IGM A;  2OXQ C;  2YUR A;  3K2J A;  5I86 A;  4BW2 A;  5LVQ A;  1X4J A;  4IR4 A;  1HYJ A;  3ZPV E;  5KO4 A;  3DAI A;  4NRB A;  2G6Q A;  3PUQ A;  5FEY A;  4O7C A;  2MNZ A;  4QY4 A;  4V3L C;  3ZNI A;  5E9V A;  2QIC A;  5HFQ A;  5I3L A;  1U6G B;  2JMD A;  3ZPV 1;  5EWC A;  4A4B A;  4YK0 A;  3SVH A;  1WEE A;  4I7D A;  2ECN A;  5FE1 A;  5TCM A;  4XUB A;  2E6S A;  3MHH A;  4FIP A;  4YAX A;  4O77 A;  5EPR A;  5E7D A;  3HMH A;  5D0C A;  3U5P A;  4YBT A;  4A49 A;  5FG5 A;  3O35 A;  3AQA A;  5CQ5 A;  4Z1Q A;  3ZTG A;  4N4G A;  4WHU A;  3MB4 A;  4NR5 A;  2YQM A;  3EB5 A;  4GPJ A;  5FE4 A;  2R0S A;  1Z6U A;  4YYK A;  5I29 A;  2R0V A;  4BJX A;  5F63 A;  4TZ8 A;  5D3P A;  1T1H A;  2L5U A;  5CU8 A;  5FE6 A;  4IC2 A;  5DX4 A;  4P5O B;  5ENI A;  5C4Q A;  5CQT A;  3EB6 A;  2YYR A;  5FH8 A;  3N9Q A;  2OUO A;  2E7O A;  2KR4 A;  4CUP A;  4F52 B;  3C5K A;  5AME A;  2CSY A;  4BW3 A;  4TZ2 A;  4UIW A;  4UYG A;  3PUR A;  5A82 A;  3DPL R;  4IOR A;  5LVR A;  5II1 A;  3O7A A;  1RMD A;  1WE9 A;  5FB1 A;  3I2D A;  2DVR A;  2G4A A;  2MUM A;  2HYE D;  5A5Q A;  4FLP A;  4WZ2 A;  2MA5 A;  1WUG A;  4AYC B;  4NR9 A;  4XYA A;  5K29 A;  5FH6 A;  4LAD B;  5CQA A;  5I1Q A;  3N9N A;  4PY6 A;  5FB0 A;  4FJC A;  4ZUX U;  3O37 A;  3ZVZ B;  5C89 A;  2RFJ A;  5IGK A;  2VJE B;  5EI4 A;  4AYC A;  3LXJ A;  2D82 A;  4TT2 A;  1WFK A;  2VNF A;  4HXN A;  4R7E A;  4X2I A;  1V87 A;  4LK9 A;  5D3R A;  4Q6F A;  3KV6 A;  3Q2F A;  4N3W A;  4J0S A;  4LKA A;  2H60 A;  2RSD A;  3RPG C;  5CFW A;  2C2V S;  3U5M A;  5TAB A;  4XUA A;  4QNS A;  4J3I A;  5AD2 A;  2VJE A;  2LXP C;  2XB1 A;  3HME A;  5G4R A;  5FE7 A;  5C87 A;  2LDR A;  4CFL A;  2Y1N A;  4B7Y C;  5B8D A;  5COI A;  2D8S A;  2YYN A;  5ENB A;  4NN2 A;  5E9M A;  5ENF A;  4TT4 A;  5C7N A;  4UP0 A;  3UVW A;  4MVT A;  5H1V A;  5C13 A;  2Y1M A;  4UIV A;  5FE5 A;  4WZ3 B;  4QUT A;  4A9E A;  5EV9 A;  2KWJ A;  3FL2 A;  3HCT A;  4I7C A;  5CP5 A;  5KTU A;  5D3N A;  5IGN A;  3V43 A;  1X0J A;  2L0B A;  1JOC A;  3C6W A;  3JVK A;  4QR3 A;  4WZ0 A;  4CCG X;  5EA1 A;  1IYM A;  2YUC A;  4W4U A;  4LZR A;  4NYV A;  4IR3 A;  3P1F A;  1WIM A;  2ECV A;  5G04 B;  4QB3 A;  5TRB A;  4TS8 A;  5EIS A;  3LRQ A;  2YEL A;  1HYI A;  5CQ4 A;  4S3O C;  2ZET C;  5EM3 A;  5HQ7 A;  4LYI A;  5LJ0 A;  5IBN A;  2JRJ A;  4UIU A;  2L5E A;  4F3I A;  4YH3 A;  1WEN A;  2L43 A;  1VFY A;  4LLB A;  2MD8 C;  4PCE A;  4YH4 A;  2LGV A;  4TU6 A;  2R10 A;  2YHN A;  2DVQ A;  5CRM A;  2ECJ A;  4NUC A;  2KFT A;  5FFY A;  3GL6 A;  2ECI A;  3P1D A;  4Q0O A;  4DON A;  5E3D A;  1DVP A;  4CUS A;  5D24 A;  4XY8 A;  4BW1 A;  2NXB A;  4QSU A;  3IU6 A;  1Z60 A;  5DLX A;  4UIT A;  4LZ2 A;  5D1L B;  1ZBD B;  2MIQ A;  4NRA A;  4YYG A;  2YEK A;  2RNY A;  3UW9 A;  2VPG A;  2D9E A;  5EPB A;  5CY9 A;  5D26 A;  2YU4 A;  4A9I A;  5ENE A;  4YAB A;  5LKZ A;  2LRI C;  5TBN A;  4HXM A;  5HCL A;  5H1T A;  3M63 A;  4Z6I A;  3SOX A;  1WEW A;  5C11 A;  5HQ5 A;  4QYD A;  4A9F A;  3U5K A;  4ALG A;  4LYS A;  5EWV A;  3KV5 A;  5FFV A;  1E4U A;  5I80 A;  4MEO A;  2MNY A;  5B76 A;  4AKN A;  2DWW A;  5FDZ A;  1X4U A;  3Q2E A;  3HCS A;  5CUG A;  4UYD A;  5II2 A;  5H1U A;  3N9P A;  5EPS A;  3LJW A;  2KTB B;  4TTE A;  5DBM A;  5KU3 A;  2XEU A;  3LQH A;  4CUR A;  2QIZ A;  3VK6 A;  4CUQ A;  4A9J A;  5FE2 A;  2MA6 A;  2GRC A;  5B78 A;  5ACY A;  3MB3 A;  3HMF A;  5CUE A;  4UYF B;  5HLS A;  4QZS A;  4O70 A;  2KE1 A;  3JVM A;  1MM3 A;  5E73 A;  3SVG A;  3DWY A;  5F60 A;  4UIX A;  4QSX A;  4C9Z A;  4C66 A;  5A5O A;  3UV4 A;  3S92 A;  3D7C A;  4IR6 A;  5DW1 A;  2LN0 A;  4NYW A;  4UYF A;  4IR5 A;  4OGJ A;  4CUU A;  2C2L A;  4A4C A;  5CQ7 A;  4GNG A;  5DW2 A;  4E96 A;  5CRZ A;  4CFK A;  4QST A;  1CHC A;  2VPD A;  4PPE A;  4YAT A;  4HBW A;  4QR4 A;  2K16 A;  2F6J A;  4MEN A;  4A9O A;  4QEV A;  5I88 A;  3N9M A;  4A9L A;  4UI9 B;  4YC9 A;  5G0F A;  4O7A A;  5KH7 A;  3L1Z B;  2KRE A;  4I7B A;  2AN6 A;  4CA1 A;  4HBV A;  5DKH A;  2ECG A;  3G0L A;  2DKW A;  4UYE A;  4IOO A;  4KV4 A;  4UIZ A;  5I7X A;  4HXK A;  2DVV A;  2YQL A;  3ASL A;  3P1E A;  5BT5 A;  4L7X A;  5HM0 A;  2CSZ A;  1X4I A;  5F36 A;  5B77 A;  5A5R A;  3DQV R;  4QYL A;  4QC3 A;  5ENC A;  5CUA A;  2HDP A;  3UVY A;  5E9Y A;  5HRX A;  3S91 A;  5ENG A;  5EGU A;  5D3L A;  2YW8 A;  4MR3 A;  5KTX A;  4NR8 A;  2CKL B;  3SOW A;  4YY6 A;  5E3G A;  2DX8 A;  2FUI A;  5D3S A;  3NXB A;  4LJN A;  4TQN A;  2MD7 B;  3MHS A;  2RNX A;  5DYX A;  2M3H A;  4FK5 A;  5EIC A;  5E9I A;  5EWH A;  2YDW A;  5DKC A;  3P1C A;  5I83 A;  4QEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...