3QZVA

Crystal structure of bptf phd-linker-bromo in complex with histone h4k12ac peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
KLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of a Mononucleosomal Histone Modification Pattern by BPTF via Multivalent Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/nuclear protein
molecule keywords Nucleosome-remodeling factor subunit BPTF
total genus 57
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2011-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3qzvA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3qzvA01
4ZDTA 3GV4A 3RTRB 5EPSA 2ECJA 5DYCA 4BJXA 4O71A 5COIA 5CQ6A 5C7NA 4WZ3B 5D1MB 4HXMA 5CS8A 3M62A 4HXRA 5CTLA 5E9KA 5DW1A 2M85A 2KGIA 3O34A 5FFVA 3N9PA 1HYIA 5DKAA 2LGKA 4QF2A 4QSPA 2YUCA 5H1UA 4C66A 5HELA 1JM7A 5F1LA 2H0DB 5BT3A 5DYAA 4YADA 5J3XA 5IGNA 2GRCA 5FB0A 2MA6A 4R8PK 5LVRA 5CY9A 5TDRA 3HCTA 3O35A 5TABA 4HXLA 2F6JA 2ECWA 4BW4A 2H60A 4KCXA 4HXNA 5DFDA 5DFCA 2CT2A 3UVXA 4QY4A 4HBWA 5HFQA 4CUSA 5I29A 3ZPV1 2ECVA 4S3OB 2EGPA 4HBVA 5F61A 4QEWA 4TU6A 5EI4A 1T1HA 3FL2A 2ECIA 1VYXA 5B79A 4NYWA 4CUTA 4UIUA 5ENCA 3NG2A 3O33A 4GNEA 3SOXA 3HCUA 5E3DA 5C89A 4LADB 3EB5A 5TBNA 5I40A 2C2LA 5FE1A 4YYGA 3O37A 2VP7A 4NR5A 2YREA 2R0YA 4Z1SA 4WZ2A 5C8GA 4E96A 4W4UA 3RPGC 5ETDA 4A4CA 3JVJA 5DLXA 2FUIA 5FH7A 3HTKC 4AYCB 4N4FA 4QEUA 4QZSA 2CSZA 2MT5A 3N9OA 4O72A 1F62A 1CHCA 1WEPA 2EODA 4O76A 2CKLA 2L80A 5ENJA 1ZS5A 4OUFA 4CUUA 5D3HA 5IGLA 5CUAA 4ZUXU 3SOWA 5LKZA 4BW3A 1X4UA 3LQJA 4QUUA 1JSPB 5FH8A 2R10A 2E3KA 5H1VA 4CUPA 4CL9A 2M3HA 5D1KB 1WEWA 5CU8A 5I83A 2YURA 4A9OA 3K2JA 4N4IA 4N4HA 4UYDA 1F68A 3MULA 2MIQA 4UIYA 2C2VS 5FE7A 5HRWA 5H9MA 3M99A 5HRXA 3MB3A 5F63A 5A85A 4Z6IA 2YW8A 2KREA 4YBTA 4NS5A 3P1EA 4NUCA 4UYFA 5D3SA 4UI9B 2RNWA 4UP0A 2DVVA 5I1QA 5I7YA 2MNZA 2K1JA 4PKLA 1X4IA 4MSXA 3FKMX 4KV1A 4YYKA 5LJ2A 5F5ZA 1Z60A 2I50A 3SVHA 5B78A 5B77A 5LKXA 5EM3A 5D26A 4MEOA 1WEMA 2NAAA 2LQ6A 2MNYA 2E6RA 1WEVA 2L75A 5E9MA 4TTEA 2VJEA 3ASLA 3C6WA 2MA5A 4IOOA 4ALHA 2R0SA 3T7LA 4UP5A 3DWYA 5EQ1A 3U5KA 4O7AA 5EWWA 3PURA 4IR5A 4A9EA 2YQDA 4O78A 4UITA 5FE8A 5EICA 5CQ4A 4YC9A 3QZTA 3D7CA 2JMIA 2WP2A 2KR4A 5HQ7A 2HYED 4V3KC 4R7EA 4UIWA 4AVXA 3I3JA 4PCEA 5CZGA 2Y43A 3RPGB 2D82A 4QEVA 4TT6A 5K29A 4O64A 3TLPA 4BW1A 5AMEA 4NN2A 5F3AA 1DVPA 5J0DA 2UZGA 2WP1A 2LXPC 5I3LA 3AADA 4HXKA 5FG5A 4A4BA 5G04B 2QJ0A 5DX4A 3JVLA 5DLZA 2H0DA 1WUMA 3N9MA 1WEOA 4LJNA 3ZTGA 5G05B 5TDWA 5G4SA 2RNYA 4S3OC 2LV9A 5C4QA 5C85A 2YU4A 4O7BA 3UV5A 2YSMA 5KH7A 3UV2A 4UYFB 5CFWA 2JMJA 4GNDA 4NRAA 5IG6A 3LRQA 4QSXA 4O7EA 4XYAA 4Z93A 5HENA 3O7AA 1G25A 4CUQA 4GPJA 2BAYA 2QICA 4LYIA 4P5OB 5FB1A 5CPEA 3U5PA 5KH9A 5E74A 2MJVB 2YSJA 5AD2A 3UW9A 2KWNA 1JM7B 2XB1A 4LC2A 5L99A 3O70A 5KU3A 3DAIA 4LKAA 4MR4A 5HCLA 3SVGA 5DYUA 4IR6A 4YATA 5BT4A 2VPBA 4A0CD 4NR8A 5DKHA 2HDPA 3VK6A 2VJFA 4BW2A 4BHWA 4XUAA 2OXQC 5DBMA 2Y1NA 5DKDA 2AN6A 1V87A 1EQFA 2KIZA 5D1LB 5EISA 5B76A 3P1CA 4WHWA 4YAXA 2DATA 5FEYA 5TRBA 2L5EA 3JVKA 4QSSA 4LZRA 1JOCA 1WENA 2VPGA 4J0RA 5D24A 4AP4A 4QC3A 5EWDA 1WESA 4A9FA 5E9LA 5EWCA 1WE9A 2CKLB 2K4DA 5CRZA 5LUUA 4J0SA 3MQMA 4A9JA 4WZ0A 5C11A 2ZETC 4FIPA 5CGPA 2KWKA 4YK0A 4TYLA 4TZ2A 2KE1A 4UIZA 2G45A 3ZVZB 4PPEA 4QNSA 3C5KA 4R2YA 5EYAF 4NYXA 5F62A 4NXJA 2DX8A 4MEQA 1WGMA 5HEMA 3KV5A 3S91A 2JRJA 3U5JA 4A9KA 5ENGA 2LGLA 3KV6A 5LKTA 5LJ0A 4FK5A 4NQNA 5L8UA 5I7XA 4QSWA 5A5RA 5D3JA 5JWMA 5F36A 3HMHA 5CRMA 5I80A 4MEPA 5B75A 5ACYA 1N87A 2YEMA 4QYDA 4A9NA 4IC3A 1WFKA 3KNVA 4RVRA 5A7CA 5HRVA 3DPLR 4F3IA 4LYWA 4YBMA 2RNXA 5A82A 5AITA 3M63A 5A5QA 5ETBA 3Q2FA 4MR6A 4YYNA 3ZYQA 4YYJA 5FBXA 2LGGA 5ENEA 3PHDA 4YH3A 3DQVR 5CQ7A 1HYJA 3Q2EA 5EV9A 5TCMA 2LSPB 2OSSA 2FUUA 4I7BA 5CQTA 2NXBA 1VD4A 4Y03A 5FE9A 2CSYA 5EGUA 4N3WA 1XWHA 5HJCA 4Q0NA 4A9IA 5D3NA 2KWJA 2YHNA 4B7YC 5D3PA 4HXSA 2K17A 5G0FA 2F6NA 5H85A 5LKUA 5AD3A 5C87A 5JG6A 4QF3A 2YQLA 5HQ5A 4UYGA 3SOUA 2RSDA 4GNFA 5CUDA 1ZBDB 4GNGA 2F42A 5HLSA 4QR3A 2ECNA 5IBNA 4ZQLA 2YW5A 4HXPA 2YT5A 4YYDA 1X0JA 4N4GA 2LN0A 3N9LA 5FERA 5I88A 5CQAA 4QSUA 2LGVA 2L43A 5D25A 1U6GB 5ENBA 4OGJA 4PS5A 2QIZA 3PUQA 5EK9A 3HMEA 2DKWA 5DW2A 4CFKA 2G4AA 4O7FA 5D0CA 1WUGA 4MR5A 4NYVA 4TT4A 5EWVA 5I86A 2KGGA 4LRGA 3ZYUA 5HM0A 5E9IA 5HQ6A 2I7KA 4NR7A 5KTWA 3HCSA 2N9GA 3HMFA 5DYXA 5D3LA 5E9VA 5E9YA 4O7CA 5F60A 4AYCA 5F1HA 5C13A 4XY9A 5ENHA 1E4UA 5CUEA 3P5OA 4YH4A 3L1ZB 4FLPA 4IR4A 4QSRA 3ZVYA 5IGKA 4QUTA 4WHUA 5DKCA 2EA6A 4QR5A 3U5OA 4FJCA 4O70A 4Q0OA 2D8SA 2KYUA 4ZW1A 3U5NA 2L0BA 5KH3A 5EP7A 3ONIA 3MB4A 3SVFA 1Z6UA 3ZNIA 2G6QA 2YYRA 2YYNA 5CUCA 5BT5A 5FE6A 3O36A 4HBYA 4OGIA 3S92A 5CQ3A 4YYHA 4YYIA 4LYSA 3N9QA 5E3GA 4YY6A 2YELA 5LVQA 1E6IA 4QSQA 4YY4A 4TU4A 5ENIA 5JI8A 1MM2A 1WILA 3G0LA 5KTUA 4F52B 1JM4B 5HFRA 3QZSA 5D3TA 3L1XA 3IHPA 5A83A 2RI7A 2RS9B 5CUBA 4C9ZA 4UYHA 4LDFA 5FE0A 4A9LA 4ZC9A 4PCIA 1X4JA 2LXHC 3L11A 4TZ8A 4CA1A 4I7CA 4TKPB 1VFYA 1FP0A 3T6RA 4NQMA 3KQIA 5E7DA 2RFJA 3EB6A 2KWOA 2VPEA 4V3LC 4QSTA 2KFTA 5L8TA 4KV4A 4UIVA 3LQHA 5LJ1A 2E7OA 5II1A 4QB3A 4Z1QA 5F2PA 4IOQA 3LJWA 3NXBA 5EPRA 4YABA 3U5MA 4XUBA 5L97A 5F25A 2L5UA 3LQIA 4IC2A 4QC1A 4NUEA 2IDAA 3RCWA 4A9HA 2OO1A 4A9MA 4MENA 1FBVA 2I8NA 3IU5A 4O75A 5B8DA 3JVMA 3UVDA 2D9EA 2DVRA 2PUYA 2PNXA 5ENFA 4X2IA 3P1DA 3AQAA 4TQNA 1WEEA 4LLBA 1WEUA 2L84A 2G43A 2KU3A 2KTBB 5II2A 4BBQA 5DY7A 5KO4A 4GB0A 3MUKA 4QYLA 5A5OA 1LDKC 5DINA 4A49A 2OUOA 5A81A 4YBSA 5A5SA 4LZSA 4UIXA 4NR6A 5CP5A 2Y1MA 2DVQA 4MVTA 2ECTA 2MD8C 3GG3A 3IU6A 3P1FA 5EU1A 2R0VA 2MUMA 4J1PA 4NR4A 5I89A 1MM3A 3SHBA 2DVSA 5E0RA 4PTBA 4NRBA 4FO9A 5AIUA 2YDWA 3G0JA 4XI1A 4XY8A 5A5PA 3ZPVE 4AKNA 2VPDA 5FE5A 5H1TA 2ECGA 5IGMA 2XEUA 4L7XA 4J3IA 5CUGA 5KHMA 2MD7B 1IYMA 5CQ5A 4QR4A 2JMDA 3UV4A 5FG4A 2YHOA 4CURA 4HXOA 1K2FA 4CFLA 3LXJA 5FFWA 2RO1A 5KTXA 4O74A 4UYEA 3MHSA 2VNFA 4HBXA 4LZ2A 5FE2A 1N72A 4LR6A 4CCGX 5EPBA 5FE4A 4QBMA 5EVAA 5DFBA 4I7DA 3V43A 5FFYA 2L85A 5L96A 3GL6A 4C67A 1WEQA 5FG6A 3U5LA 5L98A 5G4RA 4TT2A 5LCWB 5D7XA 2LDRA 5FDZA 2E7NA 2VJEB 5IIDA 4B86C 3MHHA 3MXFA 5EA1A 4Z6HA 5FH6A 4LK9A 2YQMA 4NR9A 4DONA 5FE3A 4MR3A 2YEKA 4WIVA 1WIMA 4WA6A 4QSVA 5CQ8A 2M6MA 4PY6A 5A5NA 4Q6FA 5EWHA 2E6SA 4TS8A 4CLBA 5E73A 3N9NA 4ALGA 4AUQB 4O77A 2K16A 1LDJB 5AMFA 4IR3A 1RMDA 2VJFB 4IORA 2LRIC 4YYMA 2FSAA 5D3RA 3UVYA 4NUDA 3QZVA 1BORA 3UVWA 2DWWA 2M1RA 4L58A 4NRCA 5TB6A 4X3GA 1Z2QA 3I2DA
chains in the Genus database with same CATH superfamily
4ZDTA 3GV4A 3RTRB 5EPSA 2ECJA 5DYCA 4BJXA 4O71A 5COIA 5CQ6A 5C7NA 4WZ3B 5D1MB 4HXMA 5CS8A 3FEHA 3M62A 4HXRA 5CTLA 5E9KA 5DW1A 2M85A 2KGIA 3O34A 5FFVA 3N9PA 1HYIA 5DKAA 2LGKA 4QF2A 4QSPA 2YUCA 5H1UA 4C66A 5HELA 1JM7A 5F1LA 2H0DB 5BT3A 5DYAA 4YADA 5J3XA 5IGNA 2GRCA 5FB0A 2MA6A 4R8PK 5LVRA 3SUBA 5CY9A 5K3QA 5TDRA 3HCTA 3O35A 5TABA 4HXLA 2F6JA 2ECWA 4BW4A 2H60A 4KCXA 4HXNA 5DFDA 2E61A 5DFCA 2CT2A 3UVXA 4QY4A 4AYCB 4HBWA 5HFQA 4CUSA 5I29A 3ZPV1 2ECVA 4S3OB 2EGPA 4HBVA 5F61A 4QEWA 4TU6A 5EI4A 1T1HA 3FL2A 2ECIA 2KKXA 1VYXA 5B79A 4NYWA 4CUTA 4UIUA 5ENCA 3NG2A 3O33A 4GNEA 3SOXA 3HCUA 5E3DA 5C89A 4LADB 3EB5A 5SVIA 5TBNA 5I40A 2C2LA 5FE1A 4YYGA 3O37A 2VP7A 4NR5A 2YREA 2R0YA 4Z1SA 4WZ2A 2LAUA 5C8GA 4E96A 4W4UA 3RPGC 5ETDA 4A4CA 3JVJA 5DLXA 2FUIA 5FH7A 3HTKC 3DDTA 4N4FA 4QEUA 4QZSA 2CSZA 2MT5A 3N9OA 4O72A 1F62A 1CHCA 1WEPA 2EODA 3VKGA 4O76A 2CKLA 2L80A 5ENJA 1ZS5A 4OUFA 4CUUA 5D3HA 5IGLA 5CUAA 4ZUXU 3SOWA 5LKZA 4BW3A 1X4UA 3LQJA 4QUUA 1JSPB 5FH8A 2R10A 2E3KA 5H1VA 4CUPA 4CL9A 2M3HA 2D8UA 5D1KB 1WEWA 5CU8A 5I83A 2YURA 4A9OA 3K2JA 4N4IA 4N4HA 2B0OE 4UYDA 1F68A 3MULA 2MIQA 4UIYA 2C2VS 5FE7A 5HRWA 5H9MA 3M99A 5HRXA 3MB3A 5F63A 5A85A 4Z6IA 2YW8A 2KREA 4YBTA 4NS5A 3P1EA 4NUCA 4UYFA 5D3SA 4UI9B 2RNWA 4UP0A 2DVVA 5I1QA 5I7YA 2MNZA 2K1JA 4PKLA 1X4IA 4MSXA 3FKMX 4KV1A 4YYKA 5LJ2A 5F5ZA 1Z60A 2I50A 3SVHA 5B78A 5B77A 1ZKRA 5LKXA 5EM3A 5D26A 4MEOA 1WEMA 2NAAA 2LQ6A 2MNYA 2E6RA 1WEVA 2L75A 5E9MA 4TTEA 2VJEA 3ASLA 3C6WA 2MA5A 4IOOA 4ALHA 2R0SA 3T7LA 4UP5A 3DWYA 5EQ1A 3U5KA 4O7AA 5EWWA 3PURA 4IR5A 4A9EA 2YQDA 4O78A 4UITA 5FE8A 5EICA 5CQ4A 4YC9A 3QZTA 3D7CA 2IQJA 2JMIA 2WP2A 2KR4A 5HQ7A 2HYED 4V3KC 4R7EA 4UIWA 4AVXA 3I3JA 4PCEA 1DCQA 2CONA 5CZGA 2Y43A 3ERRA 3RPGB 2D82A 4QEVA 4TT6A 5K29A 4O64A 3TLPA 4BW1A 3LDYA 5AMEA 4NN2A 5F3AA 1DVPA 3D1BA 5J0DA 2UZGA 2WP1A 2LXPC 5I3LA 3AADA 4HXKA 5FG5A 4A4BA 5G04B 2QJ0A 5DX4A 3JVLA 5DLZA 2H0DA 1WUMA 3N9MA 1WEOA 4LJNA 2DSMA 3ZTGA 3DWDA 5G05B 5TDWA 5G4SA 2RNYA 2EJNA 3D1DA 4S3OC 2LV9A 5C4QA 5C85A 2YU4A 4O7BA 3UV5A 2YSMA 4O62A 5KH7A 3UV2A 4UYFB 5CFWA 2JMJA 4GNDA 4NRAA 5IG6A 3LRQA 4QSXA 4O7EA 4XYAA 4Z93A 5HENA 2XP0A 3E2DA 3O7AA 1G25A 4CUQA 4GPJA 2BAYA 3O47A 2QICA 3PLWA 4LYIA 4P5OB 5FB1A 5CPEA 3U5PA 5KH9A 5E74A 2MJVB 2YSJA 5AD2A 3UW9A 2KWNA 1JM7B 2XB1A 4LC2A 5L99A 3O70A 5KU3A 3DAIA 4LKAA 4MR4A 5HCLA 3SVGA 5DYUA 4IR6A 4YATA 5BT4A 2VPBA 4A0CD 4NR8A 5DKHA 2HDPA 3H7HA 2VJFA 4BW2A 4BHWA 4XUAA 2OXQC 5DBMA 2Y1NA 3VK6A 5DKDA 2AN6A 1V87A 1EQFA 2KIZA 5D1LB 5EISA 5B76A 3P1CA 4WHWA 4YAXA 2DATA 5FEYA 5TRBA 3KDEC 2L5EA 3JVKA 4QSSA 4LZRA 1JOCA 1WENA 2VPGA 4AKHA 4J0RA 5D24A 4AP4A 4QC3A 5EWDA 1WESA 4A9FA 5E9LA 5EWCA 1WE9A 2CKLB 2CRRA 2K4DA 4F1PA 5CRZA 5LUUA 2EXUA 5SVIB 4J0SA 3MQMA 4A9JA 4OGEA 4WZ0A 2ZETC 5C11A 4FIPA 5CGPA 2KWKA 4YK0A 4TYLA 4TZ2A 2KE1A 4UIZA 4QQ4A 2G45A 3ZVZB 4PPEA 4QNSA 3C5KA 4R2YA 5EYAF 4NYXA 5F62A 4NXJA 2DX8A 4MEQA 1WGMA 2KKYA 5HEMA 3KV5A 3S91A 2JRJA 3U5JA 4A9KA 5ENGA 2LGLA 3KV6A 5LKTA 5LJ0A 4FK5A 4NQNA 5L8UA 5I7XA 4QSWA 2XOZA 5A5RA 5D3JA 5JWMA 5F36A 3HMHA 5CRMA 5I80A 4MEPA 5B75A 5ACYA 1N87A 2YEMA 4QYDA 4A9NA 4IC3A 1WFKA 3KNVA 4RVRA 5A7CA 5HRVA 3DPLR 4F3IA 4LYWA 4YBMA 2RNXA 5A82A 5AITA 3M63A 5A5QA 5ETBA 3Q2FA 4MR6A 4YYNA 3ZYQA 4YYJA 5FBXA 2LGGA 5ENEA 3FM8C 4YH3A 3PHDA 3DQVR 4OGCA 5CQ7A 1HYJA 3Q2EA 2FD4A 5EV9A 3T9KA 5TCMA 2LSPB 2OSSA 2FUUA 4I7BA 5CQTA 2NXBA 2OWAA 1VD4A 4Y03A 5FE9A 2CSYA 5EGUA 4N3WA 1XWHA 5HJCA 4Q0NA 4A9IA 5D3NA 2KWJA 2YHNA 4B7YC 5D3PA 4HXSA 2K17A 2XOCA 5G0FA 2F6NA 5H85A 5LKUA 5AD3A 5C87A 5JG6A 4QF3A 3LJUX 2YQLA 3FANA 5HQ5A 4UYGA 3SOUA 2RSDA 4GNFA 5CUDA 1ZBDB 4GNGA 2F42A 5HLSA 4QR3A 2ECNA 5IBNA 4ZQLA 2YW5A 4HXPA 2YT5A 4YYDA 3VKHA 1X0JA 4N4GA 2LN0A 3N9LA 5FERA 5I88A 5CQAA 4QSUA 2LGVA 2L43A 5D25A 1U6GB 5ENBA 4OGJA 4PS5A 4AI6A 2QIZA 5EK9A 3HMEA 3PUQA 2DKWA 5DW2A 4CFKA 2G4AA 4O7FA 5D0CA 1WUGA 4MR5A 4NYVA 4TT4A 5EWVA 2CRWA 5I86A 3FJUB 2KGGA 4LRGA 3ZYUA 5HM0A 5E9IA 3LVQE 5HQ6A 2I7KA 4NR7A 5KTWA 3HCSA 2N9GA 3HMFA 3M7KA 5DYXA 5D3LA 5E9VA 5E9YA 2DJAA 4O7CA 5F60A 3FAOA 4AYCA 5F1HA 5C13A 4XY9A 5ENHA 1E4UA 5CUEA 3P5OA 4YH4A 3L1ZB 4FLPA 4IR4A 4QSRA 3ZVYA 5IGKA 4H9DA 4QUTA 4WHUA 5DKCA 2EA6A 4QR5A 3U5OA 4FJCA 4O70A 4Q0OA 2D8SA 2EGMA 4ZW1A 3U5NA 2KYUA 2L0BA 3Q1DA 5KH3A 5EP7A 2JUNA 3ONIA 3MB4A 3SVFA 1Z6UA 3ZNIA 2G6QA 2YYRA 2YYNA 5CUCA 2P57A 5BT5A 5FE6A 3O36A 4HBYA 4OGIA 3S92A 5CQ3A 4YYHA 4YYIA 4LYSA 3N9QA 5E3GA 4YY6A 2YELA 5LVQA 1E6IA 4QSQA 4YY4A 4TU4A 5ENIA 5JI8A 1MM2A 1WILA 3G0LA 5KTUA 4F52B 1JM4B 5HFRA 3QZSA 5SVXA 2YVRA 5D3TA 2RR4A 3IHPA 5A83A 2RI7A 2RS9B 5CUBA 3L1XA 4C9ZA 4UYHA 4LDFA 5FE0A 4A9LA 4ZC9A 4PCIA 1X4JA 2LXHC 3L11A 4TZ8A 4CA1A 2MKEA 4I7CA 4TKPB 1VFYA 1FP0A 3T6RA 4NQMA 3KQIA 5E7DA 2RFJA 2M13A 3EB6A 2KWOA 2VPEA 4V3LC 4QSTA 2KFTA 5L8TA 4KV4A 4UIVA 3LQHA 5LJ1A 2E7OA 5II1A 4QB3A 4Z1QA 5F2PA 4IOQA 3LJWA 3NXBA 5EPRA 4YABA 3U5MA 4XUBA 5L97A 5F25A 2L5UA 3LQIA 4IC2A 4QC1A 4NUEA 2IDAA 3RCWA 4A9HA 2OO1A 4Z0OA 4A9MA 4MENA 1FBVA 2I8NA 3IU5A 4O75A 5B8DA 3JVMA 3UVDA 2D9EA 2DVRA 2PUYA 2PNXA 5ENFA 4X2IA 4AKIA 3P1DA 3AQAA 4TQNA 1WEEA 4LLBA 1WEUA 2L84A 2G43A 2KU3A 2KTBB 5II2A 4BBQA 2XOYA 5DY7A 5KO4A 4GB0A 3MUKA 4QYLA 5A5OA 1LDKC 5DINA 4A49A 2OUOA 5A81A 4YBSA 5A5SA 4LZSA 4UIXA 4NR6A 5CP5A 2Y1MA 2DVQA 4MVTA 2ECTA 2MD8C 3GG3A 3IU6A 3P1FA 5EU1A 2R0VA 2MUMA 4J1PA 4NR4A 4AKGA 5I89A 1MM3A 3SHBA 2DVSA 5E0RA 3JUEA 4PTBA 4NRBA 1MBMA 4FO9A 2YDWA 5AIUA 3G0JA 4XI1A 4XY8A 5A5PA 5SVYA 3ZPVE 4AKNA 2VPDA 5FE5A 5H1TA 2ECGA 5IGMA 2XEUA 4L7XA 4J3IA 5CUGA 5KHMA 2MD7B 1IYMA 5CQ5A 4QR4A 2JMDA 3UV4A 5FG4A 2YHOA 4CURA 4HXOA 1K2FA 4CFLA 3LXJA 5FFWA 2RO1A 5KTXA 4O74A 4UYEA 3MHSA 2VNFA 4HBXA 4LZ2A 5FE2A 2CSVA 1N72A 4LR6A 3MDBC 3LVRE 4CCGX 5EPBA 5FE4A 4QBMA 5EVAA 5DFBA 4I7DA 3V43A 5FFYA 2L85A 5L96A 3GL6A 4C67A 1WEQA 5FG6A 3U5LA 5L98A 5G4RA 4TT2A 5LCWB 5D7XA 2LDRA 5FDZA 2E7NA 2VJEB 5IIDA 4B86C 3MHHA 3MXFA 5EA1A 4Z6HA 5FH6A 4LK9A 2YQMA 4NR9A 4DONA 2L7PA 5FE3A 4MR3A 2YEKA 4WIVA 1WIMA 4WA6A 4QSVA 5CQ8A 2M6MA 2JM3A 4PY6A 5A5NA 2FFWA 4Q6FA 5EWHA 4Z0RA 2E6SA 4TS8A 4CLBA 5E73A 3N9NA 4ALGA 4AUQB 4O77A 2K16A 1LDJB 1PUOA 5AMFA 4IR3A 1RMDA 2VJFB 4IORA 2LRIC 4YYMA 2FSAA 5D3RA 3UVYA 4NUDA 3QZVA 1BORA 3UVWA 2DWWA 2M1RA 4L58A 4NRCA 5TB6A 4X3GA 1Z2QA 3I2DA
chains in the Genus database with same CATH topology
4ZDTA 3GV4A 3RTRB 5EPSA 2ECJA 5DYCA 4BJXA 4O71A 5COIA 5CQ6A 5C7NA 4WZ3B 5D1MB 4HXMA 5CS8A 3M62A 4HXRA 5CTLA 5E9KA 5DW1A 2M85A 2KGIA 3O34A 5FFVA 3N9PA 1HYIA 5DKAA 2LGKA 4QF2A 4QSPA 2YUCA 5H1UA 4C66A 5HELA 1JM7A 5F1LA 2H0DB 5BT3A 5DYAA 4YADA 5J3XA 5IGNA 2GRCA 5FB0A 2MA6A 4R8PK 5LVRA 5CY9A 5TDRA 3HCTA 3O35A 5TABA 4HXLA 2F6JA 2ECWA 4BW4A 2H60A 4KCXA 4HXNA 5DFDA 5DFCA 2CT2A 3UVXA 4QY4A 4HBWA 5HFQA 4CUSA 5I29A 3ZPV1 2ECVA 4S3OB 2EGPA 4HBVA 5F61A 4QEWA 4TU6A 5EI4A 1T1HA 3FL2A 2ECIA 1VYXA 5B79A 4NYWA 4CUTA 4UIUA 5ENCA 3NG2A 3O33A 4GNEA 3SOXA 3HCUA 5E3DA 5C89A 4LADB 3EB5A 5TBNA 5I40A 2C2LA 5FE1A 4YYGA 3O37A 2VP7A 4NR5A 2YREA 2R0YA 4Z1SA 4WZ2A 5C8GA 4E96A 4W4UA 3RPGC 5ETDA 4A4CA 3JVJA 5DLXA 2FUIA 5FH7A 3HTKC 4AYCB 4N4FA 4QEUA 4QZSA 2CSZA 2MT5A 3N9OA 4O72A 1F62A 1CHCA 1WEPA 2EODA 4O76A 2CKLA 2L80A 5ENJA 1ZS5A 4OUFA 4CUUA 5D3HA 5IGLA 5CUAA 4ZUXU 3SOWA 5LKZA 4BW3A 1X4UA 3LQJA 4QUUA 1JSPB 5FH8A 2R10A 2E3KA 5H1VA 4CUPA 4CL9A 2M3HA 5D1KB 1WEWA 5CU8A 5I83A 2YURA 4A9OA 3K2JA 4N4IA 4N4HA 4UYDA 1F68A 3MULA 2MIQA 4UIYA 2C2VS 5FE7A 5HRWA 5H9MA 3M99A 5HRXA 3MB3A 5F63A 5A85A 4Z6IA 2YW8A 2KREA 4YBTA 4NS5A 3P1EA 4NUCA 4UYFA 5D3SA 4UI9B 2RNWA 4UP0A 2DVVA 5I1QA 5I7YA 2MNZA 2K1JA 4PKLA 1X4IA 4MSXA 3FKMX 4KV1A 4YYKA 5LJ2A 5F5ZA 1Z60A 2I50A 3SVHA 5B78A 5B77A 5LKXA 5EM3A 5D26A 4MEOA 1WEMA 2NAAA 2LQ6A 2MNYA 2E6RA 1WEVA 2L75A 5E9MA 4TTEA 2VJEA 3ASLA 3C6WA 2MA5A 4IOOA 4ALHA 2R0SA 3T7LA 4UP5A 3DWYA 5EQ1A 3U5KA 4O7AA 5EWWA 3PURA 4IR5A 4A9EA 2YQDA 4O78A 4UITA 5FE8A 5EICA 5CQ4A 4YC9A 3QZTA 3D7CA 2JMIA 2WP2A 2KR4A 5HQ7A 2HYED 4V3KC 4R7EA 4UIWA 4AVXA 3I3JA 4PCEA 5CZGA 2Y43A 3RPGB 2D82A 4QEVA 4TT6A 5K29A 4O64A 3TLPA 4BW1A 5AMEA 4NN2A 5F3AA 1DVPA 5J0DA 2UZGA 2WP1A 2LXPC 5I3LA 3AADA 4HXKA 5FG5A 4A4BA 5G04B 2QJ0A 5DX4A 3JVLA 5DLZA 2H0DA 1WUMA 3N9MA 1WEOA 4LJNA 3ZTGA 5G05B 5TDWA 5G4SA 2RNYA 4S3OC 2LV9A 5C4QA 5C85A 2YU4A 4O7BA 3UV5A 2YSMA 5KH7A 3UV2A 4UYFB 5CFWA 2JMJA 4GNDA 4NRAA 5IG6A 3LRQA 4QSXA 4O7EA 4XYAA 4Z93A 5HENA 3O7AA 1G25A 4CUQA 4GPJA 2BAYA 2QICA 4LYIA 4P5OB 5FB1A 5CPEA 3U5PA 5KH9A 5E74A 2MJVB 2YSJA 5AD2A 3UW9A 2KWNA 1JM7B 2XB1A 4LC2A 5L99A 3O70A 5KU3A 3DAIA 4LKAA 4MR4A 5HCLA 3SVGA 5DYUA 4IR6A 4YATA 5BT4A 2VPBA 4A0CD 4NR8A 5DKHA 2HDPA 3VK6A 2VJFA 4BW2A 4BHWA 4XUAA 2OXQC 5DBMA 2Y1NA 5DKDA 2AN6A 1V87A 1EQFA 2KIZA 5D1LB 5EISA 5B76A 3P1CA 4WHWA 4YAXA 2DATA 5FEYA 5TRBA 2L5EA 3JVKA 4QSSA 4LZRA 1JOCA 1WENA 2VPGA 4J0RA 5D24A 4AP4A 4QC3A 5EWDA 1WESA 4A9FA 5E9LA 5EWCA 1WE9A 2CKLB 2K4DA 5CRZA 5LUUA 4J0SA 3MQMA 4A9JA 4WZ0A 5C11A 2ZETC 4FIPA 5CGPA 2KWKA 4YK0A 4TYLA 4TZ2A 2KE1A 4UIZA 2G45A 3ZVZB 4PPEA 4QNSA 3C5KA 4R2YA 5EYAF 4NYXA 5F62A 4NXJA 2DX8A 4MEQA 1WGMA 5HEMA 3KV5A 3S91A 2JRJA 3U5JA 4A9KA 5ENGA 2LGLA 3KV6A 5LKTA 5LJ0A 4FK5A 4NQNA 5L8UA 5I7XA 4QSWA 5A5RA 5D3JA 5JWMA 5F36A 3HMHA 5CRMA 5I80A 4MEPA 5B75A 5ACYA 1N87A 2YEMA 4QYDA 4A9NA 4IC3A 1WFKA 3KNVA 4RVRA 5A7CA 5HRVA 3DPLR 4F3IA 4LYWA 4YBMA 2RNXA 5A82A 5AITA 3M63A 5A5QA 5ETBA 3Q2FA 4MR6A 4YYNA 3ZYQA 4YYJA 5FBXA 2LGGA 5ENEA 3PHDA 4YH3A 3DQVR 5CQ7A 1HYJA 3Q2EA 5EV9A 5TCMA 2LSPB 2OSSA 2FUUA 4I7BA 5CQTA 2NXBA 1VD4A 4Y03A 5FE9A 2CSYA 5EGUA 4N3WA 1XWHA 5HJCA 4Q0NA 4A9IA 5D3NA 2KWJA 2YHNA 4B7YC 5D3PA 4HXSA 2K17A 5G0FA 2F6NA 5H85A 5LKUA 5AD3A 5C87A 5JG6A 4QF3A 2YQLA 5HQ5A 4UYGA 3SOUA 2RSDA 4GNFA 5CUDA 1ZBDB 4GNGA 2F42A 5HLSA 4QR3A 2ECNA 5IBNA 4ZQLA 2YW5A 4HXPA 2YT5A 4YYDA 1X0JA 4N4GA 2LN0A 3N9LA 5FERA 5I88A 5CQAA 4QSUA 2LGVA 2L43A 5D25A 1U6GB 5ENBA 4OGJA 4PS5A 2QIZA 3PUQA 5EK9A 3HMEA 2DKWA 5DW2A 4CFKA 2G4AA 4O7FA 5D0CA 1WUGA 4MR5A 4NYVA 4TT4A 5EWVA 5I86A 2KGGA 4LRGA 3ZYUA 5HM0A 5E9IA 5HQ6A 2I7KA 4NR7A 5KTWA 3HCSA 2N9GA 3HMFA 5DYXA 5D3LA 5E9VA 5E9YA 4O7CA 5F60A 4AYCA 5F1HA 5C13A 4XY9A 5ENHA 1E4UA 5CUEA 3P5OA 4YH4A 3L1ZB 4FLPA 4IR4A 4QSRA 3ZVYA 5IGKA 4QUTA 4WHUA 5DKCA 2EA6A 4QR5A 3U5OA 4FJCA 4O70A 4Q0OA 2D8SA 2KYUA 4ZW1A 3U5NA 2L0BA 5KH3A 5EP7A 3ONIA 3MB4A 3SVFA 1Z6UA 3ZNIA 2G6QA 2YYRA 2YYNA 5CUCA 5BT5A 5FE6A 3O36A 4HBYA 4OGIA 3S92A 5CQ3A 4YYHA 4YYIA 4LYSA 3N9QA 5E3GA 4YY6A 2YELA 5LVQA 1E6IA 4QSQA 4YY4A 4TU4A 5ENIA 5JI8A 1MM2A 1WILA 3G0LA 5KTUA 4F52B 1JM4B 5HFRA 3QZSA 5D3TA 3L1XA 3IHPA 5A83A 2RI7A 2RS9B 5CUBA 4C9ZA 4UYHA 4LDFA 5FE0A 4A9LA 4ZC9A 4PCIA 1X4JA 2LXHC 3L11A 4TZ8A 4CA1A 4I7CA 4TKPB 1VFYA 1FP0A 3T6RA 4NQMA 3KQIA 5E7DA 2RFJA 3EB6A 2KWOA 2VPEA 4V3LC 4QSTA 2KFTA 5L8TA 4KV4A 4UIVA 3LQHA 5LJ1A 2E7OA 5II1A 4QB3A 4Z1QA 5F2PA 4IOQA 3LJWA 3NXBA 5EPRA 4YABA 3U5MA 4XUBA 5L97A 5F25A 2L5UA 3LQIA 4IC2A 4QC1A 4NUEA 2IDAA 3RCWA 4A9HA 2OO1A 4A9MA 4MENA 1FBVA 2I8NA 3IU5A 4O75A 5B8DA 3JVMA 3UVDA 2D9EA 2DVRA 2PUYA 2PNXA 5ENFA 4X2IA 3P1DA 3AQAA 4TQNA 1WEEA 4LLBA 1WEUA 2L84A 2G43A 2KU3A 2KTBB 5II2A 4BBQA 5DY7A 5KO4A 4GB0A 3MUKA 4QYLA 5A5OA 1LDKC 5DINA 4A49A 2OUOA 5A81A 4YBSA 5A5SA 4LZSA 4UIXA 4NR6A 5CP5A 2Y1MA 2DVQA 4MVTA 2ECTA 2MD8C 3GG3A 3IU6A 3P1FA 5EU1A 2R0VA 2MUMA 4J1PA 4NR4A 5I89A 1MM3A 3SHBA 2DVSA 5E0RA 4PTBA 4NRBA 4FO9A 5AIUA 2YDWA 3G0JA 4XI1A 4XY8A 5A5PA 3ZPVE 4AKNA 2VPDA 5FE5A 5H1TA 2ECGA 5IGMA 2XEUA 4L7XA 4J3IA 5CUGA 5KHMA 2MD7B 1IYMA 5CQ5A 4QR4A 2JMDA 3UV4A 5FG4A 2YHOA 4CURA 4HXOA 1K2FA 4CFLA 3LXJA 5FFWA 2RO1A 5KTXA 4O74A 4UYEA 3MHSA 2VNFA 4HBXA 4LZ2A 5FE2A 1N72A 4LR6A 4CCGX 5EPBA 5FE4A 4QBMA 5EVAA 5DFBA 4I7DA 3V43A 5FFYA 2L85A 5L96A 3GL6A 4C67A 1WEQA 5FG6A 3U5LA 5L98A 5G4RA 4TT2A 5LCWB 5D7XA 2LDRA 5FDZA 2E7NA 2VJEB 5IIDA 4B86C 3MHHA 3MXFA 5EA1A 4Z6HA 5FH6A 4LK9A 2YQMA 4NR9A 4DONA 5FE3A 4MR3A 2YEKA 4WIVA 1WIMA 4WA6A 4QSVA 5CQ8A 2M6MA 4PY6A 5A5NA 4Q6FA 5EWHA 2E6SA 4TS8A 4CLBA 5E73A 3N9NA 4ALGA 4AUQB 4O77A 2K16A 1LDJB 5AMFA 4IR3A 1RMDA 2VJFB 4IORA 2LRIC 4YYMA 2FSAA 5D3RA 3UVYA 4NUDA 3QZVA 1BORA 3UVWA 2DWWA 2M1RA 4L58A 4NRCA 5TB6A 4X3GA 1Z2QA 3I2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZDT A;  3GV4 A;  3RTR B;  5EPS A;  2ECJ A;  5DYC A;  4BJX A;  4O71 A;  5COI A;  5CQ6 A;  5C7N A;  4WZ3 B;  5D1M B;  4HXM A;  5CS8 A;  3M62 A;  4HXR A;  5CTL A;  5E9K A;  5DW1 A;  2M85 A;  2KGI A;  3O34 A;  5FFV A;  3N9P A;  1HYI A;  5DKA A;  2LGK A;  4QF2 A;  4QSP A;  2YUC A;  5H1U A;  4C66 A;  5HEL A;  1JM7 A;  5F1L A;  2H0D B;  5BT3 A;  5DYA A;  4YAD A;  5J3X A;  5IGN A;  2GRC A;  5FB0 A;  2MA6 A;  4R8P K;  5LVR A;  5CY9 A;  5TDR A;  3HCT A;  3O35 A;  5TAB A;  4HXL A;  2F6J A;  2ECW A;  4BW4 A;  2H60 A;  4KCX A;  4HXN A;  5DFD A;  5DFC A;  2CT2 A;  3UVX A;  4QY4 A;  4HBW A;  5HFQ A;  4CUS A;  5I29 A;  3ZPV 1;  2ECV A;  4S3O B;  2EGP A;  4HBV A;  5F61 A;  4QEW A;  4TU6 A;  5EI4 A;  1T1H A;  3FL2 A;  2ECI A;  1VYX A;  5B79 A;  4NYW A;  4CUT A;  4UIU A;  5ENC A;  3NG2 A;  3O33 A;  4GNE A;  3SOX A;  3HCU A;  5E3D A;  5C89 A;  4LAD B;  3EB5 A;  5TBN A;  5I40 A;  2C2L A;  5FE1 A;  4YYG A;  3O37 A;  2VP7 A;  4NR5 A;  2YRE A;  2R0Y A;  4Z1S A;  4WZ2 A;  5C8G A;  4E96 A;  4W4U A;  3RPG C;  5ETD A;  4A4C A;  3JVJ A;  5DLX A;  2FUI A;  5FH7 A;  3HTK C;  4AYC B;  4N4F A;  4QEU A;  4QZS A;  2CSZ A;  2MT5 A;  3N9O A;  4O72 A;  1F62 A;  1CHC A;  1WEP A;  2EOD A;  4O76 A;  2CKL A;  2L80 A;  5ENJ A;  1ZS5 A;  4OUF A;  4CUU A;  5D3H A;  5IGL A;  5CUA A;  4ZUX U;  3SOW A;  5LKZ A;  4BW3 A;  1X4U A;  3LQJ A;  4QUU A;  1JSP B;  5FH8 A;  2R10 A;  2E3K A;  5H1V A;  4CUP A;  4CL9 A;  2M3H A;  5D1K B;  1WEW A;  5CU8 A;  5I83 A;  2YUR A;  4A9O A;  3K2J A;  4N4I A;  4N4H A;  4UYD A;  1F68 A;  3MUL A;  2MIQ A;  4UIY A;  2C2V S;  5FE7 A;  5HRW A;  5H9M A;  3M99 A;  5HRX A;  3MB3 A;  5F63 A;  5A85 A;  4Z6I A;  2YW8 A;  2KRE A;  4YBT A;  4NS5 A;  3P1E A;  4NUC A;  4UYF A;  5D3S A;  4UI9 B;  2RNW A;  4UP0 A;  2DVV A;  5I1Q A;  5I7Y A;  2MNZ A;  2K1J A;  4PKL A;  1X4I A;  4MSX A;  3FKM X;  4KV1 A;  4YYK A;  5LJ2 A;  5F5Z A;  1Z60 A;  2I50 A;  3SVH A;  5B78 A;  5B77 A;  5LKX A;  5EM3 A;  5D26 A;  4MEO A;  1WEM A;  2NAA A;  2LQ6 A;  2MNY A;  2E6R A;  1WEV A;  2L75 A;  5E9M A;  4TTE A;  2VJE A;  3ASL A;  3C6W A;  2MA5 A;  4IOO A;  4ALH A;  2R0S A;  3T7L A;  4UP5 A;  3DWY A;  5EQ1 A;  3U5K A;  4O7A A;  5EWW A;  3PUR A;  4IR5 A;  4A9E A;  2YQD A;  4O78 A;  4UIT A;  5FE8 A;  5EIC A;  5CQ4 A;  4YC9 A;  3QZT A;  3D7C A;  2JMI A;  2WP2 A;  2KR4 A;  5HQ7 A;  2HYE D;  4V3K C;  4R7E A;  4UIW A;  4AVX A;  3I3J A;  4PCE A;  5CZG A;  2Y43 A;  3RPG B;  2D82 A;  4QEV A;  4TT6 A;  5K29 A;  4O64 A;  3TLP A;  4BW1 A;  5AME A;  4NN2 A;  5F3A A;  1DVP A;  5J0D A;  2UZG A;  2WP1 A;  2LXP C;  5I3L A;  3AAD A;  4HXK A;  5FG5 A;  4A4B A;  5G04 B;  2QJ0 A;  5DX4 A;  3JVL A;  5DLZ A;  2H0D A;  1WUM A;  3N9M A;  1WEO A;  4LJN A;  3ZTG A;  5G05 B;  5TDW A;  5G4S A;  2RNY A;  4S3O C;  2LV9 A;  5C4Q A;  5C85 A;  2YU4 A;  4O7B A;  3UV5 A;  2YSM A;  5KH7 A;  3UV2 A;  4UYF B;  5CFW A;  2JMJ A;  4GND A;  4NRA A;  5IG6 A;  3LRQ A;  4QSX A;  4O7E A;  4XYA A;  4Z93 A;  5HEN A;  3O7A A;  1G25 A;  4CUQ A;  4GPJ A;  2BAY A;  2QIC A;  4LYI A;  4P5O B;  5FB1 A;  5CPE A;  3U5P A;  5KH9 A;  5E74 A;  2MJV B;  2YSJ A;  5AD2 A;  3UW9 A;  2KWN A;  1JM7 B;  2XB1 A;  4LC2 A;  5L99 A;  3O70 A;  5KU3 A;  3DAI A;  4LKA A;  4MR4 A;  5HCL A;  3SVG A;  5DYU A;  4IR6 A;  4YAT A;  5BT4 A;  2VPB A;  4A0C D;  4NR8 A;  5DKH A;  2HDP A;  3VK6 A;  2VJF A;  4BW2 A;  4BHW A;  4XUA A;  2OXQ C;  5DBM A;  2Y1N A;  5DKD A;  2AN6 A;  1V87 A;  1EQF A;  2KIZ A;  5D1L B;  5EIS A;  5B76 A;  3P1C A;  4WHW A;  4YAX A;  2DAT A;  5FEY A;  5TRB A;  2L5E A;  3JVK A;  4QSS A;  4LZR A;  1JOC A;  1WEN A;  2VPG A;  4J0R A;  5D24 A;  4AP4 A;  4QC3 A;  5EWD A;  1WES A;  4A9F A;  5E9L A;  5EWC A;  1WE9 A;  2CKL B;  2K4D A;  5CRZ A;  5LUU A;  4J0S A;  3MQM A;  4A9J A;  4WZ0 A;  5C11 A;  2ZET C;  4FIP A;  5CGP A;  2KWK A;  4YK0 A;  4TYL A;  4TZ2 A;  2KE1 A;  4UIZ A;  2G45 A;  3ZVZ B;  4PPE A;  4QNS A;  3C5K A;  4R2Y A;  5EYA F;  4NYX A;  5F62 A;  4NXJ A;  2DX8 A;  4MEQ A;  1WGM A;  5HEM A;  3KV5 A;  3S91 A;  2JRJ A;  3U5J A;  4A9K A;  5ENG A;  2LGL A;  3KV6 A;  5LKT A;  5LJ0 A;  4FK5 A;  4NQN A;  5L8U A;  5I7X A;  4QSW A;  5A5R A;  5D3J A;  5JWM A;  5F36 A;  3HMH A;  5CRM A;  5I80 A;  4MEP A;  5B75 A;  5ACY A;  1N87 A;  2YEM A;  4QYD A;  4A9N A;  4IC3 A;  1WFK A;  3KNV A;  4RVR A;  5A7C A;  5HRV A;  3DPL R;  4F3I A;  4LYW A;  4YBM A;  2RNX A;  5A82 A;  5AIT A;  3M63 A;  5A5Q A;  5ETB A;  3Q2F A;  4MR6 A;  4YYN A;  3ZYQ A;  4YYJ A;  5FBX A;  2LGG A;  5ENE A;  3PHD A;  4YH3 A;  3DQV R;  5CQ7 A;  1HYJ A;  3Q2E A;  5EV9 A;  5TCM A;  2LSP B;  2OSS A;  2FUU A;  4I7B A;  5CQT A;  2NXB A;  1VD4 A;  4Y03 A;  5FE9 A;  2CSY A;  5EGU A;  4N3W A;  1XWH A;  5HJC A;  4Q0N A;  4A9I A;  5D3N A;  2KWJ A;  2YHN A;  4B7Y C;  5D3P A;  4HXS A;  2K17 A;  5G0F A;  2F6N A;  5H85 A;  5LKU A;  5AD3 A;  5C87 A;  5JG6 A;  4QF3 A;  2YQL A;  5HQ5 A;  4UYG A;  3SOU A;  2RSD A;  4GNF A;  5CUD A;  1ZBD B;  4GNG A;  2F42 A;  5HLS A;  4QR3 A;  2ECN A;  5IBN A;  4ZQL A;  2YW5 A;  4HXP A;  2YT5 A;  4YYD A;  1X0J A;  4N4G A;  2LN0 A;  3N9L A;  5FER A;  5I88 A;  5CQA A;  4QSU A;  2LGV A;  2L43 A;  5D25 A;  1U6G B;  5ENB A;  4OGJ A;  4PS5 A;  2QIZ A;  3PUQ A;  5EK9 A;  3HME A;  2DKW A;  5DW2 A;  4CFK A;  2G4A A;  4O7F A;  5D0C A;  1WUG A;  4MR5 A;  4NYV A;  4TT4 A;  5EWV A;  5I86 A;  2KGG A;  4LRG A;  3ZYU A;  5HM0 A;  5E9I A;  5HQ6 A;  2I7K A;  4NR7 A;  5KTW A;  3HCS A;  2N9G A;  3HMF A;  5DYX A;  5D3L A;  5E9V A;  5E9Y A;  4O7C A;  5F60 A;  4AYC A;  5F1H A;  5C13 A;  4XY9 A;  5ENH A;  1E4U A;  5CUE A;  3P5O A;  4YH4 A;  3L1Z B;  4FLP A;  4IR4 A;  4QSR A;  3ZVY A;  5IGK A;  4QUT A;  4WHU A;  5DKC A;  2EA6 A;  4QR5 A;  3U5O A;  4FJC A;  4O70 A;  4Q0O A;  2D8S A;  2KYU A;  4ZW1 A;  3U5N A;  2L0B A;  5KH3 A;  5EP7 A;  3ONI A;  3MB4 A;  3SVF A;  1Z6U A;  3ZNI A;  2G6Q A;  2YYR A;  2YYN A;  5CUC A;  5BT5 A;  5FE6 A;  3O36 A;  4HBY A;  4OGI A;  3S92 A;  5CQ3 A;  4YYH A;  4YYI A;  4LYS A;  3N9Q A;  5E3G A;  4YY6 A;  2YEL A;  5LVQ A;  1E6I A;  4QSQ A;  4YY4 A;  4TU4 A;  5ENI A;  5JI8 A;  1MM2 A;  1WIL A;  3G0L A;  5KTU A;  4F52 B;  1JM4 B;  5HFR A;  3QZS A;  5D3T A;  3L1X A;  3IHP A;  5A83 A;  2RI7 A;  2RS9 B;  5CUB A;  4C9Z A;  4UYH A;  4LDF A;  5FE0 A;  4A9L A;  4ZC9 A;  4PCI A;  1X4J A;  2LXH C;  3L11 A;  4TZ8 A;  4CA1 A;  4I7C A;  4TKP B;  1VFY A;  1FP0 A;  3T6R A;  4NQM A;  3KQI A;  5E7D A;  2RFJ A;  3EB6 A;  2KWO A;  2VPE A;  4V3L C;  4QST A;  2KFT A;  5L8T A;  4KV4 A;  4UIV A;  3LQH A;  5LJ1 A;  2E7O A;  5II1 A;  4QB3 A;  4Z1Q A;  5F2P A;  4IOQ A;  3LJW A;  3NXB A;  5EPR A;  4YAB A;  3U5M A;  4XUB A;  5L97 A;  5F25 A;  2L5U A;  3LQI A;  4IC2 A;  4QC1 A;  4NUE A;  2IDA A;  3RCW A;  4A9H A;  2OO1 A;  4A9M A;  4MEN A;  1FBV A;  2I8N A;  3IU5 A;  4O75 A;  5B8D A;  3JVM A;  3UVD A;  2D9E A;  2DVR A;  2PUY A;  2PNX A;  5ENF A;  4X2I A;  3P1D A;  3AQA A;  4TQN A;  1WEE A;  4LLB A;  1WEU A;  2L84 A;  2G43 A;  2KU3 A;  2KTB B;  5II2 A;  4BBQ A;  5DY7 A;  5KO4 A;  4GB0 A;  3MUK A;  4QYL A;  5A5O A;  1LDK C;  5DIN A;  4A49 A;  2OUO A;  5A81 A;  4YBS A;  5A5S A;  4LZS A;  4UIX A;  4NR6 A;  5CP5 A;  2Y1M A;  2DVQ A;  4MVT A;  2ECT A;  2MD8 C;  3GG3 A;  3IU6 A;  3P1F A;  5EU1 A;  2R0V A;  2MUM A;  4J1P A;  4NR4 A;  5I89 A;  1MM3 A;  3SHB A;  2DVS A;  5E0R A;  4PTB A;  4NRB A;  4FO9 A;  5AIU A;  2YDW A;  3G0J A;  4XI1 A;  4XY8 A;  5A5P A;  3ZPV E;  4AKN A;  2VPD A;  5FE5 A;  5H1T A;  2ECG A;  5IGM A;  2XEU A;  4L7X A;  4J3I A;  5CUG A;  5KHM A;  2MD7 B;  1IYM A;  5CQ5 A;  4QR4 A;  2JMD A;  3UV4 A;  5FG4 A;  2YHO A;  4CUR A;  4HXO A;  1K2F A;  4CFL A;  3LXJ A;  5FFW A;  2RO1 A;  5KTX A;  4O74 A;  4UYE A;  3MHS A;  2VNF A;  4HBX A;  4LZ2 A;  5FE2 A;  1N72 A;  4LR6 A;  4CCG X;  5EPB A;  5FE4 A;  4QBM A;  5EVA A;  5DFB A;  4I7D A;  3V43 A;  5FFY A;  2L85 A;  5L96 A;  3GL6 A;  4C67 A;  1WEQ A;  5FG6 A;  3U5L A;  5L98 A;  5G4R A;  4TT2 A;  5LCW B;  5D7X A;  2LDR A;  5FDZ A;  2E7N A;  2VJE B;  5IID A;  4B86 C;  3MHH A;  3MXF A;  5EA1 A;  4Z6H A;  5FH6 A;  4LK9 A;  2YQM A;  4NR9 A;  4DON A;  5FE3 A;  4MR3 A;  2YEK A;  4WIV A;  1WIM A;  4WA6 A;  4QSV A;  5CQ8 A;  2M6M A;  4PY6 A;  5A5N A;  4Q6F A;  5EWH A;  2E6S A;  4TS8 A;  4CLB A;  5E73 A;  3N9N A;  4ALG A;  4AUQ B;  4O77 A;  2K16 A;  1LDJ B;  5AMF A;  4IR3 A;  1RMD A;  2VJF B;  4IOR A;  2LRI C;  4YYM A;  2FSA A;  5D3R A;  3UVY A;  4NUD A;  3QZV A;  1BOR A;  3UVW A;  2DWW A;  2M1R A;  4L58 A;  4NRC A;  5TB6 A;  4X3G A;  1Z2Q A;  3I2D A; 
#chains in the Genus database with same CATH topology
 4ZDT A;  3GV4 A;  3RTR B;  5EPS A;  2ECJ A;  5DYC A;  4BJX A;  4O71 A;  5COI A;  5CQ6 A;  5C7N A;  4WZ3 B;  5D1M B;  4HXM A;  5CS8 A;  3FEH A;  3M62 A;  4HXR A;  5CTL A;  5E9K A;  5DW1 A;  2M85 A;  2KGI A;  3O34 A;  5FFV A;  3N9P A;  1HYI A;  5DKA A;  2LGK A;  4QF2 A;  4QSP A;  2YUC A;  5H1U A;  4C66 A;  5HEL A;  1JM7 A;  5F1L A;  2H0D B;  5BT3 A;  5DYA A;  4YAD A;  5J3X A;  5IGN A;  2GRC A;  5FB0 A;  2MA6 A;  4R8P K;  5LVR A;  3SUB A;  5CY9 A;  5K3Q A;  5TDR A;  3HCT A;  3O35 A;  5TAB A;  4HXL A;  2F6J A;  2ECW A;  4BW4 A;  2H60 A;  4KCX A;  4HXN A;  5DFD A;  2E61 A;  5DFC A;  2CT2 A;  3UVX A;  4QY4 A;  4AYC B;  4HBW A;  5HFQ A;  4CUS A;  5I29 A;  3ZPV 1;  2ECV A;  4S3O B;  2EGP A;  4HBV A;  5F61 A;  4QEW A;  4TU6 A;  5EI4 A;  1T1H A;  3FL2 A;  2ECI A;  2KKX A;  1VYX A;  5B79 A;  4NYW A;  4CUT A;  4UIU A;  5ENC A;  3NG2 A;  3O33 A;  4GNE A;  3SOX A;  3HCU A;  5E3D A;  5C89 A;  4LAD B;  3EB5 A;  5SVI A;  5TBN A;  5I40 A;  2C2L A;  5FE1 A;  4YYG A;  3O37 A;  2VP7 A;  4NR5 A;  2YRE A;  2R0Y A;  4Z1S A;  4WZ2 A;  2LAU A;  5C8G A;  4E96 A;  4W4U A;  3RPG C;  5ETD A;  4A4C A;  3JVJ A;  5DLX A;  2FUI A;  5FH7 A;  3HTK C;  3DDT A;  4N4F A;  4QEU A;  4QZS A;  2CSZ A;  2MT5 A;  3N9O A;  4O72 A;  1F62 A;  1CHC A;  1WEP A;  2EOD A;  3VKG A;  4O76 A;  2CKL A;  2L80 A;  5ENJ A;  1ZS5 A;  4OUF A;  4CUU A;  5D3H A;  5IGL A;  5CUA A;  4ZUX U;  3SOW A;  5LKZ A;  4BW3 A;  1X4U A;  3LQJ A;  4QUU A;  1JSP B;  5FH8 A;  2R10 A;  2E3K A;  5H1V A;  4CUP A;  4CL9 A;  2M3H A;  2D8U A;  5D1K B;  1WEW A;  5CU8 A;  5I83 A;  2YUR A;  4A9O A;  3K2J A;  4N4I A;  4N4H A;  2B0O E;  4UYD A;  1F68 A;  3MUL A;  2MIQ A;  4UIY A;  2C2V S;  5FE7 A;  5HRW A;  5H9M A;  3M99 A;  5HRX A;  3MB3 A;  5F63 A;  5A85 A;  4Z6I A;  2YW8 A;  2KRE A;  4YBT A;  4NS5 A;  3P1E A;  4NUC A;  4UYF A;  5D3S A;  4UI9 B;  2RNW A;  4UP0 A;  2DVV A;  5I1Q A;  5I7Y A;  2MNZ A;  2K1J A;  4PKL A;  1X4I A;  4MSX A;  3FKM X;  4KV1 A;  4YYK A;  5LJ2 A;  5F5Z A;  1Z60 A;  2I50 A;  3SVH A;  5B78 A;  5B77 A;  1ZKR A;  5LKX A;  5EM3 A;  5D26 A;  4MEO A;  1WEM A;  2NAA A;  2LQ6 A;  2MNY A;  2E6R A;  1WEV A;  2L75 A;  5E9M A;  4TTE A;  2VJE A;  3ASL A;  3C6W A;  2MA5 A;  4IOO A;  4ALH A;  2R0S A;  3T7L A;  4UP5 A;  3DWY A;  5EQ1 A;  3U5K A;  4O7A A;  5EWW A;  3PUR A;  4IR5 A;  4A9E A;  2YQD A;  4O78 A;  4UIT A;  5FE8 A;  5EIC A;  5CQ4 A;  4YC9 A;  3QZT A;  3D7C A;  2IQJ A;  2JMI A;  2WP2 A;  2KR4 A;  5HQ7 A;  2HYE D;  4V3K C;  4R7E A;  4UIW A;  4AVX A;  3I3J A;  4PCE A;  1DCQ A;  2CON A;  5CZG A;  2Y43 A;  3ERR A;  3RPG B;  2D82 A;  4QEV A;  4TT6 A;  5K29 A;  4O64 A;  3TLP A;  4BW1 A;  3LDY A;  5AME A;  4NN2 A;  5F3A A;  1DVP A;  3D1B A;  5J0D A;  2UZG A;  2WP1 A;  2LXP C;  5I3L A;  3AAD A;  4HXK A;  5FG5 A;  4A4B A;  5G04 B;  2QJ0 A;  5DX4 A;  3JVL A;  5DLZ A;  2H0D A;  1WUM A;  3N9M A;  1WEO A;  4LJN A;  2DSM A;  3ZTG A;  3DWD A;  5G05 B;  5TDW A;  5G4S A;  2RNY A;  2EJN A;  3D1D A;  4S3O C;  2LV9 A;  5C4Q A;  5C85 A;  2YU4 A;  4O7B A;  3UV5 A;  2YSM A;  4O62 A;  5KH7 A;  3UV2 A;  4UYF B;  5CFW A;  2JMJ A;  4GND A;  4NRA A;  5IG6 A;  3LRQ A;  4QSX A;  4O7E A;  4XYA A;  4Z93 A;  5HEN A;  2XP0 A;  3E2D A;  3O7A A;  1G25 A;  4CUQ A;  4GPJ A;  2BAY A;  3O47 A;  2QIC A;  3PLW A;  4LYI A;  4P5O B;  5FB1 A;  5CPE A;  3U5P A;  5KH9 A;  5E74 A;  2MJV B;  2YSJ A;  5AD2 A;  3UW9 A;  2KWN A;  1JM7 B;  2XB1 A;  4LC2 A;  5L99 A;  3O70 A;  5KU3 A;  3DAI A;  4LKA A;  4MR4 A;  5HCL A;  3SVG A;  5DYU A;  4IR6 A;  4YAT A;  5BT4 A;  2VPB A;  4A0C D;  4NR8 A;  5DKH A;  2HDP A;  3H7H A;  2VJF A;  4BW2 A;  4BHW A;  4XUA A;  2OXQ C;  5DBM A;  2Y1N A;  3VK6 A;  5DKD A;  2AN6 A;  1V87 A;  1EQF A;  2KIZ A;  5D1L B;  5EIS A;  5B76 A;  3P1C A;  4WHW A;  4YAX A;  2DAT A;  5FEY A;  5TRB A;  3KDE C;  2L5E A;  3JVK A;  4QSS A;  4LZR A;  1JOC A;  1WEN A;  2VPG A;  4AKH A;  4J0R A;  5D24 A;  4AP4 A;  4QC3 A;  5EWD A;  1WES A;  4A9F A;  5E9L A;  5EWC A;  1WE9 A;  2CKL B;  2CRR A;  2K4D A;  4F1P A;  5CRZ A;  5LUU A;  2EXU A;  5SVI B;  4J0S A;  3MQM A;  4A9J A;  4OGE A;  4WZ0 A;  2ZET C;  5C11 A;  4FIP A;  5CGP A;  2KWK A;  4YK0 A;  4TYL A;  4TZ2 A;  2KE1 A;  4UIZ A;  4QQ4 A;  2G45 A;  3ZVZ B;  4PPE A;  4QNS A;  3C5K A;  4R2Y A;  5EYA F;  4NYX A;  5F62 A;  4NXJ A;  2DX8 A;  4MEQ A;  1WGM A;  2KKY A;  5HEM A;  3KV5 A;  3S91 A;  2JRJ A;  3U5J A;  4A9K A;  5ENG A;  2LGL A;  3KV6 A;  5LKT A;  5LJ0 A;  4FK5 A;  4NQN A;  5L8U A;  5I7X A;  4QSW A;  2XOZ A;  5A5R A;  5D3J A;  5JWM A;  5F36 A;  3HMH A;  5CRM A;  5I80 A;  4MEP A;  5B75 A;  5ACY A;  1N87 A;  2YEM A;  4QYD A;  4A9N A;  4IC3 A;  1WFK A;  3KNV A;  4RVR A;  5A7C A;  5HRV A;  3DPL R;  4F3I A;  4LYW A;  4YBM A;  2RNX A;  5A82 A;  5AIT A;  3M63 A;  5A5Q A;  5ETB A;  3Q2F A;  4MR6 A;  4YYN A;  3ZYQ A;  4YYJ A;  5FBX A;  2LGG A;  5ENE A;  3FM8 C;  4YH3 A;  3PHD A;  3DQV R;  4OGC A;  5CQ7 A;  1HYJ A;  3Q2E A;  2FD4 A;  5EV9 A;  3T9K A;  5TCM A;  2LSP B;  2OSS A;  2FUU A;  4I7B A;  5CQT A;  2NXB A;  2OWA A;  1VD4 A;  4Y03 A;  5FE9 A;  2CSY A;  5EGU A;  4N3W A;  1XWH A;  5HJC A;  4Q0N A;  4A9I A;  5D3N A;  2KWJ A;  2YHN A;  4B7Y C;  5D3P A;  4HXS A;  2K17 A;  2XOC A;  5G0F A;  2F6N A;  5H85 A;  5LKU A;  5AD3 A;  5C87 A;  5JG6 A;  4QF3 A;  3LJU X;  2YQL A;  3FAN A;  5HQ5 A;  4UYG A;  3SOU A;  2RSD A;  4GNF A;  5CUD A;  1ZBD B;  4GNG A;  2F42 A;  5HLS A;  4QR3 A;  2ECN A;  5IBN A;  4ZQL A;  2YW5 A;  4HXP A;  2YT5 A;  4YYD A;  3VKH A;  1X0J A;  4N4G A;  2LN0 A;  3N9L A;  5FER A;  5I88 A;  5CQA A;  4QSU A;  2LGV A;  2L43 A;  5D25 A;  1U6G B;  5ENB A;  4OGJ A;  4PS5 A;  4AI6 A;  2QIZ A;  5EK9 A;  3HME A;  3PUQ A;  2DKW A;  5DW2 A;  4CFK A;  2G4A A;  4O7F A;  5D0C A;  1WUG A;  4MR5 A;  4NYV A;  4TT4 A;  5EWV A;  2CRW A;  5I86 A;  3FJU B;  2KGG A;  4LRG A;  3ZYU A;  5HM0 A;  5E9I A;  3LVQ E;  5HQ6 A;  2I7K A;  4NR7 A;  5KTW A;  3HCS A;  2N9G A;  3HMF A;  3M7K A;  5DYX A;  5D3L A;  5E9V A;  5E9Y A;  2DJA A;  4O7C A;  5F60 A;  3FAO A;  4AYC A;  5F1H A;  5C13 A;  4XY9 A;  5ENH A;  1E4U A;  5CUE A;  3P5O A;  4YH4 A;  3L1Z B;  4FLP A;  4IR4 A;  4QSR A;  3ZVY A;  5IGK A;  4H9D A;  4QUT A;  4WHU A;  5DKC A;  2EA6 A;  4QR5 A;  3U5O A;  4FJC A;  4O70 A;  4Q0O A;  2D8S A;  2EGM A;  4ZW1 A;  3U5N A;  2KYU A;  2L0B A;  3Q1D A;  5KH3 A;  5EP7 A;  2JUN A;  3ONI A;  3MB4 A;  3SVF A;  1Z6U A;  3ZNI A;  2G6Q A;  2YYR A;  2YYN A;  5CUC A;  2P57 A;  5BT5 A;  5FE6 A;  3O36 A;  4HBY A;  4OGI A;  3S92 A;  5CQ3 A;  4YYH A;  4YYI A;  4LYS A;  3N9Q A;  5E3G A;  4YY6 A;  2YEL A;  5LVQ A;  1E6I A;  4QSQ A;  4YY4 A;  4TU4 A;  5ENI A;  5JI8 A;  1MM2 A;  1WIL A;  3G0L A;  5KTU A;  4F52 B;  1JM4 B;  5HFR A;  3QZS A;  5SVX A;  2YVR A;  5D3T A;  2RR4 A;  3IHP A;  5A83 A;  2RI7 A;  2RS9 B;  5CUB A;  3L1X A;  4C9Z A;  4UYH A;  4LDF A;  5FE0 A;  4A9L A;  4ZC9 A;  4PCI A;  1X4J A;  2LXH C;  3L11 A;  4TZ8 A;  4CA1 A;  2MKE A;  4I7C A;  4TKP B;  1VFY A;  1FP0 A;  3T6R A;  4NQM A;  3KQI A;  5E7D A;  2RFJ A;  2M13 A;  3EB6 A;  2KWO A;  2VPE A;  4V3L C;  4QST A;  2KFT A;  5L8T A;  4KV4 A;  4UIV A;  3LQH A;  5LJ1 A;  2E7O A;  5II1 A;  4QB3 A;  4Z1Q A;  5F2P A;  4IOQ A;  3LJW A;  3NXB A;  5EPR A;  4YAB A;  3U5M A;  4XUB A;  5L97 A;  5F25 A;  2L5U A;  3LQI A;  4IC2 A;  4QC1 A;  4NUE A;  2IDA A;  3RCW A;  4A9H A;  2OO1 A;  4Z0O A;  4A9M A;  4MEN A;  1FBV A;  2I8N A;  3IU5 A;  4O75 A;  5B8D A;  3JVM A;  3UVD A;  2D9E A;  2DVR A;  2PUY A;  2PNX A;  5ENF A;  4X2I A;  4AKI A;  3P1D A;  3AQA A;  4TQN A;  1WEE A;  4LLB A;  1WEU A;  2L84 A;  2G43 A;  2KU3 A;  2KTB B;  5II2 A;  4BBQ A;  2XOY A;  5DY7 A;  5KO4 A;  4GB0 A;  3MUK A;  4QYL A;  5A5O A;  1LDK C;  5DIN A;  4A49 A;  2OUO A;  5A81 A;  4YBS A;  5A5S A;  4LZS A;  4UIX A;  4NR6 A;  5CP5 A;  2Y1M A;  2DVQ A;  4MVT A;  2ECT A;  2MD8 C;  3GG3 A;  3IU6 A;  3P1F A;  5EU1 A;  2R0V A;  2MUM A;  4J1P A;  4NR4 A;  4AKG A;  5I89 A;  1MM3 A;  3SHB A;  2DVS A;  5E0R A;  3JUE A;  4PTB A;  4NRB A;  1MBM A;  4FO9 A;  2YDW A;  5AIU A;  3G0J A;  4XI1 A;  4XY8 A;  5A5P A;  5SVY A;  3ZPV E;  4AKN A;  2VPD A;  5FE5 A;  5H1T A;  2ECG A;  5IGM A;  2XEU A;  4L7X A;  4J3I A;  5CUG A;  5KHM A;  2MD7 B;  1IYM A;  5CQ5 A;  4QR4 A;  2JMD A;  3UV4 A;  5FG4 A;  2YHO A;  4CUR A;  4HXO A;  1K2F A;  4CFL A;  3LXJ A;  5FFW A;  2RO1 A;  5KTX A;  4O74 A;  4UYE A;  3MHS A;  2VNF A;  4HBX A;  4LZ2 A;  5FE2 A;  2CSV A;  1N72 A;  4LR6 A;  3MDB C;  3LVR E;  4CCG X;  5EPB A;  5FE4 A;  4QBM A;  5EVA A;  5DFB A;  4I7D A;  3V43 A;  5FFY A;  2L85 A;  5L96 A;  3GL6 A;  4C67 A;  1WEQ A;  5FG6 A;  3U5L A;  5L98 A;  5G4R A;  4TT2 A;  5LCW B;  5D7X A;  2LDR A;  5FDZ A;  2E7N A;  2VJE B;  5IID A;  4B86 C;  3MHH A;  3MXF A;  5EA1 A;  4Z6H A;  5FH6 A;  4LK9 A;  2YQM A;  4NR9 A;  4DON A;  2L7P A;  5FE3 A;  4MR3 A;  2YEK A;  4WIV A;  1WIM A;  4WA6 A;  4QSV A;  5CQ8 A;  2M6M A;  2JM3 A;  4PY6 A;  5A5N A;  2FFW A;  4Q6F A;  5EWH A;  4Z0R A;  2E6S A;  4TS8 A;  4CLB A;  5E73 A;  3N9N A;  4ALG A;  4AUQ B;  4O77 A;  2K16 A;  1LDJ B;  1PUO A;  5AMF A;  4IR3 A;  1RMD A;  2VJF B;  4IOR A;  2LRI C;  4YYM A;  2FSA A;  5D3R A;  3UVY A;  4NUD A;  3QZV A;  1BOR A;  3UVW A;  2DWW A;  2M1R A;  4L58 A;  4NRC A;  5TB6 A;  4X3G A;  1Z2Q A;  3I2D A; 
#chains in the Genus database with same CATH homology
 4ZDT A;  3GV4 A;  3RTR B;  5EPS A;  2ECJ A;  5DYC A;  4BJX A;  4O71 A;  5COI A;  5CQ6 A;  5C7N A;  4WZ3 B;  5D1M B;  4HXM A;  5CS8 A;  3M62 A;  4HXR A;  5CTL A;  5E9K A;  5DW1 A;  2M85 A;  2KGI A;  3O34 A;  5FFV A;  3N9P A;  1HYI A;  5DKA A;  2LGK A;  4QF2 A;  4QSP A;  2YUC A;  5H1U A;  4C66 A;  5HEL A;  1JM7 A;  5F1L A;  2H0D B;  5BT3 A;  5DYA A;  4YAD A;  5J3X A;  5IGN A;  2GRC A;  5FB0 A;  2MA6 A;  4R8P K;  5LVR A;  5CY9 A;  5TDR A;  3HCT A;  3O35 A;  5TAB A;  4HXL A;  2F6J A;  2ECW A;  4BW4 A;  2H60 A;  4KCX A;  4HXN A;  5DFD A;  5DFC A;  2CT2 A;  3UVX A;  4QY4 A;  4HBW A;  5HFQ A;  4CUS A;  5I29 A;  3ZPV 1;  2ECV A;  4S3O B;  2EGP A;  4HBV A;  5F61 A;  4QEW A;  4TU6 A;  5EI4 A;  1T1H A;  3FL2 A;  2ECI A;  1VYX A;  5B79 A;  4NYW A;  4CUT A;  4UIU A;  5ENC A;  3NG2 A;  3O33 A;  4GNE A;  3SOX A;  3HCU A;  5E3D A;  5C89 A;  4LAD B;  3EB5 A;  5TBN A;  5I40 A;  2C2L A;  5FE1 A;  4YYG A;  3O37 A;  2VP7 A;  4NR5 A;  2YRE A;  2R0Y A;  4Z1S A;  4WZ2 A;  5C8G A;  4E96 A;  4W4U A;  3RPG C;  5ETD A;  4A4C A;  3JVJ A;  5DLX A;  2FUI A;  5FH7 A;  3HTK C;  4AYC B;  4N4F A;  4QEU A;  4QZS A;  2CSZ A;  2MT5 A;  3N9O A;  4O72 A;  1F62 A;  1CHC A;  1WEP A;  2EOD A;  4O76 A;  2CKL A;  2L80 A;  5ENJ A;  1ZS5 A;  4OUF A;  4CUU A;  5D3H A;  5IGL A;  5CUA A;  4ZUX U;  3SOW A;  5LKZ A;  4BW3 A;  1X4U A;  3LQJ A;  4QUU A;  1JSP B;  5FH8 A;  2R10 A;  2E3K A;  5H1V A;  4CUP A;  4CL9 A;  2M3H A;  5D1K B;  1WEW A;  5CU8 A;  5I83 A;  2YUR A;  4A9O A;  3K2J A;  4N4I A;  4N4H A;  4UYD A;  1F68 A;  3MUL A;  2MIQ A;  4UIY A;  2C2V S;  5FE7 A;  5HRW A;  5H9M A;  3M99 A;  5HRX A;  3MB3 A;  5F63 A;  5A85 A;  4Z6I A;  2YW8 A;  2KRE A;  4YBT A;  4NS5 A;  3P1E A;  4NUC A;  4UYF A;  5D3S A;  4UI9 B;  2RNW A;  4UP0 A;  2DVV A;  5I1Q A;  5I7Y A;  2MNZ A;  2K1J A;  4PKL A;  1X4I A;  4MSX A;  3FKM X;  4KV1 A;  4YYK A;  5LJ2 A;  5F5Z A;  1Z60 A;  2I50 A;  3SVH A;  5B78 A;  5B77 A;  5LKX A;  5EM3 A;  5D26 A;  4MEO A;  1WEM A;  2NAA A;  2LQ6 A;  2MNY A;  2E6R A;  1WEV A;  2L75 A;  5E9M A;  4TTE A;  2VJE A;  3ASL A;  3C6W A;  2MA5 A;  4IOO A;  4ALH A;  2R0S A;  3T7L A;  4UP5 A;  3DWY A;  5EQ1 A;  3U5K A;  4O7A A;  5EWW A;  3PUR A;  4IR5 A;  4A9E A;  2YQD A;  4O78 A;  4UIT A;  5FE8 A;  5EIC A;  5CQ4 A;  4YC9 A;  3QZT A;  3D7C A;  2JMI A;  2WP2 A;  2KR4 A;  5HQ7 A;  2HYE D;  4V3K C;  4R7E A;  4UIW A;  4AVX A;  3I3J A;  4PCE A;  5CZG A;  2Y43 A;  3RPG B;  2D82 A;  4QEV A;  4TT6 A;  5K29 A;  4O64 A;  3TLP A;  4BW1 A;  5AME A;  4NN2 A;  5F3A A;  1DVP A;  5J0D A;  2UZG A;  2WP1 A;  2LXP C;  5I3L A;  3AAD A;  4HXK A;  5FG5 A;  4A4B A;  5G04 B;  2QJ0 A;  5DX4 A;  3JVL A;  5DLZ A;  2H0D A;  1WUM A;  3N9M A;  1WEO A;  4LJN A;  3ZTG A;  5G05 B;  5TDW A;  5G4S A;  2RNY A;  4S3O C;  2LV9 A;  5C4Q A;  5C85 A;  2YU4 A;  4O7B A;  3UV5 A;  2YSM A;  5KH7 A;  3UV2 A;  4UYF B;  5CFW A;  2JMJ A;  4GND A;  4NRA A;  5IG6 A;  3LRQ A;  4QSX A;  4O7E A;  4XYA A;  4Z93 A;  5HEN A;  3O7A A;  1G25 A;  4CUQ A;  4GPJ A;  2BAY A;  2QIC A;  4LYI A;  4P5O B;  5FB1 A;  5CPE A;  3U5P A;  5KH9 A;  5E74 A;  2MJV B;  2YSJ A;  5AD2 A;  3UW9 A;  2KWN A;  1JM7 B;  2XB1 A;  4LC2 A;  5L99 A;  3O70 A;  5KU3 A;  3DAI A;  4LKA A;  4MR4 A;  5HCL A;  3SVG A;  5DYU A;  4IR6 A;  4YAT A;  5BT4 A;  2VPB A;  4A0C D;  4NR8 A;  5DKH A;  2HDP A;  3VK6 A;  2VJF A;  4BW2 A;  4BHW A;  4XUA A;  2OXQ C;  5DBM A;  2Y1N A;  5DKD A;  2AN6 A;  1V87 A;  1EQF A;  2KIZ A;  5D1L B;  5EIS A;  5B76 A;  3P1C A;  4WHW A;  4YAX A;  2DAT A;  5FEY A;  5TRB A;  2L5E A;  3JVK A;  4QSS A;  4LZR A;  1JOC A;  1WEN A;  2VPG A;  4J0R A;  5D24 A;  4AP4 A;  4QC3 A;  5EWD A;  1WES A;  4A9F A;  5E9L A;  5EWC A;  1WE9 A;  2CKL B;  2K4D A;  5CRZ A;  5LUU A;  4J0S A;  3MQM A;  4A9J A;  4WZ0 A;  5C11 A;  2ZET C;  4FIP A;  5CGP A;  2KWK A;  4YK0 A;  4TYL A;  4TZ2 A;  2KE1 A;  4UIZ A;  2G45 A;  3ZVZ B;  4PPE A;  4QNS A;  3C5K A;  4R2Y A;  5EYA F;  4NYX A;  5F62 A;  4NXJ A;  2DX8 A;  4MEQ A;  1WGM A;  5HEM A;  3KV5 A;  3S91 A;  2JRJ A;  3U5J A;  4A9K A;  5ENG A;  2LGL A;  3KV6 A;  5LKT A;  5LJ0 A;  4FK5 A;  4NQN A;  5L8U A;  5I7X A;  4QSW A;  5A5R A;  5D3J A;  5JWM A;  5F36 A;  3HMH A;  5CRM A;  5I80 A;  4MEP A;  5B75 A;  5ACY A;  1N87 A;  2YEM A;  4QYD A;  4A9N A;  4IC3 A;  1WFK A;  3KNV A;  4RVR A;  5A7C A;  5HRV A;  3DPL R;  4F3I A;  4LYW A;  4YBM A;  2RNX A;  5A82 A;  5AIT A;  3M63 A;  5A5Q A;  5ETB A;  3Q2F A;  4MR6 A;  4YYN A;  3ZYQ A;  4YYJ A;  5FBX A;  2LGG A;  5ENE A;  3PHD A;  4YH3 A;  3DQV R;  5CQ7 A;  1HYJ A;  3Q2E A;  5EV9 A;  5TCM A;  2LSP B;  2OSS A;  2FUU A;  4I7B A;  5CQT A;  2NXB A;  1VD4 A;  4Y03 A;  5FE9 A;  2CSY A;  5EGU A;  4N3W A;  1XWH A;  5HJC A;  4Q0N A;  4A9I A;  5D3N A;  2KWJ A;  2YHN A;  4B7Y C;  5D3P A;  4HXS A;  2K17 A;  5G0F A;  2F6N A;  5H85 A;  5LKU A;  5AD3 A;  5C87 A;  5JG6 A;  4QF3 A;  2YQL A;  5HQ5 A;  4UYG A;  3SOU A;  2RSD A;  4GNF A;  5CUD A;  1ZBD B;  4GNG A;  2F42 A;  5HLS A;  4QR3 A;  2ECN A;  5IBN A;  4ZQL A;  2YW5 A;  4HXP A;  2YT5 A;  4YYD A;  1X0J A;  4N4G A;  2LN0 A;  3N9L A;  5FER A;  5I88 A;  5CQA A;  4QSU A;  2LGV A;  2L43 A;  5D25 A;  1U6G B;  5ENB A;  4OGJ A;  4PS5 A;  2QIZ A;  3PUQ A;  5EK9 A;  3HME A;  2DKW A;  5DW2 A;  4CFK A;  2G4A A;  4O7F A;  5D0C A;  1WUG A;  4MR5 A;  4NYV A;  4TT4 A;  5EWV A;  5I86 A;  2KGG A;  4LRG A;  3ZYU A;  5HM0 A;  5E9I A;  5HQ6 A;  2I7K A;  4NR7 A;  5KTW A;  3HCS A;  2N9G A;  3HMF A;  5DYX A;  5D3L A;  5E9V A;  5E9Y A;  4O7C A;  5F60 A;  4AYC A;  5F1H A;  5C13 A;  4XY9 A;  5ENH A;  1E4U A;  5CUE A;  3P5O A;  4YH4 A;  3L1Z B;  4FLP A;  4IR4 A;  4QSR A;  3ZVY A;  5IGK A;  4QUT A;  4WHU A;  5DKC A;  2EA6 A;  4QR5 A;  3U5O A;  4FJC A;  4O70 A;  4Q0O A;  2D8S A;  2KYU A;  4ZW1 A;  3U5N A;  2L0B A;  5KH3 A;  5EP7 A;  3ONI A;  3MB4 A;  3SVF A;  1Z6U A;  3ZNI A;  2G6Q A;  2YYR A;  2YYN A;  5CUC A;  5BT5 A;  5FE6 A;  3O36 A;  4HBY A;  4OGI A;  3S92 A;  5CQ3 A;  4YYH A;  4YYI A;  4LYS A;  3N9Q A;  5E3G A;  4YY6 A;  2YEL A;  5LVQ A;  1E6I A;  4QSQ A;  4YY4 A;  4TU4 A;  5ENI A;  5JI8 A;  1MM2 A;  1WIL A;  3G0L A;  5KTU A;  4F52 B;  1JM4 B;  5HFR A;  3QZS A;  5D3T A;  3L1X A;  3IHP A;  5A83 A;  2RI7 A;  2RS9 B;  5CUB A;  4C9Z A;  4UYH A;  4LDF A;  5FE0 A;  4A9L A;  4ZC9 A;  4PCI A;  1X4J A;  2LXH C;  3L11 A;  4TZ8 A;  4CA1 A;  4I7C A;  4TKP B;  1VFY A;  1FP0 A;  3T6R A;  4NQM A;  3KQI A;  5E7D A;  2RFJ A;  3EB6 A;  2KWO A;  2VPE A;  4V3L C;  4QST A;  2KFT A;  5L8T A;  4KV4 A;  4UIV A;  3LQH A;  5LJ1 A;  2E7O A;  5II1 A;  4QB3 A;  4Z1Q A;  5F2P A;  4IOQ A;  3LJW A;  3NXB A;  5EPR A;  4YAB A;  3U5M A;  4XUB A;  5L97 A;  5F25 A;  2L5U A;  3LQI A;  4IC2 A;  4QC1 A;  4NUE A;  2IDA A;  3RCW A;  4A9H A;  2OO1 A;  4A9M A;  4MEN A;  1FBV A;  2I8N A;  3IU5 A;  4O75 A;  5B8D A;  3JVM A;  3UVD A;  2D9E A;  2DVR A;  2PUY A;  2PNX A;  5ENF A;  4X2I A;  3P1D A;  3AQA A;  4TQN A;  1WEE A;  4LLB A;  1WEU A;  2L84 A;  2G43 A;  2KU3 A;  2KTB B;  5II2 A;  4BBQ A;  5DY7 A;  5KO4 A;  4GB0 A;  3MUK A;  4QYL A;  5A5O A;  1LDK C;  5DIN A;  4A49 A;  2OUO A;  5A81 A;  4YBS A;  5A5S A;  4LZS A;  4UIX A;  4NR6 A;  5CP5 A;  2Y1M A;  2DVQ A;  4MVT A;  2ECT A;  2MD8 C;  3GG3 A;  3IU6 A;  3P1F A;  5EU1 A;  2R0V A;  2MUM A;  4J1P A;  4NR4 A;  5I89 A;  1MM3 A;  3SHB A;  2DVS A;  5E0R A;  4PTB A;  4NRB A;  4FO9 A;  5AIU A;  2YDW A;  3G0J A;  4XI1 A;  4XY8 A;  5A5P A;  3ZPV E;  4AKN A;  2VPD A;  5FE5 A;  5H1T A;  2ECG A;  5IGM A;  2XEU A;  4L7X A;  4J3I A;  5CUG A;  5KHM A;  2MD7 B;  1IYM A;  5CQ5 A;  4QR4 A;  2JMD A;  3UV4 A;  5FG4 A;  2YHO A;  4CUR A;  4HXO A;  1K2F A;  4CFL A;  3LXJ A;  5FFW A;  2RO1 A;  5KTX A;  4O74 A;  4UYE A;  3MHS A;  2VNF A;  4HBX A;  4LZ2 A;  5FE2 A;  1N72 A;  4LR6 A;  4CCG X;  5EPB A;  5FE4 A;  4QBM A;  5EVA A;  5DFB A;  4I7D A;  3V43 A;  5FFY A;  2L85 A;  5L96 A;  3GL6 A;  4C67 A;  1WEQ A;  5FG6 A;  3U5L A;  5L98 A;  5G4R A;  4TT2 A;  5LCW B;  5D7X A;  2LDR A;  5FDZ A;  2E7N A;  2VJE B;  5IID A;  4B86 C;  3MHH A;  3MXF A;  5EA1 A;  4Z6H A;  5FH6 A;  4LK9 A;  2YQM A;  4NR9 A;  4DON A;  5FE3 A;  4MR3 A;  2YEK A;  4WIV A;  1WIM A;  4WA6 A;  4QSV A;  5CQ8 A;  2M6M A;  4PY6 A;  5A5N A;  4Q6F A;  5EWH A;  2E6S A;  4TS8 A;  4CLB A;  5E73 A;  3N9N A;  4ALG A;  4AUQ B;  4O77 A;  2K16 A;  1LDJ B;  5AMF A;  4IR3 A;  1RMD A;  2VJF B;  4IOR A;  2LRI C;  4YYM A;  2FSA A;  5D3R A;  3UVY A;  4NUD A;  3QZV A;  1BOR A;  3UVW A;  2DWW A;  2M1R A;  4L58 A;  4NRC A;  5TB6 A;  4X3G A;  1Z2Q A;  3I2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...