3QZVA

Crystal structure of bptf phd-linker-bromo in complex with histone h4k12ac peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
KLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleosome-remodeling factor subunit BPTF
publication title Recognition of a Mononucleosomal Histone Modification Pattern by BPTF via Multivalent Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/nuclear protein
total genus 57
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2011-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3qzvA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3qzvA01
1FBVA 2LGVA 3P1EA 4UP0A 3UV2A 4WZ0A 3RTRB 4HXSA 4OUFA 2LDRA 1JM7B 4O75A 4RVRA 4A9NA 4TU4A 5FB0A 2D8SA 2H0DA 5I88A 4Z1QA 2VJEB 3ZPV1 3M99A 5I7XA 4AP4A 5BT4A 5D3TA 4QF2A 2DVVA 3MQMA 4A9MA 4XY9A 5TDWA 4LDFA 3U5NA 4LADB 3UW9A 4FIPA 2YQMA 3JVMA 4J1PA 3T7LA 3ZYQA 4ZQLA 4YYIA 1VYXA 2XEUA 4QF3A 2D9EA 5I1QA 4A4BA 2YDWA 2YQLA 2OXQC 3IU6A 4J0SA 4XUAA 5G4RA 5I89A 4BW1A 5I3LA 5FG6A 3N9LA 2RO1A 3AADA 4O7BA 4CUQA 4UYDA 3ONIA 1XWHA 4XUBA 4YYDA 3FKMX 2NAAA 2YREA 5A5NA 2KGIA 5KH3A 3G0LA 4LC2A 4R8PK 5TB6A 4NR7A 4NS5A 4XY8A 4HBYA 3DAIA 5A5PA 5DFCA 2KIZA 3UVYA 1HYIA 5AMFA 4A49A 5I7YA 5EVAA 4A9LA 3ZNIA 4IC2A 3HMHA 5KH9A 4MSXA 5F5ZA 4TQNA 4YC9A 5F25A 3MHSA 4PTBA 1Z6UA 5C85A 1K2FA 2Y43A 4WA6A 2DVRA 4HXRA 4HBXA 5KTWA 3N9MA 5AIUA 4LYSA 4YH3A 3P1FA 5EWDA 2EGPA 5G0FA 1WFKA 5CRZA 4YYKA 1ZS5A 1VD4A 2WP1A 2QJ0A 3O33A 5D25A 5EPSA 5EI4A 4KV1A 4C67A 5FE0A 4YYGA 4YYJA 2KWNA 5H85A 4GNGA 5LVQA 4FJCA 3DQVR 4NUEA 3U5PA 5TDRA 4Z6IA 2IDAA 5HFRA 5CUCA 1VFYA 4NYVA 5C4QA 5FH7A 2C2LA 5D1LB 5TABA 5BT5A 5DYCA 1Z2QA 4S3OB 1U6GB 3M62A 1E4UA 1FP0A 3O34A 5DKCA 2M85A 4ALHA 5H1VA 2EODA 4A9OA 2PNXA 4A4CA 3NXBA 2FSAA 2RSDA 3C6WA 4QNSA 5CQ3A 1LDJB 4LZSA 3KNVA 3ZYUA 4HXMA 5A83A 5E9MA 5HRWA 4LLBA 5D26A 2RNWA 5F1LA 2YHNA 2Y1NA 1WGMA 5FB1A 2DX8A 4MR3A 4XI1A 5F62A 2FUIA 5G05B 1WIMA 2VPEA 4CUSA 4WZ3B 5D7XA 5EQ1A 5CS8A 5FE4A 5D0CA 3GG3A 5JI8A 2OSSA 4YY6A 2L43A 4GNDA 2YW5A 1WUGA 4ZUXU 4MR5A 2R10A 5L97A 2EA6A 5FFWA 2YUCA 2YEMA 2K16A 3N9NA 4LYIA 2LGGA 1X4UA 4IC3A 4BBQA 4TZ2A 2KWOA 5LCWB 4QY4A 5E9VA 3RPGB 4AVXA 5CFWA 4QSQA 5A5SA 4CL9A 4TU6A 4QZSA 3TLPA 4IR6A 5EK9A 4YY4A 5AMEA 4PS5A 5EU1A 4CLBA 2ECGA 4KCXA 2LGKA 3N9OA 4ZW1A 2K1JA 5L98A 5DYUA 1WUMA 2YHOA 3DPLR 4A9EA 2YYNA 4HBVA 5ENFA 1JOCA 5COIA 2YQDA 4UYGA 5EWHA 5G4SA 3O7AA 4MR4A 5CTLA 3LQHA 5F63A 2MD7B 5DW1A 2E7OA 5CQ8A 5FDZA 5EICA 2R0VA 1F62A 2YURA 4F3IA 3S92A 5KO4A 4CUPA 2YYRA 4O77A 4TT4A 2GRCA 3JVJA 5FE9A 3ZVZB 4Q6FA 4AUQB 4A9HA 4UIUA 4YBMA 5FE5A 3HMEA 4LZ2A 5EWCA 4NR9A 4TT6A 5HLSA 3QZTA 4KV4A 5D3NA 2YU4A 5I29A 4YBSA 4HBWA 3U5OA 2JRJA 2QIZA 5DY7A 4MVTA 4Q0NA 5DX4A 4UITA 5EGUA 5D3JA 2I8NA 4LYWA 5H1TA 5ENIA 4BHWA 5E74A 4QEUA 2RNXA 5TRBA 4YABA 5CPEA 5EPRA 1WEWA 3UVWA 1WEQA 3UV4A 3ZTGA 5CRMA 1JSPB 4X3GA 3RPGC 4UIYA 5IGKA 1HYJA 5DYAA 4O76A 4ZC9A 4A9IA 2L5EA 2ECVA 2HYED 5ENGA 5HQ7A 2OUOA 3LQJA 2LN0A 3KV6A 4PPEA 2M1RA 5D3LA 4C9ZA 2VJFA 4O71A 5HM0A 3KV5A 2C2VS 3U5JA 4QSWA 2E6SA 4QSVA 5C7NA 2L80A 4R2YA 4WHUA 5LKUA 4GNFA 5LJ2A 5HCLA 5L96A 4GPJA 3I3JA 5FE3A 1WEMA 2M3HA 5DW2A 5HFQA 5F61A 4NQMA 5ENCA 2YT5A 4PCIA 4AKNA 5F1HA 4UIWA 5AD2A 3IHPA 5LKZA 5E9IA 2CSYA 5J3XA 4UP5A 4IR3A 4QB3A 3EB6A 4NXJA 5FFVA 5F60A 5HQ6A 4GB0A 2MD8C 5JG6A 4QUUA 5HRXA 5HEMA 1EQFA 3UVXA 3MXFA 5CQ4A 3LQIA 3N9PA 4QSSA 5I40A 2MNYA 4LZRA 5EA1A 2CT2A 5B79A 4AYCA 3HCUA 4OGJA 3L11A 2E3KA 1RMDA 4R7EA 3D7CA 5HJCA 5DKDA 3LRQA 3O37A 4I7DA 5E9LA 4TZ8A 3UV5A 4FK5A 4CCGX 3HTKC 4LKAA 1JM7A 4HXOA 1E6IA 3U5KA 3LXJA 2RNYA 1CHCA 5CQ7A 3U5MA 2K17A 5CZGA 2OO1A 4LRGA 5FE8A 2RS9B 4B7YC 2F42A 2F6JA 2VJEA 4LJNA 2H0DB 1MM2A 3SOXA 4B86C 2CKLA 2KE1A 4TT2A 5F3AA 5B75A 2LQ6A 3O70A 2LSPB 4NR5A 2R0YA 4CFLA 2G6QA 4QR4A 4A9FA 1N72A 2F6NA 5IIDA 2PUYA 3M63A 3SHBA 5ETBA 2D82A 4WIVA 2MIQA 4QSRA 2I7KA 5ENHA 2ECTA 5E3DA 5IG6A 2JMIA 5A82A 5C87A 4V3KC 4YADA 3GV4A 4HXPA 4O74A 3QZVA 2NXBA 5ENEA 2HDPA 5CUDA 4CA1A 5E3GA 3NG2A 1X0JA 5IBNA 2LV9A 2MNZA 2ECIA 4F52B 4N4HA 3PHDA 4NYWA 4HXLA 5D24A 4OGIA 4QSPA 3HCSA 5DFBA 2VJFB 3ZVYA 3PUQA 4QYDA 5II2A 4QR3A 2MA5A 4IORA 2KTBB 3O36A 4HXKA 5E7DA 3P5OA 4O7EA 2K4DA 4Z1SA 2KREA 2MA6A 2DKWA 4BW2A 4S3OC 3MHHA 5DINA 2L84A 4UIVA 4YBTA 1WILA 2XB1A 5EV9A 5CUBA 5J0DA 3HCTA 4O7FA 2VPGA 5B78A 5C11A 1X4JA 4CUTA 4NRCA 5EPBA 3MUKA 5CQTA 4PCEA 4YAXA 1DVPA 2CSZA 5F2PA 4O64A 4A0CD 4QC3A 5II1A 4MR6A 4WZ2A 4O70A 5CUGA 4P5OB 5LKTA 5F36A 3L1ZB 5C89A 4UI9B 1MM3A 5H1UA 2KFTA 5BT3A 2WP2A 2RI7A 5HELA 5LJ0A 1Z60A 2YW8A 4N4IA 4ALGA 4AYCB 4L7XA 2L5UA 5I86A 4MEOA 4MEPA 5LVRA 5CQAA 2ZETC 2RFJA 3MB3A 3V43A 4LK9A 3AQAA 4X2IA 3KQIA 4I7BA 2JMDA 3Q2FA 5KTUA 2QICA 2YELA 4QBMA 5FE6A 4Z93A 3ZPVE 3Q2EA 5KHMA 5D3PA 1X4IA 4YH4A 2ECWA 4MENA 3UVDA 2VPDA 5FBXA 2YSMA 5JWMA 5B76A 4TYLA 5FG4A 4CURA 5C8GA 1WESA 5HQ5A 3SVGA 1WEUA 4UIZA 5CU8A 5L8UA 2FUUA 4BW4A 5A5OA 2L85A 2CKLB 2Y1MA 5KH7A 1LDKC 4TS8A 2N9GA 5CUEA 3U5LA 5D3RA 4GNEA 4CFKA 5I80A 4A9JA 5LUUA 5A85A 5FE1A 4NRBA 5TCMA 5D1KB 5ENJA 2E7NA 2KYUA 2LGLA 1JM4B 2LXHC 1WEPA 5TBNA 5DLZA 4PKLA 5FFYA 4QYLA 2KU3A 3SVHA 2DWWA 4QSUA 4O7CA 4QC1A 4PY6A 4YK0A 4BJXA 2M6MA 3DWYA 5FEYA 4UYFA 5FG5A 1WEOA 2G43A 2VNFA 4BW3A 3RCWA 2YSJA 5HENA 4DONA 3EB5A 3S91A 4ZDTA 1G25A 4NR4A 2MT5A 5FE7A 3GL6A 4XYAA 3SOUA 3JVKA 4O72A 5FH6A 2BAYA 2MJVB 4J3IA 4YYNA 2G4AA 4N4FA 1ZBDB 1WENA 4E96A 2VP7A 5B8DA 4NQNA 5L99A 4C66A 3FL2A 2VPBA 4O78A 5LKXA 2G45A 2YEKA 5EM3A 4UYHA 4WHWA 5HRVA 3N9QA 5CP5A 1WEEA 4TTEA 4J0RA 4O7AA 5CGPA 4NR6A 3P1DA 3K2JA 5B77A 2KWKA 2LRIC 1V87A 4NN2A 2DVQA 5K29A 5EWWA 5FE2A 2ECJA 4UYEA 3VK6A 5KU3A 2KR4A 5DFDA 5G04B 4NYXA 3G0JA 5E0RA 5FH8A 4Z6HA 5H9MA 4HXNA 4UIXA 2E6RA 4FLPA 1BORA 2L0BA 1WE9A 4N4GA 5EWVA 4QEWA 3QZSA 5EYAF 4NRAA 3PURA 5E9YA 5A5QA 5CQ6A 5DKHA 5CUAA 5A81A 5E73A 3I2DA 4TKPB 2JMJA 5D1MB 5D3HA 5EP7A 5AITA 4IOOA 5ACYA 5I83A 4YYMA 3SVFA 5A7CA 4Q0OA 3C5KA 4IR5A 4I7CA 2I50A 5AD3A 4YATA 5E9KA 4QEVA 1T1HA 4NR8A 4FO9A 4W4UA 3IU5A 5CQ5A 3ASLA 3LJWA 4IR4A 2MUMA 5CY9A 4NUCA 2DVSA 4A9KA 4MEQA 3JVLA 5ETDA 5D3SA 5KTXA 2DATA 4QUTA 3MULA 2KWJA 2LXPC 4L58A 5DKAA 4QSXA 4YYHA 1N87A 4V3LC 5EISA 3P1CA 1IYMA 5IGMA 5LJ1A 3MB4A 4NUDA 2H60A 4QR5A 4UYFB 2R0SA 3O35A 4LR6A 3HMFA 5IGNA 5IGLA 3SOWA 2UZGA 5C13A 5A5RA 2AN6A 5FERA 4QSTA 3L1XA 4N3WA 5DYXA 5DBMA 4CUUA 3T6RA 5L8TA 2L75A 4IOQA 4Y03A 1F68A 2ECNA 2KGGA 1WEVA 5ENBA 5DLXA
chains in the Genus database with same CATH superfamily
1FBVA 2LGVA 3P1EA 4UP0A 3UV2A 4WZ0A 3RTRB 4HXSA 4OUFA 2LDRA 1JM7B 4O75A 4RVRA 4A9NA 4TU4A 5FB0A 2D8SA 2H0DA 5I88A 4Z1QA 2VJEB 3ZPV1 3M99A 5I7XA 4AP4A 5BT4A 5D3TA 4QF2A 5K3QA 2DVVA 3MQMA 4A9MA 4XY9A 2YVRA 5TDWA 4LDFA 3U5NA 3PLWA 4LADB 3UW9A 4FIPA 2YQMA 3JVMA 4J1PA 3T7LA 4AKIA 3ZYQA 4ZQLA 4YYIA 1VYXA 2XEUA 4QF3A 5SVIB 2D9EA 5I1QA 4A4BA 2YDWA 2YQLA 2OXQC 3SUBA 3IU6A 4J0SA 4XUAA 5G4RA 5I89A 4BW1A 5I3LA 5FG6A 3N9LA 3VKGA 2RO1A 3AADA 4O7BA 4CUQA 4UYDA 3ONIA 1XWHA 4XUBA 4YYDA 3FKMX 2NAAA 2YREA 5A5NA 2KGIA 5KH3A 3G0LA 4LC2A 4R8PK 3ERRA 4F1PA 5TB6A 4NR7A 4NS5A 4XY8A 4HBYA 3DAIA 5A5PA 1ZKRA 5DFCA 2KIZA 4O62A 3UVYA 1HYIA 5AMFA 2JM3A 4A49A 5I7YA 5EVAA 4A9LA 1MBMA 3ZNIA 4IC2A 3HMHA 5KH9A 4MSXA 2KKXA 5F5ZA 4TQNA 4YC9A 5F25A 3MHSA 4PTBA 1Z6UA 5C85A 1K2FA 2Y43A 4WA6A 2DVRA 4HXRA 4HBXA 5KTWA 2M13A 3N9MA 5AIUA 4LYSA 4YH3A 3P1FA 5EWDA 3M7KA 2EGPA 3FANA 5G0FA 1WFKA 5CRZA 4YYKA 1ZS5A 1VD4A 2WP1A 2QJ0A 3O33A 5D25A 3FEHA 5EPSA 5EI4A 4KV1A 4C67A 5FE0A 4YYGA 4YYJA 2KWNA 5H85A 2B0OE 4GNGA 5LVQA 4FJCA 3DQVR 4NUEA 3U5PA 5TDRA 4Z6IA 2IDAA 5HFRA 5CUCA 1VFYA 4NYVA 5C4QA 5FH7A 2C2LA 5D1LB 5TABA 5BT5A 5DYCA 1Z2QA 4S3OB 1U6GB 3M62A 1E4UA 1FP0A 3O34A 5DKCA 2M85A 4ALHA 5H1VA 2EODA 4A9OA 2PNXA 4A4CA 3NXBA 2FSAA 2RSDA 3C6WA 4QNSA 5CQ3A 1LDJB 4LZSA 3KNVA 3ZYUA 4HXMA 5A83A 5E9MA 5HRWA 4AKHA 5D26A 2XOYA 2RNWA 4LLBA 5F1LA 2YHNA 2Y1NA 1WGMA 5FB1A 2DX8A 4MR3A 4XI1A 5F62A 2FUIA 5G05B 1WIMA 2VPEA 4CUSA 4WZ3B 4H9DA 5D7XA 5EQ1A 5CS8A 5FE4A 5D0CA 3GG3A 5JI8A 2OSSA 4YY6A 2L43A 4GNDA 2YW5A 1WUGA 4ZUXU 4MR5A 2R10A 5L97A 2EA6A 5FFWA 2YUCA 2YEMA 2K16A 3KDEC 3N9NA 4LYIA 2LGGA 1X4UA 4IC3A 4BBQA 4TZ2A 2KWOA 5LCWB 4QY4A 5E9VA 3RPGB 4AVXA 5CFWA 4QSQA 5A5SA 4CL9A 4TU6A 4QZSA 3TLPA 4IR6A 5EK9A 4YY4A 5AMEA 4PS5A 5EU1A 4CLBA 2ECGA 4KCXA 2LGKA 3N9OA 4ZW1A 2K1JA 5L98A 5DYUA 1WUMA 2EXUA 2RR4A 2YHOA 3DPLR 4A9EA 2YYNA 4HBVA 5ENFA 1JOCA 5COIA 2XOCA 2YQDA 4UYGA 5EWHA 5G4SA 3O7AA 4MR4A 5CTLA 3LQHA 5F63A 2MD7B 5DW1A 2E7OA 5CQ8A 5FDZA 5EICA 3LVRE 2R0VA 2D8UA 1F62A 2YURA 4F3IA 3S92A 5KO4A 4CUPA 2YYRA 4O77A 4TT4A 2GRCA 3JVJA 5FE9A 3ZVZB 4Q6FA 4AUQB 4A9HA 4UIUA 4YBMA 5FE5A 3HMEA 4LZ2A 5EWCA 4NR9A 4TT6A 5HLSA 3QZTA 4KV4A 5D3NA 2YU4A 5I29A 4YBSA 4HBWA 3U5OA 2JRJA 2QIZA 5DY7A 4MVTA 4Q0NA 5DX4A 4UITA 3FAOA 5EGUA 5D3JA 2I8NA 4LYWA 5H1TA 5ENIA 4BHWA 5E74A 4QEUA 2RNXA 5TRBA 4YABA 5CPEA 5EPRA 1WEWA 3UVWA 1WEQA 3UV4A 3ZTGA 5CRMA 1JSPB 4X3GA 3RPGC 4UIYA 5IGKA 1HYJA 5DYAA 4O76A 4ZC9A 4A9IA 2L5EA 2ECVA 2HYED 4Z0RA 5ENGA 5HQ7A 2OUOA 3LQJA 2LN0A 2IQJA 3KV6A 4PPEA 2M1RA 5D3LA 2E61A 4C9ZA 2VJFA 4O71A 5HM0A 2CONA 3KV5A 2C2VS 3U5JA 4QSWA 2E6SA 4QSVA 5C7NA 2L80A 4R2YA 4WHUA 5LKUA 4GNFA 5LJ2A 5HCLA 5L96A 4GPJA 3I3JA 5FE3A 1WEMA 2M3HA 5DW2A 5HFQA 5F61A 4NQMA 5ENCA 2YT5A 4PCIA 4AI6A 4AKNA 5F1HA 4UIWA 5AD2A 3IHPA 5LKZA 5E9IA 2CSYA 5J3XA 4UP5A 4IR3A 4QB3A 3EB6A 3FM8C 4NXJA 5FFVA 5F60A 5HQ6A 4GB0A 2MD8C 5JG6A 4QUUA 5HRXA 5HEMA 1EQFA 3UVXA 3MXFA 5CQ4A 4Z0OA 3LQIA 4OGCA 3N9PA 4QSSA 5I40A 2MNYA 4LZRA 5EA1A 2CT2A 5B79A 4AYCA 3HCUA 4OGJA 3L11A 2E3KA 1RMDA 4R7EA 3D7CA 5HJCA 3LDYA 5DKDA 3LRQA 3O37A 4I7DA 5E9LA 4TZ8A 3UV5A 4FK5A 4CCGX 3HTKC 4LKAA 3H7HA 1JM7A 4HXOA 1E6IA 3U5KA 3LXJA 2RNYA 1CHCA 5CQ7A 3U5MA 2K17A 5CZGA 2OO1A 3VKHA 4LRGA 5FE8A 2RS9B 4B7YC 2F42A 2F6JA 2VJEA 4LJNA 2H0DB 1MM2A 3SOXA 4B86C 1DCQA 2CKLA 2KE1A 4TT2A 5F3AA 5B75A 2LQ6A 3O70A 2LSPB 2L7PA 4NR5A 2R0YA 4CFLA 2G6QA 4QR4A 4A9FA 1N72A 2F6NA 5IIDA 2PUYA 3M63A 3SHBA 2CSVA 5ETBA 2D82A 4WIVA 2MIQA 4QSRA 2I7KA 5ENHA 2ECTA 5E3DA 5IG6A 2JMIA 5A82A 5C87A 4V3KC 4YADA 3GV4A 4HXPA 4O74A 3QZVA 2NXBA 5ENEA 2HDPA 5CUDA 4CA1A 5E3GA 3NG2A 1X0JA 5IBNA 2LV9A 2MNZA 2ECIA 4F52B 4N4HA 2FD4A 2MKEA 3PHDA 4NYWA 4HXLA 2OWAA 5D24A 4OGIA 4QSPA 3HCSA 5DFBA 2VJFB 3ZVYA 3PUQA 4QYDA 5II2A 2CRRA 4QR3A 2MA5A 5SVYA 4IORA 2KTBB 3O36A 4HXKA 5E7DA 3P5OA 4O7EA 2K4DA 4Z1SA 2KREA 2MA6A 2DKWA 4BW2A 4S3OC 3MHHA 5DINA 2L84A 4UIVA 4YBTA 1WILA 2XB1A 3LJUX 5EV9A 5CUBA 5J0DA 3HCTA 4O7FA 2VPGA 5B78A 5C11A 1X4JA 4CUTA 4NRCA 5EPBA 3MUKA 5CQTA 4PCEA 4YAXA 1DVPA 2CSZA 5F2PA 4O64A 4A0CD 4QC3A 5II1A 4MR6A 3O47A 4WZ2A 4O70A 5CUGA 4P5OB 5LKTA 5F36A 5SVXA 3L1ZB 5C89A 4UI9B 1MM3A 5H1UA 2KFTA 5BT3A 2WP2A 2RI7A 5HELA 5LJ0A 1Z60A 2YW8A 4N4IA 4ALGA 4AYCB 4L7XA 2L5UA 2P57A 5I86A 4MEOA 4MEPA 5LVRA 5CQAA 2ZETC 2RFJA 3MB3A 3V43A 4LK9A 3AQAA 4X2IA 3KQIA 4I7BA 2JMDA 3Q2FA 5KTUA 2QICA 2YELA 4QBMA 5FE6A 4Z93A 3ZPVE 3Q2EA 5KHMA 5D3PA 1X4IA 4YH4A 2ECWA 4MENA 3UVDA 2VPDA 5FBXA 2YSMA 5JWMA 5B76A 4TYLA 5FG4A 4CURA 5C8GA 1WESA 5HQ5A 3SVGA 1WEUA 4UIZA 5CU8A 5L8UA 2FUUA 4BW4A 5A5OA 2L85A 2CKLB 2Y1MA 5KH7A 1LDKC 4TS8A 2N9GA 5CUEA 3U5LA 5D3RA 4GNEA 4CFKA 5I80A 4A9JA 3E2DA 5LUUA 5A85A 5FE1A 4NRBA 5TCMA 5D1KB 5ENJA 2E7NA 2KYUA 2LGLA 1JM4B 2LXHC 1WEPA 5TBNA 5DLZA 4PKLA 5FFYA 4QYLA 2LAUA 2KU3A 3SVHA 2DWWA 4QSUA 3JUEA 4O7CA 4QC1A 4PY6A 4OGEA 4YK0A 4BJXA 2M6MA 3DWYA 5FEYA 4UYFA 5FG5A 1WEOA 2G43A 2VNFA 4BW3A 3RCWA 2YSJA 5HENA 4DONA 3EB5A 3S91A 4ZDTA 1G25A 4NR4A 2MT5A 5FE7A 3GL6A 4XYAA 3LVQE 3JVKA 4O72A 3SOUA 5FH6A 2BAYA 2MJVB 4J3IA 4YYNA 2G4AA 4N4FA 1ZBDB 1WENA 4E96A 2VP7A 4AKGA 4NQNA 5L99A 3Q1DA 5B8DA 4C66A 3FL2A 2VPBA 4O78A 5LKXA 2G45A 2YEKA 5EM3A 4UYHA 4WHWA 5HRVA 2CRWA 3N9QA 5CP5A 2DSMA 1WEEA 4TTEA 4J0RA 4O7AA 5CGPA 4NR6A 3P1DA 2XOZA 3K2JA 5B77A 2KWKA 2LRIC 1V87A 4NN2A 2DVQA 5K29A 5EWWA 5FE2A 2ECJA 4UYEA 2DJAA 3VK6A 5KU3A 2KR4A 5DFDA 2EGMA 5G04B 4NYXA 3G0JA 5E0RA 5FH8A 4Z6HA 5H9MA 4HXNA 4UIXA 2KKYA 2E6RA 5SVIA 4FLPA 1BORA 2L0BA 1WE9A 4N4GA 3D1BA 5EWVA 4QEWA 3MDBC 3QZSA 5EYAF 4NRAA 3PURA 5E9YA 3D1DA 5A5QA 5CQ6A 5DKHA 5CUAA 5A81A 5E73A 3FJUB 3I2DA 4TKPB 2JMJA 5D1MB 5D3HA 5EP7A 5AITA 4IOOA 5ACYA 5I83A 2FFWA 4YYMA 3SVFA 5A7CA 4Q0OA 3C5KA 4IR5A 4QQ4A 4I7CA 2I50A 5AD3A 4YATA 5E9KA 4QEVA 1T1HA 4NR8A 4FO9A 4W4UA 3IU5A 5CQ5A 3ASLA 3LJWA 4IR4A 2MUMA 5CY9A 4NUCA 2DVSA 4A9KA 3DWDA 4MEQA 3JVLA 5ETDA 5D3SA 5KTXA 2DATA 4QUTA 3MULA 2KWJA 2LXPC 4L58A 5DKAA 4QSXA 4YYHA 1N87A 4V3LC 5EISA 2JUNA 3P1CA 1IYMA 5IGMA 5LJ1A 3MB4A 1PUOA 4NUDA 2H60A 4QR5A 4UYFB 2R0SA 3O35A 4LR6A 2XP0A 3HMFA 5IGNA 5IGLA 3SOWA 2UZGA 5C13A 5A5RA 2AN6A 3DDTA 4QSTA 5FERA 3L1XA 4N3WA 5DYXA 5DBMA 2EJNA 4CUUA 3T6RA 3T9KA 5L8TA 2L75A 4IOQA 4Y03A 1F68A 2ECNA 2KGGA 1WEVA 5ENBA 5DLXA
chains in the Genus database with same CATH topology
1FBVA 2LGVA 3P1EA 4UP0A 3UV2A 4WZ0A 3RTRB 4HXSA 4OUFA 2LDRA 1JM7B 4O75A 4RVRA 4A9NA 4TU4A 5FB0A 2D8SA 2H0DA 5I88A 4Z1QA 2VJEB 3ZPV1 3M99A 5I7XA 4AP4A 5BT4A 5D3TA 4QF2A 2DVVA 3MQMA 4A9MA 4XY9A 5TDWA 4LDFA 3U5NA 4LADB 3UW9A 4FIPA 2YQMA 3JVMA 4J1PA 3T7LA 3ZYQA 4ZQLA 4YYIA 1VYXA 2XEUA 4QF3A 2D9EA 5I1QA 4A4BA 2YDWA 2YQLA 2OXQC 3IU6A 4J0SA 4XUAA 5G4RA 5I89A 4BW1A 5I3LA 5FG6A 3N9LA 2RO1A 3AADA 4O7BA 4CUQA 4UYDA 3ONIA 1XWHA 4XUBA 4YYDA 3FKMX 2NAAA 2YREA 5A5NA 2KGIA 5KH3A 3G0LA 4LC2A 4R8PK 5TB6A 4NR7A 4NS5A 4XY8A 4HBYA 3DAIA 5A5PA 5DFCA 2KIZA 3UVYA 1HYIA 5AMFA 4A49A 5I7YA 5EVAA 4A9LA 3ZNIA 4IC2A 3HMHA 5KH9A 4MSXA 5F5ZA 4TQNA 4YC9A 5F25A 3MHSA 4PTBA 1Z6UA 5C85A 1K2FA 2Y43A 4WA6A 2DVRA 4HXRA 4HBXA 5KTWA 3N9MA 5AIUA 4LYSA 4YH3A 3P1FA 5EWDA 2EGPA 5G0FA 1WFKA 5CRZA 4YYKA 1ZS5A 1VD4A 2WP1A 2QJ0A 3O33A 5D25A 5EPSA 5EI4A 4KV1A 4C67A 5FE0A 4YYGA 4YYJA 2KWNA 5H85A 4GNGA 5LVQA 4FJCA 3DQVR 4NUEA 3U5PA 5TDRA 4Z6IA 2IDAA 5HFRA 5CUCA 1VFYA 4NYVA 5C4QA 5FH7A 2C2LA 5D1LB 5TABA 5BT5A 5DYCA 1Z2QA 4S3OB 1U6GB 3M62A 1E4UA 1FP0A 3O34A 5DKCA 2M85A 4ALHA 5H1VA 2EODA 4A9OA 2PNXA 4A4CA 3NXBA 2FSAA 2RSDA 3C6WA 4QNSA 5CQ3A 1LDJB 4LZSA 3KNVA 3ZYUA 4HXMA 5A83A 5E9MA 5HRWA 4LLBA 5D26A 2RNWA 5F1LA 2YHNA 2Y1NA 1WGMA 5FB1A 2DX8A 4MR3A 4XI1A 5F62A 2FUIA 5G05B 1WIMA 2VPEA 4CUSA 4WZ3B 5D7XA 5EQ1A 5CS8A 5FE4A 5D0CA 3GG3A 5JI8A 2OSSA 4YY6A 2L43A 4GNDA 2YW5A 1WUGA 4ZUXU 4MR5A 2R10A 5L97A 2EA6A 5FFWA 2YUCA 2YEMA 2K16A 3N9NA 4LYIA 2LGGA 1X4UA 4IC3A 4BBQA 4TZ2A 2KWOA 5LCWB 4QY4A 5E9VA 3RPGB 4AVXA 5CFWA 4QSQA 5A5SA 4CL9A 4TU6A 4QZSA 3TLPA 4IR6A 5EK9A 4YY4A 5AMEA 4PS5A 5EU1A 4CLBA 2ECGA 4KCXA 2LGKA 3N9OA 4ZW1A 2K1JA 5L98A 5DYUA 1WUMA 2YHOA 3DPLR 4A9EA 2YYNA 4HBVA 5ENFA 1JOCA 5COIA 2YQDA 4UYGA 5EWHA 5G4SA 3O7AA 4MR4A 5CTLA 3LQHA 5F63A 2MD7B 5DW1A 2E7OA 5CQ8A 5FDZA 5EICA 2R0VA 1F62A 2YURA 4F3IA 3S92A 5KO4A 4CUPA 2YYRA 4O77A 4TT4A 2GRCA 3JVJA 5FE9A 3ZVZB 4Q6FA 4AUQB 4A9HA 4UIUA 4YBMA 5FE5A 3HMEA 4LZ2A 5EWCA 4NR9A 4TT6A 5HLSA 3QZTA 4KV4A 5D3NA 2YU4A 5I29A 4YBSA 4HBWA 3U5OA 2JRJA 2QIZA 5DY7A 4MVTA 4Q0NA 5DX4A 4UITA 5EGUA 5D3JA 2I8NA 4LYWA 5H1TA 5ENIA 4BHWA 5E74A 4QEUA 2RNXA 5TRBA 4YABA 5CPEA 5EPRA 1WEWA 3UVWA 1WEQA 3UV4A 3ZTGA 5CRMA 1JSPB 4X3GA 3RPGC 4UIYA 5IGKA 1HYJA 5DYAA 4O76A 4ZC9A 4A9IA 2L5EA 2ECVA 2HYED 5ENGA 5HQ7A 2OUOA 3LQJA 2LN0A 3KV6A 4PPEA 2M1RA 5D3LA 4C9ZA 2VJFA 4O71A 5HM0A 3KV5A 2C2VS 3U5JA 4QSWA 2E6SA 4QSVA 5C7NA 2L80A 4R2YA 4WHUA 5LKUA 4GNFA 5LJ2A 5HCLA 5L96A 4GPJA 3I3JA 5FE3A 1WEMA 2M3HA 5DW2A 5HFQA 5F61A 4NQMA 5ENCA 2YT5A 4PCIA 4AKNA 5F1HA 4UIWA 5AD2A 3IHPA 5LKZA 5E9IA 2CSYA 5J3XA 4UP5A 4IR3A 4QB3A 3EB6A 4NXJA 5FFVA 5F60A 5HQ6A 4GB0A 2MD8C 5JG6A 4QUUA 5HRXA 5HEMA 1EQFA 3UVXA 3MXFA 5CQ4A 3LQIA 3N9PA 4QSSA 5I40A 2MNYA 4LZRA 5EA1A 2CT2A 5B79A 4AYCA 3HCUA 4OGJA 3L11A 2E3KA 1RMDA 4R7EA 3D7CA 5HJCA 5DKDA 3LRQA 3O37A 4I7DA 5E9LA 4TZ8A 3UV5A 4FK5A 4CCGX 3HTKC 4LKAA 1JM7A 4HXOA 1E6IA 3U5KA 3LXJA 2RNYA 1CHCA 5CQ7A 3U5MA 2K17A 5CZGA 2OO1A 4LRGA 5FE8A 2RS9B 4B7YC 2F42A 2F6JA 2VJEA 4LJNA 2H0DB 1MM2A 3SOXA 4B86C 2CKLA 2KE1A 4TT2A 5F3AA 5B75A 2LQ6A 3O70A 2LSPB 4NR5A 2R0YA 4CFLA 2G6QA 4QR4A 4A9FA 1N72A 2F6NA 5IIDA 2PUYA 3M63A 3SHBA 5ETBA 2D82A 4WIVA 2MIQA 4QSRA 2I7KA 5ENHA 2ECTA 5E3DA 5IG6A 2JMIA 5A82A 5C87A 4V3KC 4YADA 3GV4A 4HXPA 4O74A 3QZVA 2NXBA 5ENEA 2HDPA 5CUDA 4CA1A 5E3GA 3NG2A 1X0JA 5IBNA 2LV9A 2MNZA 2ECIA 4F52B 4N4HA 3PHDA 4NYWA 4HXLA 5D24A 4OGIA 4QSPA 3HCSA 5DFBA 2VJFB 3ZVYA 3PUQA 4QYDA 5II2A 4QR3A 2MA5A 4IORA 2KTBB 3O36A 4HXKA 5E7DA 3P5OA 4O7EA 2K4DA 4Z1SA 2KREA 2MA6A 2DKWA 4BW2A 4S3OC 3MHHA 5DINA 2L84A 4UIVA 4YBTA 1WILA 2XB1A 5EV9A 5CUBA 5J0DA 3HCTA 4O7FA 2VPGA 5B78A 5C11A 1X4JA 4CUTA 4NRCA 5EPBA 3MUKA 5CQTA 4PCEA 4YAXA 1DVPA 2CSZA 5F2PA 4O64A 4A0CD 4QC3A 5II1A 4MR6A 4WZ2A 4O70A 5CUGA 4P5OB 5LKTA 5F36A 3L1ZB 5C89A 4UI9B 1MM3A 5H1UA 2KFTA 5BT3A 2WP2A 2RI7A 5HELA 5LJ0A 1Z60A 2YW8A 4N4IA 4ALGA 4AYCB 4L7XA 2L5UA 5I86A 4MEOA 4MEPA 5LVRA 5CQAA 2ZETC 2RFJA 3MB3A 3V43A 4LK9A 3AQAA 4X2IA 3KQIA 4I7BA 2JMDA 3Q2FA 5KTUA 2QICA 2YELA 4QBMA 5FE6A 4Z93A 3ZPVE 3Q2EA 5KHMA 5D3PA 1X4IA 4YH4A 2ECWA 4MENA 3UVDA 2VPDA 5FBXA 2YSMA 5JWMA 5B76A 4TYLA 5FG4A 4CURA 5C8GA 1WESA 5HQ5A 3SVGA 1WEUA 4UIZA 5CU8A 5L8UA 2FUUA 4BW4A 5A5OA 2L85A 2CKLB 2Y1MA 5KH7A 1LDKC 4TS8A 2N9GA 5CUEA 3U5LA 5D3RA 4GNEA 4CFKA 5I80A 4A9JA 5LUUA 5A85A 5FE1A 4NRBA 5TCMA 5D1KB 5ENJA 2E7NA 2KYUA 2LGLA 1JM4B 2LXHC 1WEPA 5TBNA 5DLZA 4PKLA 5FFYA 4QYLA 2KU3A 3SVHA 2DWWA 4QSUA 4O7CA 4QC1A 4PY6A 4YK0A 4BJXA 2M6MA 3DWYA 5FEYA 4UYFA 5FG5A 1WEOA 2G43A 2VNFA 4BW3A 3RCWA 2YSJA 5HENA 4DONA 3EB5A 3S91A 4ZDTA 1G25A 4NR4A 2MT5A 5FE7A 3GL6A 4XYAA 3SOUA 3JVKA 4O72A 5FH6A 2BAYA 2MJVB 4J3IA 4YYNA 2G4AA 4N4FA 1ZBDB 1WENA 4E96A 2VP7A 5B8DA 4NQNA 5L99A 4C66A 3FL2A 2VPBA 4O78A 5LKXA 2G45A 2YEKA 5EM3A 4UYHA 4WHWA 5HRVA 3N9QA 5CP5A 1WEEA 4TTEA 4J0RA 4O7AA 5CGPA 4NR6A 3P1DA 3K2JA 5B77A 2KWKA 2LRIC 1V87A 4NN2A 2DVQA 5K29A 5EWWA 5FE2A 2ECJA 4UYEA 3VK6A 5KU3A 2KR4A 5DFDA 5G04B 4NYXA 3G0JA 5E0RA 5FH8A 4Z6HA 5H9MA 4HXNA 4UIXA 2E6RA 4FLPA 1BORA 2L0BA 1WE9A 4N4GA 5EWVA 4QEWA 3QZSA 5EYAF 4NRAA 3PURA 5E9YA 5A5QA 5CQ6A 5DKHA 5CUAA 5A81A 5E73A 3I2DA 4TKPB 2JMJA 5D1MB 5D3HA 5EP7A 5AITA 4IOOA 5ACYA 5I83A 4YYMA 3SVFA 5A7CA 4Q0OA 3C5KA 4IR5A 4I7CA 2I50A 5AD3A 4YATA 5E9KA 4QEVA 1T1HA 4NR8A 4FO9A 4W4UA 3IU5A 5CQ5A 3ASLA 3LJWA 4IR4A 2MUMA 5CY9A 4NUCA 2DVSA 4A9KA 4MEQA 3JVLA 5ETDA 5D3SA 5KTXA 2DATA 4QUTA 3MULA 2KWJA 2LXPC 4L58A 5DKAA 4QSXA 4YYHA 1N87A 4V3LC 5EISA 3P1CA 1IYMA 5IGMA 5LJ1A 3MB4A 4NUDA 2H60A 4QR5A 4UYFB 2R0SA 3O35A 4LR6A 3HMFA 5IGNA 5IGLA 3SOWA 2UZGA 5C13A 5A5RA 2AN6A 5FERA 4QSTA 3L1XA 4N3WA 5DYXA 5DBMA 4CUUA 3T6RA 5L8TA 2L75A 4IOQA 4Y03A 1F68A 2ECNA 2KGGA 1WEVA 5ENBA 5DLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBV A;  2LGV A;  3P1E A;  4UP0 A;  3UV2 A;  4WZ0 A;  3RTR B;  4HXS A;  4OUF A;  2LDR A;  1JM7 B;  4O75 A;  4RVR A;  4A9N A;  4TU4 A;  5FB0 A;  2D8S A;  2H0D A;  5I88 A;  4Z1Q A;  2VJE B;  3ZPV 1;  3M99 A;  5I7X A;  4AP4 A;  5BT4 A;  5D3T A;  4QF2 A;  2DVV A;  3MQM A;  4A9M A;  4XY9 A;  5TDW A;  4LDF A;  3U5N A;  4LAD B;  3UW9 A;  4FIP A;  2YQM A;  3JVM A;  4J1P A;  3T7L A;  3ZYQ A;  4ZQL A;  4YYI A;  1VYX A;  2XEU A;  4QF3 A;  2D9E A;  5I1Q A;  4A4B A;  2YDW A;  2YQL A;  2OXQ C;  3IU6 A;  4J0S A;  4XUA A;  5G4R A;  5I89 A;  4BW1 A;  5I3L A;  5FG6 A;  3N9L A;  2RO1 A;  3AAD A;  4O7B A;  4CUQ A;  4UYD A;  3ONI A;  1XWH A;  4XUB A;  4YYD A;  3FKM X;  2NAA A;  2YRE A;  5A5N A;  2KGI A;  5KH3 A;  3G0L A;  4LC2 A;  4R8P K;  5TB6 A;  4NR7 A;  4NS5 A;  4XY8 A;  4HBY A;  3DAI A;  5A5P A;  5DFC A;  2KIZ A;  3UVY A;  1HYI A;  5AMF A;  4A49 A;  5I7Y A;  5EVA A;  4A9L A;  3ZNI A;  4IC2 A;  3HMH A;  5KH9 A;  4MSX A;  5F5Z A;  4TQN A;  4YC9 A;  5F25 A;  3MHS A;  4PTB A;  1Z6U A;  5C85 A;  1K2F A;  2Y43 A;  4WA6 A;  2DVR A;  4HXR A;  4HBX A;  5KTW A;  3N9M A;  5AIU A;  4LYS A;  4YH3 A;  3P1F A;  5EWD A;  2EGP A;  5G0F A;  1WFK A;  5CRZ A;  4YYK A;  1ZS5 A;  1VD4 A;  2WP1 A;  2QJ0 A;  3O33 A;  5D25 A;  5EPS A;  5EI4 A;  4KV1 A;  4C67 A;  5FE0 A;  4YYG A;  4YYJ A;  2KWN A;  5H85 A;  4GNG A;  5LVQ A;  4FJC A;  3DQV R;  4NUE A;  3U5P A;  5TDR A;  4Z6I A;  2IDA A;  5HFR A;  5CUC A;  1VFY A;  4NYV A;  5C4Q A;  5FH7 A;  2C2L A;  5D1L B;  5TAB A;  5BT5 A;  5DYC A;  1Z2Q A;  4S3O B;  1U6G B;  3M62 A;  1E4U A;  1FP0 A;  3O34 A;  5DKC A;  2M85 A;  4ALH A;  5H1V A;  2EOD A;  4A9O A;  2PNX A;  4A4C A;  3NXB A;  2FSA A;  2RSD A;  3C6W A;  4QNS A;  5CQ3 A;  1LDJ B;  4LZS A;  3KNV A;  3ZYU A;  4HXM A;  5A83 A;  5E9M A;  5HRW A;  4LLB A;  5D26 A;  2RNW A;  5F1L A;  2YHN A;  2Y1N A;  1WGM A;  5FB1 A;  2DX8 A;  4MR3 A;  4XI1 A;  5F62 A;  2FUI A;  5G05 B;  1WIM A;  2VPE A;  4CUS A;  4WZ3 B;  5D7X A;  5EQ1 A;  5CS8 A;  5FE4 A;  5D0C A;  3GG3 A;  5JI8 A;  2OSS A;  4YY6 A;  2L43 A;  4GND A;  2YW5 A;  1WUG A;  4ZUX U;  4MR5 A;  2R10 A;  5L97 A;  2EA6 A;  5FFW A;  2YUC A;  2YEM A;  2K16 A;  3N9N A;  4LYI A;  2LGG A;  1X4U A;  4IC3 A;  4BBQ A;  4TZ2 A;  2KWO A;  5LCW B;  4QY4 A;  5E9V A;  3RPG B;  4AVX A;  5CFW A;  4QSQ A;  5A5S A;  4CL9 A;  4TU6 A;  4QZS A;  3TLP A;  4IR6 A;  5EK9 A;  4YY4 A;  5AME A;  4PS5 A;  5EU1 A;  4CLB A;  2ECG A;  4KCX A;  2LGK A;  3N9O A;  4ZW1 A;  2K1J A;  5L98 A;  5DYU A;  1WUM A;  2YHO A;  3DPL R;  4A9E A;  2YYN A;  4HBV A;  5ENF A;  1JOC A;  5COI A;  2YQD A;  4UYG A;  5EWH A;  5G4S A;  3O7A A;  4MR4 A;  5CTL A;  3LQH A;  5F63 A;  2MD7 B;  5DW1 A;  2E7O A;  5CQ8 A;  5FDZ A;  5EIC A;  2R0V A;  1F62 A;  2YUR A;  4F3I A;  3S92 A;  5KO4 A;  4CUP A;  2YYR A;  4O77 A;  4TT4 A;  2GRC A;  3JVJ A;  5FE9 A;  3ZVZ B;  4Q6F A;  4AUQ B;  4A9H A;  4UIU A;  4YBM A;  5FE5 A;  3HME A;  4LZ2 A;  5EWC A;  4NR9 A;  4TT6 A;  5HLS A;  3QZT A;  4KV4 A;  5D3N A;  2YU4 A;  5I29 A;  4YBS A;  4HBW A;  3U5O A;  2JRJ A;  2QIZ A;  5DY7 A;  4MVT A;  4Q0N A;  5DX4 A;  4UIT A;  5EGU A;  5D3J A;  2I8N A;  4LYW A;  5H1T A;  5ENI A;  4BHW A;  5E74 A;  4QEU A;  2RNX A;  5TRB A;  4YAB A;  5CPE A;  5EPR A;  1WEW A;  3UVW A;  1WEQ A;  3UV4 A;  3ZTG A;  5CRM A;  1JSP B;  4X3G A;  3RPG C;  4UIY A;  5IGK A;  1HYJ A;  5DYA A;  4O76 A;  4ZC9 A;  4A9I A;  2L5E A;  2ECV A;  2HYE D;  5ENG A;  5HQ7 A;  2OUO A;  3LQJ A;  2LN0 A;  3KV6 A;  4PPE A;  2M1R A;  5D3L A;  4C9Z A;  2VJF A;  4O71 A;  5HM0 A;  3KV5 A;  2C2V S;  3U5J A;  4QSW A;  2E6S A;  4QSV A;  5C7N A;  2L80 A;  4R2Y A;  4WHU A;  5LKU A;  4GNF A;  5LJ2 A;  5HCL A;  5L96 A;  4GPJ A;  3I3J A;  5FE3 A;  1WEM A;  2M3H A;  5DW2 A;  5HFQ A;  5F61 A;  4NQM A;  5ENC A;  2YT5 A;  4PCI A;  4AKN A;  5F1H A;  4UIW A;  5AD2 A;  3IHP A;  5LKZ A;  5E9I A;  2CSY A;  5J3X A;  4UP5 A;  4IR3 A;  4QB3 A;  3EB6 A;  4NXJ A;  5FFV A;  5F60 A;  5HQ6 A;  4GB0 A;  2MD8 C;  5JG6 A;  4QUU A;  5HRX A;  5HEM A;  1EQF A;  3UVX A;  3MXF A;  5CQ4 A;  3LQI A;  3N9P A;  4QSS A;  5I40 A;  2MNY A;  4LZR A;  5EA1 A;  2CT2 A;  5B79 A;  4AYC A;  3HCU A;  4OGJ A;  3L11 A;  2E3K A;  1RMD A;  4R7E A;  3D7C A;  5HJC A;  5DKD A;  3LRQ A;  3O37 A;  4I7D A;  5E9L A;  4TZ8 A;  3UV5 A;  4FK5 A;  4CCG X;  3HTK C;  4LKA A;  1JM7 A;  4HXO A;  1E6I A;  3U5K A;  3LXJ A;  2RNY A;  1CHC A;  5CQ7 A;  3U5M A;  2K17 A;  5CZG A;  2OO1 A;  4LRG A;  5FE8 A;  2RS9 B;  4B7Y C;  2F42 A;  2F6J A;  2VJE A;  4LJN A;  2H0D B;  1MM2 A;  3SOX A;  4B86 C;  2CKL A;  2KE1 A;  4TT2 A;  5F3A A;  5B75 A;  2LQ6 A;  3O70 A;  2LSP B;  4NR5 A;  2R0Y A;  4CFL A;  2G6Q A;  4QR4 A;  4A9F A;  1N72 A;  2F6N A;  5IID A;  2PUY A;  3M63 A;  3SHB A;  5ETB A;  2D82 A;  4WIV A;  2MIQ A;  4QSR A;  2I7K A;  5ENH A;  2ECT A;  5E3D A;  5IG6 A;  2JMI A;  5A82 A;  5C87 A;  4V3K C;  4YAD A;  3GV4 A;  4HXP A;  4O74 A;  3QZV A;  2NXB A;  5ENE A;  2HDP A;  5CUD A;  4CA1 A;  5E3G A;  3NG2 A;  1X0J A;  5IBN A;  2LV9 A;  2MNZ A;  2ECI A;  4F52 B;  4N4H A;  3PHD A;  4NYW A;  4HXL A;  5D24 A;  4OGI A;  4QSP A;  3HCS A;  5DFB A;  2VJF B;  3ZVY A;  3PUQ A;  4QYD A;  5II2 A;  4QR3 A;  2MA5 A;  4IOR A;  2KTB B;  3O36 A;  4HXK A;  5E7D A;  3P5O A;  4O7E A;  2K4D A;  4Z1S A;  2KRE A;  2MA6 A;  2DKW A;  4BW2 A;  4S3O C;  3MHH A;  5DIN A;  2L84 A;  4UIV A;  4YBT A;  1WIL A;  2XB1 A;  5EV9 A;  5CUB A;  5J0D A;  3HCT A;  4O7F A;  2VPG A;  5B78 A;  5C11 A;  1X4J A;  4CUT A;  4NRC A;  5EPB A;  3MUK A;  5CQT A;  4PCE A;  4YAX A;  1DVP A;  2CSZ A;  5F2P A;  4O64 A;  4A0C D;  4QC3 A;  5II1 A;  4MR6 A;  4WZ2 A;  4O70 A;  5CUG A;  4P5O B;  5LKT A;  5F36 A;  3L1Z B;  5C89 A;  4UI9 B;  1MM3 A;  5H1U A;  2KFT A;  5BT3 A;  2WP2 A;  2RI7 A;  5HEL A;  5LJ0 A;  1Z60 A;  2YW8 A;  4N4I A;  4ALG A;  4AYC B;  4L7X A;  2L5U A;  5I86 A;  4MEO A;  4MEP A;  5LVR A;  5CQA A;  2ZET C;  2RFJ A;  3MB3 A;  3V43 A;  4LK9 A;  3AQA A;  4X2I A;  3KQI A;  4I7B A;  2JMD A;  3Q2F A;  5KTU A;  2QIC A;  2YEL A;  4QBM A;  5FE6 A;  4Z93 A;  3ZPV E;  3Q2E A;  5KHM A;  5D3P A;  1X4I A;  4YH4 A;  2ECW A;  4MEN A;  3UVD A;  2VPD A;  5FBX A;  2YSM A;  5JWM A;  5B76 A;  4TYL A;  5FG4 A;  4CUR A;  5C8G A;  1WES A;  5HQ5 A;  3SVG A;  1WEU A;  4UIZ A;  5CU8 A;  5L8U A;  2FUU A;  4BW4 A;  5A5O A;  2L85 A;  2CKL B;  2Y1M A;  5KH7 A;  1LDK C;  4TS8 A;  2N9G A;  5CUE A;  3U5L A;  5D3R A;  4GNE A;  4CFK A;  5I80 A;  4A9J A;  5LUU A;  5A85 A;  5FE1 A;  4NRB A;  5TCM A;  5D1K B;  5ENJ A;  2E7N A;  2KYU A;  2LGL A;  1JM4 B;  2LXH C;  1WEP A;  5TBN A;  5DLZ A;  4PKL A;  5FFY A;  4QYL A;  2KU3 A;  3SVH A;  2DWW A;  4QSU A;  4O7C A;  4QC1 A;  4PY6 A;  4YK0 A;  4BJX A;  2M6M A;  3DWY A;  5FEY A;  4UYF A;  5FG5 A;  1WEO A;  2G43 A;  2VNF A;  4BW3 A;  3RCW A;  2YSJ A;  5HEN A;  4DON A;  3EB5 A;  3S91 A;  4ZDT A;  1G25 A;  4NR4 A;  2MT5 A;  5FE7 A;  3GL6 A;  4XYA A;  3SOU A;  3JVK A;  4O72 A;  5FH6 A;  2BAY A;  2MJV B;  4J3I A;  4YYN A;  2G4A A;  4N4F A;  1ZBD B;  1WEN A;  4E96 A;  2VP7 A;  5B8D A;  4NQN A;  5L99 A;  4C66 A;  3FL2 A;  2VPB A;  4O78 A;  5LKX A;  2G45 A;  2YEK A;  5EM3 A;  4UYH A;  4WHW A;  5HRV A;  3N9Q A;  5CP5 A;  1WEE A;  4TTE A;  4J0R A;  4O7A A;  5CGP A;  4NR6 A;  3P1D A;  3K2J A;  5B77 A;  2KWK A;  2LRI C;  1V87 A;  4NN2 A;  2DVQ A;  5K29 A;  5EWW A;  5FE2 A;  2ECJ A;  4UYE A;  3VK6 A;  5KU3 A;  2KR4 A;  5DFD A;  5G04 B;  4NYX A;  3G0J A;  5E0R A;  5FH8 A;  4Z6H A;  5H9M A;  4HXN A;  4UIX A;  2E6R A;  4FLP A;  1BOR A;  2L0B A;  1WE9 A;  4N4G A;  5EWV A;  4QEW A;  3QZS A;  5EYA F;  4NRA A;  3PUR A;  5E9Y A;  5A5Q A;  5CQ6 A;  5DKH A;  5CUA A;  5A81 A;  5E73 A;  3I2D A;  4TKP B;  2JMJ A;  5D1M B;  5D3H A;  5EP7 A;  5AIT A;  4IOO A;  5ACY A;  5I83 A;  4YYM A;  3SVF A;  5A7C A;  4Q0O A;  3C5K A;  4IR5 A;  4I7C A;  2I50 A;  5AD3 A;  4YAT A;  5E9K A;  4QEV A;  1T1H A;  4NR8 A;  4FO9 A;  4W4U A;  3IU5 A;  5CQ5 A;  3ASL A;  3LJW A;  4IR4 A;  2MUM A;  5CY9 A;  4NUC A;  2DVS A;  4A9K A;  4MEQ A;  3JVL A;  5ETD A;  5D3S A;  5KTX A;  2DAT A;  4QUT A;  3MUL A;  2KWJ A;  2LXP C;  4L58 A;  5DKA A;  4QSX A;  4YYH A;  1N87 A;  4V3L C;  5EIS A;  3P1C A;  1IYM A;  5IGM A;  5LJ1 A;  3MB4 A;  4NUD A;  2H60 A;  4QR5 A;  4UYF B;  2R0S A;  3O35 A;  4LR6 A;  3HMF A;  5IGN A;  5IGL A;  3SOW A;  2UZG A;  5C13 A;  5A5R A;  2AN6 A;  5FER A;  4QST A;  3L1X A;  4N3W A;  5DYX A;  5DBM A;  4CUU A;  3T6R A;  5L8T A;  2L75 A;  4IOQ A;  4Y03 A;  1F68 A;  2ECN A;  2KGG A;  1WEV A;  5ENB A;  5DLX A; 
#chains in the Genus database with same CATH topology
 1FBV A;  2LGV A;  3P1E A;  4UP0 A;  3UV2 A;  4WZ0 A;  3RTR B;  4HXS A;  4OUF A;  2LDR A;  1JM7 B;  4O75 A;  4RVR A;  4A9N A;  4TU4 A;  5FB0 A;  2D8S A;  2H0D A;  5I88 A;  4Z1Q A;  2VJE B;  3ZPV 1;  3M99 A;  5I7X A;  4AP4 A;  5BT4 A;  5D3T A;  4QF2 A;  5K3Q A;  2DVV A;  3MQM A;  4A9M A;  4XY9 A;  2YVR A;  5TDW A;  4LDF A;  3U5N A;  3PLW A;  4LAD B;  3UW9 A;  4FIP A;  2YQM A;  3JVM A;  4J1P A;  3T7L A;  4AKI A;  3ZYQ A;  4ZQL A;  4YYI A;  1VYX A;  2XEU A;  4QF3 A;  5SVI B;  2D9E A;  5I1Q A;  4A4B A;  2YDW A;  2YQL A;  2OXQ C;  3SUB A;  3IU6 A;  4J0S A;  4XUA A;  5G4R A;  5I89 A;  4BW1 A;  5I3L A;  5FG6 A;  3N9L A;  3VKG A;  2RO1 A;  3AAD A;  4O7B A;  4CUQ A;  4UYD A;  3ONI A;  1XWH A;  4XUB A;  4YYD A;  3FKM X;  2NAA A;  2YRE A;  5A5N A;  2KGI A;  5KH3 A;  3G0L A;  4LC2 A;  4R8P K;  3ERR A;  4F1P A;  5TB6 A;  4NR7 A;  4NS5 A;  4XY8 A;  4HBY A;  3DAI A;  5A5P A;  1ZKR A;  5DFC A;  2KIZ A;  4O62 A;  3UVY A;  1HYI A;  5AMF A;  2JM3 A;  4A49 A;  5I7Y A;  5EVA A;  4A9L A;  1MBM A;  3ZNI A;  4IC2 A;  3HMH A;  5KH9 A;  4MSX A;  2KKX A;  5F5Z A;  4TQN A;  4YC9 A;  5F25 A;  3MHS A;  4PTB A;  1Z6U A;  5C85 A;  1K2F A;  2Y43 A;  4WA6 A;  2DVR A;  4HXR A;  4HBX A;  5KTW A;  2M13 A;  3N9M A;  5AIU A;  4LYS A;  4YH3 A;  3P1F A;  5EWD A;  3M7K A;  2EGP A;  3FAN A;  5G0F A;  1WFK A;  5CRZ A;  4YYK A;  1ZS5 A;  1VD4 A;  2WP1 A;  2QJ0 A;  3O33 A;  5D25 A;  3FEH A;  5EPS A;  5EI4 A;  4KV1 A;  4C67 A;  5FE0 A;  4YYG A;  4YYJ A;  2KWN A;  5H85 A;  2B0O E;  4GNG A;  5LVQ A;  4FJC A;  3DQV R;  4NUE A;  3U5P A;  5TDR A;  4Z6I A;  2IDA A;  5HFR A;  5CUC A;  1VFY A;  4NYV A;  5C4Q A;  5FH7 A;  2C2L A;  5D1L B;  5TAB A;  5BT5 A;  5DYC A;  1Z2Q A;  4S3O B;  1U6G B;  3M62 A;  1E4U A;  1FP0 A;  3O34 A;  5DKC A;  2M85 A;  4ALH A;  5H1V A;  2EOD A;  4A9O A;  2PNX A;  4A4C A;  3NXB A;  2FSA A;  2RSD A;  3C6W A;  4QNS A;  5CQ3 A;  1LDJ B;  4LZS A;  3KNV A;  3ZYU A;  4HXM A;  5A83 A;  5E9M A;  5HRW A;  4AKH A;  5D26 A;  2XOY A;  2RNW A;  4LLB A;  5F1L A;  2YHN A;  2Y1N A;  1WGM A;  5FB1 A;  2DX8 A;  4MR3 A;  4XI1 A;  5F62 A;  2FUI A;  5G05 B;  1WIM A;  2VPE A;  4CUS A;  4WZ3 B;  4H9D A;  5D7X A;  5EQ1 A;  5CS8 A;  5FE4 A;  5D0C A;  3GG3 A;  5JI8 A;  2OSS A;  4YY6 A;  2L43 A;  4GND A;  2YW5 A;  1WUG A;  4ZUX U;  4MR5 A;  2R10 A;  5L97 A;  2EA6 A;  5FFW A;  2YUC A;  2YEM A;  2K16 A;  3KDE C;  3N9N A;  4LYI A;  2LGG A;  1X4U A;  4IC3 A;  4BBQ A;  4TZ2 A;  2KWO A;  5LCW B;  4QY4 A;  5E9V A;  3RPG B;  4AVX A;  5CFW A;  4QSQ A;  5A5S A;  4CL9 A;  4TU6 A;  4QZS A;  3TLP A;  4IR6 A;  5EK9 A;  4YY4 A;  5AME A;  4PS5 A;  5EU1 A;  4CLB A;  2ECG A;  4KCX A;  2LGK A;  3N9O A;  4ZW1 A;  2K1J A;  5L98 A;  5DYU A;  1WUM A;  2EXU A;  2RR4 A;  2YHO A;  3DPL R;  4A9E A;  2YYN A;  4HBV A;  5ENF A;  1JOC A;  5COI A;  2XOC A;  2YQD A;  4UYG A;  5EWH A;  5G4S A;  3O7A A;  4MR4 A;  5CTL A;  3LQH A;  5F63 A;  2MD7 B;  5DW1 A;  2E7O A;  5CQ8 A;  5FDZ A;  5EIC A;  3LVR E;  2R0V A;  2D8U A;  1F62 A;  2YUR A;  4F3I A;  3S92 A;  5KO4 A;  4CUP A;  2YYR A;  4O77 A;  4TT4 A;  2GRC A;  3JVJ A;  5FE9 A;  3ZVZ B;  4Q6F A;  4AUQ B;  4A9H A;  4UIU A;  4YBM A;  5FE5 A;  3HME A;  4LZ2 A;  5EWC A;  4NR9 A;  4TT6 A;  5HLS A;  3QZT A;  4KV4 A;  5D3N A;  2YU4 A;  5I29 A;  4YBS A;  4HBW A;  3U5O A;  2JRJ A;  2QIZ A;  5DY7 A;  4MVT A;  4Q0N A;  5DX4 A;  4UIT A;  3FAO A;  5EGU A;  5D3J A;  2I8N A;  4LYW A;  5H1T A;  5ENI A;  4BHW A;  5E74 A;  4QEU A;  2RNX A;  5TRB A;  4YAB A;  5CPE A;  5EPR A;  1WEW A;  3UVW A;  1WEQ A;  3UV4 A;  3ZTG A;  5CRM A;  1JSP B;  4X3G A;  3RPG C;  4UIY A;  5IGK A;  1HYJ A;  5DYA A;  4O76 A;  4ZC9 A;  4A9I A;  2L5E A;  2ECV A;  2HYE D;  4Z0R A;  5ENG A;  5HQ7 A;  2OUO A;  3LQJ A;  2LN0 A;  2IQJ A;  3KV6 A;  4PPE A;  2M1R A;  5D3L A;  2E61 A;  4C9Z A;  2VJF A;  4O71 A;  5HM0 A;  2CON A;  3KV5 A;  2C2V S;  3U5J A;  4QSW A;  2E6S A;  4QSV A;  5C7N A;  2L80 A;  4R2Y A;  4WHU A;  5LKU A;  4GNF A;  5LJ2 A;  5HCL A;  5L96 A;  4GPJ A;  3I3J A;  5FE3 A;  1WEM A;  2M3H A;  5DW2 A;  5HFQ A;  5F61 A;  4NQM A;  5ENC A;  2YT5 A;  4PCI A;  4AI6 A;  4AKN A;  5F1H A;  4UIW A;  5AD2 A;  3IHP A;  5LKZ A;  5E9I A;  2CSY A;  5J3X A;  4UP5 A;  4IR3 A;  4QB3 A;  3EB6 A;  3FM8 C;  4NXJ A;  5FFV A;  5F60 A;  5HQ6 A;  4GB0 A;  2MD8 C;  5JG6 A;  4QUU A;  5HRX A;  5HEM A;  1EQF A;  3UVX A;  3MXF A;  5CQ4 A;  4Z0O A;  3LQI A;  4OGC A;  3N9P A;  4QSS A;  5I40 A;  2MNY A;  4LZR A;  5EA1 A;  2CT2 A;  5B79 A;  4AYC A;  3HCU A;  4OGJ A;  3L11 A;  2E3K A;  1RMD A;  4R7E A;  3D7C A;  5HJC A;  3LDY A;  5DKD A;  3LRQ A;  3O37 A;  4I7D A;  5E9L A;  4TZ8 A;  3UV5 A;  4FK5 A;  4CCG X;  3HTK C;  4LKA A;  3H7H A;  1JM7 A;  4HXO A;  1E6I A;  3U5K A;  3LXJ A;  2RNY A;  1CHC A;  5CQ7 A;  3U5M A;  2K17 A;  5CZG A;  2OO1 A;  3VKH A;  4LRG A;  5FE8 A;  2RS9 B;  4B7Y C;  2F42 A;  2F6J A;  2VJE A;  4LJN A;  2H0D B;  1MM2 A;  3SOX A;  4B86 C;  1DCQ A;  2CKL A;  2KE1 A;  4TT2 A;  5F3A A;  5B75 A;  2LQ6 A;  3O70 A;  2LSP B;  2L7P A;  4NR5 A;  2R0Y A;  4CFL A;  2G6Q A;  4QR4 A;  4A9F A;  1N72 A;  2F6N A;  5IID A;  2PUY A;  3M63 A;  3SHB A;  2CSV A;  5ETB A;  2D82 A;  4WIV A;  2MIQ A;  4QSR A;  2I7K A;  5ENH A;  2ECT A;  5E3D A;  5IG6 A;  2JMI A;  5A82 A;  5C87 A;  4V3K C;  4YAD A;  3GV4 A;  4HXP A;  4O74 A;  3QZV A;  2NXB A;  5ENE A;  2HDP A;  5CUD A;  4CA1 A;  5E3G A;  3NG2 A;  1X0J A;  5IBN A;  2LV9 A;  2MNZ A;  2ECI A;  4F52 B;  4N4H A;  2FD4 A;  2MKE A;  3PHD A;  4NYW A;  4HXL A;  2OWA A;  5D24 A;  4OGI A;  4QSP A;  3HCS A;  5DFB A;  2VJF B;  3ZVY A;  3PUQ A;  4QYD A;  5II2 A;  2CRR A;  4QR3 A;  2MA5 A;  5SVY A;  4IOR A;  2KTB B;  3O36 A;  4HXK A;  5E7D A;  3P5O A;  4O7E A;  2K4D A;  4Z1S A;  2KRE A;  2MA6 A;  2DKW A;  4BW2 A;  4S3O C;  3MHH A;  5DIN A;  2L84 A;  4UIV A;  4YBT A;  1WIL A;  2XB1 A;  3LJU X;  5EV9 A;  5CUB A;  5J0D A;  3HCT A;  4O7F A;  2VPG A;  5B78 A;  5C11 A;  1X4J A;  4CUT A;  4NRC A;  5EPB A;  3MUK A;  5CQT A;  4PCE A;  4YAX A;  1DVP A;  2CSZ A;  5F2P A;  4O64 A;  4A0C D;  4QC3 A;  5II1 A;  4MR6 A;  3O47 A;  4WZ2 A;  4O70 A;  5CUG A;  4P5O B;  5LKT A;  5F36 A;  5SVX A;  3L1Z B;  5C89 A;  4UI9 B;  1MM3 A;  5H1U A;  2KFT A;  5BT3 A;  2WP2 A;  2RI7 A;  5HEL A;  5LJ0 A;  1Z60 A;  2YW8 A;  4N4I A;  4ALG A;  4AYC B;  4L7X A;  2L5U A;  2P57 A;  5I86 A;  4MEO A;  4MEP A;  5LVR A;  5CQA A;  2ZET C;  2RFJ A;  3MB3 A;  3V43 A;  4LK9 A;  3AQA A;  4X2I A;  3KQI A;  4I7B A;  2JMD A;  3Q2F A;  5KTU A;  2QIC A;  2YEL A;  4QBM A;  5FE6 A;  4Z93 A;  3ZPV E;  3Q2E A;  5KHM A;  5D3P A;  1X4I A;  4YH4 A;  2ECW A;  4MEN A;  3UVD A;  2VPD A;  5FBX A;  2YSM A;  5JWM A;  5B76 A;  4TYL A;  5FG4 A;  4CUR A;  5C8G A;  1WES A;  5HQ5 A;  3SVG A;  1WEU A;  4UIZ A;  5CU8 A;  5L8U A;  2FUU A;  4BW4 A;  5A5O A;  2L85 A;  2CKL B;  2Y1M A;  5KH7 A;  1LDK C;  4TS8 A;  2N9G A;  5CUE A;  3U5L A;  5D3R A;  4GNE A;  4CFK A;  5I80 A;  4A9J A;  3E2D A;  5LUU A;  5A85 A;  5FE1 A;  4NRB A;  5TCM A;  5D1K B;  5ENJ A;  2E7N A;  2KYU A;  2LGL A;  1JM4 B;  2LXH C;  1WEP A;  5TBN A;  5DLZ A;  4PKL A;  5FFY A;  4QYL A;  2LAU A;  2KU3 A;  3SVH A;  2DWW A;  4QSU A;  3JUE A;  4O7C A;  4QC1 A;  4PY6 A;  4OGE A;  4YK0 A;  4BJX A;  2M6M A;  3DWY A;  5FEY A;  4UYF A;  5FG5 A;  1WEO A;  2G43 A;  2VNF A;  4BW3 A;  3RCW A;  2YSJ A;  5HEN A;  4DON A;  3EB5 A;  3S91 A;  4ZDT A;  1G25 A;  4NR4 A;  2MT5 A;  5FE7 A;  3GL6 A;  4XYA A;  3LVQ E;  3JVK A;  4O72 A;  3SOU A;  5FH6 A;  2BAY A;  2MJV B;  4J3I A;  4YYN A;  2G4A A;  4N4F A;  1ZBD B;  1WEN A;  4E96 A;  2VP7 A;  4AKG A;  4NQN A;  5L99 A;  3Q1D A;  5B8D A;  4C66 A;  3FL2 A;  2VPB A;  4O78 A;  5LKX A;  2G45 A;  2YEK A;  5EM3 A;  4UYH A;  4WHW A;  5HRV A;  2CRW A;  3N9Q A;  5CP5 A;  2DSM A;  1WEE A;  4TTE A;  4J0R A;  4O7A A;  5CGP A;  4NR6 A;  3P1D A;  2XOZ A;  3K2J A;  5B77 A;  2KWK A;  2LRI C;  1V87 A;  4NN2 A;  2DVQ A;  5K29 A;  5EWW A;  5FE2 A;  2ECJ A;  4UYE A;  2DJA A;  3VK6 A;  5KU3 A;  2KR4 A;  5DFD A;  2EGM A;  5G04 B;  4NYX A;  3G0J A;  5E0R A;  5FH8 A;  4Z6H A;  5H9M A;  4HXN A;  4UIX A;  2KKY A;  2E6R A;  5SVI A;  4FLP A;  1BOR A;  2L0B A;  1WE9 A;  4N4G A;  3D1B A;  5EWV A;  4QEW A;  3MDB C;  3QZS A;  5EYA F;  4NRA A;  3PUR A;  5E9Y A;  3D1D A;  5A5Q A;  5CQ6 A;  5DKH A;  5CUA A;  5A81 A;  5E73 A;  3FJU B;  3I2D A;  4TKP B;  2JMJ A;  5D1M B;  5D3H A;  5EP7 A;  5AIT A;  4IOO A;  5ACY A;  5I83 A;  2FFW A;  4YYM A;  3SVF A;  5A7C A;  4Q0O A;  3C5K A;  4IR5 A;  4QQ4 A;  4I7C A;  2I50 A;  5AD3 A;  4YAT A;  5E9K A;  4QEV A;  1T1H A;  4NR8 A;  4FO9 A;  4W4U A;  3IU5 A;  5CQ5 A;  3ASL A;  3LJW A;  4IR4 A;  2MUM A;  5CY9 A;  4NUC A;  2DVS A;  4A9K A;  3DWD A;  4MEQ A;  3JVL A;  5ETD A;  5D3S A;  5KTX A;  2DAT A;  4QUT A;  3MUL A;  2KWJ A;  2LXP C;  4L58 A;  5DKA A;  4QSX A;  4YYH A;  1N87 A;  4V3L C;  5EIS A;  2JUN A;  3P1C A;  1IYM A;  5IGM A;  5LJ1 A;  3MB4 A;  1PUO A;  4NUD A;  2H60 A;  4QR5 A;  4UYF B;  2R0S A;  3O35 A;  4LR6 A;  2XP0 A;  3HMF A;  5IGN A;  5IGL A;  3SOW A;  2UZG A;  5C13 A;  5A5R A;  2AN6 A;  3DDT A;  4QST A;  5FER A;  3L1X A;  4N3W A;  5DYX A;  5DBM A;  2EJN A;  4CUU A;  3T6R A;  3T9K A;  5L8T A;  2L75 A;  4IOQ A;  4Y03 A;  1F68 A;  2ECN A;  2KGG A;  1WEV A;  5ENB A;  5DLX A; 
#chains in the Genus database with same CATH homology
 1FBV A;  2LGV A;  3P1E A;  4UP0 A;  3UV2 A;  4WZ0 A;  3RTR B;  4HXS A;  4OUF A;  2LDR A;  1JM7 B;  4O75 A;  4RVR A;  4A9N A;  4TU4 A;  5FB0 A;  2D8S A;  2H0D A;  5I88 A;  4Z1Q A;  2VJE B;  3ZPV 1;  3M99 A;  5I7X A;  4AP4 A;  5BT4 A;  5D3T A;  4QF2 A;  2DVV A;  3MQM A;  4A9M A;  4XY9 A;  5TDW A;  4LDF A;  3U5N A;  4LAD B;  3UW9 A;  4FIP A;  2YQM A;  3JVM A;  4J1P A;  3T7L A;  3ZYQ A;  4ZQL A;  4YYI A;  1VYX A;  2XEU A;  4QF3 A;  2D9E A;  5I1Q A;  4A4B A;  2YDW A;  2YQL A;  2OXQ C;  3IU6 A;  4J0S A;  4XUA A;  5G4R A;  5I89 A;  4BW1 A;  5I3L A;  5FG6 A;  3N9L A;  2RO1 A;  3AAD A;  4O7B A;  4CUQ A;  4UYD A;  3ONI A;  1XWH A;  4XUB A;  4YYD A;  3FKM X;  2NAA A;  2YRE A;  5A5N A;  2KGI A;  5KH3 A;  3G0L A;  4LC2 A;  4R8P K;  5TB6 A;  4NR7 A;  4NS5 A;  4XY8 A;  4HBY A;  3DAI A;  5A5P A;  5DFC A;  2KIZ A;  3UVY A;  1HYI A;  5AMF A;  4A49 A;  5I7Y A;  5EVA A;  4A9L A;  3ZNI A;  4IC2 A;  3HMH A;  5KH9 A;  4MSX A;  5F5Z A;  4TQN A;  4YC9 A;  5F25 A;  3MHS A;  4PTB A;  1Z6U A;  5C85 A;  1K2F A;  2Y43 A;  4WA6 A;  2DVR A;  4HXR A;  4HBX A;  5KTW A;  3N9M A;  5AIU A;  4LYS A;  4YH3 A;  3P1F A;  5EWD A;  2EGP A;  5G0F A;  1WFK A;  5CRZ A;  4YYK A;  1ZS5 A;  1VD4 A;  2WP1 A;  2QJ0 A;  3O33 A;  5D25 A;  5EPS A;  5EI4 A;  4KV1 A;  4C67 A;  5FE0 A;  4YYG A;  4YYJ A;  2KWN A;  5H85 A;  4GNG A;  5LVQ A;  4FJC A;  3DQV R;  4NUE A;  3U5P A;  5TDR A;  4Z6I A;  2IDA A;  5HFR A;  5CUC A;  1VFY A;  4NYV A;  5C4Q A;  5FH7 A;  2C2L A;  5D1L B;  5TAB A;  5BT5 A;  5DYC A;  1Z2Q A;  4S3O B;  1U6G B;  3M62 A;  1E4U A;  1FP0 A;  3O34 A;  5DKC A;  2M85 A;  4ALH A;  5H1V A;  2EOD A;  4A9O A;  2PNX A;  4A4C A;  3NXB A;  2FSA A;  2RSD A;  3C6W A;  4QNS A;  5CQ3 A;  1LDJ B;  4LZS A;  3KNV A;  3ZYU A;  4HXM A;  5A83 A;  5E9M A;  5HRW A;  4LLB A;  5D26 A;  2RNW A;  5F1L A;  2YHN A;  2Y1N A;  1WGM A;  5FB1 A;  2DX8 A;  4MR3 A;  4XI1 A;  5F62 A;  2FUI A;  5G05 B;  1WIM A;  2VPE A;  4CUS A;  4WZ3 B;  5D7X A;  5EQ1 A;  5CS8 A;  5FE4 A;  5D0C A;  3GG3 A;  5JI8 A;  2OSS A;  4YY6 A;  2L43 A;  4GND A;  2YW5 A;  1WUG A;  4ZUX U;  4MR5 A;  2R10 A;  5L97 A;  2EA6 A;  5FFW A;  2YUC A;  2YEM A;  2K16 A;  3N9N A;  4LYI A;  2LGG A;  1X4U A;  4IC3 A;  4BBQ A;  4TZ2 A;  2KWO A;  5LCW B;  4QY4 A;  5E9V A;  3RPG B;  4AVX A;  5CFW A;  4QSQ A;  5A5S A;  4CL9 A;  4TU6 A;  4QZS A;  3TLP A;  4IR6 A;  5EK9 A;  4YY4 A;  5AME A;  4PS5 A;  5EU1 A;  4CLB A;  2ECG A;  4KCX A;  2LGK A;  3N9O A;  4ZW1 A;  2K1J A;  5L98 A;  5DYU A;  1WUM A;  2YHO A;  3DPL R;  4A9E A;  2YYN A;  4HBV A;  5ENF A;  1JOC A;  5COI A;  2YQD A;  4UYG A;  5EWH A;  5G4S A;  3O7A A;  4MR4 A;  5CTL A;  3LQH A;  5F63 A;  2MD7 B;  5DW1 A;  2E7O A;  5CQ8 A;  5FDZ A;  5EIC A;  2R0V A;  1F62 A;  2YUR A;  4F3I A;  3S92 A;  5KO4 A;  4CUP A;  2YYR A;  4O77 A;  4TT4 A;  2GRC A;  3JVJ A;  5FE9 A;  3ZVZ B;  4Q6F A;  4AUQ B;  4A9H A;  4UIU A;  4YBM A;  5FE5 A;  3HME A;  4LZ2 A;  5EWC A;  4NR9 A;  4TT6 A;  5HLS A;  3QZT A;  4KV4 A;  5D3N A;  2YU4 A;  5I29 A;  4YBS A;  4HBW A;  3U5O A;  2JRJ A;  2QIZ A;  5DY7 A;  4MVT A;  4Q0N A;  5DX4 A;  4UIT A;  5EGU A;  5D3J A;  2I8N A;  4LYW A;  5H1T A;  5ENI A;  4BHW A;  5E74 A;  4QEU A;  2RNX A;  5TRB A;  4YAB A;  5CPE A;  5EPR A;  1WEW A;  3UVW A;  1WEQ A;  3UV4 A;  3ZTG A;  5CRM A;  1JSP B;  4X3G A;  3RPG C;  4UIY A;  5IGK A;  1HYJ A;  5DYA A;  4O76 A;  4ZC9 A;  4A9I A;  2L5E A;  2ECV A;  2HYE D;  5ENG A;  5HQ7 A;  2OUO A;  3LQJ A;  2LN0 A;  3KV6 A;  4PPE A;  2M1R A;  5D3L A;  4C9Z A;  2VJF A;  4O71 A;  5HM0 A;  3KV5 A;  2C2V S;  3U5J A;  4QSW A;  2E6S A;  4QSV A;  5C7N A;  2L80 A;  4R2Y A;  4WHU A;  5LKU A;  4GNF A;  5LJ2 A;  5HCL A;  5L96 A;  4GPJ A;  3I3J A;  5FE3 A;  1WEM A;  2M3H A;  5DW2 A;  5HFQ A;  5F61 A;  4NQM A;  5ENC A;  2YT5 A;  4PCI A;  4AKN A;  5F1H A;  4UIW A;  5AD2 A;  3IHP A;  5LKZ A;  5E9I A;  2CSY A;  5J3X A;  4UP5 A;  4IR3 A;  4QB3 A;  3EB6 A;  4NXJ A;  5FFV A;  5F60 A;  5HQ6 A;  4GB0 A;  2MD8 C;  5JG6 A;  4QUU A;  5HRX A;  5HEM A;  1EQF A;  3UVX A;  3MXF A;  5CQ4 A;  3LQI A;  3N9P A;  4QSS A;  5I40 A;  2MNY A;  4LZR A;  5EA1 A;  2CT2 A;  5B79 A;  4AYC A;  3HCU A;  4OGJ A;  3L11 A;  2E3K A;  1RMD A;  4R7E A;  3D7C A;  5HJC A;  5DKD A;  3LRQ A;  3O37 A;  4I7D A;  5E9L A;  4TZ8 A;  3UV5 A;  4FK5 A;  4CCG X;  3HTK C;  4LKA A;  1JM7 A;  4HXO A;  1E6I A;  3U5K A;  3LXJ A;  2RNY A;  1CHC A;  5CQ7 A;  3U5M A;  2K17 A;  5CZG A;  2OO1 A;  4LRG A;  5FE8 A;  2RS9 B;  4B7Y C;  2F42 A;  2F6J A;  2VJE A;  4LJN A;  2H0D B;  1MM2 A;  3SOX A;  4B86 C;  2CKL A;  2KE1 A;  4TT2 A;  5F3A A;  5B75 A;  2LQ6 A;  3O70 A;  2LSP B;  4NR5 A;  2R0Y A;  4CFL A;  2G6Q A;  4QR4 A;  4A9F A;  1N72 A;  2F6N A;  5IID A;  2PUY A;  3M63 A;  3SHB A;  5ETB A;  2D82 A;  4WIV A;  2MIQ A;  4QSR A;  2I7K A;  5ENH A;  2ECT A;  5E3D A;  5IG6 A;  2JMI A;  5A82 A;  5C87 A;  4V3K C;  4YAD A;  3GV4 A;  4HXP A;  4O74 A;  3QZV A;  2NXB A;  5ENE A;  2HDP A;  5CUD A;  4CA1 A;  5E3G A;  3NG2 A;  1X0J A;  5IBN A;  2LV9 A;  2MNZ A;  2ECI A;  4F52 B;  4N4H A;  3PHD A;  4NYW A;  4HXL A;  5D24 A;  4OGI A;  4QSP A;  3HCS A;  5DFB A;  2VJF B;  3ZVY A;  3PUQ A;  4QYD A;  5II2 A;  4QR3 A;  2MA5 A;  4IOR A;  2KTB B;  3O36 A;  4HXK A;  5E7D A;  3P5O A;  4O7E A;  2K4D A;  4Z1S A;  2KRE A;  2MA6 A;  2DKW A;  4BW2 A;  4S3O C;  3MHH A;  5DIN A;  2L84 A;  4UIV A;  4YBT A;  1WIL A;  2XB1 A;  5EV9 A;  5CUB A;  5J0D A;  3HCT A;  4O7F A;  2VPG A;  5B78 A;  5C11 A;  1X4J A;  4CUT A;  4NRC A;  5EPB A;  3MUK A;  5CQT A;  4PCE A;  4YAX A;  1DVP A;  2CSZ A;  5F2P A;  4O64 A;  4A0C D;  4QC3 A;  5II1 A;  4MR6 A;  4WZ2 A;  4O70 A;  5CUG A;  4P5O B;  5LKT A;  5F36 A;  3L1Z B;  5C89 A;  4UI9 B;  1MM3 A;  5H1U A;  2KFT A;  5BT3 A;  2WP2 A;  2RI7 A;  5HEL A;  5LJ0 A;  1Z60 A;  2YW8 A;  4N4I A;  4ALG A;  4AYC B;  4L7X A;  2L5U A;  5I86 A;  4MEO A;  4MEP A;  5LVR A;  5CQA A;  2ZET C;  2RFJ A;  3MB3 A;  3V43 A;  4LK9 A;  3AQA A;  4X2I A;  3KQI A;  4I7B A;  2JMD A;  3Q2F A;  5KTU A;  2QIC A;  2YEL A;  4QBM A;  5FE6 A;  4Z93 A;  3ZPV E;  3Q2E A;  5KHM A;  5D3P A;  1X4I A;  4YH4 A;  2ECW A;  4MEN A;  3UVD A;  2VPD A;  5FBX A;  2YSM A;  5JWM A;  5B76 A;  4TYL A;  5FG4 A;  4CUR A;  5C8G A;  1WES A;  5HQ5 A;  3SVG A;  1WEU A;  4UIZ A;  5CU8 A;  5L8U A;  2FUU A;  4BW4 A;  5A5O A;  2L85 A;  2CKL B;  2Y1M A;  5KH7 A;  1LDK C;  4TS8 A;  2N9G A;  5CUE A;  3U5L A;  5D3R A;  4GNE A;  4CFK A;  5I80 A;  4A9J A;  5LUU A;  5A85 A;  5FE1 A;  4NRB A;  5TCM A;  5D1K B;  5ENJ A;  2E7N A;  2KYU A;  2LGL A;  1JM4 B;  2LXH C;  1WEP A;  5TBN A;  5DLZ A;  4PKL A;  5FFY A;  4QYL A;  2KU3 A;  3SVH A;  2DWW A;  4QSU A;  4O7C A;  4QC1 A;  4PY6 A;  4YK0 A;  4BJX A;  2M6M A;  3DWY A;  5FEY A;  4UYF A;  5FG5 A;  1WEO A;  2G43 A;  2VNF A;  4BW3 A;  3RCW A;  2YSJ A;  5HEN A;  4DON A;  3EB5 A;  3S91 A;  4ZDT A;  1G25 A;  4NR4 A;  2MT5 A;  5FE7 A;  3GL6 A;  4XYA A;  3SOU A;  3JVK A;  4O72 A;  5FH6 A;  2BAY A;  2MJV B;  4J3I A;  4YYN A;  2G4A A;  4N4F A;  1ZBD B;  1WEN A;  4E96 A;  2VP7 A;  5B8D A;  4NQN A;  5L99 A;  4C66 A;  3FL2 A;  2VPB A;  4O78 A;  5LKX A;  2G45 A;  2YEK A;  5EM3 A;  4UYH A;  4WHW A;  5HRV A;  3N9Q A;  5CP5 A;  1WEE A;  4TTE A;  4J0R A;  4O7A A;  5CGP A;  4NR6 A;  3P1D A;  3K2J A;  5B77 A;  2KWK A;  2LRI C;  1V87 A;  4NN2 A;  2DVQ A;  5K29 A;  5EWW A;  5FE2 A;  2ECJ A;  4UYE A;  3VK6 A;  5KU3 A;  2KR4 A;  5DFD A;  5G04 B;  4NYX A;  3G0J A;  5E0R A;  5FH8 A;  4Z6H A;  5H9M A;  4HXN A;  4UIX A;  2E6R A;  4FLP A;  1BOR A;  2L0B A;  1WE9 A;  4N4G A;  5EWV A;  4QEW A;  3QZS A;  5EYA F;  4NRA A;  3PUR A;  5E9Y A;  5A5Q A;  5CQ6 A;  5DKH A;  5CUA A;  5A81 A;  5E73 A;  3I2D A;  4TKP B;  2JMJ A;  5D1M B;  5D3H A;  5EP7 A;  5AIT A;  4IOO A;  5ACY A;  5I83 A;  4YYM A;  3SVF A;  5A7C A;  4Q0O A;  3C5K A;  4IR5 A;  4I7C A;  2I50 A;  5AD3 A;  4YAT A;  5E9K A;  4QEV A;  1T1H A;  4NR8 A;  4FO9 A;  4W4U A;  3IU5 A;  5CQ5 A;  3ASL A;  3LJW A;  4IR4 A;  2MUM A;  5CY9 A;  4NUC A;  2DVS A;  4A9K A;  4MEQ A;  3JVL A;  5ETD A;  5D3S A;  5KTX A;  2DAT A;  4QUT A;  3MUL A;  2KWJ A;  2LXP C;  4L58 A;  5DKA A;  4QSX A;  4YYH A;  1N87 A;  4V3L C;  5EIS A;  3P1C A;  1IYM A;  5IGM A;  5LJ1 A;  3MB4 A;  4NUD A;  2H60 A;  4QR5 A;  4UYF B;  2R0S A;  3O35 A;  4LR6 A;  3HMF A;  5IGN A;  5IGL A;  3SOW A;  2UZG A;  5C13 A;  5A5R A;  2AN6 A;  5FER A;  4QST A;  3L1X A;  4N3W A;  5DYX A;  5DBM A;  4CUU A;  3T6R A;  5L8T A;  2L75 A;  4IOQ A;  4Y03 A;  1F68 A;  2ECN A;  2KGG A;  1WEV A;  5ENB A;  5DLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...