3R0GA

3d structure of ferric methanosarcina acetivorans protoglobin i149f mutant in aquomet form
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
191
structure length
191
Chain Sequence
KIPGYTYGETENRAPFNLEDLKLLKEAVMFTAEDEEYIQKAGEVLEDQVEEILDTWYGFVGSHPHLLYYFTSPDGTPNEKYLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNVESVPNIGYRYLVAFIYPFTATMKPFLARKGHTPEEVEKMYQAWFKATTLQVALWSYPYVKYGDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural heterogeneity and ligand gating in ferric methanosarcina acetivorans protoglobin mutants.
pubmed doi rcsb
source organism Methanosarcina acetivorans
molecule tags Oxygen binding, oxygen transport
molecule keywords Methanosarcina acetivorans protoglobin
total genus 72
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11563 Protoglobin Protoglobin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 3r0gA00
1VXDA 3BCQB 3SZKA 1GBUA 4L7YA 4AVDA 2EVPA 2MGAA 3ARLA 3M39A 1EBCA 2ZSXA 3QJDB 1Y4GA 1XYEB 2IN4A 3M3BA 2FRFA 1UX9A 4YU3A 4O2GA 5CHRA 4H2LA 1FSLA 2Z6NA 3PI1A 2H8DB 1DXCA 2Z8AA 1RQ3B 4FWYA 1RQ4A 4KMVA 1QSHB 1O1LB 3GQRB 3WTGA 1FDHG 2HBEB 1JP8A 1OBMA 5C6YA 1J7SB 1YG5B 2Z6SA 2ZSQA 4F6IA 1B86B 4HHBA 1NEJA 2ZS0A 1YOGA 1JP6A 3ZH0A 4BJAA 1Y7ZB 1ABSA 3HHBB 3MKBB 5EE4D 4NXCA 4N7OB 2ZSRA 1THBA 1LH1A 4VHBA 2G3HA 3A59B 1NGKA 3ODQB 1UFPA 1Y0CB 5HY8B 1NS9A 1G08B 1PMBA 1PBXA 2GNWA 3ZJPA 4PNJA 1K1KA 1N9FA 1MYMA 2D5ZA 1AJGA 1NQPA 1MLQA 1FSXA 1MNIA 2LH1A 1MBSA 1V4UB 3IA3B 4F69A 1AZIA 1BABA 1MLRA 1O1MB 2MGKA 1FLPA 3NMLA 2CMMA 1CMYB 3LB3A 1FHJB 1HLMA 2HCOB 1DXVA 2DN1A 1GBVB 1COHA 5CN4A 1HABA 3DR9A 1BZRA 2ZLVB 1SI4A 2R4XA 2RAOB 3G46A 5JDOC 1HDAA 1LA6A 1O1JB 2G12A 1HACA 3UHNA 4U8UA 2PGHA 1HDBA 1GDLA 5E83A 1FAWA 1YFFA 1V07A 4HSWA 1OUTB 1C7CB 1YGDA 1HGAA 1S5YB 2VEBA 1VXAA 1Z8UB 1CQ2A 1Y4QA 1CPWA 2GTLC 1BIJB 1JPBA 3HEOA 2ZS1D 1YIHA 1YENA 2MHBA 1DXUA 1JEBB 3IXFA 1V4WB 4F4OA 2MGBA 3ZJLA 1ABYA 1BABB 3UH6A 3H58A 1G09A 3PT8B 1X9FC 3WR1B 4DC7A 3S65A 1ABWA 4UZVA 4L2MA 1CG5B 1CBLA 3NMMA 4NZIA 2E2YA 2LHBA 2GNVA 1J7SA 4C0NA 1GDJA 1LH2A 4IT8A 1N9XA 4MQKA 2HBEA 1IRDB 1AJ9B 3ODQA 4FH7A 2BMMA 5CHQA 3KMFC 3PT7A 2G0SA 1MBIA 1X3KA 1RQ3A 3QQQA 2QMBA 2H35B 5JDOD 3K9ZA 4DC8A 1MLFA 1O1KB 1MGNA 2ZSTA 3MYMA 1HRMA 2QLSA 1DLYA 1XYEA 4N8TB 2NSRA 1U7RA 1CQXA 5CN9A 1C7BA 4OODA 2V1KA 1O1NA 2MGGA 1QPWA 1B86A 1UVXA 1YG5A 2GRZA 2G14A 3D1KB 1MWDA 3ZOLA 1NIHA 3UHRA 1J3FA 2XKIA 2V1IA 5MBNA 1RQ4B 1SDKA 1Y0DA 1MYIA 1T1NB 1XZVA 1NXFA 2C0KA 3K8BA 1CG8A 1A9WE 1MBAA 3BJ3B 1NPFA 1X9FD 1Y09A 1OFJA 1UIWA 2ZLTA 3ZJQA 3UH5A 3AT6B 4TYXA 3MOUA 1LJWA 3HF4A 4B3WA 2SPNA 1YE2B 3PI9B 3B75B 1QXEB 3DHRB 1VWTB 3TM3A 1YMBA 5D1VA 1YE0B 1S69A 4ZVBA 1JZKA 2GKMA 5CN8A 1MLNA 5AZRA 2HHEB 105MA 4FC3B 1YHUB 1RPSB 1RSEA 1J7WA 1Y8HA 3QJCA 1MTJA 1K0YA 1V9QA 3RJNB 1CP5A 1YVTA 1BBBB 4X0LA 4ODCB 2GTLB 1S0HB 2HBDA 3AT6A 3V2VA 1HV4B 1MLUA 1XZUA 1C40A 1UX8A 3G4YA 3PI8B 1HDSB 3BJ1A 1VXCA 1CIKA 1HGCA 3LQDB 3UHBA 1B0BA 5KERB 1QSIA 1XZVB 1CLSA 3HXNB 1A01B 1T1NA 1SDKB 1MYJA 2HHBA 1H97A 1NIHB 4UURA 2R50A 4DWTA 2D2NC 1HBHA 1Y7GA 2R1HB 4ZVAA 1BJEA 1Y22B 2DHBA 1MKOA 1YCBA 6HBWB 3IC2A 1HCOA 3A0GB 3V2ZA 5SW7B 1Y7DB 1XZ5B 1BZ6A 2BW9M 1JF3A 5CMVA 1LH3A 1O1KA 1Y4FB 4NK1A 1Y0AB 1HBBA 1O16A 4M4AB 2R4ZA 2XKHA 1V5HA 1EMYA 1IRDA 3OJ1A 1SDLA 2BLJM 1BZ0A 5ILPA 1HCOB 2NSSA 4N7PB 1OJ6A 3HEPA 1HBHB 2DN2A 1LHSA 2ZWJA 5CN6A 3CIUA 1Y4RA 2W6WA 4PQCA 2W72C 5JGGA 3HXNA 3ZJIA 4F6DA 1MLJA 3UHHA 2HZ3A 1HBSB 2HBSB 1YMAA 3UHIA 1JEBA 1DXUB 1VXHA 1UC3A 1YEUB 1GZXA 5EQMA 3G4UA 2V1EA 3OZUA 1MLGA 1BIJA 2V1FA 4KMWA 2WTGA 1JL6A 3UBCA 4MQCA 2ZSOA 3LHBA 4IROA 3NFEB 5D5RA 2D2MC 4X0LB 1HBIA 3LB1A 1C7DB 1DKEB 3S1JA 3MVCA 3GOUB 1HDBB 2HBCA 1DO4A 2HBGA 2D60B 3LR9A 1SHRB 1EWAA 2VLZA 1CH9A 1SI4B 5CNFA 4F6BA 3MBAA 5ILRA 1GBVA 1Y4BB 3ED9A 3H57A 1Y5JA 1Y35A 1R1XB 2GDMA 1Y2ZB 3DHRA 1URYA 2FALA 1Y4VA 3NL7A 1DO1A 3UI0A 1Y8WA 1FSXB 3MJPB 1S5XB 2MYEA 2G0VA 1JP9A 3GQPB 1GLIB 3E5IA 1PBXB 4WJGA 1YHRA 1CP0A 3QM5A 3WHMA 1J52A 2AUQA 4NI1A 3R5IB 1QPWB 1BZZB 1TESA 1YEVA 1CH2A 4U8UD 1RTXA 3FS4B 2HHDB 1O1NB 1HSYA 4C44A 3UGZA 3PI4A 1C7BB 2B7HB 3FH9A 3WCVC 1YEVB 4G51A 1NWIA 1BZZA 3OGBA 2O5QX 1F65A 1DUKA 3DUTB 3IC0A 2QMBB 2MB5A 1Y31A 2LH5A 2QSPA 4HSXA 3WCUC 4FWXA 3SDHA 2ZT1A 1UT0A 3AG0A 3GQPA 3FH9B 3UH3A 3WR1A 2ZFBB 1M6CA 3QJDA 1Y46B 3FS4A 3ZJNA 1Q1FA 3WCTD 3S48C 1F63A 1IRCA 4F4OB 1CH1A 1R1XA 1DWSA 4SDHA 1Y5JB 1AJHA 1A4FB 1W92A 3UH7A 3EDAA 1Y4QB 2V1JA 1GLIA 3OK5A 2DXMA 2D60A 1OFKA 2VYWA 1LFZA 2EKTA 1Y8WB 4N7NA 1Y4VB 1F5PA 1HACB 1NS6A 5F0BA 3U3EA 1Y2ZA 5CNCA 2RAOA 1G0AB 1LFTA 2AV3A 1I3DA 4ROLB 1YDZA 1BZPA 4OF9A 5AZQA 2RI4B 5F2AA 1GZXB 3LR7A 4KN3A 1EW6A 1YVQA 3WCUB 1KR7A 1G9VB 1CO8A 2R4YA 2FAMA 3KUNA 5EYSA 1JZMA 2AURA 1WLAA 1V4UA 1MWCA 1Y83B 1DKEA 3UHGA 2M6ZB 1NQPB 1OR4A 1HLBA 1JW8A 3VRGA 3QQRA 3E55A 4MQCB 5KKKA 1RVWA 4F68A 1MOBA 4TWVA 4KJTA 4GZGA 1QXDA 2SPMA 5E6EA 1LUEA 3OO4B 2GL3A 3UHXA 2ZLXB 3SDNA 3P5QA 1IWHA 4JYQA 3UBVA 107MA 4MQIB 2GTLD 1SPGA 1IBEB 2BNLA 1GVHA 5SW7A 2GKNA 1XXTB 1YZIB 2ZS0B 2V1GA 5ILEA 1BINA 2OIFA 1N9HA 1BZ0B 1ASHA 4TWUA 1YCAA 3EU1A 4MQGB 1CO9A 1YGFB 2GRFA 2EKUA 3G52A 1O1OA 1HBBB 1RTEA 2H8DA 4MPMA 3ZJRA 1CLSB 2LH6A 1M6MA 2Z85A 5KERA 3EOKA 3ARJA 1JF4A 3WFWA 3VREA 1ECNA 3UHUA 1Y0WA 5CNBA 1HV4A 3HRWA 4YU4B 2H8FA 3A0GA 4WJG1 1MKOB 1YMCA 1MNJA 1DWTA 1H1XA 4ODCA 1EBTA 1BBBA 2HHBB 1K0YB 1Y83A 1GBUB 2MGFA 3QJCB 1A00A 1J3YA 5M3SA 1HGCB 1V4XA 3BJ1B 1HDSA 1MOAA 3WCWD 1LTWA 3GKVB 1RQAB 1VXGA 2ZS1C 2EB9A 2HBDB 3A9MA 3PIAA 3D17A 4ROLA 3MJUB 4XDIA 2XYKA 1J40B 1G0AA 1LFTB 5C6EB 3NG6A 1KD2A 3B75A 3MJUA 1ECAA 1HBAB 3GKTA 1XZ2A 3UHWA 1YVTB 1A3OB 1LFZB 3VAUA 4AVEA 7HBIA 2D6CA 1Y09B 3GKVA 2DXMB 2ZFOB 3HYUA 1J3YB 2HZ1A 3QZXA 2BWHA 1LFYB 1XZ4A 1YEQB 2MYAA 3D1AB 1BUWA 1XZ7A 1QXEA 3PI9A 1Y46A 1LJWB 4YU4A 1UIWB 1A9WA 2SPOA 3VREB 4MXLA 1JDOA 3QM6A 3EOKB 1XY0B 3K8BB 2QSSA 3ONZA 3M3AA 5ILMA 1Y0DB 2MGJA 2MGEA 2QSPB 1G0BB 4MQGA 3QM7A 1Y45A 1Y7CB 2W72A 1MOHA 2NRMA 3GDJB 2G0XA 1Y5KA 2OLPA 3D1KA 1NZ4A 1X9FA 1V75A 1ABWB 4UIQA 3TLDA 3S65B 4PQ6A 1MYFA 1KFRA 1IBEA 3VHBA 3OVUC 3QM9A 1G09B 2LH2A 3EDBA 4XS0B 3R5IA 1M9PA 1VHBA 1XQ5A 3G4WA 1V4WA 1IDRA 3VRFA 1L2KA 3WFTA 3WHMB 1AJ9A 5E6EB 4B4YA 3ECZA 3UHCA 1LH5A 1S5YA 3PELB 1IT3A 1A6MA 1Y5FA 4HRRA 3O89A 4M4BA 1DO3A 4MU5A 4ROMA 3S1IA 3G4QA 2LH7A 4QAUA 3NL7B 5E83B 3WCTA 1MLMA 3WFUA 1HDAB 1LA6B 1MTIA 1ABYB 1O1JA 3A2GA 5JDOE 109MA 4F6GA 2MHBB 5EE4C 1YIHB 1DXVB 2MYDA 1GCVB 1MNHA 1VXBA 1VXEA 1OUTA 3PI2A 2D5XA 3WCTB 1QI8B 1MWBA 1FAWB 1YFFB 3ASEA 4MQJB 1Y8KB 1QI8A 3GK9A 3NFEA 2PGHB 4U8UB 4HRRB 2QRWA 2QU0A 1K1KB 2VHBA 2ZLUB 2ZS1A 2ZLVA 1Y8IA 2MGHA 3A5GA 5HBIA 1HABB 2WY4A 1GCVA 2DN1B 3OZWA 3OO5A 1FHJA 6HBIA 3WCTC 3UHEA 3GYSA 3UHTA 1M9PB 1S56A 4N7OA 5HLUA 2MGLA 2O5LX 1Y4RB 1XCHA 3CIUB 1TU9A 3MN0A 5JOMA 3UHSA 1Y7ZA 2AA1A 2MGIA 2ZSSA 4O4ZA 2D5ZB 1X9FB 1DTIA 2OH9A 4HHBB 2DC3A 2JHOA 4O35A 2MYCA 3E4NA 1Y31B 1G0BA 1LH7A 1YHEA 2D2MB 1Y0AA 2QSSB 3ONZB 3IC0B 1MBCA 3LB2A 1XQ5B 4XS0A 4YU3B 4O1TA 1MTKA 1U7SA 2MBWA 1JY7A 2B7HA 1DWRA 1A6NA 1UVYA 1BUWB 1XZ7B 1HHOA 4H07A 3ZJOA 2W72B 2AUOA 1O1LA 3GQRA 3WTGB 1DLWA 2PEGB 3CY5A 4MAXA 3ZJSA 3SZKB 3A5AA 1LH6A 1FN3B 3AQ5A 3WCVB 2Z6NB 1MZ0A 2R4WA 2O58X 1QSIB 1DM1A 2ZT4A 5HLXA 1Y4GB 1YEOA 1HBAA 3A5BA 3D4XA 3D1AA 2MGMA 4H0BA 2W6VB 4MXKA 5JDOF 1A6KA 1O1IA 3PIAB 1Y35B 1XZ4B 4L7YB 1OR6A 2EF2A 1RQAA 1NAZA 1YHUA 1J7YA 4F6FA 3ZJJA 3RGKA 1FDHA 3GOUA 1A3OA 2D2ND 4MBNA 1C7DA 4FH6A 4IROB 2BK9A 2IG3A 5EYJA 1A3NB 2MGCA 1YE2A 3DHTB 1BVDA 1WMUA 2MGDA 112MA 3HC9A 3HRWB 1Y0WB 1GCWA 1YIEA 1YEOB 1SPEA 4NXAA 3QZZA 3G4RA 1Y0TA 2VLYA 1J41B 2GRHA 3BOMA 3ZJHA 1A00B 5JGGB 3WCVA 1S61A 4O4TA 5B85A 2R80B 4HRTA 3UHKA 108MA 1A0ZB 4ILZA 1Y85B 3EU1B 2OHAA 1CH5A 5EV5A 4N7PA 1MYTA 2AV0A 1MODA 3S66A 1YHUD 1SDLB 3E5OA 1JY7B 4N8TA 1BZ1B 4M4AA 2QLSB 1JZLA 3HENA 3WCPB 2YRSA 2H35A 3WCPA 2D2MA 3P5QB 3AQ9A 5HAVA 2VEEA 4NI0A 1XZ5A 4MQKB 5EOHA 3OO4A 1YH9A 2ZSPA 103MA 3IC2B 111MA 1A6GA 1NZ3A 2DHBB 4ESAB 3QJEA 1XXTA 1RVWB 1CG5A 1YZIA 110MA 3UHDA 2O5MX 2AA1B 3OZVA 2WTHA 1Y85A 1A0ZA 1MBOA 2M6ZA 1SWMA 1IT2A 1SPGB 2R80A 4MQIA 3PT8A 3GQGA 3UHZA 1G9VA 4PQBA 1J41A 1YVQB 3WCUA 1YENB 1WVPA 2DN3B 1XZUB 3OO5B 2ZLXA 2RI4A 2OH8A 2GLNA 1QXDB 3DHTA 1NZ2A 2ZLUA 1S0HA 1HBGA 2QU0B 1YGDB 1C7CA 2ZT3A 3TM9A 1OUUA 1JWNA 3AT5A 1Y8KA 1I3EA 4MQJA 2BLHA 1LFVB 1GJNA 3QM8A 2D5XB 2ZFOC 1MBNA 4FC3A 1HGBA 3GLNA 3KUOA 1COHB 2NRLA 1DUOA 5HLQA 5CNEA 1ITHA 1A0UA 1CMYA 106MA 1O1IB 1VWTA 5HU6A 3D4XB 102MA 101MA 3UHVA 1YHUC 4M4BB 2FRKX 2XKGA 3BJ3A 1CG8B 3UHQA 1ECOA 1CIOA 1VREA 1YOHA 1NS9B 2VYYA 1R1YB 1FN3A 3UGYA 3CY5B 2PEGA 4MQHA 1A4FA 1VRFA 2BKMA 1Y4PA 4HBIA 3VRFB 1MYZA 3A59A 2W31A 1HHOB 1MLOA 3W4UB 3DUTA 5B84A 1IOPA 2FRJX 2EB8A 3HHBA 3MKBA 2ZSZA 2ZT2A 2ZFBA 1CBMA 3LB4A 1NWNA 1HBRB 1DO7A 1MDNA 2W6YA 3AQ6A 1Y5KB 1YHEB 1Y45B 3PT7B 5E29B 1QSHA 1YHRB 2SPLA 5E29A 1N9IA 2AUPA 2ZS0C 1MBDA 1MCYA 3RJ6A 4G51B 3NMMB 3ORDA 1JL7A 1HBRA 3MJPA 4G1VA 4U8UC 2HHDA 1ECDA 4NI1B 5HU6B 3W4UA 1YEQA 3GYSB 3ECXA 2LH3A 1Y4PB 1LFYA 4MQHB 1MLHA 3BCQA 1MNOA 1R1YA 4G1BA 2MYBA 1Y8IB 2VRYA 2ZS1B 3HYUB 3WI8A 1D8UA 1HGAB 1SHRA 2QFKA 2G0RA 2VM0A 2HBCB 1S5XA 1LFLA 1O1PB 4FWZA 1LFVA 5EUIB 4NS2A 5IKSA 2EVKA 1CH4A 3WFXA 3ECLA 1OUUB 3QMAA 3NG6B 1LFQA 5C6EA 1J40A 2QFNA 2G11A 2ZS0D 1A0UB 1Y4BA 2HCOA 3QJBB 3ZHWA 1LHTA 3AQ8A 1HGBB 2V1HA 2HBSA 1DXTB 3KMFA 1O1MA 2O5BX 3GQGB 2D2MD 104MA 3AT5B 4ROMB 5CN5A 1Y5FB 2ZLWA 3PELA 4ESAA 4F6JA 1J3ZA 1G08A 2H8FB 1CH7A 1URVA 1Y0CA 2VLXA 5HY8A 5EU2A 1CH3A 3D7OA 2DN3A 3UHYA 4NI0B 1YEUA 5CN7A 3K3UA 3ARKA 3G53A 1HBSA 2D2NB 1YOIA 1F5OA 2HBFB 3R0GA 1MLKA 2Z6TA 1THBB 2O5OX 5MBAA 2KSCA 1NZ5A 1O1OB 1GDIA 3WCVD 1DTMA 1YGFA 1Y7DA 2ZT0A 5CNGA 1V75B 2DN2B 3WCWB 2G10A 6HBWA 3BJ2B 1NEJB 3QJEB 4WCHD 1Y22A 3BJ2A 2R1HA 3WCWA 1YH9B 3WCUD 3GDJA 5AB8A 1Y7CA 1MLLA 2VYZA 2W6XA 4JACA 1A01A 1Y4FA 2YRSB 3G4VA 1FCSA 2G0ZA 4H2LB 2HBFA 3BOMB 1IWHB 2D2NA 1XY0A 3MYNA 1X46A 3LQDA 4MBAA 3BA2A 1BZ1A 1MNKA 1VXFA 1MLSA 2ZFOD 4LPIA 1C40B 3D7OB 1BVCA 4DWUA 5EETA 3AQ7A 3S66B 2BLIA 1MYGA 2OHBA 1J3ZB 1Y01B 1Y7GB 4NK2A 2ZLWB 1HJTA 1MYHA 3PI3A 3VRGB 2FRIX 4HRTB 3O7NA 1MOCA 3ZOMA 1UMOA 1DXTA 2ZSYA 2ZFOA 1Y0TB 2HHEA 3PI8A 5KDQB 3WCWC 3QJBA 2O5TX 1GCWB 1YIEB 3ZJMA 2ZSNA 1WMUB 1YE0A 1YDZB 1XZ2B 1LFQB 1A3NA 2W6VA 1KD2B 1GDKA 2GTLA 1NS6B 3D17B 3HF4B 1DXDA 4N7NB 5EUIA 1O1PA 2NX0A 1LFLB 2ZLTB 1J7WB 1S6AA 1Y8HB 5KDQA 1RPSA 1V4XB 1J7YB 1UFJA 1NPGA 3M38A 2O5SX 2HZ2A 5CNDA
chains in the Genus database with same CATH superfamily
3BRPB 1VXDA 3BCQB 3SZKA 1GBUA 4L7YA 4AVDA 2EVPA 2MGAA 3ARLA 3M39A 1EBCA 2ZSXA 3QJDB 3NUHB 1Y4GA 1XYEB 2IN4A 3M3BA 2FRFA 1UX9A 4YU3A 4O2GA 5CHRA 4H2LA 1FSLA 2Z6NA 3PI1A 2H8DB 1DXCA 2Z8AA 1RQ3B 4FWYA 4F0UA 1RQ4A 4A8MP 4KMVA 1QSHB 1O1LB 3GQRB 3WTGA 1FDHG 2HBEB 2V8AB 1JP8A 1OBMA 5C6YA 1J7SB 1YG5B 2Z6SA 2ZSQA 4F6IA 1B86B 4HHBA 1NEJA 1HHTP 2ZS0A 1YOGA 1JP6A 3ZH0A 4BJAA 1Y7ZB 1ABSA 3HHBB 3MKBB 5EE4D 4NXCA 4N7OB 2ZSRA 1UVIA 1THBA 1LH1A 4VHBA 2X49A 1JBOA 2G3HA 3A59B 1NGKA 3ODQB 1UFPA 4ZIZA 1Y0CB 5HY8B 1NS9A 1G08B 1PMBA 1PBXA 2GNWA 3V57A 3ZJPA 4PNJA 1K1KA 1N9FA 1MYMA 2D5ZA 1EYXA 1MDTA 1AJGA 1UVJA 1NQPA 1MLQA 1FSXA 1MNIA 2LH1A 1MBSA 1V4UB 3IA3B 4F69A 1AZIA 1BABA 1MLRA 1O1MB 2MGKA 1FLPA 3NMLA 2CMMA 1CMYB 3LB3A 1FHJB 1HLMA 2HCOB 4GXEA 2J96A 1DXVA 2DN1A 1GBVB 4ERVA 1COHA 5CN4A 1HABA 3DR9A 1BZRA 2ZLVB 1SI4A 2R4XA 2RAOB 3G46A 5JDOC 1HDAA 1LA6A 1O1JB 2G12A 1HACA 3UHNA 4U8UA 2PGHA 1HDBA 1GDLA 5E83A 1FAWA 1YFFA 1V07A 4HSWA 1OUTB 1C7CB 1YGDA 1EYXB 1HGAA 1S5YB 2VEBA 1VXAA 1Z8UB 1CQ2A 4A8OA 1Y4QA 1CPWA 2GTLC 1BIJB 1JPBA 3HEOA 2ZS1D 1YIHA 1YENA 2MHBA 1DXUA 1JEBB 2UULC 3IXFA 1V4WB 4F4OA 2MGBA 3ZJLA 1ABYA 1BABB 3UH6A 3H58A 1G09A 3PT8B 1X9FC 3WR1B 4DC7A 1B33B 3S65A 3V58A 1ABWA 4UZVA 4L2MA 1CG5B 1CBLA 3NMMA 4NZIA 2E2YA 2LHBA 2GNVA 1J7SA 4C0NA 1GDJA 1LH2A 4IT8A 1N9XA 4ZIZB 4MQKA 2HBEA 1IRDB 1AJ9B 1KTPA 3ODQA 4FH7A 2BMMA 5CHQA 3KMFC 3PT7A 2G0SA 1MBIA 3MWNA 1X3KA 1RQ3A 3QQQA 2QMBA 2H35B 5JDOD 3K9ZA 4DC8A 1MLFA 3PMCA 1O1KB 1A87A 1MGNA 2ZSTA 3MYMA 1HRMA 2QLSA 1DLYA 1XYEA 4N8TB 2NSRA 1U7RA 1CQXA 5CN9A 1C7BA 3GIOA 4OODA 2V1KA 1O1NA 2MGGA 1QPWA 1B86A 1UVXA 1YG5A 2GRZA 2G14A 3D1KB 1MWDA 2V8AA 3ZOLA 4A8YA 1NIHA 3UHRA 1J3FA 2XKIA 2V1IA 5MBNA 1RQ4B 1SDKA 1Y0DA 1MYIA 1T1NB 1HA7B 1XZVA 1NXFA 2C0KA 3K8BA 1CG8A 1A9WE 1MBAA 3BJ3B 1NPFA 1X9FD 1Y09A 1OFJA 1UIWA 2ZLTA 4Z8KB 3ZJQA 3UH5A 3AT6B 4TYXA 3MOUA 1LJWA 3HF4A 4B3WA 2SPNA 1YE2B 3PI9B 3B75B 1XF6C 1QXEB 3DHRB 1VWTB 3TM3A 1YMBA 3O2CA 5D1VA 1YE0B 1S69A 4ZVBA 1JZKA 1LIAA 2GKMA 5CN8A 1MLNA 5AZRA 2HHEB 105MA 4FC3B 1CPCA 1YHUB 1RPSB 1RSEA 3L0FB 1J7WA 1Y8HA 3QJCA 1MTJA 1K0YA 1V9QA 1YVTA 1CP5A 3RJNB 1BBBB 4X0LA 4ETUA 4ODCB 1QGWC 2GTLB 1S0HB 1CIIA 2HBDA 3AT6A 3V2VA 1HV4B 1MLUA 1XZUA 4Z8KA 1C40A 1UX8A 3G4YA 3PI8B 1HDSB 3BJ1A 1VXCA 1CIKA 1HGCA 3LQDB 3UHBA 1B0BA 5KERB 1QSIA 1XZVB 1CLSA 3HXNB 2C7LA 1A01B 1T1NA 5AQDM 1SDKB 1MYJA 2HHBA 1H97A 1NIHB 4UURA 2R50A 1F0LA 4DWTA 2D2NC 1HBHA 1Y7GA 2R1HB 4ZVAA 1BJEA 1Y22B 2DHBA 1MKOA 1YCBA 6HBWB 3IC2A 1HCOA 3A0GB 3V2ZA 5SW7B 2DKDA 1Y7DB 1XZ5B 1BZ6A 2BW9M 1JF3A 5CMVA 1LH3A 1O1KA 1Y4FB 4NK1A 1Y0AB 1HBBA 1O16A 4M4AB 2R4ZA 2XKHA 1V5HA 4TMAB 1EMYA 1IRDA 3OJ1A 1SDLA 2BLJM 1BZ0A 5ILPA 1HCOB 2NSSA 4N7PB 1OJ6A 3HEPA 1HBHB 2DN2A 1LHSA 2ZWJA 5CN6A 3CIUA 1Y4RA 2W6WA 4PQCA 2W72C 2C7LB 4A8SA 5JGGA 3HXNA 2JL9A 3ZJIA 4F6DA 1MLJA 3UHHA 2HZ3A 1HBSB 2HBSB 1YMAA 3UHIA 1JEBA 1DXUB 1VXHA 1UC3A 1YEUB 1GZXA 5EQMA 2C7KB 3G4UA 2V1EA 3OZUA 1MLGA 1BIJA 2V1FA 4KMWA 2WTGA 4A8WA 1JL6A 3UBCA 4MQCA 2ZSOA 3LHBA 4IROA 3NFEB 5D5RA 2D2MC 4X0LB 1HBIA 3LB1A 1C7DB 1DKEB 3S1JA 3MVCA 3GOUB 1HDBB 2HBCA 1DO4A 2HBGA 2D60B 3LR9A 1SHRB 1EWAA 1HI8A 2VLZA 1CH9A 1SI4B 5CNFA 4F6BA 3MBAA 5ILRA 1GBVA 1Y4BB 3ED9A 3H57A 1Y5JA 1Y35A 1R1XB 2GDMA 1F99B 1Y2ZB 3DHRA 1URYA 2FALA 1Y4VA 3DBJB 3NL7A 1DO1A 3UI0A 1Y8WA 1FSXB 3MJPB 1S5XB 2MYEA 2G0VA 1JP9A 1B8DB 3GQPB 1GLIB 3E5IA 1PBXB 4WJGA 1HA7A 1YHRA 1CP0A 3QM5A 3WHMA 1J52A 2AUQA 3GUQA 4NI1A 3R5IB 1QPWB 1BZZB 1TESA 1YEVA 1CH2A 4U8UD 1RTXA 3FS4B 2HHDB 1O1NB 1HSYA 4C44A 3UGZA 3PI4A 1C7BB 2B7HB 3FH9A 3WCVC 1YEVB 4G51A 1NWIA 1BZZA 3OGBA 2O5QX 1F65A 1DUKA 3DUTB 3IC0A 2QMBB 2MB5A 1Y31A 2LH5A 1DDTA 2QSPA 4HSXA 3WCUC 4FWXA 3SDHA 5B13G 2ZT1A 1UT0A 3AG0A 3GQPA 3FH9B 3UH3A 3WR1A 2ZFBB 1M6CA 3QJDA 4N6SA 1Y46B 3FS4A 3ZJNA 3DBJA 1Q1FA 2DKCA 3WCTD 2VJRA 4H0MB 3S48C 2VJTB 1F63A 1IRCA 1F99A 4F4OB 1CH1A 1R1XA 1DWSA 4SDHA 1Y5JB 1AJHA 1A4FB 1W92A 3UH7A 1UVKA 3EDAA 1Y4QB 2V1JA 1GLIA 3OK5A 2DXMA 2D60A 1OFKA 2VYWA 1LFZA 2EKTA 1Y8WB 4N7NA 1Y4VB 1F5PA 1HACB 1NS6A 5F0BA 3U3EA 2YSKA 1Y2ZA 5CNCA 2RAOA 1G0AB 1LFTA 2AV3A 1I3DA 4ROLB 1YDZA 1BZPA 4OF9A 5AZQA 1GH0B 2RI4B 5F2AA 1GZXB 3LR7A 4KN3A 1EW6A 1YVQA 3WCUB 1KR7A 1G9VB 1CO8A 2R4YA 2FAMA 2WCRA 3KUNA 5EYSA 1JZMA 2AURA 1WLAA 1V4UA 1MWCA 4PO5A 1Y83B 1DKEA 3UHGA 2M6ZB 2C7JB 1NQPB 1OR4A 1HLBA 1JW8A 3VRGA 3QQRA 3E55A 4MQCB 5KKKA 1RVWA 2DKAA 4F68A 1MOBA 4TWVA 4KJTA 4GZGA 1QXDA 2SPMA 5E6EA 1LUEA 3OO4B 2GL3A 3UHXA 2ZLXB 3SDNA 1RH1A 3KVSB 3P5QA 1IWHA 4JYQA 3UBVA 107MA 4Q70A 4MQIB 2GTLD 1SPGA 1HHSA 1IBEB 2BNLA 1GVHA 5SW7A 2GKNA 4HH1A 1XXTB 1YZIB 2ZS0B 2V1GA 5ILEA 1BINA 2OIFA 1N9HA 1BZ0B 1ASHA 4TWUA 1YCAA 3EU1A 4MQGB 1CO9A 1YGFB 2GRFA 2EKUA 3G52A 1O1OA 1HBBB 1RTEA 2H8DA 4MPMA 3ZJRA 1CLSB 2LH6A 1M6MA 2Z85A 5KERA 3EOKA 3ARJA 1JF4A 3WFWA 3VREA 1ECNA 3UHUA 1Y0WA 5CNBA 1HV4A 3HRWA 4YU4B 2H8FA 3A0GA 4WJG1 1MKOB 1YMCA 1MNJA 1DWTA 1H1XA 4ODCA 1EBTA 1BBBA 2HHBB 1K0YB 1Y83A 1GBUB 2MGFA 3QJCB 1A00A 4ETVA 1J3YA 5M3SA 1HGCB 1V4XA 1COLA 3BJ1B 1HDSA 1MOAA 3WCWD 1LTWA 3GKVB 1RQAB 1VXGA 2ZS1C 2VJHA 2EB9A 2HBDB 3A9MA 3PIAA 2UUMA 3D17A 4ROLA 3MJUB 2XYKA 1J40B 4XDIA 1G0AA 1LFTB 5C6EB 3NG6A 1KD2A 3B75A 3MJUA 1ECAA 1HBAB 3GKTA 1XZ2A 3UHWA 1YVTB 2VJHB 1A3OB 1LFZB 3VAUA 4AVEA 7HBIA 2D6CA 1Y09B 3GKVA 2DXMB 2ZFOB 3HYUA 1J3YB 2HZ1A 3QZXA 5B13A 4LMXB 2BWHA 1LIAB 1LFYB 1XZ4A 1YEQB 2MYAA 3D1AB 2VJTA 1BUWA 1XZ7A 4H0MA 1QXEA 3PI9A 1Y46A 4N6SB 2UULH 1LJWB 4YU4A 1UIWB 1A9WA 2SPOA 3VREB 4MXLA 1JDOA 3QM6A 3EOKB 1XY0B 2VMLA 3K8BB 4ERTA 2QSSA 3ONZA 3M3AA 5ILMA 1Y0DB 2MGJA 2MGEA 2QSPB 1G0BB 4MQGA 3QM7A 1Y45A 1Y7CB 2W72A 1MOHA 1UVLA 2NRMA 3GDJB 2G0XA 1Y5KA 2OLPA 3D1KA 1NZ4A 4BJUA 1X9FA 1V75A 1ABWB 4UIQA 3TLDA 3S65B 1UVNA 4PQ6A 1MYFA 1KFRA 1IBEA 3VHBA 3OVUC 4Q70B 3QM9A 1G09B 2LH2A 3EDBA 4XS0B 3R5IA 1M9PA 1VHBA 1XQ5A 3G4WA 4L1EA 1V4WA 4AE1A 1IDRA 3VRFA 1L2KA 3WFTA 3WHMB 1AJ9A 5E6EB 4B4YA 3ECZA 3UHCA 1LH5A 1S5YA 3PELB 1IT3A 1A6MA 1Y5FA 4HRRA 3O89A 4M4BA 1DO3A 1B33A 4MU5A 4ROMA 3S1IA 3G4QA 2LH7A 4QAUA 3NL7B 5E83B 3WCTA 1MLMA 3WFUA 2BV8A 1HDAB 1LA6B 1MTIA 1ABYB 1O1JA 3A2GA 2WCQA 109MA 5JDOE 1ON7B 4F6GA 2MHBB 5EE4C 1YIHB 1DXVB 4GXEB 2MYDA 1GCVB 1MNHA 1PHNB 1VXBA 1VXEA 2BV8B 1OUTA 3PI2A 2D5XA 3WCTB 1QI8B 1MWBA 1FAWB 1YFFB 3ASEA 3O18A 4MQJB 1Y8KB 1QI8A 3GK9A 3NFEA 2PGHB 4U8UB 4HRRB 2QRWA 4A8KA 2QU0A 1K1KB 2VHBA 2ZLUB 2ZS1A 2ZLVA 4B02A 1Y8IA 2MGHA 3A5GA 5HBIA 1HABB 2WY4A 1GCVA 2DN1B 3OZWA 3OO5A 1FHJA 4ETTA 6HBIA 3WCTC 3UHEA 3GYSA 3UHTA 1I7YA 1M9PB 1S56A 4N7OA 5HLUA 2MGLA 2O5LX 1Y4RB 1XCHA 3CIUB 1TU9A 3MN0A 5JOMA 3UHSA 1Y7ZA 2AA1A 2MGIA 2ZSSA 4O4ZA 2D5ZB 1X9FB 1DTIA 2OH9A 4HHBB 2DC3A 2JHOA 4O35A 4LM6B 2MYCA 3E4NA 3FEWX 1Y31B 1G0BA 1LH7A 1YHEA 2D2MB 1Y0AA 2QSSB 3ONZB 3IC0B 1JBOB 1MBCA 3LB2A 1XQ5B 4L1EB 4XS0A 4YU3B 4O1TA 1MTKA 1U7SA 2MBWA 1JY7A 2B7HA 1KN1B 1DWRA 1A6NA 1NY9A 1UVYA 1BUWB 1XZ7B 1HHOA 4H07A 3ZJOA 2W72B 2AUOA 1O1LA 3GQRA 3WTGB 1DLWA 2PEGB 3CY5A 4MAXA 3ZJSA 3SZKB 3A5AA 1LH6A 1FN3B 3AQ5A 3WCVB 2Z6NB 1MZ0A 2R4WA 2O58X 1QSIB 1DM1A 2ZT4A 1B8DA 5HLXA 1Y4GB 1YEOA 4F0TA 1HBAA 3A5BA 3D4XA 3D1AA 2MGMA 4GY3B 4H0BA 2W6VB 4MXKA 5JDOF 1A6KA 1O1IA 2UUMB 3PIAB 1Y35B 1XZ4B 5FVBM 2JLFA 4L7YB 1OR6A 2EF2A 1RQAA 1NAZA 1YHUA 1CPCB 1J7YA 2UULD 4F6FA 3ZJJA 3RGKA 1FDHA 3GOUA 1A3OA 2D2ND 4MBNA 1C7DA 4FH6A 4RMPA 3O2CB 4IROB 2BK9A 2IG3A 5EYJA 1A3NB 2MGCA 1YE2A 3DHTB 1BVDA 1WMUA 2MGDA 112MA 3HC9A 3HRWB 1Y0WB 2C7KA 1GCWA 1YIEA 1YEOB 4F0TB 1SPEA 4NXAA 1ALLA 3QZZA 3G4RA 1Y0TA 3PMDA 2VLYA 1J41B 2GRHA 3BOMA 3ZJHA 1A00B 4LMSB 5JGGB 3WCVA 1S61A 4O4TA 5B85A 2R80B 4HRTA 2X4AA 3UHKA 108MA 1A0ZB 4ILZA 1Y85B 3VNCA 3EU1B 2OHAA 1CH5A 5EV5A 4N7PA 1MYTA 2AV0A 1MODA 2UULA 3S66A 1YHUD 1SDLB 2UUMX 1KN1A 3E5OA 1JY7B 4N8TA 4ESUA 1BZ1B 4M4AA 2QLSB 1JZLA 3HENA 3WCPB 2YRSA 2H35A 3WCPA 2D2MA 3KVSA 3P5QB 3AQ9A 5HAVA 2VEEA 4NI0A 1XZ5A 4MQKB 5EOHA 3OO4A 1YH9A 2ZSPA 103MA 3IC2B 3ZTAA 111MA 1A6GA 1NZ3A 2DHBB 2UUNA 4AE0A 4ESAB 3QJEA 1XXTA 1RVWB 1CG5A 1YZIA 3V58B 110MA 3UHDA 2O5MX 2AA1B 3OZVA 2WTHA 1Y85A 1A0ZA 1MBOA 2M6ZA 1SWMA 1IT2A 1SPGB 2R80A 4PO5B 4MQIA 3PT8A 3GQGA 1I7YB 3UHZA 1G9VA 4PQBA 2I88A 1J41A 1YVQB 3WCUA 1YENB 1WVPA 2DN3B 1XZUB 1TOXA 3OO5B 2ZLXA 2RI4A 1GH0A 2OH8A 2GLNA 1QXDB 3DHTA 1NZ2A 2ZLUA 1S0HA 1HBGA 2QU0B 1YGDB 1C7CA 2ZT3A 3TM9A 1OUUA 1JWNA 3AT5A 1Y8KA 1I3EA 3O18B 4MQJA 2BLHA 1LFVB 1GJNA 3QM8A 2D5XB 2ZFOC 1UVMA 1MBNA 1XDTT 4FC3A 1PHNA 1HGBA 3GLNA 3KUOA 1COHB 2NRLA 1DUOA 5HLQA 5CNEA 1HI1A 1ITHA 1A0UA 1CMYA 106MA 1O1IB 1VWTA 5HU6A 3D4XB 102MA 4GY3A 4A8FA 3RQRA 101MA 3UHVA 1YHUC 4M4BB 3LQ9A 2FRKX 2XKGA 3BJ3A 1CG8B 3UHQA 1ECOA 3V57B 1CIOA 1VREA 1YOHA 1NS9B 2VYYA 1R1YB 1FN3A 3UGYA 3CY5B 2PEGA 4MQHA 1A4FA 1VRFA 2BKMA 1Y4PA 4HBIA 3VRFB 1MYZA 3A59A 2W31A 1HHOB 1MLOA 3W4UB 3DUTA 5B84A 1IOPA 2FRJX 2VJRB 2EB8A 4YJJB 3HHBA 3MKBA 2ZSZA 2ZT2A 2ZFBA 1CBMA 3LB4A 1NWNA 1HBRB 1WACA 1DO7A 1MDNA 2W6YA 3AQ6A 1Y5KB 1YHEB 1Y45B 3PT7B 5E29B 1KTPB 1QSHA 1YHRB 2SPLA 5E29A 1N9IA 2AUPA 2ZS0C 1MBDA 1MCYA 3RJ6A 4G51B 3NMMB 3ORDA 1JL7A 1HBRA 3MJPA 4G1VA 4U8UC 2HHDA 1ECDA 4YJJA 4NI1B 5HU6B 3W4UA 1YEQA 3GYSB 3ECXA 2LH3A 1Y4PB 1LFYA 4MQHB 1MLHA 3BCQA 1MNOA 1R1YA 4G1BA 2MYBA 1XG0C 1Y8IB 2VRYA 2ZS1B 3HYUB 4XXKA 3WI8A 1D8UA 1HGAB 1SHRA 2QFKA 2G0RA 4BS9A 2VM0A 2HBCB 1S5XA 1LFLA 1O1PB 4FWZA 1LFVA 5EUIB 4NS2A 5IKSA 2EVKA 1CH4A 3WFXA 3ECLA 1OUUB 3QMAA 3NG6B 1LFQA 1J40A 5C6EA 2QFNA 2G11A 5FVBA 2ZS0D 1A0UB 2UUND 1Y4BA 2HCOA 3QJBB 3ZHWA 1LHTA 3AQ8A 1HGBB 2V1HA 1ON7A 2HBSA 1DXTB 3KMFA 1O1MA 2O5BX 3GQGB 2D2MD 104MA 3AT5B 4ROMB 5CN5A 1Y5FB 2ZLWA 3PELA 4ESAA 4F6JA 1J3ZA 1G08A 2H8FB 1CH7A 1URVA 1Y0CA 2VLXA 5HY8A 5EU2A 1CH3A 3D7OA 2DN3A 3UHYA 4NI0B 1YEUA 5CN7A 3K3UA 3ARKA 3G53A 1HBSA 2D2NB 1YOIA 1F5OA 2HBFB 3R0GA 1MLKA 2Z6TA 1THBB 2O5OX 5MBAA 2KSCA 1NZ5A 1O1OB 1GDIA 3WCVD 1DTMA 1YGFA 1Y7DA 2ZT0A 5CNGA 1V75B 2DN2B 3WCWB 2G10A 6HBWA 3BJ2B 1NEJB 3QJEB 4WCHD 2UUNB 1Y22A 1SGKA 2R1HA 3BJ2A 4XXIA 3WCWA 1YH9B 3WCUD 3GDJA 5AB8A 1Y7CA 2JLGA 1MLLA 2VYZA 2W6XA 4JACA 4F0UB 1A01A 1Y4FA 2YRSB 3G4VA 1FCSA 2G0ZA 4H2LB 2HBFA 3BOMB 1IWHB 2D2NA 1XY0A 3MYNA 2VMLB 1X46A 3LQDA 4MBAA 3BA2A 1BZ1A 1MNKA 1ALLB 1MLSA 1VXFA 2ZFOD 4LPIA 1C40B 3D7OB 1BVCA 4DWUA 5EETA 3AQ7A 2UULB 3S66B 2BLIA 1MYGA 2OHBA 1J3ZB 1Y01B 1Y7GB 4NK2A 2ZLWB 1HJTA 1MYHA 3PI3A 3VRGB 2FRIX 2C7JA 5AQDA 1HI0P 4A8QA 4HRTB 3O7NA 1MOCA 3BRPA 3ZOMA 1UMOA 1DXTA 2ZSYA 2ZFOA 1Y0TB 2HHEA 3PI8A 5KDQB 3WCWC 3QJBA 2O5TX 1GCWB 1YIEB 3ZJMA 2ZSNA 1WMUB 1YE0A 1YDZB 1XZ2B 4HH0A 1LFQB 1A3NA 2W6VA 1KD2B 1GDKA 2GTLA 1NS6B 3D17B 3HF4B 4RMPB 1DXDA 4N7NB 5EUIA 1O1PA 2NX0A 1LFLB 2ZLTB 1J7WB 1S6AA 1Y8HB 5KDQA 3L0FA 1RPSA 1V4XB 1J7YB 1UFJA 1NPGA 3M38A 2O5SX 2HZ2A 5CNDA
chains in the Genus database with same CATH topology
1VXDA 3BCQB 3SZKA 1GBUA 4L7YA 4AVDA 2EVPA 2MGAA 3ARLA 3M39A 1EBCA 2ZSXA 3QJDB 1Y4GA 1XYEB 2IN4A 3M3BA 2FRFA 1UX9A 4YU3A 4O2GA 5CHRA 4H2LA 1FSLA 2Z6NA 3PI1A 2H8DB 1DXCA 2Z8AA 1RQ3B 4FWYA 1RQ4A 4KMVA 1QSHB 1O1LB 3GQRB 3WTGA 1FDHG 2HBEB 1JP8A 1OBMA 5C6YA 1J7SB 1YG5B 2Z6SA 2ZSQA 4F6IA 1B86B 4HHBA 1NEJA 2ZS0A 1YOGA 1JP6A 3ZH0A 4BJAA 1Y7ZB 1ABSA 3HHBB 3MKBB 5EE4D 4NXCA 4N7OB 2ZSRA 1THBA 1LH1A 4VHBA 2G3HA 3A59B 1NGKA 3ODQB 1UFPA 1Y0CB 5HY8B 1NS9A 1G08B 1PMBA 1PBXA 2GNWA 3ZJPA 4PNJA 1K1KA 1N9FA 1MYMA 2D5ZA 1AJGA 1NQPA 1MLQA 1FSXA 1MNIA 2LH1A 1MBSA 1V4UB 3IA3B 4F69A 1AZIA 1BABA 1MLRA 1O1MB 2MGKA 1FLPA 3NMLA 2CMMA 1CMYB 3LB3A 1FHJB 1HLMA 2HCOB 1DXVA 2DN1A 1GBVB 1COHA 5CN4A 1HABA 3DR9A 1BZRA 2ZLVB 1SI4A 2R4XA 2RAOB 3G46A 5JDOC 1HDAA 1LA6A 1O1JB 2G12A 1HACA 3UHNA 4U8UA 2PGHA 1HDBA 1GDLA 5E83A 1FAWA 1YFFA 1V07A 4HSWA 1OUTB 1C7CB 1YGDA 1HGAA 1S5YB 2VEBA 1VXAA 1Z8UB 1CQ2A 1Y4QA 1CPWA 2GTLC 1BIJB 1JPBA 3HEOA 2ZS1D 1YIHA 1YENA 2MHBA 1DXUA 1JEBB 3IXFA 1V4WB 4F4OA 2MGBA 3ZJLA 1ABYA 1BABB 3UH6A 3H58A 1G09A 3PT8B 1X9FC 3WR1B 4DC7A 3S65A 1ABWA 4UZVA 4L2MA 1CG5B 1CBLA 3NMMA 4NZIA 2E2YA 2LHBA 2GNVA 1J7SA 4C0NA 1GDJA 1LH2A 4IT8A 1N9XA 4MQKA 2HBEA 1IRDB 1AJ9B 3ODQA 4FH7A 2BMMA 5CHQA 3KMFC 3PT7A 2G0SA 1MBIA 1X3KA 1RQ3A 3QQQA 2QMBA 2H35B 5JDOD 3K9ZA 4DC8A 1MLFA 1O1KB 1MGNA 2ZSTA 3MYMA 1HRMA 2QLSA 1DLYA 1XYEA 4N8TB 2NSRA 1U7RA 1CQXA 5CN9A 1C7BA 4OODA 2V1KA 1O1NA 2MGGA 1QPWA 1B86A 1UVXA 1YG5A 2GRZA 2G14A 3D1KB 1MWDA 3ZOLA 1NIHA 3UHRA 1J3FA 2XKIA 2V1IA 5MBNA 1RQ4B 1SDKA 1Y0DA 1MYIA 1T1NB 1XZVA 1NXFA 2C0KA 3K8BA 1CG8A 1A9WE 1MBAA 3BJ3B 1NPFA 1X9FD 1Y09A 1OFJA 1UIWA 2ZLTA 3ZJQA 3UH5A 3AT6B 4TYXA 3MOUA 1LJWA 3HF4A 4B3WA 2SPNA 1YE2B 3PI9B 3B75B 1QXEB 3DHRB 1VWTB 3TM3A 1YMBA 5D1VA 1YE0B 1S69A 4ZVBA 1JZKA 2GKMA 5CN8A 1MLNA 5AZRA 2HHEB 105MA 4FC3B 1YHUB 1RPSB 1RSEA 1J7WA 1Y8HA 3QJCA 1MTJA 1K0YA 1V9QA 3RJNB 1CP5A 1YVTA 1BBBB 4X0LA 4ODCB 2GTLB 1S0HB 2HBDA 3AT6A 3V2VA 1HV4B 1MLUA 1XZUA 1C40A 1UX8A 3G4YA 3PI8B 1HDSB 3BJ1A 1VXCA 1CIKA 1HGCA 3LQDB 3UHBA 1B0BA 5KERB 1QSIA 1XZVB 1CLSA 3HXNB 1A01B 1T1NA 1SDKB 1MYJA 2HHBA 1H97A 1NIHB 4UURA 2R50A 4DWTA 2D2NC 1HBHA 1Y7GA 2R1HB 4ZVAA 1BJEA 1Y22B 2DHBA 1MKOA 1YCBA 6HBWB 3IC2A 1HCOA 3A0GB 3V2ZA 5SW7B 1Y7DB 1XZ5B 1BZ6A 2BW9M 1JF3A 5CMVA 1LH3A 1O1KA 1Y4FB 4NK1A 1Y0AB 1HBBA 1O16A 4M4AB 2R4ZA 2XKHA 1V5HA 1EMYA 1IRDA 3OJ1A 1SDLA 2BLJM 1BZ0A 5ILPA 1HCOB 2NSSA 4N7PB 1OJ6A 3HEPA 1HBHB 2DN2A 1LHSA 2ZWJA 5CN6A 3CIUA 1Y4RA 2W6WA 4PQCA 2W72C 5JGGA 3HXNA 3ZJIA 4F6DA 1MLJA 3UHHA 2HZ3A 1HBSB 2HBSB 1YMAA 3UHIA 1JEBA 1DXUB 1VXHA 1UC3A 1YEUB 1GZXA 5EQMA 3G4UA 2V1EA 3OZUA 1MLGA 1BIJA 2V1FA 4KMWA 2WTGA 1JL6A 3UBCA 4MQCA 2ZSOA 3LHBA 4IROA 3NFEB 5D5RA 2D2MC 4X0LB 1HBIA 3LB1A 1C7DB 1DKEB 3S1JA 3MVCA 3GOUB 1HDBB 2HBCA 1DO4A 2HBGA 2D60B 3LR9A 1SHRB 1EWAA 2VLZA 1CH9A 1SI4B 5CNFA 4F6BA 3MBAA 5ILRA 1GBVA 1Y4BB 3ED9A 3H57A 1Y5JA 1Y35A 1R1XB 2GDMA 1Y2ZB 3DHRA 1URYA 2FALA 1Y4VA 3NL7A 1DO1A 3UI0A 1Y8WA 1FSXB 3MJPB 1S5XB 2MYEA 2G0VA 1JP9A 3GQPB 1GLIB 3E5IA 1PBXB 4WJGA 1YHRA 1CP0A 3QM5A 3WHMA 1J52A 2AUQA 4NI1A 3R5IB 1QPWB 1BZZB 1TESA 1YEVA 1CH2A 4U8UD 1RTXA 3FS4B 2HHDB 1O1NB 1HSYA 4C44A 3UGZA 3PI4A 1C7BB 2B7HB 3FH9A 3WCVC 1YEVB 4G51A 1NWIA 1BZZA 3OGBA 2O5QX 1F65A 1DUKA 3DUTB 3IC0A 2QMBB 2MB5A 1Y31A 2LH5A 2QSPA 4HSXA 3WCUC 4FWXA 3SDHA 2ZT1A 1UT0A 3AG0A 3GQPA 3FH9B 3UH3A 3WR1A 2ZFBB 1M6CA 3QJDA 1Y46B 3FS4A 3ZJNA 1Q1FA 3WCTD 3S48C 1F63A 1IRCA 4F4OB 1CH1A 1R1XA 1DWSA 4SDHA 1Y5JB 1AJHA 1A4FB 1W92A 3UH7A 3EDAA 1Y4QB 2V1JA 1GLIA 3OK5A 2DXMA 2D60A 1OFKA 2VYWA 1LFZA 2EKTA 1Y8WB 4N7NA 1Y4VB 1F5PA 1HACB 1NS6A 5F0BA 3U3EA 1Y2ZA 5CNCA 2RAOA 1G0AB 1LFTA 2AV3A 1I3DA 4ROLB 1YDZA 1BZPA 4OF9A 5AZQA 2RI4B 5F2AA 1GZXB 3LR7A 4KN3A 1EW6A 1YVQA 3WCUB 1KR7A 1G9VB 1CO8A 2R4YA 2FAMA 3KUNA 5EYSA 1JZMA 2AURA 1WLAA 1V4UA 1MWCA 1Y83B 1DKEA 3UHGA 2M6ZB 1NQPB 1OR4A 1HLBA 1JW8A 3VRGA 3QQRA 3E55A 4MQCB 5KKKA 1RVWA 4F68A 1MOBA 4TWVA 4KJTA 4GZGA 1QXDA 2SPMA 5E6EA 1LUEA 3OO4B 2GL3A 3UHXA 2ZLXB 3SDNA 3P5QA 1IWHA 4JYQA 3UBVA 107MA 4MQIB 2GTLD 1SPGA 1IBEB 2BNLA 1GVHA 5SW7A 2GKNA 1XXTB 1YZIB 2ZS0B 2V1GA 5ILEA 1BINA 2OIFA 1N9HA 1BZ0B 1ASHA 4TWUA 1YCAA 3EU1A 4MQGB 1CO9A 1YGFB 2GRFA 2EKUA 3G52A 1O1OA 1HBBB 1RTEA 2H8DA 4MPMA 3ZJRA 1CLSB 2LH6A 1M6MA 2Z85A 5KERA 3EOKA 3ARJA 1JF4A 3WFWA 3VREA 1ECNA 3UHUA 1Y0WA 5CNBA 1HV4A 3HRWA 4YU4B 2H8FA 3A0GA 4WJG1 1MKOB 1YMCA 1MNJA 1DWTA 1H1XA 4ODCA 1EBTA 1BBBA 2HHBB 1K0YB 1Y83A 1GBUB 2MGFA 3QJCB 1A00A 1J3YA 5M3SA 1HGCB 1V4XA 3BJ1B 1HDSA 1MOAA 3WCWD 1LTWA 3GKVB 1RQAB 1VXGA 2ZS1C 2EB9A 2HBDB 3A9MA 3PIAA 3D17A 4ROLA 3MJUB 4XDIA 2XYKA 1J40B 1G0AA 1LFTB 5C6EB 3NG6A 1KD2A 3B75A 3MJUA 1ECAA 1HBAB 3GKTA 1XZ2A 3UHWA 1YVTB 1A3OB 1LFZB 3VAUA 4AVEA 7HBIA 2D6CA 1Y09B 3GKVA 2DXMB 2ZFOB 3HYUA 1J3YB 2HZ1A 3QZXA 2BWHA 1LFYB 1XZ4A 1YEQB 2MYAA 3D1AB 1BUWA 1XZ7A 1QXEA 3PI9A 1Y46A 1LJWB 4YU4A 1UIWB 1A9WA 2SPOA 3VREB 4MXLA 1JDOA 3QM6A 3EOKB 1XY0B 3K8BB 2QSSA 3ONZA 3M3AA 5ILMA 1Y0DB 2MGJA 2MGEA 2QSPB 1G0BB 4MQGA 3QM7A 1Y45A 1Y7CB 2W72A 1MOHA 2NRMA 3GDJB 2G0XA 1Y5KA 2OLPA 3D1KA 1NZ4A 1X9FA 1V75A 1ABWB 4UIQA 3TLDA 3S65B 4PQ6A 1MYFA 1KFRA 1IBEA 3VHBA 3OVUC 3QM9A 1G09B 2LH2A 3EDBA 4XS0B 3R5IA 1M9PA 1VHBA 1XQ5A 3G4WA 1V4WA 1IDRA 3VRFA 1L2KA 3WFTA 3WHMB 1AJ9A 5E6EB 4B4YA 3ECZA 3UHCA 1LH5A 1S5YA 3PELB 1IT3A 1A6MA 1Y5FA 4HRRA 3O89A 4M4BA 1DO3A 4MU5A 4ROMA 3S1IA 3G4QA 2LH7A 4QAUA 3NL7B 5E83B 3WCTA 1MLMA 3WFUA 1HDAB 1LA6B 1MTIA 1ABYB 1O1JA 3A2GA 5JDOE 109MA 4F6GA 2MHBB 5EE4C 1YIHB 1DXVB 2MYDA 1GCVB 1MNHA 1VXBA 1VXEA 1OUTA 3PI2A 2D5XA 3WCTB 1QI8B 1MWBA 1FAWB 1YFFB 3ASEA 4MQJB 1Y8KB 1QI8A 3GK9A 3NFEA 2PGHB 4U8UB 4HRRB 2QRWA 2QU0A 1K1KB 2VHBA 2ZLUB 2ZS1A 2ZLVA 1Y8IA 2MGHA 3A5GA 5HBIA 1HABB 2WY4A 1GCVA 2DN1B 3OZWA 3OO5A 1FHJA 6HBIA 3WCTC 3UHEA 3GYSA 3UHTA 1M9PB 1S56A 4N7OA 5HLUA 2MGLA 2O5LX 1Y4RB 1XCHA 3CIUB 1TU9A 3MN0A 5JOMA 3UHSA 1Y7ZA 2AA1A 2MGIA 2ZSSA 4O4ZA 2D5ZB 1X9FB 1DTIA 2OH9A 4HHBB 2DC3A 2JHOA 4O35A 2MYCA 3E4NA 1Y31B 1G0BA 1LH7A 1YHEA 2D2MB 1Y0AA 2QSSB 3ONZB 3IC0B 1MBCA 3LB2A 1XQ5B 4XS0A 4YU3B 4O1TA 1MTKA 1U7SA 2MBWA 1JY7A 2B7HA 1DWRA 1A6NA 1UVYA 1BUWB 1XZ7B 1HHOA 4H07A 3ZJOA 2W72B 2AUOA 1O1LA 3GQRA 3WTGB 1DLWA 2PEGB 3CY5A 4MAXA 3ZJSA 3SZKB 3A5AA 1LH6A 1FN3B 3AQ5A 3WCVB 2Z6NB 1MZ0A 2R4WA 2O58X 1QSIB 1DM1A 2ZT4A 5HLXA 1Y4GB 1YEOA 1HBAA 3A5BA 3D4XA 3D1AA 2MGMA 4H0BA 2W6VB 4MXKA 5JDOF 1A6KA 1O1IA 3PIAB 1Y35B 1XZ4B 4L7YB 1OR6A 2EF2A 1RQAA 1NAZA 1YHUA 1J7YA 4F6FA 3ZJJA 3RGKA 1FDHA 3GOUA 1A3OA 2D2ND 4MBNA 1C7DA 4FH6A 4IROB 2BK9A 2IG3A 5EYJA 1A3NB 2MGCA 1YE2A 3DHTB 1BVDA 1WMUA 2MGDA 112MA 3HC9A 3HRWB 1Y0WB 1GCWA 1YIEA 1YEOB 1SPEA 4NXAA 3QZZA 3G4RA 1Y0TA 2VLYA 1J41B 2GRHA 3BOMA 3ZJHA 1A00B 5JGGB 3WCVA 1S61A 4O4TA 5B85A 2R80B 4HRTA 3UHKA 108MA 1A0ZB 4ILZA 1Y85B 3EU1B 2OHAA 1CH5A 5EV5A 4N7PA 1MYTA 2AV0A 1MODA 3S66A 1YHUD 1SDLB 3E5OA 1JY7B 4N8TA 1BZ1B 4M4AA 2QLSB 1JZLA 3HENA 3WCPB 2YRSA 2H35A 3WCPA 2D2MA 3P5QB 3AQ9A 5HAVA 2VEEA 4NI0A 1XZ5A 4MQKB 5EOHA 3OO4A 1YH9A 2ZSPA 103MA 3IC2B 111MA 1A6GA 1NZ3A 2DHBB 4ESAB 3QJEA 1XXTA 1RVWB 1CG5A 1YZIA 110MA 3UHDA 2O5MX 2AA1B 3OZVA 2WTHA 1Y85A 1A0ZA 1MBOA 2M6ZA 1SWMA 1IT2A 1SPGB 2R80A 4MQIA 3PT8A 3GQGA 3UHZA 1G9VA 4PQBA 1J41A 1YVQB 3WCUA 1YENB 1WVPA 2DN3B 1XZUB 3OO5B 2ZLXA 2RI4A 2OH8A 2GLNA 1QXDB 3DHTA 1NZ2A 2ZLUA 1S0HA 1HBGA 2QU0B 1YGDB 1C7CA 2ZT3A 3TM9A 1OUUA 1JWNA 3AT5A 1Y8KA 1I3EA 4MQJA 2BLHA 1LFVB 1GJNA 3QM8A 2D5XB 2ZFOC 1MBNA 4FC3A 1HGBA 3GLNA 3KUOA 1COHB 2NRLA 1DUOA 5HLQA 5CNEA 1ITHA 1A0UA 1CMYA 106MA 1O1IB 1VWTA 5HU6A 3D4XB 102MA 101MA 3UHVA 1YHUC 4M4BB 2FRKX 2XKGA 3BJ3A 1CG8B 3UHQA 1ECOA 1CIOA 1VREA 1YOHA 1NS9B 2VYYA 1R1YB 1FN3A 3UGYA 3CY5B 2PEGA 4MQHA 1A4FA 1VRFA 2BKMA 1Y4PA 4HBIA 3VRFB 1MYZA 3A59A 2W31A 1HHOB 1MLOA 3W4UB 3DUTA 5B84A 1IOPA 2FRJX 2EB8A 3HHBA 3MKBA 2ZSZA 2ZT2A 2ZFBA 1CBMA 3LB4A 1NWNA 1HBRB 1DO7A 1MDNA 2W6YA 3AQ6A 1Y5KB 1YHEB 1Y45B 3PT7B 5E29B 1QSHA 1YHRB 2SPLA 5E29A 1N9IA 2AUPA 2ZS0C 1MBDA 1MCYA 3RJ6A 4G51B 3NMMB 3ORDA 1JL7A 1HBRA 3MJPA 4G1VA 4U8UC 2HHDA 1ECDA 4NI1B 5HU6B 3W4UA 1YEQA 3GYSB 3ECXA 2LH3A 1Y4PB 1LFYA 4MQHB 1MLHA 3BCQA 1MNOA 1R1YA 4G1BA 2MYBA 1Y8IB 2VRYA 2ZS1B 3HYUB 3WI8A 1D8UA 1HGAB 1SHRA 2QFKA 2G0RA 2VM0A 2HBCB 1S5XA 1LFLA 1O1PB 4FWZA 1LFVA 5EUIB 4NS2A 5IKSA 2EVKA 1CH4A 3WFXA 3ECLA 1OUUB 3QMAA 3NG6B 1LFQA 5C6EA 1J40A 2QFNA 2G11A 2ZS0D 1A0UB 1Y4BA 2HCOA 3QJBB 3ZHWA 1LHTA 3AQ8A 1HGBB 2V1HA 2HBSA 1DXTB 3KMFA 1O1MA 2O5BX 3GQGB 2D2MD 104MA 3AT5B 4ROMB 5CN5A 1Y5FB 2ZLWA 3PELA 4ESAA 4F6JA 1J3ZA 1G08A 2H8FB 1CH7A 1URVA 1Y0CA 2VLXA 5HY8A 5EU2A 1CH3A 3D7OA 2DN3A 3UHYA 4NI0B 1YEUA 5CN7A 3K3UA 3ARKA 3G53A 1HBSA 2D2NB 1YOIA 1F5OA 2HBFB 3R0GA 1MLKA 2Z6TA 1THBB 2O5OX 5MBAA 2KSCA 1NZ5A 1O1OB 1GDIA 3WCVD 1DTMA 1YGFA 1Y7DA 2ZT0A 5CNGA 1V75B 2DN2B 3WCWB 2G10A 6HBWA 3BJ2B 1NEJB 3QJEB 4WCHD 1Y22A 3BJ2A 2R1HA 3WCWA 1YH9B 3WCUD 3GDJA 5AB8A 1Y7CA 1MLLA 2VYZA 2W6XA 4JACA 1A01A 1Y4FA 2YRSB 3G4VA 1FCSA 2G0ZA 4H2LB 2HBFA 3BOMB 1IWHB 2D2NA 1XY0A 3MYNA 1X46A 3LQDA 4MBAA 3BA2A 1BZ1A 1MNKA 1VXFA 1MLSA 2ZFOD 4LPIA 1C40B 3D7OB 1BVCA 4DWUA 5EETA 3AQ7A 3S66B 2BLIA 1MYGA 2OHBA 1J3ZB 1Y01B 1Y7GB 4NK2A 2ZLWB 1HJTA 1MYHA 3PI3A 3VRGB 2FRIX 4HRTB 3O7NA 1MOCA 3ZOMA 1UMOA 1DXTA 2ZSYA 2ZFOA 1Y0TB 2HHEA 3PI8A 5KDQB 3WCWC 3QJBA 2O5TX 1GCWB 1YIEB 3ZJMA 2ZSNA 1WMUB 1YE0A 1YDZB 1XZ2B 1LFQB 1A3NA 2W6VA 1KD2B 1GDKA 2GTLA 1NS6B 3D17B 3HF4B 1DXDA 4N7NB 5EUIA 1O1PA 2NX0A 1LFLB 2ZLTB 1J7WB 1S6AA 1Y8HB 5KDQA 1RPSA 1V4XB 1J7YB 1UFJA 1NPGA 3M38A 2O5SX 2HZ2A 5CNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VXD A;  3BCQ B;  3SZK A;  1GBU A;  4L7Y A;  4AVD A;  2EVP A;  2MGA A;  3ARL A;  3M39 A;  1EBC A;  2ZSX A;  3QJD B;  1Y4G A;  1XYE B;  2IN4 A;  3M3B A;  2FRF A;  1UX9 A;  4YU3 A;  4O2G A;  5CHR A;  4H2L A;  1FSL A;  2Z6N A;  3PI1 A;  2H8D B;  1DXC A;  2Z8A A;  1RQ3 B;  4FWY A;  1RQ4 A;  4KMV A;  1QSH B;  1O1L B;  3GQR B;  3WTG A;  1FDH G;  2HBE B;  1JP8 A;  1OBM A;  5C6Y A;  1J7S B;  1YG5 B;  2Z6S A;  2ZSQ A;  4F6I A;  1B86 B;  4HHB A;  1NEJ A;  2ZS0 A;  1YOG A;  1JP6 A;  3ZH0 A;  4BJA A;  1Y7Z B;  1ABS A;  3HHB B;  3MKB B;  5EE4 D;  4NXC A;  4N7O B;  2ZSR A;  1THB A;  1LH1 A;  4VHB A;  2G3H A;  3A59 B;  1NGK A;  3ODQ B;  1UFP A;  1Y0C B;  5HY8 B;  1NS9 A;  1G08 B;  1PMB A;  1PBX A;  2GNW A;  3ZJP A;  4PNJ A;  1K1K A;  1N9F A;  1MYM A;  2D5Z A;  1AJG A;  1NQP A;  1MLQ A;  1FSX A;  1MNI A;  2LH1 A;  1MBS A;  1V4U B;  3IA3 B;  4F69 A;  1AZI A;  1BAB A;  1MLR A;  1O1M B;  2MGK A;  1FLP A;  3NML A;  2CMM A;  1CMY B;  3LB3 A;  1FHJ B;  1HLM A;  2HCO B;  1DXV A;  2DN1 A;  1GBV B;  1COH A;  5CN4 A;  1HAB A;  3DR9 A;  1BZR A;  2ZLV B;  1SI4 A;  2R4X A;  2RAO B;  3G46 A;  5JDO C;  1HDA A;  1LA6 A;  1O1J B;  2G12 A;  1HAC A;  3UHN A;  4U8U A;  2PGH A;  1HDB A;  1GDL A;  5E83 A;  1FAW A;  1YFF A;  1V07 A;  4HSW A;  1OUT B;  1C7C B;  1YGD A;  1HGA A;  1S5Y B;  2VEB A;  1VXA A;  1Z8U B;  1CQ2 A;  1Y4Q A;  1CPW A;  2GTL C;  1BIJ B;  1JPB A;  3HEO A;  2ZS1 D;  1YIH A;  1YEN A;  2MHB A;  1DXU A;  1JEB B;  3IXF A;  1V4W B;  4F4O A;  2MGB A;  3ZJL A;  1ABY A;  1BAB B;  3UH6 A;  3H58 A;  1G09 A;  3PT8 B;  1X9F C;  3WR1 B;  4DC7 A;  3S65 A;  1ABW A;  4UZV A;  4L2M A;  1CG5 B;  1CBL A;  3NMM A;  4NZI A;  2E2Y A;  2LHB A;  2GNV A;  1J7S A;  4C0N A;  1GDJ A;  1LH2 A;  4IT8 A;  1N9X A;  4MQK A;  2HBE A;  1IRD B;  1AJ9 B;  3ODQ A;  4FH7 A;  2BMM A;  5CHQ A;  3KMF C;  3PT7 A;  2G0S A;  1MBI A;  1X3K A;  1RQ3 A;  3QQQ A;  2QMB A;  2H35 B;  5JDO D;  3K9Z A;  4DC8 A;  1MLF A;  1O1K B;  1MGN A;  2ZST A;  3MYM A;  1HRM A;  2QLS A;  1DLY A;  1XYE A;  4N8T B;  2NSR A;  1U7R A;  1CQX A;  5CN9 A;  1C7B A;  4OOD A;  2V1K A;  1O1N A;  2MGG A;  1QPW A;  1B86 A;  1UVX A;  1YG5 A;  2GRZ A;  2G14 A;  3D1K B;  1MWD A;  3ZOL A;  1NIH A;  3UHR A;  1J3F A;  2XKI A;  2V1I A;  5MBN A;  1RQ4 B;  1SDK A;  1Y0D A;  1MYI A;  1T1N B;  1XZV A;  1NXF A;  2C0K A;  3K8B A;  1CG8 A;  1A9W E;  1MBA A;  3BJ3 B;  1NPF A;  1X9F D;  1Y09 A;  1OFJ A;  1UIW A;  2ZLT A;  3ZJQ A;  3UH5 A;  3AT6 B;  4TYX A;  3MOU A;  1LJW A;  3HF4 A;  4B3W A;  2SPN A;  1YE2 B;  3PI9 B;  3B75 B;  1QXE B;  3DHR B;  1VWT B;  3TM3 A;  1YMB A;  5D1V A;  1YE0 B;  1S69 A;  4ZVB A;  1JZK A;  2GKM A;  5CN8 A;  1MLN A;  5AZR A;  2HHE B;  105M A;  4FC3 B;  1YHU B;  1RPS B;  1RSE A;  1J7W A;  1Y8H A;  3QJC A;  1MTJ A;  1K0Y A;  1V9Q A;  3RJN B;  1CP5 A;  1YVT A;  1BBB B;  4X0L A;  4ODC B;  2GTL B;  1S0H B;  2HBD A;  3AT6 A;  3V2V A;  1HV4 B;  1MLU A;  1XZU A;  1C40 A;  1UX8 A;  3G4Y A;  3PI8 B;  1HDS B;  3BJ1 A;  1VXC A;  1CIK A;  1HGC A;  3LQD B;  3UHB A;  1B0B A;  5KER B;  1QSI A;  1XZV B;  1CLS A;  3HXN B;  1A01 B;  1T1N A;  1SDK B;  1MYJ A;  2HHB A;  1H97 A;  1NIH B;  4UUR A;  2R50 A;  4DWT A;  2D2N C;  1HBH A;  1Y7G A;  2R1H B;  4ZVA A;  1BJE A;  1Y22 B;  2DHB A;  1MKO A;  1YCB A;  6HBW B;  3IC2 A;  1HCO A;  3A0G B;  3V2Z A;  5SW7 B;  1Y7D B;  1XZ5 B;  1BZ6 A;  2BW9 M;  1JF3 A;  5CMV A;  1LH3 A;  1O1K A;  1Y4F B;  4NK1 A;  1Y0A B;  1HBB A;  1O16 A;  4M4A B;  2R4Z A;  2XKH A;  1V5H A;  1EMY A;  1IRD A;  3OJ1 A;  1SDL A;  2BLJ M;  1BZ0 A;  5ILP A;  1HCO B;  2NSS A;  4N7P B;  1OJ6 A;  3HEP A;  1HBH B;  2DN2 A;  1LHS A;  2ZWJ A;  5CN6 A;  3CIU A;  1Y4R A;  2W6W A;  4PQC A;  2W72 C;  5JGG A;  3HXN A;  3ZJI A;  4F6D A;  1MLJ A;  3UHH A;  2HZ3 A;  1HBS B;  2HBS B;  1YMA A;  3UHI A;  1JEB A;  1DXU B;  1VXH A;  1UC3 A;  1YEU B;  1GZX A;  5EQM A;  3G4U A;  2V1E A;  3OZU A;  1MLG A;  1BIJ A;  2V1F A;  4KMW A;  2WTG A;  1JL6 A;  3UBC A;  4MQC A;  2ZSO A;  3LHB A;  4IRO A;  3NFE B;  5D5R A;  2D2M C;  4X0L B;  1HBI A;  3LB1 A;  1C7D B;  1DKE B;  3S1J A;  3MVC A;  3GOU B;  1HDB B;  2HBC A;  1DO4 A;  2HBG A;  2D60 B;  3LR9 A;  1SHR B;  1EWA A;  2VLZ A;  1CH9 A;  1SI4 B;  5CNF A;  4F6B A;  3MBA A;  5ILR A;  1GBV A;  1Y4B B;  3ED9 A;  3H57 A;  1Y5J A;  1Y35 A;  1R1X B;  2GDM A;  1Y2Z B;  3DHR A;  1URY A;  2FAL A;  1Y4V A;  3NL7 A;  1DO1 A;  3UI0 A;  1Y8W A;  1FSX B;  3MJP B;  1S5X B;  2MYE A;  2G0V A;  1JP9 A;  3GQP B;  1GLI B;  3E5I A;  1PBX B;  4WJG A;  1YHR A;  1CP0 A;  3QM5 A;  3WHM A;  1J52 A;  2AUQ A;  4NI1 A;  3R5I B;  1QPW B;  1BZZ B;  1TES A;  1YEV A;  1CH2 A;  4U8U D;  1RTX A;  3FS4 B;  2HHD B;  1O1N B;  1HSY A;  4C44 A;  3UGZ A;  3PI4 A;  1C7B B;  2B7H B;  3FH9 A;  3WCV C;  1YEV B;  4G51 A;  1NWI A;  1BZZ A;  3OGB A;  2O5Q X;  1F65 A;  1DUK A;  3DUT B;  3IC0 A;  2QMB B;  2MB5 A;  1Y31 A;  2LH5 A;  2QSP A;  4HSX A;  3WCU C;  4FWX A;  3SDH A;  2ZT1 A;  1UT0 A;  3AG0 A;  3GQP A;  3FH9 B;  3UH3 A;  3WR1 A;  2ZFB B;  1M6C A;  3QJD A;  1Y46 B;  3FS4 A;  3ZJN A;  1Q1F A;  3WCT D;  3S48 C;  1F63 A;  1IRC A;  4F4O B;  1CH1 A;  1R1X A;  1DWS A;  4SDH A;  1Y5J B;  1AJH A;  1A4F B;  1W92 A;  3UH7 A;  3EDA A;  1Y4Q B;  2V1J A;  1GLI A;  3OK5 A;  2DXM A;  2D60 A;  1OFK A;  2VYW A;  1LFZ A;  2EKT A;  1Y8W B;  4N7N A;  1Y4V B;  1F5P A;  1HAC B;  1NS6 A;  5F0B A;  3U3E A;  1Y2Z A;  5CNC A;  2RAO A;  1G0A B;  1LFT A;  2AV3 A;  1I3D A;  4ROL B;  1YDZ A;  1BZP A;  4OF9 A;  5AZQ A;  2RI4 B;  5F2A A;  1GZX B;  3LR7 A;  4KN3 A;  1EW6 A;  1YVQ A;  3WCU B;  1KR7 A;  1G9V B;  1CO8 A;  2R4Y A;  2FAM A;  3KUN A;  5EYS A;  1JZM A;  2AUR A;  1WLA A;  1V4U A;  1MWC A;  1Y83 B;  1DKE A;  3UHG A;  2M6Z B;  1NQP B;  1OR4 A;  1HLB A;  1JW8 A;  3VRG A;  3QQR A;  3E55 A;  4MQC B;  5KKK A;  1RVW A;  4F68 A;  1MOB A;  4TWV A;  4KJT A;  4GZG A;  1QXD A;  2SPM A;  5E6E A;  1LUE A;  3OO4 B;  2GL3 A;  3UHX A;  2ZLX B;  3SDN A;  3P5Q A;  1IWH A;  4JYQ A;  3UBV A;  107M A;  4MQI B;  2GTL D;  1SPG A;  1IBE B;  2BNL A;  1GVH A;  5SW7 A;  2GKN A;  1XXT B;  1YZI B;  2ZS0 B;  2V1G A;  5ILE A;  1BIN A;  2OIF A;  1N9H A;  1BZ0 B;  1ASH A;  4TWU A;  1YCA A;  3EU1 A;  4MQG B;  1CO9 A;  1YGF B;  2GRF A;  2EKU A;  3G52 A;  1O1O A;  1HBB B;  1RTE A;  2H8D A;  4MPM A;  3ZJR A;  1CLS B;  2LH6 A;  1M6M A;  2Z85 A;  5KER A;  3EOK A;  3ARJ A;  1JF4 A;  3WFW A;  3VRE A;  1ECN A;  3UHU A;  1Y0W A;  5CNB A;  1HV4 A;  3HRW A;  4YU4 B;  2H8F A;  3A0G A;  4WJG 1;  1MKO B;  1YMC A;  1MNJ A;  1DWT A;  1H1X A;  4ODC A;  1EBT A;  1BBB A;  2HHB B;  1K0Y B;  1Y83 A;  1GBU B;  2MGF A;  3QJC B;  1A00 A;  1J3Y A;  5M3S A;  1HGC B;  1V4X A;  3BJ1 B;  1HDS A;  1MOA A;  3WCW D;  1LTW A;  3GKV B;  1RQA B;  1VXG A;  2ZS1 C;  2EB9 A;  2HBD B;  3A9M A;  3PIA A;  3D17 A;  4ROL A;  3MJU B;  4XDI A;  2XYK A;  1J40 B;  1G0A A;  1LFT B;  5C6E B;  3NG6 A;  1KD2 A;  3B75 A;  3MJU A;  1ECA A;  1HBA B;  3GKT A;  1XZ2 A;  3UHW A;  1YVT B;  1A3O B;  1LFZ B;  3VAU A;  4AVE A;  7HBI A;  2D6C A;  1Y09 B;  3GKV A;  2DXM B;  2ZFO B;  3HYU A;  1J3Y B;  2HZ1 A;  3QZX A;  2BWH A;  1LFY B;  1XZ4 A;  1YEQ B;  2MYA A;  3D1A B;  1BUW A;  1XZ7 A;  1QXE A;  3PI9 A;  1Y46 A;  1LJW B;  4YU4 A;  1UIW B;  1A9W A;  2SPO A;  3VRE B;  4MXL A;  1JDO A;  3QM6 A;  3EOK B;  1XY0 B;  3K8B B;  2QSS A;  3ONZ A;  3M3A A;  5ILM A;  1Y0D B;  2MGJ A;  2MGE A;  2QSP B;  1G0B B;  4MQG A;  3QM7 A;  1Y45 A;  1Y7C B;  2W72 A;  1MOH A;  2NRM A;  3GDJ B;  2G0X A;  1Y5K A;  2OLP A;  3D1K A;  1NZ4 A;  1X9F A;  1V75 A;  1ABW B;  4UIQ A;  3TLD A;  3S65 B;  4PQ6 A;  1MYF A;  1KFR A;  1IBE A;  3VHB A;  3OVU C;  3QM9 A;  1G09 B;  2LH2 A;  3EDB A;  4XS0 B;  3R5I A;  1M9P A;  1VHB A;  1XQ5 A;  3G4W A;  1V4W A;  1IDR A;  3VRF A;  1L2K A;  3WFT A;  3WHM B;  1AJ9 A;  5E6E B;  4B4Y A;  3ECZ A;  3UHC A;  1LH5 A;  1S5Y A;  3PEL B;  1IT3 A;  1A6M A;  1Y5F A;  4HRR A;  3O89 A;  4M4B A;  1DO3 A;  4MU5 A;  4ROM A;  3S1I A;  3G4Q A;  2LH7 A;  4QAU A;  3NL7 B;  5E83 B;  3WCT A;  1MLM A;  3WFU A;  1HDA B;  1LA6 B;  1MTI A;  1ABY B;  1O1J A;  3A2G A;  5JDO E;  109M A;  4F6G A;  2MHB B;  5EE4 C;  1YIH B;  1DXV B;  2MYD A;  1GCV B;  1MNH A;  1VXB A;  1VXE A;  1OUT A;  3PI2 A;  2D5X A;  3WCT B;  1QI8 B;  1MWB A;  1FAW B;  1YFF B;  3ASE A;  4MQJ B;  1Y8K B;  1QI8 A;  3GK9 A;  3NFE A;  2PGH B;  4U8U B;  4HRR B;  2QRW A;  2QU0 A;  1K1K B;  2VHB A;  2ZLU B;  2ZS1 A;  2ZLV A;  1Y8I A;  2MGH A;  3A5G A;  5HBI A;  1HAB B;  2WY4 A;  1GCV A;  2DN1 B;  3OZW A;  3OO5 A;  1FHJ A;  6HBI A;  3WCT C;  3UHE A;  3GYS A;  3UHT A;  1M9P B;  1S56 A;  4N7O A;  5HLU A;  2MGL A;  2O5L X;  1Y4R B;  1XCH A;  3CIU B;  1TU9 A;  3MN0 A;  5JOM A;  3UHS A;  1Y7Z A;  2AA1 A;  2MGI A;  2ZSS A;  4O4Z A;  2D5Z B;  1X9F B;  1DTI A;  2OH9 A;  4HHB B;  2DC3 A;  2JHO A;  4O35 A;  2MYC A;  3E4N A;  1Y31 B;  1G0B A;  1LH7 A;  1YHE A;  2D2M B;  1Y0A A;  2QSS B;  3ONZ B;  3IC0 B;  1MBC A;  3LB2 A;  1XQ5 B;  4XS0 A;  4YU3 B;  4O1T A;  1MTK A;  1U7S A;  2MBW A;  1JY7 A;  2B7H A;  1DWR A;  1A6N A;  1UVY A;  1BUW B;  1XZ7 B;  1HHO A;  4H07 A;  3ZJO A;  2W72 B;  2AUO A;  1O1L A;  3GQR A;  3WTG B;  1DLW A;  2PEG B;  3CY5 A;  4MAX A;  3ZJS A;  3SZK B;  3A5A A;  1LH6 A;  1FN3 B;  3AQ5 A;  3WCV B;  2Z6N B;  1MZ0 A;  2R4W A;  2O58 X;  1QSI B;  1DM1 A;  2ZT4 A;  5HLX A;  1Y4G B;  1YEO A;  1HBA A;  3A5B A;  3D4X A;  3D1A A;  2MGM A;  4H0B A;  2W6V B;  4MXK A;  5JDO F;  1A6K A;  1O1I A;  3PIA B;  1Y35 B;  1XZ4 B;  4L7Y B;  1OR6 A;  2EF2 A;  1RQA A;  1NAZ A;  1YHU A;  1J7Y A;  4F6F A;  3ZJJ A;  3RGK A;  1FDH A;  3GOU A;  1A3O A;  2D2N D;  4MBN A;  1C7D A;  4FH6 A;  4IRO B;  2BK9 A;  2IG3 A;  5EYJ A;  1A3N B;  2MGC A;  1YE2 A;  3DHT B;  1BVD A;  1WMU A;  2MGD A;  112M A;  3HC9 A;  3HRW B;  1Y0W B;  1GCW A;  1YIE A;  1YEO B;  1SPE A;  4NXA A;  3QZZ A;  3G4R A;  1Y0T A;  2VLY A;  1J41 B;  2GRH A;  3BOM A;  3ZJH A;  1A00 B;  5JGG B;  3WCV A;  1S61 A;  4O4T A;  5B85 A;  2R80 B;  4HRT A;  3UHK A;  108M A;  1A0Z B;  4ILZ A;  1Y85 B;  3EU1 B;  2OHA A;  1CH5 A;  5EV5 A;  4N7P A;  1MYT A;  2AV0 A;  1MOD A;  3S66 A;  1YHU D;  1SDL B;  3E5O A;  1JY7 B;  4N8T A;  1BZ1 B;  4M4A A;  2QLS B;  1JZL A;  3HEN A;  3WCP B;  2YRS A;  2H35 A;  3WCP A;  2D2M A;  3P5Q B;  3AQ9 A;  5HAV A;  2VEE A;  4NI0 A;  1XZ5 A;  4MQK B;  5EOH A;  3OO4 A;  1YH9 A;  2ZSP A;  103M A;  3IC2 B;  111M A;  1A6G A;  1NZ3 A;  2DHB B;  4ESA B;  3QJE A;  1XXT A;  1RVW B;  1CG5 A;  1YZI A;  110M A;  3UHD A;  2O5M X;  2AA1 B;  3OZV A;  2WTH A;  1Y85 A;  1A0Z A;  1MBO A;  2M6Z A;  1SWM A;  1IT2 A;  1SPG B;  2R80 A;  4MQI A;  3PT8 A;  3GQG A;  3UHZ A;  1G9V A;  4PQB A;  1J41 A;  1YVQ B;  3WCU A;  1YEN B;  1WVP A;  2DN3 B;  1XZU B;  3OO5 B;  2ZLX A;  2RI4 A;  2OH8 A;  2GLN A;  1QXD B;  3DHT A;  1NZ2 A;  2ZLU A;  1S0H A;  1HBG A;  2QU0 B;  1YGD B;  1C7C A;  2ZT3 A;  3TM9 A;  1OUU A;  1JWN A;  3AT5 A;  1Y8K A;  1I3E A;  4MQJ A;  2BLH A;  1LFV B;  1GJN A;  3QM8 A;  2D5X B;  2ZFO C;  1MBN A;  4FC3 A;  1HGB A;  3GLN A;  3KUO A;  1COH B;  2NRL A;  1DUO A;  5HLQ A;  5CNE A;  1ITH A;  1A0U A;  1CMY A;  106M A;  1O1I B;  1VWT A;  5HU6 A;  3D4X B;  102M A;  101M A;  3UHV A;  1YHU C;  4M4B B;  2FRK X;  2XKG A;  3BJ3 A;  1CG8 B;  3UHQ A;  1ECO A;  1CIO A;  1VRE A;  1YOH A;  1NS9 B;  2VYY A;  1R1Y B;  1FN3 A;  3UGY A;  3CY5 B;  2PEG A;  4MQH A;  1A4F A;  1VRF A;  2BKM A;  1Y4P A;  4HBI A;  3VRF B;  1MYZ A;  3A59 A;  2W31 A;  1HHO B;  1MLO A;  3W4U B;  3DUT A;  5B84 A;  1IOP A;  2FRJ X;  2EB8 A;  3HHB A;  3MKB A;  2ZSZ A;  2ZT2 A;  2ZFB A;  1CBM A;  3LB4 A;  1NWN A;  1HBR B;  1DO7 A;  1MDN A;  2W6Y A;  3AQ6 A;  1Y5K B;  1YHE B;  1Y45 B;  3PT7 B;  5E29 B;  1QSH A;  1YHR B;  2SPL A;  5E29 A;  1N9I A;  2AUP A;  2ZS0 C;  1MBD A;  1MCY A;  3RJ6 A;  4G51 B;  3NMM B;  3ORD A;  1JL7 A;  1HBR A;  3MJP A;  4G1V A;  4U8U C;  2HHD A;  1ECD A;  4NI1 B;  5HU6 B;  3W4U A;  1YEQ A;  3GYS B;  3ECX A;  2LH3 A;  1Y4P B;  1LFY A;  4MQH B;  1MLH A;  3BCQ A;  1MNO A;  1R1Y A;  4G1B A;  2MYB A;  1Y8I B;  2VRY A;  2ZS1 B;  3HYU B;  3WI8 A;  1D8U A;  1HGA B;  1SHR A;  2QFK A;  2G0R A;  2VM0 A;  2HBC B;  1S5X A;  1LFL A;  1O1P B;  4FWZ A;  1LFV A;  5EUI B;  4NS2 A;  5IKS A;  2EVK A;  1CH4 A;  3WFX A;  3ECL A;  1OUU B;  3QMA A;  3NG6 B;  1LFQ A;  5C6E A;  1J40 A;  2QFN A;  2G11 A;  2ZS0 D;  1A0U B;  1Y4B A;  2HCO A;  3QJB B;  3ZHW A;  1LHT A;  3AQ8 A;  1HGB B;  2V1H A;  2HBS A;  1DXT B;  3KMF A;  1O1M A;  2O5B X;  3GQG B;  2D2M D;  104M A;  3AT5 B;  4ROM B;  5CN5 A;  1Y5F B;  2ZLW A;  3PEL A;  4ESA A;  4F6J A;  1J3Z A;  1G08 A;  2H8F B;  1CH7 A;  1URV A;  1Y0C A;  2VLX A;  5HY8 A;  5EU2 A;  1CH3 A;  3D7O A;  2DN3 A;  3UHY A;  4NI0 B;  1YEU A;  5CN7 A;  3K3U A;  3ARK A;  3G53 A;  1HBS A;  2D2N B;  1YOI A;  1F5O A;  2HBF B;  3R0G A;  1MLK A;  2Z6T A;  1THB B;  2O5O X;  5MBA A;  2KSC A;  1NZ5 A;  1O1O B;  1GDI A;  3WCV D;  1DTM A;  1YGF A;  1Y7D A;  2ZT0 A;  5CNG A;  1V75 B;  2DN2 B;  3WCW B;  2G10 A;  6HBW A;  3BJ2 B;  1NEJ B;  3QJE B;  4WCH D;  1Y22 A;  3BJ2 A;  2R1H A;  3WCW A;  1YH9 B;  3WCU D;  3GDJ A;  5AB8 A;  1Y7C A;  1MLL A;  2VYZ A;  2W6X A;  4JAC A;  1A01 A;  1Y4F A;  2YRS B;  3G4V A;  1FCS A;  2G0Z A;  4H2L B;  2HBF A;  3BOM B;  1IWH B;  2D2N A;  1XY0 A;  3MYN A;  1X46 A;  3LQD A;  4MBA A;  3BA2 A;  1BZ1 A;  1MNK A;  1VXF A;  1MLS A;  2ZFO D;  4LPI A;  1C40 B;  3D7O B;  1BVC A;  4DWU A;  5EET A;  3AQ7 A;  3S66 B;  2BLI A;  1MYG A;  2OHB A;  1J3Z B;  1Y01 B;  1Y7G B;  4NK2 A;  2ZLW B;  1HJT A;  1MYH A;  3PI3 A;  3VRG B;  2FRI X;  4HRT B;  3O7N A;  1MOC A;  3ZOM A;  1UMO A;  1DXT A;  2ZSY A;  2ZFO A;  1Y0T B;  2HHE A;  3PI8 A;  5KDQ B;  3WCW C;  3QJB A;  2O5T X;  1GCW B;  1YIE B;  3ZJM A;  2ZSN A;  1WMU B;  1YE0 A;  1YDZ B;  1XZ2 B;  1LFQ B;  1A3N A;  2W6V A;  1KD2 B;  1GDK A;  2GTL A;  1NS6 B;  3D17 B;  3HF4 B;  1DXD A;  4N7N B;  5EUI A;  1O1P A;  2NX0 A;  1LFL B;  2ZLT B;  1J7W B;  1S6A A;  1Y8H B;  5KDQ A;  1RPS A;  1V4X B;  1J7Y B;  1UFJ A;  1NPG A;  3M38 A;  2O5S X;  2HZ2 A;  5CND A; 
#chains in the Genus database with same CATH topology
 3BRP B;  1VXD A;  3BCQ B;  3SZK A;  1GBU A;  4L7Y A;  4AVD A;  2EVP A;  2MGA A;  3ARL A;  3M39 A;  1EBC A;  2ZSX A;  3QJD B;  3NUH B;  1Y4G A;  1XYE B;  2IN4 A;  3M3B A;  2FRF A;  1UX9 A;  4YU3 A;  4O2G A;  5CHR A;  4H2L A;  1FSL A;  2Z6N A;  3PI1 A;  2H8D B;  1DXC A;  2Z8A A;  1RQ3 B;  4FWY A;  4F0U A;  1RQ4 A;  4A8M P;  4KMV A;  1QSH B;  1O1L B;  3GQR B;  3WTG A;  1FDH G;  2HBE B;  2V8A B;  1JP8 A;  1OBM A;  5C6Y A;  1J7S B;  1YG5 B;  2Z6S A;  2ZSQ A;  4F6I A;  1B86 B;  4HHB A;  1NEJ A;  1HHT P;  2ZS0 A;  1YOG A;  1JP6 A;  3ZH0 A;  4BJA A;  1Y7Z B;  1ABS A;  3HHB B;  3MKB B;  5EE4 D;  4NXC A;  4N7O B;  2ZSR A;  1UVI A;  1THB A;  1LH1 A;  4VHB A;  2X49 A;  1JBO A;  2G3H A;  3A59 B;  1NGK A;  3ODQ B;  1UFP A;  4ZIZ A;  1Y0C B;  5HY8 B;  1NS9 A;  1G08 B;  1PMB A;  1PBX A;  2GNW A;  3V57 A;  3ZJP A;  4PNJ A;  1K1K A;  1N9F A;  1MYM A;  2D5Z A;  1EYX A;  1MDT A;  1AJG A;  1UVJ A;  1NQP A;  1MLQ A;  1FSX A;  1MNI A;  2LH1 A;  1MBS A;  1V4U B;  3IA3 B;  4F69 A;  1AZI A;  1BAB A;  1MLR A;  1O1M B;  2MGK A;  1FLP A;  3NML A;  2CMM A;  1CMY B;  3LB3 A;  1FHJ B;  1HLM A;  2HCO B;  4GXE A;  2J96 A;  1DXV A;  2DN1 A;  1GBV B;  4ERV A;  1COH A;  5CN4 A;  1HAB A;  3DR9 A;  1BZR A;  2ZLV B;  1SI4 A;  2R4X A;  2RAO B;  3G46 A;  5JDO C;  1HDA A;  1LA6 A;  1O1J B;  2G12 A;  1HAC A;  3UHN A;  4U8U A;  2PGH A;  1HDB A;  1GDL A;  5E83 A;  1FAW A;  1YFF A;  1V07 A;  4HSW A;  1OUT B;  1C7C B;  1YGD A;  1EYX B;  1HGA A;  1S5Y B;  2VEB A;  1VXA A;  1Z8U B;  1CQ2 A;  4A8O A;  1Y4Q A;  1CPW A;  2GTL C;  1BIJ B;  1JPB A;  3HEO A;  2ZS1 D;  1YIH A;  1YEN A;  2MHB A;  1DXU A;  1JEB B;  2UUL C;  3IXF A;  1V4W B;  4F4O A;  2MGB A;  3ZJL A;  1ABY A;  1BAB B;  3UH6 A;  3H58 A;  1G09 A;  3PT8 B;  1X9F C;  3WR1 B;  4DC7 A;  1B33 B;  3S65 A;  3V58 A;  1ABW A;  4UZV A;  4L2M A;  1CG5 B;  1CBL A;  3NMM A;  4NZI A;  2E2Y A;  2LHB A;  2GNV A;  1J7S A;  4C0N A;  1GDJ A;  1LH2 A;  4IT8 A;  1N9X A;  4ZIZ B;  4MQK A;  2HBE A;  1IRD B;  1AJ9 B;  1KTP A;  3ODQ A;  4FH7 A;  2BMM A;  5CHQ A;  3KMF C;  3PT7 A;  2G0S A;  1MBI A;  3MWN A;  1X3K A;  1RQ3 A;  3QQQ A;  2QMB A;  2H35 B;  5JDO D;  3K9Z A;  4DC8 A;  1MLF A;  3PMC A;  1O1K B;  1A87 A;  1MGN A;  2ZST A;  3MYM A;  1HRM A;  2QLS A;  1DLY A;  1XYE A;  4N8T B;  2NSR A;  1U7R A;  1CQX A;  5CN9 A;  1C7B A;  3GIO A;  4OOD A;  2V1K A;  1O1N A;  2MGG A;  1QPW A;  1B86 A;  1UVX A;  1YG5 A;  2GRZ A;  2G14 A;  3D1K B;  1MWD A;  2V8A A;  3ZOL A;  4A8Y A;  1NIH A;  3UHR A;  1J3F A;  2XKI A;  2V1I A;  5MBN A;  1RQ4 B;  1SDK A;  1Y0D A;  1MYI A;  1T1N B;  1HA7 B;  1XZV A;  1NXF A;  2C0K A;  3K8B A;  1CG8 A;  1A9W E;  1MBA A;  3BJ3 B;  1NPF A;  1X9F D;  1Y09 A;  1OFJ A;  1UIW A;  2ZLT A;  4Z8K B;  3ZJQ A;  3UH5 A;  3AT6 B;  4TYX A;  3MOU A;  1LJW A;  3HF4 A;  4B3W A;  2SPN A;  1YE2 B;  3PI9 B;  3B75 B;  1XF6 C;  1QXE B;  3DHR B;  1VWT B;  3TM3 A;  1YMB A;  3O2C A;  5D1V A;  1YE0 B;  1S69 A;  4ZVB A;  1JZK A;  1LIA A;  2GKM A;  5CN8 A;  1MLN A;  5AZR A;  2HHE B;  105M A;  4FC3 B;  1CPC A;  1YHU B;  1RPS B;  1RSE A;  3L0F B;  1J7W A;  1Y8H A;  3QJC A;  1MTJ A;  1K0Y A;  1V9Q A;  1YVT A;  1CP5 A;  3RJN B;  1BBB B;  4X0L A;  4ETU A;  4ODC B;  1QGW C;  2GTL B;  1S0H B;  1CII A;  2HBD A;  3AT6 A;  3V2V A;  1HV4 B;  1MLU A;  1XZU A;  4Z8K A;  1C40 A;  1UX8 A;  3G4Y A;  3PI8 B;  1HDS B;  3BJ1 A;  1VXC A;  1CIK A;  1HGC A;  3LQD B;  3UHB A;  1B0B A;  5KER B;  1QSI A;  1XZV B;  1CLS A;  3HXN B;  2C7L A;  1A01 B;  1T1N A;  5AQD M;  1SDK B;  1MYJ A;  2HHB A;  1H97 A;  1NIH B;  4UUR A;  2R50 A;  1F0L A;  4DWT A;  2D2N C;  1HBH A;  1Y7G A;  2R1H B;  4ZVA A;  1BJE A;  1Y22 B;  2DHB A;  1MKO A;  1YCB A;  6HBW B;  3IC2 A;  1HCO A;  3A0G B;  3V2Z A;  5SW7 B;  2DKD A;  1Y7D B;  1XZ5 B;  1BZ6 A;  2BW9 M;  1JF3 A;  5CMV A;  1LH3 A;  1O1K A;  1Y4F B;  4NK1 A;  1Y0A B;  1HBB A;  1O16 A;  4M4A B;  2R4Z A;  2XKH A;  1V5H A;  4TMA B;  1EMY A;  1IRD A;  3OJ1 A;  1SDL A;  2BLJ M;  1BZ0 A;  5ILP A;  1HCO B;  2NSS A;  4N7P B;  1OJ6 A;  3HEP A;  1HBH B;  2DN2 A;  1LHS A;  2ZWJ A;  5CN6 A;  3CIU A;  1Y4R A;  2W6W A;  4PQC A;  2W72 C;  2C7L B;  4A8S A;  5JGG A;  3HXN A;  2JL9 A;  3ZJI A;  4F6D A;  1MLJ A;  3UHH A;  2HZ3 A;  1HBS B;  2HBS B;  1YMA A;  3UHI A;  1JEB A;  1DXU B;  1VXH A;  1UC3 A;  1YEU B;  1GZX A;  5EQM A;  2C7K B;  3G4U A;  2V1E A;  3OZU A;  1MLG A;  1BIJ A;  2V1F A;  4KMW A;  2WTG A;  4A8W A;  1JL6 A;  3UBC A;  4MQC A;  2ZSO A;  3LHB A;  4IRO A;  3NFE B;  5D5R A;  2D2M C;  4X0L B;  1HBI A;  3LB1 A;  1C7D B;  1DKE B;  3S1J A;  3MVC A;  3GOU B;  1HDB B;  2HBC A;  1DO4 A;  2HBG A;  2D60 B;  3LR9 A;  1SHR B;  1EWA A;  1HI8 A;  2VLZ A;  1CH9 A;  1SI4 B;  5CNF A;  4F6B A;  3MBA A;  5ILR A;  1GBV A;  1Y4B B;  3ED9 A;  3H57 A;  1Y5J A;  1Y35 A;  1R1X B;  2GDM A;  1F99 B;  1Y2Z B;  3DHR A;  1URY A;  2FAL A;  1Y4V A;  3DBJ B;  3NL7 A;  1DO1 A;  3UI0 A;  1Y8W A;  1FSX B;  3MJP B;  1S5X B;  2MYE A;  2G0V A;  1JP9 A;  1B8D B;  3GQP B;  1GLI B;  3E5I A;  1PBX B;  4WJG A;  1HA7 A;  1YHR A;  1CP0 A;  3QM5 A;  3WHM A;  1J52 A;  2AUQ A;  3GUQ A;  4NI1 A;  3R5I B;  1QPW B;  1BZZ B;  1TES A;  1YEV A;  1CH2 A;  4U8U D;  1RTX A;  3FS4 B;  2HHD B;  1O1N B;  1HSY A;  4C44 A;  3UGZ A;  3PI4 A;  1C7B B;  2B7H B;  3FH9 A;  3WCV C;  1YEV B;  4G51 A;  1NWI A;  1BZZ A;  3OGB A;  2O5Q X;  1F65 A;  1DUK A;  3DUT B;  3IC0 A;  2QMB B;  2MB5 A;  1Y31 A;  2LH5 A;  1DDT A;  2QSP A;  4HSX A;  3WCU C;  4FWX A;  3SDH A;  5B13 G;  2ZT1 A;  1UT0 A;  3AG0 A;  3GQP A;  3FH9 B;  3UH3 A;  3WR1 A;  2ZFB B;  1M6C A;  3QJD A;  4N6S A;  1Y46 B;  3FS4 A;  3ZJN A;  3DBJ A;  1Q1F A;  2DKC A;  3WCT D;  2VJR A;  4H0M B;  3S48 C;  2VJT B;  1F63 A;  1IRC A;  1F99 A;  4F4O B;  1CH1 A;  1R1X A;  1DWS A;  4SDH A;  1Y5J B;  1AJH A;  1A4F B;  1W92 A;  3UH7 A;  1UVK A;  3EDA A;  1Y4Q B;  2V1J A;  1GLI A;  3OK5 A;  2DXM A;  2D60 A;  1OFK A;  2VYW A;  1LFZ A;  2EKT A;  1Y8W B;  4N7N A;  1Y4V B;  1F5P A;  1HAC B;  1NS6 A;  5F0B A;  3U3E A;  2YSK A;  1Y2Z A;  5CNC A;  2RAO A;  1G0A B;  1LFT A;  2AV3 A;  1I3D A;  4ROL B;  1YDZ A;  1BZP A;  4OF9 A;  5AZQ A;  1GH0 B;  2RI4 B;  5F2A A;  1GZX B;  3LR7 A;  4KN3 A;  1EW6 A;  1YVQ A;  3WCU B;  1KR7 A;  1G9V B;  1CO8 A;  2R4Y A;  2FAM A;  2WCR A;  3KUN A;  5EYS A;  1JZM A;  2AUR A;  1WLA A;  1V4U A;  1MWC A;  4PO5 A;  1Y83 B;  1DKE A;  3UHG A;  2M6Z B;  2C7J B;  1NQP B;  1OR4 A;  1HLB A;  1JW8 A;  3VRG A;  3QQR A;  3E55 A;  4MQC B;  5KKK A;  1RVW A;  2DKA A;  4F68 A;  1MOB A;  4TWV A;  4KJT A;  4GZG A;  1QXD A;  2SPM A;  5E6E A;  1LUE A;  3OO4 B;  2GL3 A;  3UHX A;  2ZLX B;  3SDN A;  1RH1 A;  3KVS B;  3P5Q A;  1IWH A;  4JYQ A;  3UBV A;  107M A;  4Q70 A;  4MQI B;  2GTL D;  1SPG A;  1HHS A;  1IBE B;  2BNL A;  1GVH A;  5SW7 A;  2GKN A;  4HH1 A;  1XXT B;  1YZI B;  2ZS0 B;  2V1G A;  5ILE A;  1BIN A;  2OIF A;  1N9H A;  1BZ0 B;  1ASH A;  4TWU A;  1YCA A;  3EU1 A;  4MQG B;  1CO9 A;  1YGF B;  2GRF A;  2EKU A;  3G52 A;  1O1O A;  1HBB B;  1RTE A;  2H8D A;  4MPM A;  3ZJR A;  1CLS B;  2LH6 A;  1M6M A;  2Z85 A;  5KER A;  3EOK A;  3ARJ A;  1JF4 A;  3WFW A;  3VRE A;  1ECN A;  3UHU A;  1Y0W A;  5CNB A;  1HV4 A;  3HRW A;  4YU4 B;  2H8F A;  3A0G A;  4WJG 1;  1MKO B;  1YMC A;  1MNJ A;  1DWT A;  1H1X A;  4ODC A;  1EBT A;  1BBB A;  2HHB B;  1K0Y B;  1Y83 A;  1GBU B;  2MGF A;  3QJC B;  1A00 A;  4ETV A;  1J3Y A;  5M3S A;  1HGC B;  1V4X A;  1COL A;  3BJ1 B;  1HDS A;  1MOA A;  3WCW D;  1LTW A;  3GKV B;  1RQA B;  1VXG A;  2ZS1 C;  2VJH A;  2EB9 A;  2HBD B;  3A9M A;  3PIA A;  2UUM A;  3D17 A;  4ROL A;  3MJU B;  2XYK A;  1J40 B;  4XDI A;  1G0A A;  1LFT B;  5C6E B;  3NG6 A;  1KD2 A;  3B75 A;  3MJU A;  1ECA A;  1HBA B;  3GKT A;  1XZ2 A;  3UHW A;  1YVT B;  2VJH B;  1A3O B;  1LFZ B;  3VAU A;  4AVE A;  7HBI A;  2D6C A;  1Y09 B;  3GKV A;  2DXM B;  2ZFO B;  3HYU A;  1J3Y B;  2HZ1 A;  3QZX A;  5B13 A;  4LMX B;  2BWH A;  1LIA B;  1LFY B;  1XZ4 A;  1YEQ B;  2MYA A;  3D1A B;  2VJT A;  1BUW A;  1XZ7 A;  4H0M A;  1QXE A;  3PI9 A;  1Y46 A;  4N6S B;  2UUL H;  1LJW B;  4YU4 A;  1UIW B;  1A9W A;  2SPO A;  3VRE B;  4MXL A;  1JDO A;  3QM6 A;  3EOK B;  1XY0 B;  2VML A;  3K8B B;  4ERT A;  2QSS A;  3ONZ A;  3M3A A;  5ILM A;  1Y0D B;  2MGJ A;  2MGE A;  2QSP B;  1G0B B;  4MQG A;  3QM7 A;  1Y45 A;  1Y7C B;  2W72 A;  1MOH A;  1UVL A;  2NRM A;  3GDJ B;  2G0X A;  1Y5K A;  2OLP A;  3D1K A;  1NZ4 A;  4BJU A;  1X9F A;  1V75 A;  1ABW B;  4UIQ A;  3TLD A;  3S65 B;  1UVN A;  4PQ6 A;  1MYF A;  1KFR A;  1IBE A;  3VHB A;  3OVU C;  4Q70 B;  3QM9 A;  1G09 B;  2LH2 A;  3EDB A;  4XS0 B;  3R5I A;  1M9P A;  1VHB A;  1XQ5 A;  3G4W A;  4L1E A;  1V4W A;  4AE1 A;  1IDR A;  3VRF A;  1L2K A;  3WFT A;  3WHM B;  1AJ9 A;  5E6E B;  4B4Y A;  3ECZ A;  3UHC A;  1LH5 A;  1S5Y A;  3PEL B;  1IT3 A;  1A6M A;  1Y5F A;  4HRR A;  3O89 A;  4M4B A;  1DO3 A;  1B33 A;  4MU5 A;  4ROM A;  3S1I A;  3G4Q A;  2LH7 A;  4QAU A;  3NL7 B;  5E83 B;  3WCT A;  1MLM A;  3WFU A;  2BV8 A;  1HDA B;  1LA6 B;  1MTI A;  1ABY B;  1O1J A;  3A2G A;  2WCQ A;  109M A;  5JDO E;  1ON7 B;  4F6G A;  2MHB B;  5EE4 C;  1YIH B;  1DXV B;  4GXE B;  2MYD A;  1GCV B;  1MNH A;  1PHN B;  1VXB A;  1VXE A;  2BV8 B;  1OUT A;  3PI2 A;  2D5X A;  3WCT B;  1QI8 B;  1MWB A;  1FAW B;  1YFF B;  3ASE A;  3O18 A;  4MQJ B;  1Y8K B;  1QI8 A;  3GK9 A;  3NFE A;  2PGH B;  4U8U B;  4HRR B;  2QRW A;  4A8K A;  2QU0 A;  1K1K B;  2VHB A;  2ZLU B;  2ZS1 A;  2ZLV A;  4B02 A;  1Y8I A;  2MGH A;  3A5G A;  5HBI A;  1HAB B;  2WY4 A;  1GCV A;  2DN1 B;  3OZW A;  3OO5 A;  1FHJ A;  4ETT A;  6HBI A;  3WCT C;  3UHE A;  3GYS A;  3UHT A;  1I7Y A;  1M9P B;  1S56 A;  4N7O A;  5HLU A;  2MGL A;  2O5L X;  1Y4R B;  1XCH A;  3CIU B;  1TU9 A;  3MN0 A;  5JOM A;  3UHS A;  1Y7Z A;  2AA1 A;  2MGI A;  2ZSS A;  4O4Z A;  2D5Z B;  1X9F B;  1DTI A;  2OH9 A;  4HHB B;  2DC3 A;  2JHO A;  4O35 A;  4LM6 B;  2MYC A;  3E4N A;  3FEW X;  1Y31 B;  1G0B A;  1LH7 A;  1YHE A;  2D2M B;  1Y0A A;  2QSS B;  3ONZ B;  3IC0 B;  1JBO B;  1MBC A;  3LB2 A;  1XQ5 B;  4L1E B;  4XS0 A;  4YU3 B;  4O1T A;  1MTK A;  1U7S A;  2MBW A;  1JY7 A;  2B7H A;  1KN1 B;  1DWR A;  1A6N A;  1NY9 A;  1UVY A;  1BUW B;  1XZ7 B;  1HHO A;  4H07 A;  3ZJO A;  2W72 B;  2AUO A;  1O1L A;  3GQR A;  3WTG B;  1DLW A;  2PEG B;  3CY5 A;  4MAX A;  3ZJS A;  3SZK B;  3A5A A;  1LH6 A;  1FN3 B;  3AQ5 A;  3WCV B;  2Z6N B;  1MZ0 A;  2R4W A;  2O58 X;  1QSI B;  1DM1 A;  2ZT4 A;  1B8D A;  5HLX A;  1Y4G B;  1YEO A;  4F0T A;  1HBA A;  3A5B A;  3D4X A;  3D1A A;  2MGM A;  4GY3 B;  4H0B A;  2W6V B;  4MXK A;  5JDO F;  1A6K A;  1O1I A;  2UUM B;  3PIA B;  1Y35 B;  1XZ4 B;  5FVB M;  2JLF A;  4L7Y B;  1OR6 A;  2EF2 A;  1RQA A;  1NAZ A;  1YHU A;  1CPC B;  1J7Y A;  2UUL D;  4F6F A;  3ZJJ A;  3RGK A;  1FDH A;  3GOU A;  1A3O A;  2D2N D;  4MBN A;  1C7D A;  4FH6 A;  4RMP A;  3O2C B;  4IRO B;  2BK9 A;  2IG3 A;  5EYJ A;  1A3N B;  2MGC A;  1YE2 A;  3DHT B;  1BVD A;  1WMU A;  2MGD A;  112M A;  3HC9 A;  3HRW B;  1Y0W B;  2C7K A;  1GCW A;  1YIE A;  1YEO B;  4F0T B;  1SPE A;  4NXA A;  1ALL A;  3QZZ A;  3G4R A;  1Y0T A;  3PMD A;  2VLY A;  1J41 B;  2GRH A;  3BOM A;  3ZJH A;  1A00 B;  4LMS B;  5JGG B;  3WCV A;  1S61 A;  4O4T A;  5B85 A;  2R80 B;  4HRT A;  2X4A A;  3UHK A;  108M A;  1A0Z B;  4ILZ A;  1Y85 B;  3VNC A;  3EU1 B;  2OHA A;  1CH5 A;  5EV5 A;  4N7P A;  1MYT A;  2AV0 A;  1MOD A;  2UUL A;  3S66 A;  1YHU D;  1SDL B;  2UUM X;  1KN1 A;  3E5O A;  1JY7 B;  4N8T A;  4ESU A;  1BZ1 B;  4M4A A;  2QLS B;  1JZL A;  3HEN A;  3WCP B;  2YRS A;  2H35 A;  3WCP A;  2D2M A;  3KVS A;  3P5Q B;  3AQ9 A;  5HAV A;  2VEE A;  4NI0 A;  1XZ5 A;  4MQK B;  5EOH A;  3OO4 A;  1YH9 A;  2ZSP A;  103M A;  3IC2 B;  3ZTA A;  111M A;  1A6G A;  1NZ3 A;  2DHB B;  2UUN A;  4AE0 A;  4ESA B;  3QJE A;  1XXT A;  1RVW B;  1CG5 A;  1YZI A;  3V58 B;  110M A;  3UHD A;  2O5M X;  2AA1 B;  3OZV A;  2WTH A;  1Y85 A;  1A0Z A;  1MBO A;  2M6Z A;  1SWM A;  1IT2 A;  1SPG B;  2R80 A;  4PO5 B;  4MQI A;  3PT8 A;  3GQG A;  1I7Y B;  3UHZ A;  1G9V A;  4PQB A;  2I88 A;  1J41 A;  1YVQ B;  3WCU A;  1YEN B;  1WVP A;  2DN3 B;  1XZU B;  1TOX A;  3OO5 B;  2ZLX A;  2RI4 A;  1GH0 A;  2OH8 A;  2GLN A;  1QXD B;  3DHT A;  1NZ2 A;  2ZLU A;  1S0H A;  1HBG A;  2QU0 B;  1YGD B;  1C7C A;  2ZT3 A;  3TM9 A;  1OUU A;  1JWN A;  3AT5 A;  1Y8K A;  1I3E A;  3O18 B;  4MQJ A;  2BLH A;  1LFV B;  1GJN A;  3QM8 A;  2D5X B;  2ZFO C;  1UVM A;  1MBN A;  1XDT T;  4FC3 A;  1PHN A;  1HGB A;  3GLN A;  3KUO A;  1COH B;  2NRL A;  1DUO A;  5HLQ A;  5CNE A;  1HI1 A;  1ITH A;  1A0U A;  1CMY A;  106M A;  1O1I B;  1VWT A;  5HU6 A;  3D4X B;  102M A;  4GY3 A;  4A8F A;  3RQR A;  101M A;  3UHV A;  1YHU C;  4M4B B;  3LQ9 A;  2FRK X;  2XKG A;  3BJ3 A;  1CG8 B;  3UHQ A;  1ECO A;  3V57 B;  1CIO A;  1VRE A;  1YOH A;  1NS9 B;  2VYY A;  1R1Y B;  1FN3 A;  3UGY A;  3CY5 B;  2PEG A;  4MQH A;  1A4F A;  1VRF A;  2BKM A;  1Y4P A;  4HBI A;  3VRF B;  1MYZ A;  3A59 A;  2W31 A;  1HHO B;  1MLO A;  3W4U B;  3DUT A;  5B84 A;  1IOP A;  2FRJ X;  2VJR B;  2EB8 A;  4YJJ B;  3HHB A;  3MKB A;  2ZSZ A;  2ZT2 A;  2ZFB A;  1CBM A;  3LB4 A;  1NWN A;  1HBR B;  1WAC A;  1DO7 A;  1MDN A;  2W6Y A;  3AQ6 A;  1Y5K B;  1YHE B;  1Y45 B;  3PT7 B;  5E29 B;  1KTP B;  1QSH A;  1YHR B;  2SPL A;  5E29 A;  1N9I A;  2AUP A;  2ZS0 C;  1MBD A;  1MCY A;  3RJ6 A;  4G51 B;  3NMM B;  3ORD A;  1JL7 A;  1HBR A;  3MJP A;  4G1V A;  4U8U C;  2HHD A;  1ECD A;  4YJJ A;  4NI1 B;  5HU6 B;  3W4U A;  1YEQ A;  3GYS B;  3ECX A;  2LH3 A;  1Y4P B;  1LFY A;  4MQH B;  1MLH A;  3BCQ A;  1MNO A;  1R1Y A;  4G1B A;  2MYB A;  1XG0 C;  1Y8I B;  2VRY A;  2ZS1 B;  3HYU B;  4XXK A;  3WI8 A;  1D8U A;  1HGA B;  1SHR A;  2QFK A;  2G0R A;  4BS9 A;  2VM0 A;  2HBC B;  1S5X A;  1LFL A;  1O1P B;  4FWZ A;  1LFV A;  5EUI B;  4NS2 A;  5IKS A;  2EVK A;  1CH4 A;  3WFX A;  3ECL A;  1OUU B;  3QMA A;  3NG6 B;  1LFQ A;  1J40 A;  5C6E A;  2QFN A;  2G11 A;  5FVB A;  2ZS0 D;  1A0U B;  2UUN D;  1Y4B A;  2HCO A;  3QJB B;  3ZHW A;  1LHT A;  3AQ8 A;  1HGB B;  2V1H A;  1ON7 A;  2HBS A;  1DXT B;  3KMF A;  1O1M A;  2O5B X;  3GQG B;  2D2M D;  104M A;  3AT5 B;  4ROM B;  5CN5 A;  1Y5F B;  2ZLW A;  3PEL A;  4ESA A;  4F6J A;  1J3Z A;  1G08 A;  2H8F B;  1CH7 A;  1URV A;  1Y0C A;  2VLX A;  5HY8 A;  5EU2 A;  1CH3 A;  3D7O A;  2DN3 A;  3UHY A;  4NI0 B;  1YEU A;  5CN7 A;  3K3U A;  3ARK A;  3G53 A;  1HBS A;  2D2N B;  1YOI A;  1F5O A;  2HBF B;  3R0G A;  1MLK A;  2Z6T A;  1THB B;  2O5O X;  5MBA A;  2KSC A;  1NZ5 A;  1O1O B;  1GDI A;  3WCV D;  1DTM A;  1YGF A;  1Y7D A;  2ZT0 A;  5CNG A;  1V75 B;  2DN2 B;  3WCW B;  2G10 A;  6HBW A;  3BJ2 B;  1NEJ B;  3QJE B;  4WCH D;  2UUN B;  1Y22 A;  1SGK A;  2R1H A;  3BJ2 A;  4XXI A;  3WCW A;  1YH9 B;  3WCU D;  3GDJ A;  5AB8 A;  1Y7C A;  2JLG A;  1MLL A;  2VYZ A;  2W6X A;  4JAC A;  4F0U B;  1A01 A;  1Y4F A;  2YRS B;  3G4V A;  1FCS A;  2G0Z A;  4H2L B;  2HBF A;  3BOM B;  1IWH B;  2D2N A;  1XY0 A;  3MYN A;  2VML B;  1X46 A;  3LQD A;  4MBA A;  3BA2 A;  1BZ1 A;  1MNK A;  1ALL B;  1MLS A;  1VXF A;  2ZFO D;  4LPI A;  1C40 B;  3D7O B;  1BVC A;  4DWU A;  5EET A;  3AQ7 A;  2UUL B;  3S66 B;  2BLI A;  1MYG A;  2OHB A;  1J3Z B;  1Y01 B;  1Y7G B;  4NK2 A;  2ZLW B;  1HJT A;  1MYH A;  3PI3 A;  3VRG B;  2FRI X;  2C7J A;  5AQD A;  1HI0 P;  4A8Q A;  4HRT B;  3O7N A;  1MOC A;  3BRP A;  3ZOM A;  1UMO A;  1DXT A;  2ZSY A;  2ZFO A;  1Y0T B;  2HHE A;  3PI8 A;  5KDQ B;  3WCW C;  3QJB A;  2O5T X;  1GCW B;  1YIE B;  3ZJM A;  2ZSN A;  1WMU B;  1YE0 A;  1YDZ B;  1XZ2 B;  4HH0 A;  1LFQ B;  1A3N A;  2W6V A;  1KD2 B;  1GDK A;  2GTL A;  1NS6 B;  3D17 B;  3HF4 B;  4RMP B;  1DXD A;  4N7N B;  5EUI A;  1O1P A;  2NX0 A;  1LFL B;  2ZLT B;  1J7W B;  1S6A A;  1Y8H B;  5KDQ A;  3L0F A;  1RPS A;  1V4X B;  1J7Y B;  1UFJ A;  1NPG A;  3M38 A;  2O5S X;  2HZ2 A;  5CND A; 
#chains in the Genus database with same CATH homology
 1VXD A;  3BCQ B;  3SZK A;  1GBU A;  4L7Y A;  4AVD A;  2EVP A;  2MGA A;  3ARL A;  3M39 A;  1EBC A;  2ZSX A;  3QJD B;  1Y4G A;  1XYE B;  2IN4 A;  3M3B A;  2FRF A;  1UX9 A;  4YU3 A;  4O2G A;  5CHR A;  4H2L A;  1FSL A;  2Z6N A;  3PI1 A;  2H8D B;  1DXC A;  2Z8A A;  1RQ3 B;  4FWY A;  1RQ4 A;  4KMV A;  1QSH B;  1O1L B;  3GQR B;  3WTG A;  1FDH G;  2HBE B;  1JP8 A;  1OBM A;  5C6Y A;  1J7S B;  1YG5 B;  2Z6S A;  2ZSQ A;  4F6I A;  1B86 B;  4HHB A;  1NEJ A;  2ZS0 A;  1YOG A;  1JP6 A;  3ZH0 A;  4BJA A;  1Y7Z B;  1ABS A;  3HHB B;  3MKB B;  5EE4 D;  4NXC A;  4N7O B;  2ZSR A;  1THB A;  1LH1 A;  4VHB A;  2G3H A;  3A59 B;  1NGK A;  3ODQ B;  1UFP A;  1Y0C B;  5HY8 B;  1NS9 A;  1G08 B;  1PMB A;  1PBX A;  2GNW A;  3ZJP A;  4PNJ A;  1K1K A;  1N9F A;  1MYM A;  2D5Z A;  1AJG A;  1NQP A;  1MLQ A;  1FSX A;  1MNI A;  2LH1 A;  1MBS A;  1V4U B;  3IA3 B;  4F69 A;  1AZI A;  1BAB A;  1MLR A;  1O1M B;  2MGK A;  1FLP A;  3NML A;  2CMM A;  1CMY B;  3LB3 A;  1FHJ B;  1HLM A;  2HCO B;  1DXV A;  2DN1 A;  1GBV B;  1COH A;  5CN4 A;  1HAB A;  3DR9 A;  1BZR A;  2ZLV B;  1SI4 A;  2R4X A;  2RAO B;  3G46 A;  5JDO C;  1HDA A;  1LA6 A;  1O1J B;  2G12 A;  1HAC A;  3UHN A;  4U8U A;  2PGH A;  1HDB A;  1GDL A;  5E83 A;  1FAW A;  1YFF A;  1V07 A;  4HSW A;  1OUT B;  1C7C B;  1YGD A;  1HGA A;  1S5Y B;  2VEB A;  1VXA A;  1Z8U B;  1CQ2 A;  1Y4Q A;  1CPW A;  2GTL C;  1BIJ B;  1JPB A;  3HEO A;  2ZS1 D;  1YIH A;  1YEN A;  2MHB A;  1DXU A;  1JEB B;  3IXF A;  1V4W B;  4F4O A;  2MGB A;  3ZJL A;  1ABY A;  1BAB B;  3UH6 A;  3H58 A;  1G09 A;  3PT8 B;  1X9F C;  3WR1 B;  4DC7 A;  3S65 A;  1ABW A;  4UZV A;  4L2M A;  1CG5 B;  1CBL A;  3NMM A;  4NZI A;  2E2Y A;  2LHB A;  2GNV A;  1J7S A;  4C0N A;  1GDJ A;  1LH2 A;  4IT8 A;  1N9X A;  4MQK A;  2HBE A;  1IRD B;  1AJ9 B;  3ODQ A;  4FH7 A;  2BMM A;  5CHQ A;  3KMF C;  3PT7 A;  2G0S A;  1MBI A;  1X3K A;  1RQ3 A;  3QQQ A;  2QMB A;  2H35 B;  5JDO D;  3K9Z A;  4DC8 A;  1MLF A;  1O1K B;  1MGN A;  2ZST A;  3MYM A;  1HRM A;  2QLS A;  1DLY A;  1XYE A;  4N8T B;  2NSR A;  1U7R A;  1CQX A;  5CN9 A;  1C7B A;  4OOD A;  2V1K A;  1O1N A;  2MGG A;  1QPW A;  1B86 A;  1UVX A;  1YG5 A;  2GRZ A;  2G14 A;  3D1K B;  1MWD A;  3ZOL A;  1NIH A;  3UHR A;  1J3F A;  2XKI A;  2V1I A;  5MBN A;  1RQ4 B;  1SDK A;  1Y0D A;  1MYI A;  1T1N B;  1XZV A;  1NXF A;  2C0K A;  3K8B A;  1CG8 A;  1A9W E;  1MBA A;  3BJ3 B;  1NPF A;  1X9F D;  1Y09 A;  1OFJ A;  1UIW A;  2ZLT A;  3ZJQ A;  3UH5 A;  3AT6 B;  4TYX A;  3MOU A;  1LJW A;  3HF4 A;  4B3W A;  2SPN A;  1YE2 B;  3PI9 B;  3B75 B;  1QXE B;  3DHR B;  1VWT B;  3TM3 A;  1YMB A;  5D1V A;  1YE0 B;  1S69 A;  4ZVB A;  1JZK A;  2GKM A;  5CN8 A;  1MLN A;  5AZR A;  2HHE B;  105M A;  4FC3 B;  1YHU B;  1RPS B;  1RSE A;  1J7W A;  1Y8H A;  3QJC A;  1MTJ A;  1K0Y A;  1V9Q A;  3RJN B;  1CP5 A;  1YVT A;  1BBB B;  4X0L A;  4ODC B;  2GTL B;  1S0H B;  2HBD A;  3AT6 A;  3V2V A;  1HV4 B;  1MLU A;  1XZU A;  1C40 A;  1UX8 A;  3G4Y A;  3PI8 B;  1HDS B;  3BJ1 A;  1VXC A;  1CIK A;  1HGC A;  3LQD B;  3UHB A;  1B0B A;  5KER B;  1QSI A;  1XZV B;  1CLS A;  3HXN B;  1A01 B;  1T1N A;  1SDK B;  1MYJ A;  2HHB A;  1H97 A;  1NIH B;  4UUR A;  2R50 A;  4DWT A;  2D2N C;  1HBH A;  1Y7G A;  2R1H B;  4ZVA A;  1BJE A;  1Y22 B;  2DHB A;  1MKO A;  1YCB A;  6HBW B;  3IC2 A;  1HCO A;  3A0G B;  3V2Z A;  5SW7 B;  1Y7D B;  1XZ5 B;  1BZ6 A;  2BW9 M;  1JF3 A;  5CMV A;  1LH3 A;  1O1K A;  1Y4F B;  4NK1 A;  1Y0A B;  1HBB A;  1O16 A;  4M4A B;  2R4Z A;  2XKH A;  1V5H A;  1EMY A;  1IRD A;  3OJ1 A;  1SDL A;  2BLJ M;  1BZ0 A;  5ILP A;  1HCO B;  2NSS A;  4N7P B;  1OJ6 A;  3HEP A;  1HBH B;  2DN2 A;  1LHS A;  2ZWJ A;  5CN6 A;  3CIU A;  1Y4R A;  2W6W A;  4PQC A;  2W72 C;  5JGG A;  3HXN A;  3ZJI A;  4F6D A;  1MLJ A;  3UHH A;  2HZ3 A;  1HBS B;  2HBS B;  1YMA A;  3UHI A;  1JEB A;  1DXU B;  1VXH A;  1UC3 A;  1YEU B;  1GZX A;  5EQM A;  3G4U A;  2V1E A;  3OZU A;  1MLG A;  1BIJ A;  2V1F A;  4KMW A;  2WTG A;  1JL6 A;  3UBC A;  4MQC A;  2ZSO A;  3LHB A;  4IRO A;  3NFE B;  5D5R A;  2D2M C;  4X0L B;  1HBI A;  3LB1 A;  1C7D B;  1DKE B;  3S1J A;  3MVC A;  3GOU B;  1HDB B;  2HBC A;  1DO4 A;  2HBG A;  2D60 B;  3LR9 A;  1SHR B;  1EWA A;  2VLZ A;  1CH9 A;  1SI4 B;  5CNF A;  4F6B A;  3MBA A;  5ILR A;  1GBV A;  1Y4B B;  3ED9 A;  3H57 A;  1Y5J A;  1Y35 A;  1R1X B;  2GDM A;  1Y2Z B;  3DHR A;  1URY A;  2FAL A;  1Y4V A;  3NL7 A;  1DO1 A;  3UI0 A;  1Y8W A;  1FSX B;  3MJP B;  1S5X B;  2MYE A;  2G0V A;  1JP9 A;  3GQP B;  1GLI B;  3E5I A;  1PBX B;  4WJG A;  1YHR A;  1CP0 A;  3QM5 A;  3WHM A;  1J52 A;  2AUQ A;  4NI1 A;  3R5I B;  1QPW B;  1BZZ B;  1TES A;  1YEV A;  1CH2 A;  4U8U D;  1RTX A;  3FS4 B;  2HHD B;  1O1N B;  1HSY A;  4C44 A;  3UGZ A;  3PI4 A;  1C7B B;  2B7H B;  3FH9 A;  3WCV C;  1YEV B;  4G51 A;  1NWI A;  1BZZ A;  3OGB A;  2O5Q X;  1F65 A;  1DUK A;  3DUT B;  3IC0 A;  2QMB B;  2MB5 A;  1Y31 A;  2LH5 A;  2QSP A;  4HSX A;  3WCU C;  4FWX A;  3SDH A;  2ZT1 A;  1UT0 A;  3AG0 A;  3GQP A;  3FH9 B;  3UH3 A;  3WR1 A;  2ZFB B;  1M6C A;  3QJD A;  1Y46 B;  3FS4 A;  3ZJN A;  1Q1F A;  3WCT D;  3S48 C;  1F63 A;  1IRC A;  4F4O B;  1CH1 A;  1R1X A;  1DWS A;  4SDH A;  1Y5J B;  1AJH A;  1A4F B;  1W92 A;  3UH7 A;  3EDA A;  1Y4Q B;  2V1J A;  1GLI A;  3OK5 A;  2DXM A;  2D60 A;  1OFK A;  2VYW A;  1LFZ A;  2EKT A;  1Y8W B;  4N7N A;  1Y4V B;  1F5P A;  1HAC B;  1NS6 A;  5F0B A;  3U3E A;  1Y2Z A;  5CNC A;  2RAO A;  1G0A B;  1LFT A;  2AV3 A;  1I3D A;  4ROL B;  1YDZ A;  1BZP A;  4OF9 A;  5AZQ A;  2RI4 B;  5F2A A;  1GZX B;  3LR7 A;  4KN3 A;  1EW6 A;  1YVQ A;  3WCU B;  1KR7 A;  1G9V B;  1CO8 A;  2R4Y A;  2FAM A;  3KUN A;  5EYS A;  1JZM A;  2AUR A;  1WLA A;  1V4U A;  1MWC A;  1Y83 B;  1DKE A;  3UHG A;  2M6Z B;  1NQP B;  1OR4 A;  1HLB A;  1JW8 A;  3VRG A;  3QQR A;  3E55 A;  4MQC B;  5KKK A;  1RVW A;  4F68 A;  1MOB A;  4TWV A;  4KJT A;  4GZG A;  1QXD A;  2SPM A;  5E6E A;  1LUE A;  3OO4 B;  2GL3 A;  3UHX A;  2ZLX B;  3SDN A;  3P5Q A;  1IWH A;  4JYQ A;  3UBV A;  107M A;  4MQI B;  2GTL D;  1SPG A;  1IBE B;  2BNL A;  1GVH A;  5SW7 A;  2GKN A;  1XXT B;  1YZI B;  2ZS0 B;  2V1G A;  5ILE A;  1BIN A;  2OIF A;  1N9H A;  1BZ0 B;  1ASH A;  4TWU A;  1YCA A;  3EU1 A;  4MQG B;  1CO9 A;  1YGF B;  2GRF A;  2EKU A;  3G52 A;  1O1O A;  1HBB B;  1RTE A;  2H8D A;  4MPM A;  3ZJR A;  1CLS B;  2LH6 A;  1M6M A;  2Z85 A;  5KER A;  3EOK A;  3ARJ A;  1JF4 A;  3WFW A;  3VRE A;  1ECN A;  3UHU A;  1Y0W A;  5CNB A;  1HV4 A;  3HRW A;  4YU4 B;  2H8F A;  3A0G A;  4WJG 1;  1MKO B;  1YMC A;  1MNJ A;  1DWT A;  1H1X A;  4ODC A;  1EBT A;  1BBB A;  2HHB B;  1K0Y B;  1Y83 A;  1GBU B;  2MGF A;  3QJC B;  1A00 A;  1J3Y A;  5M3S A;  1HGC B;  1V4X A;  3BJ1 B;  1HDS A;  1MOA A;  3WCW D;  1LTW A;  3GKV B;  1RQA B;  1VXG A;  2ZS1 C;  2EB9 A;  2HBD B;  3A9M A;  3PIA A;  3D17 A;  4ROL A;  3MJU B;  4XDI A;  2XYK A;  1J40 B;  1G0A A;  1LFT B;  5C6E B;  3NG6 A;  1KD2 A;  3B75 A;  3MJU A;  1ECA A;  1HBA B;  3GKT A;  1XZ2 A;  3UHW A;  1YVT B;  1A3O B;  1LFZ B;  3VAU A;  4AVE A;  7HBI A;  2D6C A;  1Y09 B;  3GKV A;  2DXM B;  2ZFO B;  3HYU A;  1J3Y B;  2HZ1 A;  3QZX A;  2BWH A;  1LFY B;  1XZ4 A;  1YEQ B;  2MYA A;  3D1A B;  1BUW A;  1XZ7 A;  1QXE A;  3PI9 A;  1Y46 A;  1LJW B;  4YU4 A;  1UIW B;  1A9W A;  2SPO A;  3VRE B;  4MXL A;  1JDO A;  3QM6 A;  3EOK B;  1XY0 B;  3K8B B;  2QSS A;  3ONZ A;  3M3A A;  5ILM A;  1Y0D B;  2MGJ A;  2MGE A;  2QSP B;  1G0B B;  4MQG A;  3QM7 A;  1Y45 A;  1Y7C B;  2W72 A;  1MOH A;  2NRM A;  3GDJ B;  2G0X A;  1Y5K A;  2OLP A;  3D1K A;  1NZ4 A;  1X9F A;  1V75 A;  1ABW B;  4UIQ A;  3TLD A;  3S65 B;  4PQ6 A;  1MYF A;  1KFR A;  1IBE A;  3VHB A;  3OVU C;  3QM9 A;  1G09 B;  2LH2 A;  3EDB A;  4XS0 B;  3R5I A;  1M9P A;  1VHB A;  1XQ5 A;  3G4W A;  1V4W A;  1IDR A;  3VRF A;  1L2K A;  3WFT A;  3WHM B;  1AJ9 A;  5E6E B;  4B4Y A;  3ECZ A;  3UHC A;  1LH5 A;  1S5Y A;  3PEL B;  1IT3 A;  1A6M A;  1Y5F A;  4HRR A;  3O89 A;  4M4B A;  1DO3 A;  4MU5 A;  4ROM A;  3S1I A;  3G4Q A;  2LH7 A;  4QAU A;  3NL7 B;  5E83 B;  3WCT A;  1MLM A;  3WFU A;  1HDA B;  1LA6 B;  1MTI A;  1ABY B;  1O1J A;  3A2G A;  5JDO E;  109M A;  4F6G A;  2MHB B;  5EE4 C;  1YIH B;  1DXV B;  2MYD A;  1GCV B;  1MNH A;  1VXB A;  1VXE A;  1OUT A;  3PI2 A;  2D5X A;  3WCT B;  1QI8 B;  1MWB A;  1FAW B;  1YFF B;  3ASE A;  4MQJ B;  1Y8K B;  1QI8 A;  3GK9 A;  3NFE A;  2PGH B;  4U8U B;  4HRR B;  2QRW A;  2QU0 A;  1K1K B;  2VHB A;  2ZLU B;  2ZS1 A;  2ZLV A;  1Y8I A;  2MGH A;  3A5G A;  5HBI A;  1HAB B;  2WY4 A;  1GCV A;  2DN1 B;  3OZW A;  3OO5 A;  1FHJ A;  6HBI A;  3WCT C;  3UHE A;  3GYS A;  3UHT A;  1M9P B;  1S56 A;  4N7O A;  5HLU A;  2MGL A;  2O5L X;  1Y4R B;  1XCH A;  3CIU B;  1TU9 A;  3MN0 A;  5JOM A;  3UHS A;  1Y7Z A;  2AA1 A;  2MGI A;  2ZSS A;  4O4Z A;  2D5Z B;  1X9F B;  1DTI A;  2OH9 A;  4HHB B;  2DC3 A;  2JHO A;  4O35 A;  2MYC A;  3E4N A;  1Y31 B;  1G0B A;  1LH7 A;  1YHE A;  2D2M B;  1Y0A A;  2QSS B;  3ONZ B;  3IC0 B;  1MBC A;  3LB2 A;  1XQ5 B;  4XS0 A;  4YU3 B;  4O1T A;  1MTK A;  1U7S A;  2MBW A;  1JY7 A;  2B7H A;  1DWR A;  1A6N A;  1UVY A;  1BUW B;  1XZ7 B;  1HHO A;  4H07 A;  3ZJO A;  2W72 B;  2AUO A;  1O1L A;  3GQR A;  3WTG B;  1DLW A;  2PEG B;  3CY5 A;  4MAX A;  3ZJS A;  3SZK B;  3A5A A;  1LH6 A;  1FN3 B;  3AQ5 A;  3WCV B;  2Z6N B;  1MZ0 A;  2R4W A;  2O58 X;  1QSI B;  1DM1 A;  2ZT4 A;  5HLX A;  1Y4G B;  1YEO A;  1HBA A;  3A5B A;  3D4X A;  3D1A A;  2MGM A;  4H0B A;  2W6V B;  4MXK A;  5JDO F;  1A6K A;  1O1I A;  3PIA B;  1Y35 B;  1XZ4 B;  4L7Y B;  1OR6 A;  2EF2 A;  1RQA A;  1NAZ A;  1YHU A;  1J7Y A;  4F6F A;  3ZJJ A;  3RGK A;  1FDH A;  3GOU A;  1A3O A;  2D2N D;  4MBN A;  1C7D A;  4FH6 A;  4IRO B;  2BK9 A;  2IG3 A;  5EYJ A;  1A3N B;  2MGC A;  1YE2 A;  3DHT B;  1BVD A;  1WMU A;  2MGD A;  112M A;  3HC9 A;  3HRW B;  1Y0W B;  1GCW A;  1YIE A;  1YEO B;  1SPE A;  4NXA A;  3QZZ A;  3G4R A;  1Y0T A;  2VLY A;  1J41 B;  2GRH A;  3BOM A;  3ZJH A;  1A00 B;  5JGG B;  3WCV A;  1S61 A;  4O4T A;  5B85 A;  2R80 B;  4HRT A;  3UHK A;  108M A;  1A0Z B;  4ILZ A;  1Y85 B;  3EU1 B;  2OHA A;  1CH5 A;  5EV5 A;  4N7P A;  1MYT A;  2AV0 A;  1MOD A;  3S66 A;  1YHU D;  1SDL B;  3E5O A;  1JY7 B;  4N8T A;  1BZ1 B;  4M4A A;  2QLS B;  1JZL A;  3HEN A;  3WCP B;  2YRS A;  2H35 A;  3WCP A;  2D2M A;  3P5Q B;  3AQ9 A;  5HAV A;  2VEE A;  4NI0 A;  1XZ5 A;  4MQK B;  5EOH A;  3OO4 A;  1YH9 A;  2ZSP A;  103M A;  3IC2 B;  111M A;  1A6G A;  1NZ3 A;  2DHB B;  4ESA B;  3QJE A;  1XXT A;  1RVW B;  1CG5 A;  1YZI A;  110M A;  3UHD A;  2O5M X;  2AA1 B;  3OZV A;  2WTH A;  1Y85 A;  1A0Z A;  1MBO A;  2M6Z A;  1SWM A;  1IT2 A;  1SPG B;  2R80 A;  4MQI A;  3PT8 A;  3GQG A;  3UHZ A;  1G9V A;  4PQB A;  1J41 A;  1YVQ B;  3WCU A;  1YEN B;  1WVP A;  2DN3 B;  1XZU B;  3OO5 B;  2ZLX A;  2RI4 A;  2OH8 A;  2GLN A;  1QXD B;  3DHT A;  1NZ2 A;  2ZLU A;  1S0H A;  1HBG A;  2QU0 B;  1YGD B;  1C7C A;  2ZT3 A;  3TM9 A;  1OUU A;  1JWN A;  3AT5 A;  1Y8K A;  1I3E A;  4MQJ A;  2BLH A;  1LFV B;  1GJN A;  3QM8 A;  2D5X B;  2ZFO C;  1MBN A;  4FC3 A;  1HGB A;  3GLN A;  3KUO A;  1COH B;  2NRL A;  1DUO A;  5HLQ A;  5CNE A;  1ITH A;  1A0U A;  1CMY A;  106M A;  1O1I B;  1VWT A;  5HU6 A;  3D4X B;  102M A;  101M A;  3UHV A;  1YHU C;  4M4B B;  2FRK X;  2XKG A;  3BJ3 A;  1CG8 B;  3UHQ A;  1ECO A;  1CIO A;  1VRE A;  1YOH A;  1NS9 B;  2VYY A;  1R1Y B;  1FN3 A;  3UGY A;  3CY5 B;  2PEG A;  4MQH A;  1A4F A;  1VRF A;  2BKM A;  1Y4P A;  4HBI A;  3VRF B;  1MYZ A;  3A59 A;  2W31 A;  1HHO B;  1MLO A;  3W4U B;  3DUT A;  5B84 A;  1IOP A;  2FRJ X;  2EB8 A;  3HHB A;  3MKB A;  2ZSZ A;  2ZT2 A;  2ZFB A;  1CBM A;  3LB4 A;  1NWN A;  1HBR B;  1DO7 A;  1MDN A;  2W6Y A;  3AQ6 A;  1Y5K B;  1YHE B;  1Y45 B;  3PT7 B;  5E29 B;  1QSH A;  1YHR B;  2SPL A;  5E29 A;  1N9I A;  2AUP A;  2ZS0 C;  1MBD A;  1MCY A;  3RJ6 A;  4G51 B;  3NMM B;  3ORD A;  1JL7 A;  1HBR A;  3MJP A;  4G1V A;  4U8U C;  2HHD A;  1ECD A;  4NI1 B;  5HU6 B;  3W4U A;  1YEQ A;  3GYS B;  3ECX A;  2LH3 A;  1Y4P B;  1LFY A;  4MQH B;  1MLH A;  3BCQ A;  1MNO A;  1R1Y A;  4G1B A;  2MYB A;  1Y8I B;  2VRY A;  2ZS1 B;  3HYU B;  3WI8 A;  1D8U A;  1HGA B;  1SHR A;  2QFK A;  2G0R A;  2VM0 A;  2HBC B;  1S5X A;  1LFL A;  1O1P B;  4FWZ A;  1LFV A;  5EUI B;  4NS2 A;  5IKS A;  2EVK A;  1CH4 A;  3WFX A;  3ECL A;  1OUU B;  3QMA A;  3NG6 B;  1LFQ A;  5C6E A;  1J40 A;  2QFN A;  2G11 A;  2ZS0 D;  1A0U B;  1Y4B A;  2HCO A;  3QJB B;  3ZHW A;  1LHT A;  3AQ8 A;  1HGB B;  2V1H A;  2HBS A;  1DXT B;  3KMF A;  1O1M A;  2O5B X;  3GQG B;  2D2M D;  104M A;  3AT5 B;  4ROM B;  5CN5 A;  1Y5F B;  2ZLW A;  3PEL A;  4ESA A;  4F6J A;  1J3Z A;  1G08 A;  2H8F B;  1CH7 A;  1URV A;  1Y0C A;  2VLX A;  5HY8 A;  5EU2 A;  1CH3 A;  3D7O A;  2DN3 A;  3UHY A;  4NI0 B;  1YEU A;  5CN7 A;  3K3U A;  3ARK A;  3G53 A;  1HBS A;  2D2N B;  1YOI A;  1F5O A;  2HBF B;  3R0G A;  1MLK A;  2Z6T A;  1THB B;  2O5O X;  5MBA A;  2KSC A;  1NZ5 A;  1O1O B;  1GDI A;  3WCV D;  1DTM A;  1YGF A;  1Y7D A;  2ZT0 A;  5CNG A;  1V75 B;  2DN2 B;  3WCW B;  2G10 A;  6HBW A;  3BJ2 B;  1NEJ B;  3QJE B;  4WCH D;  1Y22 A;  3BJ2 A;  2R1H A;  3WCW A;  1YH9 B;  3WCU D;  3GDJ A;  5AB8 A;  1Y7C A;  1MLL A;  2VYZ A;  2W6X A;  4JAC A;  1A01 A;  1Y4F A;  2YRS B;  3G4V A;  1FCS A;  2G0Z A;  4H2L B;  2HBF A;  3BOM B;  1IWH B;  2D2N A;  1XY0 A;  3MYN A;  1X46 A;  3LQD A;  4MBA A;  3BA2 A;  1BZ1 A;  1MNK A;  1VXF A;  1MLS A;  2ZFO D;  4LPI A;  1C40 B;  3D7O B;  1BVC A;  4DWU A;  5EET A;  3AQ7 A;  3S66 B;  2BLI A;  1MYG A;  2OHB A;  1J3Z B;  1Y01 B;  1Y7G B;  4NK2 A;  2ZLW B;  1HJT A;  1MYH A;  3PI3 A;  3VRG B;  2FRI X;  4HRT B;  3O7N A;  1MOC A;  3ZOM A;  1UMO A;  1DXT A;  2ZSY A;  2ZFO A;  1Y0T B;  2HHE A;  3PI8 A;  5KDQ B;  3WCW C;  3QJB A;  2O5T X;  1GCW B;  1YIE B;  3ZJM A;  2ZSN A;  1WMU B;  1YE0 A;  1YDZ B;  1XZ2 B;  1LFQ B;  1A3N A;  2W6V A;  1KD2 B;  1GDK A;  2GTL A;  1NS6 B;  3D17 B;  3HF4 B;  1DXD A;  4N7N B;  5EUI A;  1O1P A;  2NX0 A;  1LFL B;  2ZLT B;  1J7W B;  1S6A A;  1Y8H B;  5KDQ A;  1RPS A;  1V4X B;  1J7Y B;  1UFJ A;  1NPG A;  3M38 A;  2O5S X;  2HZ2 A;  5CND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...