3QZVA

Crystal structure of bptf phd-linker-bromo in complex with histone h4k12ac peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
b'KLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleosome-remodeling factor subunit BPTF
molecule tags Transcription/nuclear protein
source organism Homo sapiens
publication title Recognition of a Mononucleosomal Histone Modification Pattern by BPTF via Multivalent Interactions.
pubmed doi rcsb
total genus 57
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2011-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3qzvA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3qzvA01
1XWHA 2RSDA 4YYGA 4LYWA 2ECJA 4BBQA 3EB6A 2LGKA 4YYKA 4Z6IA 5IIDA 1JSPB 2CKLB 2MNZA 5F1HA 4QSWA 5F2PA 5ENHA 2M6MA 5FH7A 5E0RA 5F61A 4UIXA 3UVYA 4O75A 4WIVA 4LDFA 5D3PA 5FH6A 3MB4A 5H9MA 5F25A 1MM3A 4WZ2A 4LZSA 1WEWA 4QF2A 4NR4A 2YEKA 5L8UA 2RI7A 4J0RA 4YAXA 4J3IA 2NXBA 5H1UA 2YHOA 4HXLA 4A9JA 1VYXA 2KWOA 4LC2A 3QZSA 5HQ6A 5AMEA 2VJEB 2XEUA 3O7AA 2Y43A 2YSMA 4MEPA 5F1LA 4GNEA 5I83A 2C2LA 2OSSA 4IOQA 5L8TA 4O70A 3U5PA 5I80A 4AVXA 5HQ7A 5A82A 5CQ3A 5KTWA 1WEOA 2ECVA 1JM7A 3S91A 4NUEA 5I86A 4A9FA 4IR3A 2KGGA 4Z93A 4UYEA 2KREA 5CUEA 1HYIA 2H0DB 4LK9A 3DAIA 2XB1A 4L7XA 4YK0A 1FBVA 5KO4A 4I7BA 3UVXA 3LQJA 4UIWA 3MHSA 3N9MA 5CY9A 4NXJA 5AMFA 4GNDA 4C67A 2VPEA 4YYIA 5LJ1A 5C87A 2ZETC 3PUQA 3L11A 5HCLA 5I40A 5CU8A 3ZYUA 4Z6HA 3L1XA 1RMDA 3MHHA 4N4IA 5KU3A 5II1A 2OUOA 5E9MA 4Z1SA 4TU4A 2YW5A 2FSAA 3JVLA 5D25A 5COIA 5DY7A 1WEVA 4LJNA 4UP5A 4QR4A 4FLPA 1E6IA 1Z2QA 4Q6FA 1T1HA 4O76A 2VJFA 4XYAA 4O64A 4N4GA 5F5ZA 3PURA 5DFDA 5H1TA 4CUTA 3UW9A 3LQIA 2D82A 1FP0A 4OGJA 4KCXA 5ENEA 4PY6A 4NYXA 2YQMA 3SOWA 2YSJA 5CQ7A 4QNSA 5FE2A 5F36A 5BT5A 5FE9A 5LKTA 3LQHA 1CHCA 1U6GB 3T7LA 5JI8A 1JM4B 5A5SA 4R8PK 3HMFA 3P5OA 4TYLA 3ZNIA 5D1KB 4R2YA 4C9ZA 4NUDA 2EODA 4QEWA 5D24A 4NYVA 5L96A 3AQAA 5ENBA 4QBMA 2DWWA 4MR3A 5EV9A 5CUBA 4J1PA 5D1MB 4A4CA 4LKAA 5DFCA 4UYHA 5BT3A 5EWCA 4NQMA 3FL2A 2N9GA 2KR4A 4NUCA 5EVAA 4XI1A 5FFYA 2DVSA 3SVGA 4NR8A 2L5EA 5E9LA 2I7KA 4O7AA 4XUAA 2YYNA 3N9OA 2Y1MA 5AIUA 3U5KA 5EPRA 2YUCA 1VFYA 5ETDA 5EM3A 4YH3A 5FH8A 4A9NA 4IR4A 5G04B 3RTRB 4QEVA 4FIPA 3HCTA 4E96A 5A5NA 2H0DA 3RPGC 3IHPA 2DVQA 4J0SA 1HYJA 5C13A 2YW8A 3V43A 5TBNA 2KFTA 5A5QA 5EA1A 3SVFA 2DVRA 3P1CA 4QYLA 2MD8C 4QSXA 3T6RA 5FE1A 4N3WA 2JMJA 5D7XA 2DKWA 4MR6A 3DPLR 4HBWA 2YU4A 3LXJA 3PHDA 3MULA 2HYED 5F63A 4UYDA 4NRAA 4CFKA 5H1VA 2D9EA 4GNFA 2CT2A 5ENCA 4N4HA 4O7CA 4XUBA 5DLZA 2YQDA 2M85A 4UITA 4FO9A 4OUFA 3HMHA 4OGIA 4PCIA 4MEOA 3EB5A 5DKCA 4HXOA 2KU3A 3O70A 1WE9A 2RNWA 4HBXA 3KV5A 3N9NA 5A5RA 3M99A 5KH3A 4YYMA 2QJ0A 4Q0OA 4HBYA 4UIZA 4YYHA 5A7CA 4RVRA 4CFLA 5G05B 5FE4A 1WUMA 4YBMA 5F3AA 4ALGA 3P1EA 4ZW1A 2EA6A 2L0BA 4O72A 5HFQA 1DVPA 2YEMA 4QSUA 5EGUA 5CPEA 5JWMA 3JVKA 5FE5A 5J0DA 5LUUA 3ZYQA 5BT4A 2E6SA 3ZTGA 4A9MA 5AD3A 3GV4A 5CQ5A 2L84A 4F52B 4A9OA 4CURA 2KWNA 1X0JA 5CS8A 2PUYA 2RO1A 4NRBA 5K29A 2G45A 5DKDA 4TZ8A 1WENA 2LDRA 4UYGA 5D0CA 5KH7A 2NAAA 5B77A 5FFWA 4MENA 4TTEA 2LXPC 4CUQA 1WGMA 4AYCB 2WP1A 4QSTA 4HXMA 1E4UA 4P5OB 2R0SA 2VJFB 4YY4A 3RPGB 4A0CD 4HXSA 5EWWA 1N72A 2BAYA 3MXFA 4HXKA 4LZRA 5CTLA 5LKXA 5CP5A 5HFRA 2JRJA 3QZVA 2K16A 3N9PA 5LVQA 3MB3A 1VD4A 4CUPA 4NR7A 1WEEA 4YYDA 4PPEA 5FB1A 4MR4A 2YHNA 5E7DA 4CLBA 3MUKA 2YQLA 2AN6A 2LV9A 2YYRA 4LADB 4MVTA 4WZ0A 1G25A 4ZQLA 4BW1A 4LYSA 2I8NA 4LRGA 5KTUA 2FUUA 4R7EA 5E73A 1WEPA 4O7BA 4QB3A 4Z1QA 3N9LA 3UVDA 3TLPA 4BHWA 3FKMX 5EYAF 2OXQC 2RNYA 3HMEA 4NRCA 5CFWA 4A9KA 1ZBDB 5CZGA 4BW4A 2CKLA 2YREA 3KNVA 3O36A 2RS9B 4L58A 1Z6UA 5DINA 5CUCA 5TABA 4Q0NA 5F62A 3SOXA 5DLXA 5A81A 4W4UA 5C7NA 5CRZA 5D3HA 5DW1A 3U5JA 5E9KA 2KTBB 2KYUA 2QIZA 2LSPB 2L75A 5B76A 5LKZA 3ASLA 1X4IA 4BW3A 4MSXA 5B8DA 2MT5A 1MM2A 4YYNA 3ZVYA 2YT5A 5I1QA 4B7YC 5EK9A 5EU1A 2GRCA 4UYFB 4IC2A 5I7XA 3S92A 3DQVR 4I7DA 4CUSA 2WP2A 4YABA 1V87A 4V3LC 4NQNA 5IBNA 5ENIA 2VNFA 3ZPVE 2KWJA 4LR6A 5ENFA 5H85A 5IG6A 4QYDA 4QUUA 3UV5A 4ALHA 2CSYA 4YBTA 4QSQA 3SHBA 5D3RA 5FDZA 5EQ1A 3O34A 4HBVA 4TS8A 5E3GA 4KV4A 2QICA 4FJCA 4ZUXU 4O74A 5DKAA 2ECIA 2DVVA 4O71A 4IR6A 3ZVZB 4IR5A 5DBMA 4YY6A 2LGVA 2JMDA 3I2DA 4UI9B 2ECWA 5E9VA 1WESA 4QSVA 3D7CA 4QEUA 5G0FA 4ZDTA 1JOCA 4QC3A 5C8GA 2F6JA 5CRMA 2UZGA 4F3IA 3HCSA 3UV2A 2LGGA 5I29A 2M1RA 5C89A 4A9IA 4CA1A 4O7FA 4TQNA 3C5KA 2KWKA 5FBXA 5G4SA 5L99A 3ZPV1 4HXRA 3M63A 2ECTA 5LVRA 4UP0A 2R0VA 1EQFA 5I89A 4FK5A 1X4UA 4QSSA 2MJVB 4QSRA 5DW2A 2RFJA 3G0JA 5A83A 5TCMA 2CSZA 3I3JA 5L97A 4WZ3B 5CUGA 5HEMA 4NYWA 5A85A 2MIQA 5HLSA 5IGLA 5HQ5A 2YELA 2K1JA 2R0YA 5C85A 4GB0A 4WHWA 5EISA 5HENA 5TB6A 4CL9A 3K2JA 4CUUA 1IYMA 5DX4A 4ZC9A 1LDKC 5CQ4A 3JVMA 3VK6A 3KV6A 5AD2A 5FB0A 2MUMA 4NN2A 5G4RA 1WFKA 4A9EA 3L1ZB 4NR5A 3LJWA 5TDWA 3U5LA 2ECNA 5I88A 5A5OA 4I7CA 2DATA 5LJ0A 4AP4A 5FEYA 3SOUA 3GG3A 5IGMA 4TT4A 4QUTA 4QR3A 2VP7A 5FE3A 2ECGA 2L85A 5EWHA 5DFBA 2LN0A 4X2IA 5ETBA 3Q2EA 4PTBA 3U5MA 4UIUA 5HELA 3UVWA 5C4QA 4WA6A 5FE8A 3Q2FA 5TDRA 2LXHC 5CQ8A 3DWYA 5EI4A 4A9HA 2KGIA 3M62A 5D3JA 4MEQA 2VPGA 4YC9A 5D3TA 4YBSA 3GL6A 1N87A 4N4FA 5DYCA 5EWVA 4B86C 5ENGA 4GPJA 4UYFA 3JVJA 4PKLA 3P1DA 3UV4A 2MNYA 1F62A 2LRIC 5A5PA 2YDWA 2H60A 5DYXA 4IC3A 2VPDA 4S3OC 5E3DA 2E7OA 3N9QA 5EP7A 3LRQA 3NG2A 2KE1A 5ACYA 4MR5A 3O37A 4QY4A 5F60A 5FFVA 2KIZA 5DKHA 5HM0A 2Y1NA 2M3HA 4A49A 2DX8A 4CCGX 4QF3A 1WIMA 3QZTA 2VPBA 5L98A 5CUAA 1WUGA 4PS5A 4LLBA 3NXBA 4LZ2A 2MA5A 4X3GA 4V3KC 4YH4A 1ZS5A 5D3LA 5II2A 3IU6A 3RCWA 2EGPA 2G43A 2F6NA 1K2FA 2PNXA 4NS5A 4YATA 5AITA 5IGKA 4GNGA 5LCWB 4TT2A 4YADA 4QC1A 5KTXA 4WHUA 4DONA 2D8SA 4NR6A 5KH9A 2K4DA 2YURA 2MD7B 4HXPA 5JG6A 4LYIA 5FE6A 4BW2A 4IORA 4XY8A 5D3SA 2L80A 1F68A 5LKUA 5I3LA 3AADA 5FE7A 5CQAA 5E74A 5HRWA 3SVHA 4TZ2A 5HRVA 4O77A 5FE0A 2G6QA 3C6WA 5FERA 1BORA 5FG5A 2LQ6A 5KHMA 5D26A 5DYAA 5CQTA 4YYJA 4A4BA 4UIYA 3HCUA 1JM7B 2K17A 4AUQB 2OO1A 5LJ2A 5CUDA 3KQIA 5HRXA 2L5UA 5E9IA 2JMIA 4HXNA 5CQ6A 5EPBA 5C11A 5B79A 5DYUA 5B78A 4PCEA 5D1LB 1Z60A 5J3XA 2E3KA 5IGNA 2F42A 3O33A 4KV1A 2G4AA 4AKNA 1WEUA 2I50A 3ONIA 4IOOA 4QSPA 4TU6A 5E9YA 4NR9A 5ENJA 2VJEA 4XY9A 3U5NA 5EWDA 1WILA 2IDAA 4UIVA 4C66A 4QZSA 4O7EA 5I7YA 5D3NA 3MQMA 4QR5A 2HDPA 5HJCA 2L43A 5FG4A 2E7NA 5FG6A 2FUIA 5B75A 4A9LA 3P1FA 1X4JA 2C2VS 2R10A 5TRBA 4TKPB 3HTKC 4TT6A 3IU5A 5CGPA 5EPSA 4Y03A 1LDJB 2E6RA 4S3OB 1WEMA 1WEQA 4O78A 2MA6A 3O35A 5EICA 3G0LA 4AYCA 3U5OA 4BJXA 2RNXA 2LGLA
chains in the Genus database with same CATH superfamily
1XWHA 2RSDA 4YYGA 4LYWA 2ECJA 4BBQA 3EB6A 2LGKA 4YYKA 4Z6IA 5IIDA 1JSPB 2CKLB 2MNZA 3KDEC 5F1HA 4QSWA 5F2PA 5ENHA 2EXUA 2M6MA 3D1DA 5FH7A 5E0RA 3LJUX 5F61A 4UIXA 3UVYA 4OGEA 4O75A 4WIVA 4LDFA 5D3PA 5FH6A 3MB4A 5H9MA 3FEHA 5F25A 1MM3A 4WZ2A 4LZSA 1WEWA 4QF2A 4NR4A 2FD4A 3LDYA 2YEKA 5L8UA 3PLWA 2RI7A 4J0RA 4YAXA 4J3IA 2NXBA 5H1UA 2YHOA 4HXLA 4A9JA 1VYXA 5SVXA 2KWOA 4LC2A 3QZSA 5HQ6A 5AMEA 2VJEB 2XEUA 3O7AA 2Y43A 2YSMA 4MEPA 5F1LA 2KKYA 5I83A 4AI6A 2OSSA 2C2LA 4GNEA 4IOQA 4OGCA 5L8TA 4O70A 3U5PA 5I80A 2DJAA 5HQ7A 5A82A 5CQ3A 5KTWA 1WEOA 2ECVA 4AVXA 1JM7A 3S91A 4NUEA 5I86A 4A9FA 4IR3A 2KGGA 4Z93A 1DCQA 4UYEA 2KREA 5CUEA 1HYIA 2H0DB 4LK9A 3DAIA 2XB1A 4L7XA 4YK0A 1FBVA 5KO4A 4I7BA 3UVXA 3M7KA 3LQJA 4UIWA 3MHSA 3N9MA 5CY9A 4NXJA 5AMFA 4GNDA 4C67A 2VPEA 4YYIA 5LJ1A 5C87A 2ZETC 3PUQA 3SUBA 3L11A 5HCLA 5I40A 5CU8A 3ZYUA 4Z6HA 3L1XA 1RMDA 3MHHA 4N4IA 5KU3A 5II1A 2OUOA 5E9MA 4Z1SA 4TU4A 2YW5A 2FSAA 3JVLA 5D25A 5COIA 5DY7A 1WEVA 4LJNA 4UP5A 4QR4A 4FLPA 1E6IA 1Z2QA 2L7PA 4Q6FA 1T1HA 4O76A 2VJFA 4XYAA 4O64A 4N4GA 5F5ZA 3PURA 5DFDA 5H1TA 4CUTA 3O47A 3UW9A 2RR4A 4AKIA 3LQIA 2D82A 1FP0A 4OGJA 4KCXA 5ENEA 4PY6A 4NYXA 2YQMA 2M13A 3SOWA 2XOYA 2YSJA 5CQ7A 4QNSA 5FE2A 5F36A 5BT5A 5FE9A 5LKTA 3LQHA 1CHCA 1U6GB 2IQJA 5SVIB 3T7LA 5JI8A 1JM4B 5A5SA 4R8PK 3HMFA 3P5OA 4TYLA 3ZNIA 5D1KB 4R2YA 4C9ZA 4NUDA 2EODA 4QEWA 5D24A 4NYVA 5L96A 3AQAA 5ENBA 4QBMA 2DWWA 4MR3A 5EV9A 5CUBA 4J1PA 5D1MB 4A4CA 4LKAA 5DFCA 4UYHA 5BT3A 5EWCA 4NQMA 3FL2A 2N9GA 2KR4A 4NUCA 5EVAA 4XI1A 3D1BA 5FFYA 2P57A 2DVSA 3SVGA 4NR8A 2L5EA 5E9LA 2I7KA 4O7AA 4XUAA 2YYNA 3N9OA 2JUNA 2Y1MA 5AIUA 3U5KA 5EPRA 2YUCA 1VFYA 5ETDA 5EM3A 4YH3A 5FH8A 4A9NA 4IR4A 5G04B 3FM8C 3RTRB 4QEVA 4FIPA 3HCTA 4E96A 5A5NA 2XP0A 2H0DA 3RPGC 2XOCA 3IHPA 2DVQA 4J0SA 1HYJA 5C13A 2YW8A 3V43A 5TBNA 2KFTA 5A5QA 3VKGA 5EA1A 3SVFA 2DVRA 3P1CA 4QYLA 2MD8C 4QSXA 3T6RA 5FE1A 4N3WA 2JMJA 5D7XA 2DKWA 4MR6A 3DPLR 4HBWA 2YU4A 3LXJA 3PHDA 3MULA 2HYED 5F63A 4UYDA 4NRAA 4CFKA 5H1VA 2D9EA 4GNFA 2CT2A 5ENCA 2YVRA 4N4HA 4O7CA 4XUBA 5DLZA 2YQDA 3T9KA 2M85A 4F1PA 4UITA 4FO9A 4OUFA 3HMHA 4OGIA 4PCIA 4MEOA 3EB5A 5DKCA 4HXOA 2KU3A 3MDBC 3O70A 1WE9A 2RNWA 4HBXA 3KV5A 2LAUA 3N9NA 5A5RA 3M99A 5KH3A 4YYMA 2QJ0A 4Q0OA 4HBYA 4UIZA 4YYHA 5A7CA 4RVRA 4CFLA 5G05B 5FE4A 1WUMA 4YBMA 5F3AA 4ALGA 3P1EA 4ZW1A 4Z0RA 2EA6A 2L0BA 4O72A 5HFQA 1DVPA 2YEMA 3LVQE 4QSUA 5EGUA 5CPEA 5JWMA 3JVKA 5FE5A 5J0DA 5LUUA 3ZYQA 5BT4A 2E6SA 3ZTGA 4A9MA 5AD3A 3DDTA 3GV4A 5CQ5A 2L84A 5K3QA 4F52B 4A9OA 4CURA 2KWNA 1X0JA 5CS8A 2PUYA 2RO1A 4NRBA 5K29A 2G45A 5DKDA 4TZ8A 1WENA 2LDRA 4UYGA 5D0CA 5KH7A 2NAAA 5B77A 5FFWA 4MENA 4TTEA 2LXPC 4CUQA 3DWDA 1WGMA 4AYCB 2WP1A 4QSTA 4HXMA 1E4UA 4P5OB 4ZUXU 2R0SA 2VJFB 4YY4A 3RPGB 4A0CD 4HXSA 5EWWA 1N72A 2BAYA 3MXFA 4HXKA 4LZRA 5CTLA 5LKXA 5CP5A 5HFRA 2JRJA 3QZVA 2K16A 3N9PA 5LVQA 3MB3A 1VD4A 4CUPA 4NR7A 1WEEA 4YYDA 1ZKRA 4PPEA 5FB1A 4MR4A 2YHNA 5E7DA 4CLBA 3MUKA 2YQLA 2AN6A 2LV9A 2YYRA 4LADB 4MVTA 4AKGA 4WZ0A 1G25A 4ZQLA 4BW1A 4LYSA 2I8NA 4LRGA 5KTUA 2FUUA 4R7EA 5E73A 1WEPA 4O7BA 4QB3A 4Z1QA 3N9LA 3UVDA 3TLPA 4BHWA 3FKMX 5EYAF 2OXQC 2RNYA 3HMEA 4NRCA 5CFWA 4A9KA 1ZBDB 5CZGA 4BW4A 2CKLA 2YREA 3KNVA 3O36A 2RS9B 4L58A 1Z6UA 5DINA 5CUCA 5TABA 4Q0NA 5F62A 3SOXA 5DLXA 2EGMA 5A81A 4W4UA 5C7NA 5CRZA 5D3HA 5DW1A 3U5JA 5E9KA 2KTBB 2KYUA 2QIZA 2LSPB 2XOZA 2L75A 5B76A 5LKZA 3ASLA 1X4IA 4BW3A 4MSXA 5B8DA 2B0OE 2MT5A 1MM2A 4YYNA 3ZVYA 2YT5A 5I1QA 4B7YC 5EK9A 5EU1A 2GRCA 4UYFB 4IC2A 5I7XA 3S92A 3DQVR 4I7DA 4CUSA 2WP2A 2E61A 4YABA 1V87A 4V3LC 4NQNA 5IBNA 5ENIA 2VNFA 3ZPVE 2KWJA 4LR6A 5ENFA 5H85A 5IG6A 4QYDA 4QUUA 3UV5A 4ALHA 2CSYA 4YBTA 4QSQA 3SHBA 3E2DA 5D3RA 5FDZA 5EQ1A 3O34A 4HBVA 4TS8A 5E3GA 4KV4A 2QICA 4FJCA 5SVYA 4O74A 5DKAA 2CSVA 2ECIA 2DVVA 4O71A 4IR6A 3ZVZB 4IR5A 5DBMA 4YY6A 2LGVA 3FJUB 4QQ4A 2JMDA 5SVIA 3I2DA 1MBMA 3JUEA 4UI9B 2ECWA 5E9VA 1WESA 4QSVA 3D7CA 4QEUA 5G0FA 4ZDTA 1JOCA 4QC3A 5C8GA 2F6JA 5CRMA 2UZGA 4F3IA 3HCSA 3UV2A 2LGGA 5I29A 2M1RA 5C89A 4A9IA 4CA1A 4O7FA 4TQNA 3C5KA 2KWKA 5FBXA 5G4SA 5L99A 3ZPV1 4HXRA 2CRRA 3M63A 2ECTA 3ERRA 5LVRA 4UP0A 2R0VA 1EQFA 5I89A 4FK5A 1X4UA 4QSSA 2MJVB 4QSRA 5DW2A 2RFJA 3G0JA 5A83A 5TCMA 2CSZA 2MKEA 3I3JA 5L97A 2CONA 4WZ3B 5CUGA 5HEMA 4NYWA 5A85A 2MIQA 5HLSA 5IGLA 4O62A 5HQ5A 2YELA 2K1JA 2R0YA 5C85A 4GB0A 4WHWA 5EISA 5HENA 5TB6A 4CL9A 3K2JA 4CUUA 1IYMA 5DX4A 4ZC9A 1LDKC 5CQ4A 3JVMA 3FAOA 3VK6A 3KV6A 5AD2A 5FB0A 2MUMA 4NN2A 5G4RA 1WFKA 4A9EA 3L1ZB 4NR5A 3LJWA 5TDWA 3U5LA 2ECNA 5I88A 5A5OA 4I7CA 2DATA 5LJ0A 4AP4A 5FEYA 3SOUA 3GG3A 5IGMA 4TT4A 4QUTA 4QR3A 2VP7A 5FE3A 2ECGA 2L85A 5EWHA 5DFBA 2LN0A 4X2IA 5ETBA 3Q2EA 4PTBA 3U5MA 4UIUA 5HELA 3UVWA 5C4QA 2FFWA 3LVRE 4WA6A 5FE8A 3Q2FA 5TDRA 2KKXA 2LXHC 5CQ8A 3DWYA 5EI4A 4A9HA 2KGIA 3M62A 3FANA 5D3JA 4MEQA 2VPGA 4YC9A 5D3TA 4YBSA 3GL6A 1N87A 4N4FA 5DYCA 5EWVA 4B86C 5ENGA 4GPJA 4UYFA 3JVJA 4PKLA 3P1DA 3UV4A 2MNYA 1F62A 2LRIC 5A5PA 2YDWA 2H60A 5DYXA 4IC3A 2VPDA 4S3OC 5E3DA 2E7OA 3N9QA 5EP7A 3LRQA 3NG2A 2KE1A 5ACYA 4MR5A 3O37A 4QY4A 5F60A 5FFVA 2KIZA 2OWAA 5DKHA 5HM0A 2Y1NA 2M3HA 4A49A 2DX8A 4CCGX 4QF3A 1WIMA 3QZTA 2VPBA 5L98A 5CUAA 1WUGA 4PS5A 4LLBA 3NXBA 4LZ2A 2MA5A 4X3GA 4V3KC 4YH4A 1ZS5A 5D3LA 5II2A 3IU6A 3RCWA 2EGPA 2G43A 2F6NA 1K2FA 2PNXA 4NS5A 4YATA 3H7HA 5AITA 5IGKA 4GNGA 5LCWB 4TT2A 4YADA 4QC1A 5KTXA 4WHUA 4DONA 2D8SA 2DSMA 4NR6A 5KH9A 2K4DA 2YURA 2MD7B 4HXPA 2CRWA 5JG6A 4LYIA 1PUOA 5FE6A 4BW2A 4IORA 4XY8A 5D3SA 2L80A 1F68A 5LKUA 5I3LA 3AADA 5FE7A 5CQAA 5E74A 5HRWA 3SVHA 4TZ2A 5HRVA 4O77A 5FE0A 2G6QA 3C6WA 5FERA 1BORA 5FG5A 3Q1DA 2LQ6A 5KHMA 5D26A 5DYAA 5CQTA 4YYJA 4A4BA 4UIYA 3HCUA 1JM7B 2K17A 4AUQB 2OO1A 5LJ2A 5CUDA 3KQIA 5HRXA 2L5UA 5E9IA 2JMIA 4HXNA 5CQ6A 5EPBA 5C11A 5B79A 5DYUA 5B78A 4PCEA 5D1LB 1Z60A 5J3XA 2E3KA 5IGNA 2F42A 3O33A 4KV1A 2G4AA 4AKNA 1WEUA 2I50A 3ONIA 4IOOA 4QSPA 4TU6A 5E9YA 4NR9A 5ENJA 2VJEA 4XY9A 3U5NA 5EWDA 1WILA 2IDAA 4UIVA 4C66A 4QZSA 4O7EA 5I7YA 5D3NA 3MQMA 4QR5A 2HDPA 5HJCA 2L43A 5FG4A 4AKHA 2E7NA 5FG6A 2FUIA 5B75A 4A9LA 3P1FA 1X4JA 2C2VS 2R10A 5TRBA 4TKPB 3HTKC 4H9DA 4TT6A 3IU5A 5CGPA 5EPSA 4Y03A 1LDJB 2EJNA 2E6RA 4S3OB 3VKHA 1WEMA 1WEQA 4O78A 2MA6A 3O35A 5EICA 3G0LA 4Z0OA 4AYCA 2D8UA 3U5OA 2JM3A 4BJXA 2RNXA 2LGLA
chains in the Genus database with same CATH topology
1XWHA 2RSDA 4YYGA 4LYWA 2ECJA 4BBQA 3EB6A 2LGKA 4YYKA 4Z6IA 5IIDA 1JSPB 2CKLB 2MNZA 5F1HA 4QSWA 5F2PA 5ENHA 2M6MA 5FH7A 5E0RA 5F61A 4UIXA 3UVYA 4O75A 4WIVA 4LDFA 5D3PA 5FH6A 3MB4A 5H9MA 5F25A 1MM3A 4WZ2A 4LZSA 1WEWA 4QF2A 4NR4A 2YEKA 5L8UA 2RI7A 4J0RA 4YAXA 4J3IA 2NXBA 5H1UA 2YHOA 4HXLA 4A9JA 1VYXA 2KWOA 4LC2A 3QZSA 5HQ6A 5AMEA 2VJEB 2XEUA 3O7AA 2Y43A 2YSMA 4MEPA 5F1LA 4GNEA 5I83A 2C2LA 2OSSA 4IOQA 5L8TA 4O70A 3U5PA 5I80A 4AVXA 5HQ7A 5A82A 5CQ3A 5KTWA 1WEOA 2ECVA 1JM7A 3S91A 4NUEA 5I86A 4A9FA 4IR3A 2KGGA 4Z93A 4UYEA 2KREA 5CUEA 1HYIA 2H0DB 4LK9A 3DAIA 2XB1A 4L7XA 4YK0A 1FBVA 5KO4A 4I7BA 3UVXA 3LQJA 4UIWA 3MHSA 3N9MA 5CY9A 4NXJA 5AMFA 4GNDA 4C67A 2VPEA 4YYIA 5LJ1A 5C87A 2ZETC 3PUQA 3L11A 5HCLA 5I40A 5CU8A 3ZYUA 4Z6HA 3L1XA 1RMDA 3MHHA 4N4IA 5KU3A 5II1A 2OUOA 5E9MA 4Z1SA 4TU4A 2YW5A 2FSAA 3JVLA 5D25A 5COIA 5DY7A 1WEVA 4LJNA 4UP5A 4QR4A 4FLPA 1E6IA 1Z2QA 4Q6FA 1T1HA 4O76A 2VJFA 4XYAA 4O64A 4N4GA 5F5ZA 3PURA 5DFDA 5H1TA 4CUTA 3UW9A 3LQIA 2D82A 1FP0A 4OGJA 4KCXA 5ENEA 4PY6A 4NYXA 2YQMA 3SOWA 2YSJA 5CQ7A 4QNSA 5FE2A 5F36A 5BT5A 5FE9A 5LKTA 3LQHA 1CHCA 1U6GB 3T7LA 5JI8A 1JM4B 5A5SA 4R8PK 3HMFA 3P5OA 4TYLA 3ZNIA 5D1KB 4R2YA 4C9ZA 4NUDA 2EODA 4QEWA 5D24A 4NYVA 5L96A 3AQAA 5ENBA 4QBMA 2DWWA 4MR3A 5EV9A 5CUBA 4J1PA 5D1MB 4A4CA 4LKAA 5DFCA 4UYHA 5BT3A 5EWCA 4NQMA 3FL2A 2N9GA 2KR4A 4NUCA 5EVAA 4XI1A 5FFYA 2DVSA 3SVGA 4NR8A 2L5EA 5E9LA 2I7KA 4O7AA 4XUAA 2YYNA 3N9OA 2Y1MA 5AIUA 3U5KA 5EPRA 2YUCA 1VFYA 5ETDA 5EM3A 4YH3A 5FH8A 4A9NA 4IR4A 5G04B 3RTRB 4QEVA 4FIPA 3HCTA 4E96A 5A5NA 2H0DA 3RPGC 3IHPA 2DVQA 4J0SA 1HYJA 5C13A 2YW8A 3V43A 5TBNA 2KFTA 5A5QA 5EA1A 3SVFA 2DVRA 3P1CA 4QYLA 2MD8C 4QSXA 3T6RA 5FE1A 4N3WA 2JMJA 5D7XA 2DKWA 4MR6A 3DPLR 4HBWA 2YU4A 3LXJA 3PHDA 3MULA 2HYED 5F63A 4UYDA 4NRAA 4CFKA 5H1VA 2D9EA 4GNFA 2CT2A 5ENCA 4N4HA 4O7CA 4XUBA 5DLZA 2YQDA 2M85A 4UITA 4FO9A 4OUFA 3HMHA 4OGIA 4PCIA 4MEOA 3EB5A 5DKCA 4HXOA 2KU3A 3O70A 1WE9A 2RNWA 4HBXA 3KV5A 3N9NA 5A5RA 3M99A 5KH3A 4YYMA 2QJ0A 4Q0OA 4HBYA 4UIZA 4YYHA 5A7CA 4RVRA 4CFLA 5G05B 5FE4A 1WUMA 4YBMA 5F3AA 4ALGA 3P1EA 4ZW1A 2EA6A 2L0BA 4O72A 5HFQA 1DVPA 2YEMA 4QSUA 5EGUA 5CPEA 5JWMA 3JVKA 5FE5A 5J0DA 5LUUA 3ZYQA 5BT4A 2E6SA 3ZTGA 4A9MA 5AD3A 3GV4A 5CQ5A 2L84A 4F52B 4A9OA 4CURA 2KWNA 1X0JA 5CS8A 2PUYA 2RO1A 4NRBA 5K29A 2G45A 5DKDA 4TZ8A 1WENA 2LDRA 4UYGA 5D0CA 5KH7A 2NAAA 5B77A 5FFWA 4MENA 4TTEA 2LXPC 4CUQA 1WGMA 4AYCB 2WP1A 4QSTA 4HXMA 1E4UA 4P5OB 2R0SA 2VJFB 4YY4A 3RPGB 4A0CD 4HXSA 5EWWA 1N72A 2BAYA 3MXFA 4HXKA 4LZRA 5CTLA 5LKXA 5CP5A 5HFRA 2JRJA 3QZVA 2K16A 3N9PA 5LVQA 3MB3A 1VD4A 4CUPA 4NR7A 1WEEA 4YYDA 4PPEA 5FB1A 4MR4A 2YHNA 5E7DA 4CLBA 3MUKA 2YQLA 2AN6A 2LV9A 2YYRA 4LADB 4MVTA 4WZ0A 1G25A 4ZQLA 4BW1A 4LYSA 2I8NA 4LRGA 5KTUA 2FUUA 4R7EA 5E73A 1WEPA 4O7BA 4QB3A 4Z1QA 3N9LA 3UVDA 3TLPA 4BHWA 3FKMX 5EYAF 2OXQC 2RNYA 3HMEA 4NRCA 5CFWA 4A9KA 1ZBDB 5CZGA 4BW4A 2CKLA 2YREA 3KNVA 3O36A 2RS9B 4L58A 1Z6UA 5DINA 5CUCA 5TABA 4Q0NA 5F62A 3SOXA 5DLXA 5A81A 4W4UA 5C7NA 5CRZA 5D3HA 5DW1A 3U5JA 5E9KA 2KTBB 2KYUA 2QIZA 2LSPB 2L75A 5B76A 5LKZA 3ASLA 1X4IA 4BW3A 4MSXA 5B8DA 2MT5A 1MM2A 4YYNA 3ZVYA 2YT5A 5I1QA 4B7YC 5EK9A 5EU1A 2GRCA 4UYFB 4IC2A 5I7XA 3S92A 3DQVR 4I7DA 4CUSA 2WP2A 4YABA 1V87A 4V3LC 4NQNA 5IBNA 5ENIA 2VNFA 3ZPVE 2KWJA 4LR6A 5ENFA 5H85A 5IG6A 4QYDA 4QUUA 3UV5A 4ALHA 2CSYA 4YBTA 4QSQA 3SHBA 5D3RA 5FDZA 5EQ1A 3O34A 4HBVA 4TS8A 5E3GA 4KV4A 2QICA 4FJCA 4ZUXU 4O74A 5DKAA 2ECIA 2DVVA 4O71A 4IR6A 3ZVZB 4IR5A 5DBMA 4YY6A 2LGVA 2JMDA 3I2DA 4UI9B 2ECWA 5E9VA 1WESA 4QSVA 3D7CA 4QEUA 5G0FA 4ZDTA 1JOCA 4QC3A 5C8GA 2F6JA 5CRMA 2UZGA 4F3IA 3HCSA 3UV2A 2LGGA 5I29A 2M1RA 5C89A 4A9IA 4CA1A 4O7FA 4TQNA 3C5KA 2KWKA 5FBXA 5G4SA 5L99A 3ZPV1 4HXRA 3M63A 2ECTA 5LVRA 4UP0A 2R0VA 1EQFA 5I89A 4FK5A 1X4UA 4QSSA 2MJVB 4QSRA 5DW2A 2RFJA 3G0JA 5A83A 5TCMA 2CSZA 3I3JA 5L97A 4WZ3B 5CUGA 5HEMA 4NYWA 5A85A 2MIQA 5HLSA 5IGLA 5HQ5A 2YELA 2K1JA 2R0YA 5C85A 4GB0A 4WHWA 5EISA 5HENA 5TB6A 4CL9A 3K2JA 4CUUA 1IYMA 5DX4A 4ZC9A 1LDKC 5CQ4A 3JVMA 3VK6A 3KV6A 5AD2A 5FB0A 2MUMA 4NN2A 5G4RA 1WFKA 4A9EA 3L1ZB 4NR5A 3LJWA 5TDWA 3U5LA 2ECNA 5I88A 5A5OA 4I7CA 2DATA 5LJ0A 4AP4A 5FEYA 3SOUA 3GG3A 5IGMA 4TT4A 4QUTA 4QR3A 2VP7A 5FE3A 2ECGA 2L85A 5EWHA 5DFBA 2LN0A 4X2IA 5ETBA 3Q2EA 4PTBA 3U5MA 4UIUA 5HELA 3UVWA 5C4QA 4WA6A 5FE8A 3Q2FA 5TDRA 2LXHC 5CQ8A 3DWYA 5EI4A 4A9HA 2KGIA 3M62A 5D3JA 4MEQA 2VPGA 4YC9A 5D3TA 4YBSA 3GL6A 1N87A 4N4FA 5DYCA 5EWVA 4B86C 5ENGA 4GPJA 4UYFA 3JVJA 4PKLA 3P1DA 3UV4A 2MNYA 1F62A 2LRIC 5A5PA 2YDWA 2H60A 5DYXA 4IC3A 2VPDA 4S3OC 5E3DA 2E7OA 3N9QA 5EP7A 3LRQA 3NG2A 2KE1A 5ACYA 4MR5A 3O37A 4QY4A 5F60A 5FFVA 2KIZA 5DKHA 5HM0A 2Y1NA 2M3HA 4A49A 2DX8A 4CCGX 4QF3A 1WIMA 3QZTA 2VPBA 5L98A 5CUAA 1WUGA 4PS5A 4LLBA 3NXBA 4LZ2A 2MA5A 4X3GA 4V3KC 4YH4A 1ZS5A 5D3LA 5II2A 3IU6A 3RCWA 2EGPA 2G43A 2F6NA 1K2FA 2PNXA 4NS5A 4YATA 5AITA 5IGKA 4GNGA 5LCWB 4TT2A 4YADA 4QC1A 5KTXA 4WHUA 4DONA 2D8SA 4NR6A 5KH9A 2K4DA 2YURA 2MD7B 4HXPA 5JG6A 4LYIA 5FE6A 4BW2A 4IORA 4XY8A 5D3SA 2L80A 1F68A 5LKUA 5I3LA 3AADA 5FE7A 5CQAA 5E74A 5HRWA 3SVHA 4TZ2A 5HRVA 4O77A 5FE0A 2G6QA 3C6WA 5FERA 1BORA 5FG5A 2LQ6A 5KHMA 5D26A 5DYAA 5CQTA 4YYJA 4A4BA 4UIYA 3HCUA 1JM7B 2K17A 4AUQB 2OO1A 5LJ2A 5CUDA 3KQIA 5HRXA 2L5UA 5E9IA 2JMIA 4HXNA 5CQ6A 5EPBA 5C11A 5B79A 5DYUA 5B78A 4PCEA 5D1LB 1Z60A 5J3XA 2E3KA 5IGNA 2F42A 3O33A 4KV1A 2G4AA 4AKNA 1WEUA 2I50A 3ONIA 4IOOA 4QSPA 4TU6A 5E9YA 4NR9A 5ENJA 2VJEA 4XY9A 3U5NA 5EWDA 1WILA 2IDAA 4UIVA 4C66A 4QZSA 4O7EA 5I7YA 5D3NA 3MQMA 4QR5A 2HDPA 5HJCA 2L43A 5FG4A 2E7NA 5FG6A 2FUIA 5B75A 4A9LA 3P1FA 1X4JA 2C2VS 2R10A 5TRBA 4TKPB 3HTKC 4TT6A 3IU5A 5CGPA 5EPSA 4Y03A 1LDJB 2E6RA 4S3OB 1WEMA 1WEQA 4O78A 2MA6A 3O35A 5EICA 3G0LA 4AYCA 3U5OA 4BJXA 2RNXA 2LGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWH A;  2RSD A;  4YYG A;  4LYW A;  2ECJ A;  4BBQ A;  3EB6 A;  2LGK A;  4YYK A;  4Z6I A;  5IID A;  1JSP B;  2CKL B;  2MNZ A;  5F1H A;  4QSW A;  5F2P A;  5ENH A;  2M6M A;  5FH7 A;  5E0R A;  5F61 A;  4UIX A;  3UVY A;  4O75 A;  4WIV A;  4LDF A;  5D3P A;  5FH6 A;  3MB4 A;  5H9M A;  5F25 A;  1MM3 A;  4WZ2 A;  4LZS A;  1WEW A;  4QF2 A;  4NR4 A;  2YEK A;  5L8U A;  2RI7 A;  4J0R A;  4YAX A;  4J3I A;  2NXB A;  5H1U A;  2YHO A;  4HXL A;  4A9J A;  1VYX A;  2KWO A;  4LC2 A;  3QZS A;  5HQ6 A;  5AME A;  2VJE B;  2XEU A;  3O7A A;  2Y43 A;  2YSM A;  4MEP A;  5F1L A;  4GNE A;  5I83 A;  2C2L A;  2OSS A;  4IOQ A;  5L8T A;  4O70 A;  3U5P A;  5I80 A;  4AVX A;  5HQ7 A;  5A82 A;  5CQ3 A;  5KTW A;  1WEO A;  2ECV A;  1JM7 A;  3S91 A;  4NUE A;  5I86 A;  4A9F A;  4IR3 A;  2KGG A;  4Z93 A;  4UYE A;  2KRE A;  5CUE A;  1HYI A;  2H0D B;  4LK9 A;  3DAI A;  2XB1 A;  4L7X A;  4YK0 A;  1FBV A;  5KO4 A;  4I7B A;  3UVX A;  3LQJ A;  4UIW A;  3MHS A;  3N9M A;  5CY9 A;  4NXJ A;  5AMF A;  4GND A;  4C67 A;  2VPE A;  4YYI A;  5LJ1 A;  5C87 A;  2ZET C;  3PUQ A;  3L11 A;  5HCL A;  5I40 A;  5CU8 A;  3ZYU A;  4Z6H A;  3L1X A;  1RMD A;  3MHH A;  4N4I A;  5KU3 A;  5II1 A;  2OUO A;  5E9M A;  4Z1S A;  4TU4 A;  2YW5 A;  2FSA A;  3JVL A;  5D25 A;  5COI A;  5DY7 A;  1WEV A;  4LJN A;  4UP5 A;  4QR4 A;  4FLP A;  1E6I A;  1Z2Q A;  4Q6F A;  1T1H A;  4O76 A;  2VJF A;  4XYA A;  4O64 A;  4N4G A;  5F5Z A;  3PUR A;  5DFD A;  5H1T A;  4CUT A;  3UW9 A;  3LQI A;  2D82 A;  1FP0 A;  4OGJ A;  4KCX A;  5ENE A;  4PY6 A;  4NYX A;  2YQM A;  3SOW A;  2YSJ A;  5CQ7 A;  4QNS A;  5FE2 A;  5F36 A;  5BT5 A;  5FE9 A;  5LKT A;  3LQH A;  1CHC A;  1U6G B;  3T7L A;  5JI8 A;  1JM4 B;  5A5S A;  4R8P K;  3HMF A;  3P5O A;  4TYL A;  3ZNI A;  5D1K B;  4R2Y A;  4C9Z A;  4NUD A;  2EOD A;  4QEW A;  5D24 A;  4NYV A;  5L96 A;  3AQA A;  5ENB A;  4QBM A;  2DWW A;  4MR3 A;  5EV9 A;  5CUB A;  4J1P A;  5D1M B;  4A4C A;  4LKA A;  5DFC A;  4UYH A;  5BT3 A;  5EWC A;  4NQM A;  3FL2 A;  2N9G A;  2KR4 A;  4NUC A;  5EVA A;  4XI1 A;  5FFY A;  2DVS A;  3SVG A;  4NR8 A;  2L5E A;  5E9L A;  2I7K A;  4O7A A;  4XUA A;  2YYN A;  3N9O A;  2Y1M A;  5AIU A;  3U5K A;  5EPR A;  2YUC A;  1VFY A;  5ETD A;  5EM3 A;  4YH3 A;  5FH8 A;  4A9N A;  4IR4 A;  5G04 B;  3RTR B;  4QEV A;  4FIP A;  3HCT A;  4E96 A;  5A5N A;  2H0D A;  3RPG C;  3IHP A;  2DVQ A;  4J0S A;  1HYJ A;  5C13 A;  2YW8 A;  3V43 A;  5TBN A;  2KFT A;  5A5Q A;  5EA1 A;  3SVF A;  2DVR A;  3P1C A;  4QYL A;  2MD8 C;  4QSX A;  3T6R A;  5FE1 A;  4N3W A;  2JMJ A;  5D7X A;  2DKW A;  4MR6 A;  3DPL R;  4HBW A;  2YU4 A;  3LXJ A;  3PHD A;  3MUL A;  2HYE D;  5F63 A;  4UYD A;  4NRA A;  4CFK A;  5H1V A;  2D9E A;  4GNF A;  2CT2 A;  5ENC A;  4N4H A;  4O7C A;  4XUB A;  5DLZ A;  2YQD A;  2M85 A;  4UIT A;  4FO9 A;  4OUF A;  3HMH A;  4OGI A;  4PCI A;  4MEO A;  3EB5 A;  5DKC A;  4HXO A;  2KU3 A;  3O70 A;  1WE9 A;  2RNW A;  4HBX A;  3KV5 A;  3N9N A;  5A5R A;  3M99 A;  5KH3 A;  4YYM A;  2QJ0 A;  4Q0O A;  4HBY A;  4UIZ A;  4YYH A;  5A7C A;  4RVR A;  4CFL A;  5G05 B;  5FE4 A;  1WUM A;  4YBM A;  5F3A A;  4ALG A;  3P1E A;  4ZW1 A;  2EA6 A;  2L0B A;  4O72 A;  5HFQ A;  1DVP A;  2YEM A;  4QSU A;  5EGU A;  5CPE A;  5JWM A;  3JVK A;  5FE5 A;  5J0D A;  5LUU A;  3ZYQ A;  5BT4 A;  2E6S A;  3ZTG A;  4A9M A;  5AD3 A;  3GV4 A;  5CQ5 A;  2L84 A;  4F52 B;  4A9O A;  4CUR A;  2KWN A;  1X0J A;  5CS8 A;  2PUY A;  2RO1 A;  4NRB A;  5K29 A;  2G45 A;  5DKD A;  4TZ8 A;  1WEN A;  2LDR A;  4UYG A;  5D0C A;  5KH7 A;  2NAA A;  5B77 A;  5FFW A;  4MEN A;  4TTE A;  2LXP C;  4CUQ A;  1WGM A;  4AYC B;  2WP1 A;  4QST A;  4HXM A;  1E4U A;  4P5O B;  2R0S A;  2VJF B;  4YY4 A;  3RPG B;  4A0C D;  4HXS A;  5EWW A;  1N72 A;  2BAY A;  3MXF A;  4HXK A;  4LZR A;  5CTL A;  5LKX A;  5CP5 A;  5HFR A;  2JRJ A;  3QZV A;  2K16 A;  3N9P A;  5LVQ A;  3MB3 A;  1VD4 A;  4CUP A;  4NR7 A;  1WEE A;  4YYD A;  4PPE A;  5FB1 A;  4MR4 A;  2YHN A;  5E7D A;  4CLB A;  3MUK A;  2YQL A;  2AN6 A;  2LV9 A;  2YYR A;  4LAD B;  4MVT A;  4WZ0 A;  1G25 A;  4ZQL A;  4BW1 A;  4LYS A;  2I8N A;  4LRG A;  5KTU A;  2FUU A;  4R7E A;  5E73 A;  1WEP A;  4O7B A;  4QB3 A;  4Z1Q A;  3N9L A;  3UVD A;  3TLP A;  4BHW A;  3FKM X;  5EYA F;  2OXQ C;  2RNY A;  3HME A;  4NRC A;  5CFW A;  4A9K A;  1ZBD B;  5CZG A;  4BW4 A;  2CKL A;  2YRE A;  3KNV A;  3O36 A;  2RS9 B;  4L58 A;  1Z6U A;  5DIN A;  5CUC A;  5TAB A;  4Q0N A;  5F62 A;  3SOX A;  5DLX A;  5A81 A;  4W4U A;  5C7N A;  5CRZ A;  5D3H A;  5DW1 A;  3U5J A;  5E9K A;  2KTB B;  2KYU A;  2QIZ A;  2LSP B;  2L75 A;  5B76 A;  5LKZ A;  3ASL A;  1X4I A;  4BW3 A;  4MSX A;  5B8D A;  2MT5 A;  1MM2 A;  4YYN A;  3ZVY A;  2YT5 A;  5I1Q A;  4B7Y C;  5EK9 A;  5EU1 A;  2GRC A;  4UYF B;  4IC2 A;  5I7X A;  3S92 A;  3DQV R;  4I7D A;  4CUS A;  2WP2 A;  4YAB A;  1V87 A;  4V3L C;  4NQN A;  5IBN A;  5ENI A;  2VNF A;  3ZPV E;  2KWJ A;  4LR6 A;  5ENF A;  5H85 A;  5IG6 A;  4QYD A;  4QUU A;  3UV5 A;  4ALH A;  2CSY A;  4YBT A;  4QSQ A;  3SHB A;  5D3R A;  5FDZ A;  5EQ1 A;  3O34 A;  4HBV A;  4TS8 A;  5E3G A;  4KV4 A;  2QIC A;  4FJC A;  4ZUX U;  4O74 A;  5DKA A;  2ECI A;  2DVV A;  4O71 A;  4IR6 A;  3ZVZ B;  4IR5 A;  5DBM A;  4YY6 A;  2LGV A;  2JMD A;  3I2D A;  4UI9 B;  2ECW A;  5E9V A;  1WES A;  4QSV A;  3D7C A;  4QEU A;  5G0F A;  4ZDT A;  1JOC A;  4QC3 A;  5C8G A;  2F6J A;  5CRM A;  2UZG A;  4F3I A;  3HCS A;  3UV2 A;  2LGG A;  5I29 A;  2M1R A;  5C89 A;  4A9I A;  4CA1 A;  4O7F A;  4TQN A;  3C5K A;  2KWK A;  5FBX A;  5G4S A;  5L99 A;  3ZPV 1;  4HXR A;  3M63 A;  2ECT A;  5LVR A;  4UP0 A;  2R0V A;  1EQF A;  5I89 A;  4FK5 A;  1X4U A;  4QSS A;  2MJV B;  4QSR A;  5DW2 A;  2RFJ A;  3G0J A;  5A83 A;  5TCM A;  2CSZ A;  3I3J A;  5L97 A;  4WZ3 B;  5CUG A;  5HEM A;  4NYW A;  5A85 A;  2MIQ A;  5HLS A;  5IGL A;  5HQ5 A;  2YEL A;  2K1J A;  2R0Y A;  5C85 A;  4GB0 A;  4WHW A;  5EIS A;  5HEN A;  5TB6 A;  4CL9 A;  3K2J A;  4CUU A;  1IYM A;  5DX4 A;  4ZC9 A;  1LDK C;  5CQ4 A;  3JVM A;  3VK6 A;  3KV6 A;  5AD2 A;  5FB0 A;  2MUM A;  4NN2 A;  5G4R A;  1WFK A;  4A9E A;  3L1Z B;  4NR5 A;  3LJW A;  5TDW A;  3U5L A;  2ECN A;  5I88 A;  5A5O A;  4I7C A;  2DAT A;  5LJ0 A;  4AP4 A;  5FEY A;  3SOU A;  3GG3 A;  5IGM A;  4TT4 A;  4QUT A;  4QR3 A;  2VP7 A;  5FE3 A;  2ECG A;  2L85 A;  5EWH A;  5DFB A;  2LN0 A;  4X2I A;  5ETB A;  3Q2E A;  4PTB A;  3U5M A;  4UIU A;  5HEL A;  3UVW A;  5C4Q A;  4WA6 A;  5FE8 A;  3Q2F A;  5TDR A;  2LXH C;  5CQ8 A;  3DWY A;  5EI4 A;  4A9H A;  2KGI A;  3M62 A;  5D3J A;  4MEQ A;  2VPG A;  4YC9 A;  5D3T A;  4YBS A;  3GL6 A;  1N87 A;  4N4F A;  5DYC A;  5EWV A;  4B86 C;  5ENG A;  4GPJ A;  4UYF A;  3JVJ A;  4PKL A;  3P1D A;  3UV4 A;  2MNY A;  1F62 A;  2LRI C;  5A5P A;  2YDW A;  2H60 A;  5DYX A;  4IC3 A;  2VPD A;  4S3O C;  5E3D A;  2E7O A;  3N9Q A;  5EP7 A;  3LRQ A;  3NG2 A;  2KE1 A;  5ACY A;  4MR5 A;  3O37 A;  4QY4 A;  5F60 A;  5FFV A;  2KIZ A;  5DKH A;  5HM0 A;  2Y1N A;  2M3H A;  4A49 A;  2DX8 A;  4CCG X;  4QF3 A;  1WIM A;  3QZT A;  2VPB A;  5L98 A;  5CUA A;  1WUG A;  4PS5 A;  4LLB A;  3NXB A;  4LZ2 A;  2MA5 A;  4X3G A;  4V3K C;  4YH4 A;  1ZS5 A;  5D3L A;  5II2 A;  3IU6 A;  3RCW A;  2EGP A;  2G43 A;  2F6N A;  1K2F A;  2PNX A;  4NS5 A;  4YAT A;  5AIT A;  5IGK A;  4GNG A;  5LCW B;  4TT2 A;  4YAD A;  4QC1 A;  5KTX A;  4WHU A;  4DON A;  2D8S A;  4NR6 A;  5KH9 A;  2K4D A;  2YUR A;  2MD7 B;  4HXP A;  5JG6 A;  4LYI A;  5FE6 A;  4BW2 A;  4IOR A;  4XY8 A;  5D3S A;  2L80 A;  1F68 A;  5LKU A;  5I3L A;  3AAD A;  5FE7 A;  5CQA A;  5E74 A;  5HRW A;  3SVH A;  4TZ2 A;  5HRV A;  4O77 A;  5FE0 A;  2G6Q A;  3C6W A;  5FER A;  1BOR A;  5FG5 A;  2LQ6 A;  5KHM A;  5D26 A;  5DYA A;  5CQT A;  4YYJ A;  4A4B A;  4UIY A;  3HCU A;  1JM7 B;  2K17 A;  4AUQ B;  2OO1 A;  5LJ2 A;  5CUD A;  3KQI A;  5HRX A;  2L5U A;  5E9I A;  2JMI A;  4HXN A;  5CQ6 A;  5EPB A;  5C11 A;  5B79 A;  5DYU A;  5B78 A;  4PCE A;  5D1L B;  1Z60 A;  5J3X A;  2E3K A;  5IGN A;  2F42 A;  3O33 A;  4KV1 A;  2G4A A;  4AKN A;  1WEU A;  2I50 A;  3ONI A;  4IOO A;  4QSP A;  4TU6 A;  5E9Y A;  4NR9 A;  5ENJ A;  2VJE A;  4XY9 A;  3U5N A;  5EWD A;  1WIL A;  2IDA A;  4UIV A;  4C66 A;  4QZS A;  4O7E A;  5I7Y A;  5D3N A;  3MQM A;  4QR5 A;  2HDP A;  5HJC A;  2L43 A;  5FG4 A;  2E7N A;  5FG6 A;  2FUI A;  5B75 A;  4A9L A;  3P1F A;  1X4J A;  2C2V S;  2R10 A;  5TRB A;  4TKP B;  3HTK C;  4TT6 A;  3IU5 A;  5CGP A;  5EPS A;  4Y03 A;  1LDJ B;  2E6R A;  4S3O B;  1WEM A;  1WEQ A;  4O78 A;  2MA6 A;  3O35 A;  5EIC A;  3G0L A;  4AYC A;  3U5O A;  4BJX A;  2RNX A;  2LGL A; 
#chains in the Genus database with same CATH topology
 1XWH A;  2RSD A;  4YYG A;  4LYW A;  2ECJ A;  4BBQ A;  3EB6 A;  2LGK A;  4YYK A;  4Z6I A;  5IID A;  1JSP B;  2CKL B;  2MNZ A;  3KDE C;  5F1H A;  4QSW A;  5F2P A;  5ENH A;  2EXU A;  2M6M A;  3D1D A;  5FH7 A;  5E0R A;  3LJU X;  5F61 A;  4UIX A;  3UVY A;  4OGE A;  4O75 A;  4WIV A;  4LDF A;  5D3P A;  5FH6 A;  3MB4 A;  5H9M A;  3FEH A;  5F25 A;  1MM3 A;  4WZ2 A;  4LZS A;  1WEW A;  4QF2 A;  4NR4 A;  2FD4 A;  3LDY A;  2YEK A;  5L8U A;  3PLW A;  2RI7 A;  4J0R A;  4YAX A;  4J3I A;  2NXB A;  5H1U A;  2YHO A;  4HXL A;  4A9J A;  1VYX A;  5SVX A;  2KWO A;  4LC2 A;  3QZS A;  5HQ6 A;  5AME A;  2VJE B;  2XEU A;  3O7A A;  2Y43 A;  2YSM A;  4MEP A;  5F1L A;  2KKY A;  5I83 A;  4AI6 A;  2OSS A;  2C2L A;  4GNE A;  4IOQ A;  4OGC A;  5L8T A;  4O70 A;  3U5P A;  5I80 A;  2DJA A;  5HQ7 A;  5A82 A;  5CQ3 A;  5KTW A;  1WEO A;  2ECV A;  4AVX A;  1JM7 A;  3S91 A;  4NUE A;  5I86 A;  4A9F A;  4IR3 A;  2KGG A;  4Z93 A;  1DCQ A;  4UYE A;  2KRE A;  5CUE A;  1HYI A;  2H0D B;  4LK9 A;  3DAI A;  2XB1 A;  4L7X A;  4YK0 A;  1FBV A;  5KO4 A;  4I7B A;  3UVX A;  3M7K A;  3LQJ A;  4UIW A;  3MHS A;  3N9M A;  5CY9 A;  4NXJ A;  5AMF A;  4GND A;  4C67 A;  2VPE A;  4YYI A;  5LJ1 A;  5C87 A;  2ZET C;  3PUQ A;  3SUB A;  3L11 A;  5HCL A;  5I40 A;  5CU8 A;  3ZYU A;  4Z6H A;  3L1X A;  1RMD A;  3MHH A;  4N4I A;  5KU3 A;  5II1 A;  2OUO A;  5E9M A;  4Z1S A;  4TU4 A;  2YW5 A;  2FSA A;  3JVL A;  5D25 A;  5COI A;  5DY7 A;  1WEV A;  4LJN A;  4UP5 A;  4QR4 A;  4FLP A;  1E6I A;  1Z2Q A;  2L7P A;  4Q6F A;  1T1H A;  4O76 A;  2VJF A;  4XYA A;  4O64 A;  4N4G A;  5F5Z A;  3PUR A;  5DFD A;  5H1T A;  4CUT A;  3O47 A;  3UW9 A;  2RR4 A;  4AKI A;  3LQI A;  2D82 A;  1FP0 A;  4OGJ A;  4KCX A;  5ENE A;  4PY6 A;  4NYX A;  2YQM A;  2M13 A;  3SOW A;  2XOY A;  2YSJ A;  5CQ7 A;  4QNS A;  5FE2 A;  5F36 A;  5BT5 A;  5FE9 A;  5LKT A;  3LQH A;  1CHC A;  1U6G B;  2IQJ A;  5SVI B;  3T7L A;  5JI8 A;  1JM4 B;  5A5S A;  4R8P K;  3HMF A;  3P5O A;  4TYL A;  3ZNI A;  5D1K B;  4R2Y A;  4C9Z A;  4NUD A;  2EOD A;  4QEW A;  5D24 A;  4NYV A;  5L96 A;  3AQA A;  5ENB A;  4QBM A;  2DWW A;  4MR3 A;  5EV9 A;  5CUB A;  4J1P A;  5D1M B;  4A4C A;  4LKA A;  5DFC A;  4UYH A;  5BT3 A;  5EWC A;  4NQM A;  3FL2 A;  2N9G A;  2KR4 A;  4NUC A;  5EVA A;  4XI1 A;  3D1B A;  5FFY A;  2P57 A;  2DVS A;  3SVG A;  4NR8 A;  2L5E A;  5E9L A;  2I7K A;  4O7A A;  4XUA A;  2YYN A;  3N9O A;  2JUN A;  2Y1M A;  5AIU A;  3U5K A;  5EPR A;  2YUC A;  1VFY A;  5ETD A;  5EM3 A;  4YH3 A;  5FH8 A;  4A9N A;  4IR4 A;  5G04 B;  3FM8 C;  3RTR B;  4QEV A;  4FIP A;  3HCT A;  4E96 A;  5A5N A;  2XP0 A;  2H0D A;  3RPG C;  2XOC A;  3IHP A;  2DVQ A;  4J0S A;  1HYJ A;  5C13 A;  2YW8 A;  3V43 A;  5TBN A;  2KFT A;  5A5Q A;  3VKG A;  5EA1 A;  3SVF A;  2DVR A;  3P1C A;  4QYL A;  2MD8 C;  4QSX A;  3T6R A;  5FE1 A;  4N3W A;  2JMJ A;  5D7X A;  2DKW A;  4MR6 A;  3DPL R;  4HBW A;  2YU4 A;  3LXJ A;  3PHD A;  3MUL A;  2HYE D;  5F63 A;  4UYD A;  4NRA A;  4CFK A;  5H1V A;  2D9E A;  4GNF A;  2CT2 A;  5ENC A;  2YVR A;  4N4H A;  4O7C A;  4XUB A;  5DLZ A;  2YQD A;  3T9K A;  2M85 A;  4F1P A;  4UIT A;  4FO9 A;  4OUF A;  3HMH A;  4OGI A;  4PCI A;  4MEO A;  3EB5 A;  5DKC A;  4HXO A;  2KU3 A;  3MDB C;  3O70 A;  1WE9 A;  2RNW A;  4HBX A;  3KV5 A;  2LAU A;  3N9N A;  5A5R A;  3M99 A;  5KH3 A;  4YYM A;  2QJ0 A;  4Q0O A;  4HBY A;  4UIZ A;  4YYH A;  5A7C A;  4RVR A;  4CFL A;  5G05 B;  5FE4 A;  1WUM A;  4YBM A;  5F3A A;  4ALG A;  3P1E A;  4ZW1 A;  4Z0R A;  2EA6 A;  2L0B A;  4O72 A;  5HFQ A;  1DVP A;  2YEM A;  3LVQ E;  4QSU A;  5EGU A;  5CPE A;  5JWM A;  3JVK A;  5FE5 A;  5J0D A;  5LUU A;  3ZYQ A;  5BT4 A;  2E6S A;  3ZTG A;  4A9M A;  5AD3 A;  3DDT A;  3GV4 A;  5CQ5 A;  2L84 A;  5K3Q A;  4F52 B;  4A9O A;  4CUR A;  2KWN A;  1X0J A;  5CS8 A;  2PUY A;  2RO1 A;  4NRB A;  5K29 A;  2G45 A;  5DKD A;  4TZ8 A;  1WEN A;  2LDR A;  4UYG A;  5D0C A;  5KH7 A;  2NAA A;  5B77 A;  5FFW A;  4MEN A;  4TTE A;  2LXP C;  4CUQ A;  3DWD A;  1WGM A;  4AYC B;  2WP1 A;  4QST A;  4HXM A;  1E4U A;  4P5O B;  4ZUX U;  2R0S A;  2VJF B;  4YY4 A;  3RPG B;  4A0C D;  4HXS A;  5EWW A;  1N72 A;  2BAY A;  3MXF A;  4HXK A;  4LZR A;  5CTL A;  5LKX A;  5CP5 A;  5HFR A;  2JRJ A;  3QZV A;  2K16 A;  3N9P A;  5LVQ A;  3MB3 A;  1VD4 A;  4CUP A;  4NR7 A;  1WEE A;  4YYD A;  1ZKR A;  4PPE A;  5FB1 A;  4MR4 A;  2YHN A;  5E7D A;  4CLB A;  3MUK A;  2YQL A;  2AN6 A;  2LV9 A;  2YYR A;  4LAD B;  4MVT A;  4AKG A;  4WZ0 A;  1G25 A;  4ZQL A;  4BW1 A;  4LYS A;  2I8N A;  4LRG A;  5KTU A;  2FUU A;  4R7E A;  5E73 A;  1WEP A;  4O7B A;  4QB3 A;  4Z1Q A;  3N9L A;  3UVD A;  3TLP A;  4BHW A;  3FKM X;  5EYA F;  2OXQ C;  2RNY A;  3HME A;  4NRC A;  5CFW A;  4A9K A;  1ZBD B;  5CZG A;  4BW4 A;  2CKL A;  2YRE A;  3KNV A;  3O36 A;  2RS9 B;  4L58 A;  1Z6U A;  5DIN A;  5CUC A;  5TAB A;  4Q0N A;  5F62 A;  3SOX A;  5DLX A;  2EGM A;  5A81 A;  4W4U A;  5C7N A;  5CRZ A;  5D3H A;  5DW1 A;  3U5J A;  5E9K A;  2KTB B;  2KYU A;  2QIZ A;  2LSP B;  2XOZ A;  2L75 A;  5B76 A;  5LKZ A;  3ASL A;  1X4I A;  4BW3 A;  4MSX A;  5B8D A;  2B0O E;  2MT5 A;  1MM2 A;  4YYN A;  3ZVY A;  2YT5 A;  5I1Q A;  4B7Y C;  5EK9 A;  5EU1 A;  2GRC A;  4UYF B;  4IC2 A;  5I7X A;  3S92 A;  3DQV R;  4I7D A;  4CUS A;  2WP2 A;  2E61 A;  4YAB A;  1V87 A;  4V3L C;  4NQN A;  5IBN A;  5ENI A;  2VNF A;  3ZPV E;  2KWJ A;  4LR6 A;  5ENF A;  5H85 A;  5IG6 A;  4QYD A;  4QUU A;  3UV5 A;  4ALH A;  2CSY A;  4YBT A;  4QSQ A;  3SHB A;  3E2D A;  5D3R A;  5FDZ A;  5EQ1 A;  3O34 A;  4HBV A;  4TS8 A;  5E3G A;  4KV4 A;  2QIC A;  4FJC A;  5SVY A;  4O74 A;  5DKA A;  2CSV A;  2ECI A;  2DVV A;  4O71 A;  4IR6 A;  3ZVZ B;  4IR5 A;  5DBM A;  4YY6 A;  2LGV A;  3FJU B;  4QQ4 A;  2JMD A;  5SVI A;  3I2D A;  1MBM A;  3JUE A;  4UI9 B;  2ECW A;  5E9V A;  1WES A;  4QSV A;  3D7C A;  4QEU A;  5G0F A;  4ZDT A;  1JOC A;  4QC3 A;  5C8G A;  2F6J A;  5CRM A;  2UZG A;  4F3I A;  3HCS A;  3UV2 A;  2LGG A;  5I29 A;  2M1R A;  5C89 A;  4A9I A;  4CA1 A;  4O7F A;  4TQN A;  3C5K A;  2KWK A;  5FBX A;  5G4S A;  5L99 A;  3ZPV 1;  4HXR A;  2CRR A;  3M63 A;  2ECT A;  3ERR A;  5LVR A;  4UP0 A;  2R0V A;  1EQF A;  5I89 A;  4FK5 A;  1X4U A;  4QSS A;  2MJV B;  4QSR A;  5DW2 A;  2RFJ A;  3G0J A;  5A83 A;  5TCM A;  2CSZ A;  2MKE A;  3I3J A;  5L97 A;  2CON A;  4WZ3 B;  5CUG A;  5HEM A;  4NYW A;  5A85 A;  2MIQ A;  5HLS A;  5IGL A;  4O62 A;  5HQ5 A;  2YEL A;  2K1J A;  2R0Y A;  5C85 A;  4GB0 A;  4WHW A;  5EIS A;  5HEN A;  5TB6 A;  4CL9 A;  3K2J A;  4CUU A;  1IYM A;  5DX4 A;  4ZC9 A;  1LDK C;  5CQ4 A;  3JVM A;  3FAO A;  3VK6 A;  3KV6 A;  5AD2 A;  5FB0 A;  2MUM A;  4NN2 A;  5G4R A;  1WFK A;  4A9E A;  3L1Z B;  4NR5 A;  3LJW A;  5TDW A;  3U5L A;  2ECN A;  5I88 A;  5A5O A;  4I7C A;  2DAT A;  5LJ0 A;  4AP4 A;  5FEY A;  3SOU A;  3GG3 A;  5IGM A;  4TT4 A;  4QUT A;  4QR3 A;  2VP7 A;  5FE3 A;  2ECG A;  2L85 A;  5EWH A;  5DFB A;  2LN0 A;  4X2I A;  5ETB A;  3Q2E A;  4PTB A;  3U5M A;  4UIU A;  5HEL A;  3UVW A;  5C4Q A;  2FFW A;  3LVR E;  4WA6 A;  5FE8 A;  3Q2F A;  5TDR A;  2KKX A;  2LXH C;  5CQ8 A;  3DWY A;  5EI4 A;  4A9H A;  2KGI A;  3M62 A;  3FAN A;  5D3J A;  4MEQ A;  2VPG A;  4YC9 A;  5D3T A;  4YBS A;  3GL6 A;  1N87 A;  4N4F A;  5DYC A;  5EWV A;  4B86 C;  5ENG A;  4GPJ A;  4UYF A;  3JVJ A;  4PKL A;  3P1D A;  3UV4 A;  2MNY A;  1F62 A;  2LRI C;  5A5P A;  2YDW A;  2H60 A;  5DYX A;  4IC3 A;  2VPD A;  4S3O C;  5E3D A;  2E7O A;  3N9Q A;  5EP7 A;  3LRQ A;  3NG2 A;  2KE1 A;  5ACY A;  4MR5 A;  3O37 A;  4QY4 A;  5F60 A;  5FFV A;  2KIZ A;  2OWA A;  5DKH A;  5HM0 A;  2Y1N A;  2M3H A;  4A49 A;  2DX8 A;  4CCG X;  4QF3 A;  1WIM A;  3QZT A;  2VPB A;  5L98 A;  5CUA A;  1WUG A;  4PS5 A;  4LLB A;  3NXB A;  4LZ2 A;  2MA5 A;  4X3G A;  4V3K C;  4YH4 A;  1ZS5 A;  5D3L A;  5II2 A;  3IU6 A;  3RCW A;  2EGP A;  2G43 A;  2F6N A;  1K2F A;  2PNX A;  4NS5 A;  4YAT A;  3H7H A;  5AIT A;  5IGK A;  4GNG A;  5LCW B;  4TT2 A;  4YAD A;  4QC1 A;  5KTX A;  4WHU A;  4DON A;  2D8S A;  2DSM A;  4NR6 A;  5KH9 A;  2K4D A;  2YUR A;  2MD7 B;  4HXP A;  2CRW A;  5JG6 A;  4LYI A;  1PUO A;  5FE6 A;  4BW2 A;  4IOR A;  4XY8 A;  5D3S A;  2L80 A;  1F68 A;  5LKU A;  5I3L A;  3AAD A;  5FE7 A;  5CQA A;  5E74 A;  5HRW A;  3SVH A;  4TZ2 A;  5HRV A;  4O77 A;  5FE0 A;  2G6Q A;  3C6W A;  5FER A;  1BOR A;  5FG5 A;  3Q1D A;  2LQ6 A;  5KHM A;  5D26 A;  5DYA A;  5CQT A;  4YYJ A;  4A4B A;  4UIY A;  3HCU A;  1JM7 B;  2K17 A;  4AUQ B;  2OO1 A;  5LJ2 A;  5CUD A;  3KQI A;  5HRX A;  2L5U A;  5E9I A;  2JMI A;  4HXN A;  5CQ6 A;  5EPB A;  5C11 A;  5B79 A;  5DYU A;  5B78 A;  4PCE A;  5D1L B;  1Z60 A;  5J3X A;  2E3K A;  5IGN A;  2F42 A;  3O33 A;  4KV1 A;  2G4A A;  4AKN A;  1WEU A;  2I50 A;  3ONI A;  4IOO A;  4QSP A;  4TU6 A;  5E9Y A;  4NR9 A;  5ENJ A;  2VJE A;  4XY9 A;  3U5N A;  5EWD A;  1WIL A;  2IDA A;  4UIV A;  4C66 A;  4QZS A;  4O7E A;  5I7Y A;  5D3N A;  3MQM A;  4QR5 A;  2HDP A;  5HJC A;  2L43 A;  5FG4 A;  4AKH A;  2E7N A;  5FG6 A;  2FUI A;  5B75 A;  4A9L A;  3P1F A;  1X4J A;  2C2V S;  2R10 A;  5TRB A;  4TKP B;  3HTK C;  4H9D A;  4TT6 A;  3IU5 A;  5CGP A;  5EPS A;  4Y03 A;  1LDJ B;  2EJN A;  2E6R A;  4S3O B;  3VKH A;  1WEM A;  1WEQ A;  4O78 A;  2MA6 A;  3O35 A;  5EIC A;  3G0L A;  4Z0O A;  4AYC A;  2D8U A;  3U5O A;  2JM3 A;  4BJX A;  2RNX A;  2LGL A; 
#chains in the Genus database with same CATH homology
 1XWH A;  2RSD A;  4YYG A;  4LYW A;  2ECJ A;  4BBQ A;  3EB6 A;  2LGK A;  4YYK A;  4Z6I A;  5IID A;  1JSP B;  2CKL B;  2MNZ A;  5F1H A;  4QSW A;  5F2P A;  5ENH A;  2M6M A;  5FH7 A;  5E0R A;  5F61 A;  4UIX A;  3UVY A;  4O75 A;  4WIV A;  4LDF A;  5D3P A;  5FH6 A;  3MB4 A;  5H9M A;  5F25 A;  1MM3 A;  4WZ2 A;  4LZS A;  1WEW A;  4QF2 A;  4NR4 A;  2YEK A;  5L8U A;  2RI7 A;  4J0R A;  4YAX A;  4J3I A;  2NXB A;  5H1U A;  2YHO A;  4HXL A;  4A9J A;  1VYX A;  2KWO A;  4LC2 A;  3QZS A;  5HQ6 A;  5AME A;  2VJE B;  2XEU A;  3O7A A;  2Y43 A;  2YSM A;  4MEP A;  5F1L A;  4GNE A;  5I83 A;  2C2L A;  2OSS A;  4IOQ A;  5L8T A;  4O70 A;  3U5P A;  5I80 A;  4AVX A;  5HQ7 A;  5A82 A;  5CQ3 A;  5KTW A;  1WEO A;  2ECV A;  1JM7 A;  3S91 A;  4NUE A;  5I86 A;  4A9F A;  4IR3 A;  2KGG A;  4Z93 A;  4UYE A;  2KRE A;  5CUE A;  1HYI A;  2H0D B;  4LK9 A;  3DAI A;  2XB1 A;  4L7X A;  4YK0 A;  1FBV A;  5KO4 A;  4I7B A;  3UVX A;  3LQJ A;  4UIW A;  3MHS A;  3N9M A;  5CY9 A;  4NXJ A;  5AMF A;  4GND A;  4C67 A;  2VPE A;  4YYI A;  5LJ1 A;  5C87 A;  2ZET C;  3PUQ A;  3L11 A;  5HCL A;  5I40 A;  5CU8 A;  3ZYU A;  4Z6H A;  3L1X A;  1RMD A;  3MHH A;  4N4I A;  5KU3 A;  5II1 A;  2OUO A;  5E9M A;  4Z1S A;  4TU4 A;  2YW5 A;  2FSA A;  3JVL A;  5D25 A;  5COI A;  5DY7 A;  1WEV A;  4LJN A;  4UP5 A;  4QR4 A;  4FLP A;  1E6I A;  1Z2Q A;  4Q6F A;  1T1H A;  4O76 A;  2VJF A;  4XYA A;  4O64 A;  4N4G A;  5F5Z A;  3PUR A;  5DFD A;  5H1T A;  4CUT A;  3UW9 A;  3LQI A;  2D82 A;  1FP0 A;  4OGJ A;  4KCX A;  5ENE A;  4PY6 A;  4NYX A;  2YQM A;  3SOW A;  2YSJ A;  5CQ7 A;  4QNS A;  5FE2 A;  5F36 A;  5BT5 A;  5FE9 A;  5LKT A;  3LQH A;  1CHC A;  1U6G B;  3T7L A;  5JI8 A;  1JM4 B;  5A5S A;  4R8P K;  3HMF A;  3P5O A;  4TYL A;  3ZNI A;  5D1K B;  4R2Y A;  4C9Z A;  4NUD A;  2EOD A;  4QEW A;  5D24 A;  4NYV A;  5L96 A;  3AQA A;  5ENB A;  4QBM A;  2DWW A;  4MR3 A;  5EV9 A;  5CUB A;  4J1P A;  5D1M B;  4A4C A;  4LKA A;  5DFC A;  4UYH A;  5BT3 A;  5EWC A;  4NQM A;  3FL2 A;  2N9G A;  2KR4 A;  4NUC A;  5EVA A;  4XI1 A;  5FFY A;  2DVS A;  3SVG A;  4NR8 A;  2L5E A;  5E9L A;  2I7K A;  4O7A A;  4XUA A;  2YYN A;  3N9O A;  2Y1M A;  5AIU A;  3U5K A;  5EPR A;  2YUC A;  1VFY A;  5ETD A;  5EM3 A;  4YH3 A;  5FH8 A;  4A9N A;  4IR4 A;  5G04 B;  3RTR B;  4QEV A;  4FIP A;  3HCT A;  4E96 A;  5A5N A;  2H0D A;  3RPG C;  3IHP A;  2DVQ A;  4J0S A;  1HYJ A;  5C13 A;  2YW8 A;  3V43 A;  5TBN A;  2KFT A;  5A5Q A;  5EA1 A;  3SVF A;  2DVR A;  3P1C A;  4QYL A;  2MD8 C;  4QSX A;  3T6R A;  5FE1 A;  4N3W A;  2JMJ A;  5D7X A;  2DKW A;  4MR6 A;  3DPL R;  4HBW A;  2YU4 A;  3LXJ A;  3PHD A;  3MUL A;  2HYE D;  5F63 A;  4UYD A;  4NRA A;  4CFK A;  5H1V A;  2D9E A;  4GNF A;  2CT2 A;  5ENC A;  4N4H A;  4O7C A;  4XUB A;  5DLZ A;  2YQD A;  2M85 A;  4UIT A;  4FO9 A;  4OUF A;  3HMH A;  4OGI A;  4PCI A;  4MEO A;  3EB5 A;  5DKC A;  4HXO A;  2KU3 A;  3O70 A;  1WE9 A;  2RNW A;  4HBX A;  3KV5 A;  3N9N A;  5A5R A;  3M99 A;  5KH3 A;  4YYM A;  2QJ0 A;  4Q0O A;  4HBY A;  4UIZ A;  4YYH A;  5A7C A;  4RVR A;  4CFL A;  5G05 B;  5FE4 A;  1WUM A;  4YBM A;  5F3A A;  4ALG A;  3P1E A;  4ZW1 A;  2EA6 A;  2L0B A;  4O72 A;  5HFQ A;  1DVP A;  2YEM A;  4QSU A;  5EGU A;  5CPE A;  5JWM A;  3JVK A;  5FE5 A;  5J0D A;  5LUU A;  3ZYQ A;  5BT4 A;  2E6S A;  3ZTG A;  4A9M A;  5AD3 A;  3GV4 A;  5CQ5 A;  2L84 A;  4F52 B;  4A9O A;  4CUR A;  2KWN A;  1X0J A;  5CS8 A;  2PUY A;  2RO1 A;  4NRB A;  5K29 A;  2G45 A;  5DKD A;  4TZ8 A;  1WEN A;  2LDR A;  4UYG A;  5D0C A;  5KH7 A;  2NAA A;  5B77 A;  5FFW A;  4MEN A;  4TTE A;  2LXP C;  4CUQ A;  1WGM A;  4AYC B;  2WP1 A;  4QST A;  4HXM A;  1E4U A;  4P5O B;  2R0S A;  2VJF B;  4YY4 A;  3RPG B;  4A0C D;  4HXS A;  5EWW A;  1N72 A;  2BAY A;  3MXF A;  4HXK A;  4LZR A;  5CTL A;  5LKX A;  5CP5 A;  5HFR A;  2JRJ A;  3QZV A;  2K16 A;  3N9P A;  5LVQ A;  3MB3 A;  1VD4 A;  4CUP A;  4NR7 A;  1WEE A;  4YYD A;  4PPE A;  5FB1 A;  4MR4 A;  2YHN A;  5E7D A;  4CLB A;  3MUK A;  2YQL A;  2AN6 A;  2LV9 A;  2YYR A;  4LAD B;  4MVT A;  4WZ0 A;  1G25 A;  4ZQL A;  4BW1 A;  4LYS A;  2I8N A;  4LRG A;  5KTU A;  2FUU A;  4R7E A;  5E73 A;  1WEP A;  4O7B A;  4QB3 A;  4Z1Q A;  3N9L A;  3UVD A;  3TLP A;  4BHW A;  3FKM X;  5EYA F;  2OXQ C;  2RNY A;  3HME A;  4NRC A;  5CFW A;  4A9K A;  1ZBD B;  5CZG A;  4BW4 A;  2CKL A;  2YRE A;  3KNV A;  3O36 A;  2RS9 B;  4L58 A;  1Z6U A;  5DIN A;  5CUC A;  5TAB A;  4Q0N A;  5F62 A;  3SOX A;  5DLX A;  5A81 A;  4W4U A;  5C7N A;  5CRZ A;  5D3H A;  5DW1 A;  3U5J A;  5E9K A;  2KTB B;  2KYU A;  2QIZ A;  2LSP B;  2L75 A;  5B76 A;  5LKZ A;  3ASL A;  1X4I A;  4BW3 A;  4MSX A;  5B8D A;  2MT5 A;  1MM2 A;  4YYN A;  3ZVY A;  2YT5 A;  5I1Q A;  4B7Y C;  5EK9 A;  5EU1 A;  2GRC A;  4UYF B;  4IC2 A;  5I7X A;  3S92 A;  3DQV R;  4I7D A;  4CUS A;  2WP2 A;  4YAB A;  1V87 A;  4V3L C;  4NQN A;  5IBN A;  5ENI A;  2VNF A;  3ZPV E;  2KWJ A;  4LR6 A;  5ENF A;  5H85 A;  5IG6 A;  4QYD A;  4QUU A;  3UV5 A;  4ALH A;  2CSY A;  4YBT A;  4QSQ A;  3SHB A;  5D3R A;  5FDZ A;  5EQ1 A;  3O34 A;  4HBV A;  4TS8 A;  5E3G A;  4KV4 A;  2QIC A;  4FJC A;  4ZUX U;  4O74 A;  5DKA A;  2ECI A;  2DVV A;  4O71 A;  4IR6 A;  3ZVZ B;  4IR5 A;  5DBM A;  4YY6 A;  2LGV A;  2JMD A;  3I2D A;  4UI9 B;  2ECW A;  5E9V A;  1WES A;  4QSV A;  3D7C A;  4QEU A;  5G0F A;  4ZDT A;  1JOC A;  4QC3 A;  5C8G A;  2F6J A;  5CRM A;  2UZG A;  4F3I A;  3HCS A;  3UV2 A;  2LGG A;  5I29 A;  2M1R A;  5C89 A;  4A9I A;  4CA1 A;  4O7F A;  4TQN A;  3C5K A;  2KWK A;  5FBX A;  5G4S A;  5L99 A;  3ZPV 1;  4HXR A;  3M63 A;  2ECT A;  5LVR A;  4UP0 A;  2R0V A;  1EQF A;  5I89 A;  4FK5 A;  1X4U A;  4QSS A;  2MJV B;  4QSR A;  5DW2 A;  2RFJ A;  3G0J A;  5A83 A;  5TCM A;  2CSZ A;  3I3J A;  5L97 A;  4WZ3 B;  5CUG A;  5HEM A;  4NYW A;  5A85 A;  2MIQ A;  5HLS A;  5IGL A;  5HQ5 A;  2YEL A;  2K1J A;  2R0Y A;  5C85 A;  4GB0 A;  4WHW A;  5EIS A;  5HEN A;  5TB6 A;  4CL9 A;  3K2J A;  4CUU A;  1IYM A;  5DX4 A;  4ZC9 A;  1LDK C;  5CQ4 A;  3JVM A;  3VK6 A;  3KV6 A;  5AD2 A;  5FB0 A;  2MUM A;  4NN2 A;  5G4R A;  1WFK A;  4A9E A;  3L1Z B;  4NR5 A;  3LJW A;  5TDW A;  3U5L A;  2ECN A;  5I88 A;  5A5O A;  4I7C A;  2DAT A;  5LJ0 A;  4AP4 A;  5FEY A;  3SOU A;  3GG3 A;  5IGM A;  4TT4 A;  4QUT A;  4QR3 A;  2VP7 A;  5FE3 A;  2ECG A;  2L85 A;  5EWH A;  5DFB A;  2LN0 A;  4X2I A;  5ETB A;  3Q2E A;  4PTB A;  3U5M A;  4UIU A;  5HEL A;  3UVW A;  5C4Q A;  4WA6 A;  5FE8 A;  3Q2F A;  5TDR A;  2LXH C;  5CQ8 A;  3DWY A;  5EI4 A;  4A9H A;  2KGI A;  3M62 A;  5D3J A;  4MEQ A;  2VPG A;  4YC9 A;  5D3T A;  4YBS A;  3GL6 A;  1N87 A;  4N4F A;  5DYC A;  5EWV A;  4B86 C;  5ENG A;  4GPJ A;  4UYF A;  3JVJ A;  4PKL A;  3P1D A;  3UV4 A;  2MNY A;  1F62 A;  2LRI C;  5A5P A;  2YDW A;  2H60 A;  5DYX A;  4IC3 A;  2VPD A;  4S3O C;  5E3D A;  2E7O A;  3N9Q A;  5EP7 A;  3LRQ A;  3NG2 A;  2KE1 A;  5ACY A;  4MR5 A;  3O37 A;  4QY4 A;  5F60 A;  5FFV A;  2KIZ A;  5DKH A;  5HM0 A;  2Y1N A;  2M3H A;  4A49 A;  2DX8 A;  4CCG X;  4QF3 A;  1WIM A;  3QZT A;  2VPB A;  5L98 A;  5CUA A;  1WUG A;  4PS5 A;  4LLB A;  3NXB A;  4LZ2 A;  2MA5 A;  4X3G A;  4V3K C;  4YH4 A;  1ZS5 A;  5D3L A;  5II2 A;  3IU6 A;  3RCW A;  2EGP A;  2G43 A;  2F6N A;  1K2F A;  2PNX A;  4NS5 A;  4YAT A;  5AIT A;  5IGK A;  4GNG A;  5LCW B;  4TT2 A;  4YAD A;  4QC1 A;  5KTX A;  4WHU A;  4DON A;  2D8S A;  4NR6 A;  5KH9 A;  2K4D A;  2YUR A;  2MD7 B;  4HXP A;  5JG6 A;  4LYI A;  5FE6 A;  4BW2 A;  4IOR A;  4XY8 A;  5D3S A;  2L80 A;  1F68 A;  5LKU A;  5I3L A;  3AAD A;  5FE7 A;  5CQA A;  5E74 A;  5HRW A;  3SVH A;  4TZ2 A;  5HRV A;  4O77 A;  5FE0 A;  2G6Q A;  3C6W A;  5FER A;  1BOR A;  5FG5 A;  2LQ6 A;  5KHM A;  5D26 A;  5DYA A;  5CQT A;  4YYJ A;  4A4B A;  4UIY A;  3HCU A;  1JM7 B;  2K17 A;  4AUQ B;  2OO1 A;  5LJ2 A;  5CUD A;  3KQI A;  5HRX A;  2L5U A;  5E9I A;  2JMI A;  4HXN A;  5CQ6 A;  5EPB A;  5C11 A;  5B79 A;  5DYU A;  5B78 A;  4PCE A;  5D1L B;  1Z60 A;  5J3X A;  2E3K A;  5IGN A;  2F42 A;  3O33 A;  4KV1 A;  2G4A A;  4AKN A;  1WEU A;  2I50 A;  3ONI A;  4IOO A;  4QSP A;  4TU6 A;  5E9Y A;  4NR9 A;  5ENJ A;  2VJE A;  4XY9 A;  3U5N A;  5EWD A;  1WIL A;  2IDA A;  4UIV A;  4C66 A;  4QZS A;  4O7E A;  5I7Y A;  5D3N A;  3MQM A;  4QR5 A;  2HDP A;  5HJC A;  2L43 A;  5FG4 A;  2E7N A;  5FG6 A;  2FUI A;  5B75 A;  4A9L A;  3P1F A;  1X4J A;  2C2V S;  2R10 A;  5TRB A;  4TKP B;  3HTK C;  4TT6 A;  3IU5 A;  5CGP A;  5EPS A;  4Y03 A;  1LDJ B;  2E6R A;  4S3O B;  1WEM A;  1WEQ A;  4O78 A;  2MA6 A;  3O35 A;  5EIC A;  3G0L A;  4AYC A;  3U5O A;  4BJX A;  2RNX A;  2LGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...