3R0KA

Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : tartrate bound, no mg
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
362
structure length
355
Chain Sequence
VSKIIDIKTSIIKIPLKRTFIHIDSLAVELTLDNGVKGYGVAPATTAITGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKANSIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGADFNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEINKYSLNVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDNLKGFGFNLAENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enzyme of enolase superfamily
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Francisella philomiragia
molecule tags Metal binding protein
total genus 117
structure length 355
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3r0kA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3r0kA01
2PSNA 2PTZA 4E4UA 3P3BA 2PMQA 4GGBA 4GGHA 3OTRA 3ZLFA 3UCCA 1SJAA 3CYJA 3MUCA 1E9IA 3SN1A 4GFIA 3ZLGA 1SJBA 3OZYA 2MUCA 4HCHA 3IK4A 3MWCA 4A6GA 3T4WA 3GY1A 4IL2A 3JW7A 5FJOA 2OX4A 1W6TA 2PTYA 5FJRA 2QJNA 3V4BA 2GGIA 3VC5A 3STPA 3TWBA 4F4RA 4MMWA 1R6WA 4Z17A 1OEPA 3SBFA 3CT2A 3NFUA 3EKGA 3HPFA 2PTWA 3VFCA 2OZ8A 4GYPC 4DXKA 3SQSA 4H83A 4YWSA 2PP0A 3N6HA 1SJCA 2AL1A 4H2HA 1MUCA 3OZMA 3T9PA 2OZ3A 3FJ4A 2QDEA 3TOYA 2MNRA 2AL2B 4K1WA 1KKRA 1EBGA 1MNSA 4HNLA 1MDRA 2PS2A 4DHGA 3VCNA 4HCLA 2PODA 4E4FA 3P0WA 3OPSA 3DG7A 3QPEA 4IZGA 3DG6A 3SSZA 1KKOA 3IJLA 1BQGA 3DEQA 2QJMA 3QTPA 3ENLA 5EU9A 2I5QA 4KT2A 1NU5A 3VCCA 3UJRA 3TTEA 3IJIA 5FJUA 3PWGA 1KCZA 3RO6A 1ONEA 5ENLA 3JZUA 3V5FA 3R25A 3CK5A 3I4KA 2OLAA 1EC7A 4DYEA 3P93A 1KD0A 2PP1A 2PGWA 2PPGA 3S47A 2QGYA 3H8AA 1XS2A 3V5CA 3MZNA 4K2SA 4KPLA 4KEMA 1R0MA 2XGZA 2PA6A 4E5TA 2OQHA 5J04A 2AL2A 3NO1A 3SJNA 2AKMA 3PWIA 3MSYA 3FVDA 3DDMA 2XH4A 3NXLA 6ENLA 3CAWA 2O56A 3GO2A 2PU0A 1L8PA 1TZZA 3ZLHA 3RR1A 1JCTA 1IYXA 3DG3A 4ZCWA 3UCDA 4HN8A 2GGGA 3JVAA 3DERA 3R0KA 2OPJA 4MGGA 4HNCA 1FHVA 2XSXA 4JN8A 2HXTA 3DFHA 1JDFA 1ECQA 5FJPA 2XH0A 4H19A 4GMEA 1YEYA 1NELA 4HYRA 2GGJA 3RRAA 2P88A 3VA8A 1TE6A 3TWAA 3SN0A 3T6CA 3DESA 4DN1A 3TCSA 3DFYA 4X2PA 3QN3A 4JHMA 2CHRA 2P0IA 3V3WA 5FJTA 2XH2A 3TJIA 4J3ZA 4M6UA 3BOXA 2QDDA 3MQTA 3FYYA 2PP3A 1MDLA 4EWJA 2OG9A 1RVKA 3H7VA 5IDZA 3OW1A 3GD6A 3FCPA 3DIPA 7ENLA 3R1ZA 4E6MA 1ELSA 2PCEA 1WUFA 3B97A 1PDZA 2NQLA 2HNEA 4M0XA 3UJEA 1EC9A 1WUEA 3U4FA 4K8GA 3KUMA 3MKCA 1FHUA 3ES8A 3Q4DA 3EEZA 3I6EA 2GGEA 4E8GA 1MRAA 2DW7A 3R11A 3QLDA 3RGTA 2RDXA 3NZGA 4ZA0A 4IT1A 2XH7A 3D47A 3UGVA 3IJQA 3N4EA 3QKEA 4KWSA 4FP1A 3CB3A 2QVHA 4DX3A 1JPMA 3N4FA 3Q45A 4GIRA 4IP4A 3GC2A 3UJ2A 2PTXA 3UXLA 2OFJA 1BKHA 2OVLA 3DGBA 4G7FA 2P8BA 2PGEA 4IHCA 2OQYA 3ZVHB 3FXGA 4A35A 1EBHA 3CXOA 3R0UA 3BSMA 1DTNA 2P3ZA 2AKZA 3UJSA 2DW6A 4FI4A 3ES7A 3FV9A 3H12A 3S5SA 3TJ4A 3SN4A 3TW9A 1JPDX 4H1ZA 2ONEA 2HZGA 2GDQA 1P48A 3RCYA 2FYMA 2POZA 5BOFA 2FKPA 4JN7A 2HXUA 3BJSA 4G8TA 3UJFA 2PU1A 4A3RA 2OZTA 3I6TA 2GSHA 3PK7A 3K1GA 4MKSA 3T8QA 3PFRA 5BOEA 3U9IA 2ZC8A 3UXKA 1P43A 3ZVIA 4DWDA 3H70A 1TKKA 3D46A 2ZADA 1SJDA 2OKTA 3ZVHA 3MY9A 2GL5A 1F9CA 2OO6A 3OP2A 4Z1YA 1EC8A 3N6JA 4J1OA 4GYPA 1PDYA 4IL0A 3RITA 1XPYA 4IP5A 3THUA 4GISA 3R10A 2QJJA 4HPNA 2P8CA 2QQ6A 4HCDA 3VDGA 4ENLA 3VC6A 2GGHA 3TQPA 4ROPA
chains in the Genus database with same CATH superfamily
3PR2A 1FOBA 3PAJA 2J9YA 3GDMA 4XAYA 5U25A 3L0GA 2ZTKA 4GYFA 3KVKA 1NWSA 3W22A 2HJPA 1JOAA 3W9ZA 3H4GA 2G0WA 2BHYA 1TMLA 2IKHA 1C9DA 2QV5A 3FS2A 1K8CA 2Q71A 3LB0A 3C0SA 3IRDA 3LV5A 1F74A 3BOLA 1XGEA 3WK2A 3KFTA 5TQLA 3V4BA 2JK2A 4JQ3A 3ETRB 4E3TA 4WXYA 5HMSA 4FXFA 1ODZA 4L1WA 1O94A 3BCDA 4UTKA 1W54A 2WW5A 3TFXA 1SJCA 1NHQA 4ZEPA 3K4AA 5F2MA 5REQA 3SR6B 2AL2B 4PUMA 5LXEA 3HM7A 5EA9A 1V6UA 1EJVC 2QW5A 3AXMA 1W2PA 2WYSA 5M5DA 4A3HA 4E4FA 3H2AA 2RKXA 4NASA 1VCVA 2J25A 2WZEA 4XO6A 1XX1A 3IJLA 4JQ9A 4F8XA 1GVSA 1HX0A 3ABSA 3FSUA 5EFDA 2P76A 3O05A 3UJRA 2RGMA 4IGSA 5I3IA 2V0TA 2FZMA 3H7UA 1Y65A 5A8MA 4AX6A 2J7EA 2A7RA 3AUOA 3TU9A 5C0QA 4TR9A 4D6JA 3BV7A 3DFOA 3MB9A 4L61A 3ITOA 3DJJA 2Y6ZA 1ZDLA 5D2YA 2HV5A 5I2UA 4DXXA 1E1EA 1CXEA 4INFA 3PZQA 2WK2A 3SCUA 1R5YA 5BMWA 1ZTVA 4B15A 3TSBA 1FWWA 4MZ8A 4NZFA 3VVGA 4C1NB 3PPHA 1V7AA 2AKMA 3GTXA 3BLLA 3UXAA 3PWIA 2A7NA 3WIJA 1NDWA 1SO3A 2CERA 1C8QA 3CJPA 3O0KA 3BPWA 1WZLA 3W7NA 3AUJA 1VJSA 4BK9A 1X7IA 1NHSA 1B90A 3DN5A 1P6BA 4Y6GA 2C8NA 4HNCA 3ZT5A 4UTLA 2NQZA 2WNQA 4W88A 2HXTA 3DFHA 4BI5A 2PURA 3PULA 5DXXA 5RUBA 4ZO9A 2WAGA 2HDJA 1Q6LA 3N2BA 2GGJA 3S6TA 3I68A 3W38A 3WBAA 2ZXDA 3OZPA 4CNUA 4HOWA 1ADSA 3GW0A 1QPNA 2DSWA 5BW6A 4O14A 5A8QA 4NKCA 2OSWA 4Q6XA 3V3WA 4LY4A 1J10A 1IIHA 1TZ9A 3UG5A 5LNRA 3LM3A 2CW6A 1LWJA 4K37A 2G3FA 4DM2A 1R2RA 2GJNA 4J5NA 1MDLA 2DFAA 4O1DA 3KCJA 3BW4A 4E6MA 2Y85A 4MB4A 1S5MA 3DHUA 4HZ6A 2GQWA 3XIMA 3GIPA 3KP0A 1E71M 5EGRA 4JTKA 4ICNA 3B8VA 4HU4A 5FS7A 1N8IA 2FHFA 2Z00A 4DPQA 3S83A 3ES8A 3URAA 3Q4DA 3EDKA 2B7QA 3WDPP 4HN4A 4AB4A 4RL3A 4XZHA 3H4XA 1XWYA 2DW7A 4WEVX 4JQ2A 3ARZA 4FK9A 4GQQA 4L6OA 1OIFA 1CGWA 1NOFA 1XH2A 3NZGA 1SVDA 4MM1A 5H8UA 4O12A 1HGWA 2OMAA 1XLKA 3CB3A 3F1QA 3W83A 3W1XA 2PWUA 3CV6A 3HG4A 3MJYA 3WLQA 4IP4A 3RJXA 4MJZA 1MW3A 4B16A 3PPFA 4LOCA 4KWWA 3LPPA 5DMYA 1DBTA 3E2VA 1UR8A 1E5NA 2QCMA 2J62A 4GY7A 1UROA 2YA2A 3PUGA 2PDUA 2R1KA 5TF0A 1UWUA 1V8EA 1BWVA 2CHOA 1ENUA 1WAUA 1G7UA 3GVGA 3UA4A 5CC7A 1ZBKA 1TYTA 1Q6CA 3UR8A 5LXXA 3I3DA 1VYRA 3EOSA 2J7HA 2VRJA 1BTMA 1ITUA 3P5YA 1H3GA 3L4ZA 4LVDA 2V2CA 3A9BA 4FDCB 4W7VA 3RX4A 2QYGA 1Q6FA 5DANA 1KM0A 1GQNA 1VFTA 3BGJA 3GIQA 3BJSA 2ANUA 1XD0A 3WBWA 4LVFA 1R3RA 3ICJA 2YX0A 3SEPA 3W7JA 1EGVA 2X1RA 3W81A 3C5QA 2F2HA 3H22A 5JCLA 5C2XA 3AS3A 3RJYA 2VCCA 1XLFA 5DRIA 2ZC8A 2BVDA 1U22A 4QJ3B 1R87A 4MJ4A 4DXVA 1TKKA 3GD3A 4H4XA 4MZ1A 2KX9A 4E2VA 1J9YA 4F48A 3E0LA 4JD4A 3APTA 3SY5A 4F2TA 3T8LA 3PPGA 2Q8LA 4WY0F 3QQ1A 4M6VA 1WPCA 5HK4A 3VOIA 4MNLA 4ERIA 2RH9A 3S2LA 3EMQA 1WE5A 3W88A 3CQKA 1XCWA 2PEVA 4W8LA 4Q8UA 1Q1RA 4LS2A 1OX4A 3PTMA 2J77A 5AHMA 1VPXA 1JAKA 3EX6A 1OIMA 3EA2A 2GZXA 2I9EA 4NL1A 3GLCA 3GU9A 5HBFA 4R33A 4EAYA 3VGFA 1GG1A 1REQA 4O19A 3NQMA 2PFHA 1XBXA 4MJ2A 2OEMA 3E6EA 2QJNA 3NSXA 3UU0A 4ZQCA 1BXBA 2QCHA 4LUTA 1A5KC 1DQWA 1KRMA 1EGMA 1KV5A 1YDOA 2UY5A 3ZXWA 4A3QA 2PTWA 7TAAA 1AD4A 2Y88A 4NG3A 3VFCA 2OZ8A 3SUWA 1QO5A 2WM0A 3CYVA 4PC8A 1SR0A 2PP0A 4UQ9A 1CZ1A 4MADA 5HNUA 3KBNA 1DJQA 2OZ3A 5MKGA 2PGFA 4DLFA 4HTYA 4DWSD 2BGSA 2E6AA 2YSWA 2E68A 1KKRA 5AHIA 1JUKA 4JEQA 3R79A 4E2BA 2PC8A 4AXNA 1MDRA 1NEYA 3WFAA 2OYMA 4LYPA 1NDYA 4JL1A 5LIUX 2W3ZA 1E6PA 2WSPA 3RN6A 3GYEA 3OPSA 1PWMA 2D69A 5ECVA 4YCOA 1U83A 4ACYA 1AVAA 1JZ3A 3GDBA 1L2UA 2G97A 1RY0A 5FSDC 2WLZA 3L4UA 1C29A 1UMYA 4ASTA 4AHOA 4N9DA 5TBOA 3WD4A 4DZHA 3S42A 5FEWA 2PF0A 1RCXB 3WSUA 2G96A 5K9DA 1J0KA 1DJZA 3HA1A 3F5JA 3CHDA 4JTQA 4KFNA 3L5LA 4O0QA 3OBAA 4H8HA 3N1AA 4Q4OA 4RZBA 3BURA 1W3LA 3RG6A 4JTTA 2YFOA 1UUQA 1F07A 4QM1A 2X0HA 2J88A 4TV5A 1BFNA 1QOPA 1KBJA 3CZEA 4CQDA 1XH0A 4KPLA 4AVOA 2DJLA 4HPJA 4DJEC 1BVWA 1WX0A 2DU2A 1Q1WA 3KXQA 1CB7B 4FIRA 1UD8A 1HJVA 3VGEA 5M03A 3KWXA 1R3TA 2WJDA 5HULA 2J7FA 4BI6A 3AISA 2H9AA 4J7RA 3WMBA 1NFGA 3QPZA 1PS9A 3HQOA 5HNNA 4HMNA 3C2FA 4B2DA 5EMMA 3BLFA 6ENLA 4CD8A 3BL3A 4JTFA 2NXHA 1R3YA 3G3DA 3CBWA 4GA8A 4ZBCA 1SW3A 4DM1A 3UCDA 4GYKA 4GVIA 3FGCA 4Q8NA 3PNZA 2QAFA 2QAPA 4DWSB 3GXTA 1ITXA 5CPSA 3M43A 1UUOA 2XH0A 2VFGA 1FP9A 4WJ8A 1M9HA 3WQEA 5LA0A 3POHA 5DXYA 4HA3A 2Q02A 2Y5JA 3NXFA 5AY7A 3UQNA 1A5OC 2WQDA 4O1BA 2C19A 3ECQA 1IHIA 1PZ2A 1JDEA 5C70A 1W5PA 4F0HA 2R1NA 1X97A 2YVJA 3C6CA 4JNZA 1GXFA 3QN3A 1U5VA 4C6DA 2P50A 1JXKA 4FXJA 1DWHM 4GXMA 3SDOA 1XLJA 3KBWA 3NSMA 3WQ8A 3GXIA 3TYBA 4M6UA 2O55A 2V2HA 3LERA 3S8HA 5CPLA 1TPDA 2VENA 4EWJA 1RP9A 2WVVB 7A3HA 4L4OA 1IWPA 2XVNA 3EPMA 3VI2A 2OT0A 3DIPA 3PZVA 4I5UA 7ENLA 4HNTA 4AWSA 3W87A 3QXBA 4IIGA 3SSJA 2E25A 4AC1X 3GVVA 3O0HA 4LQ1A 1UJPA 4NAFB 3AJ7A 4RDZA 1A5MC 4H3DA 1FWJC 1EC9A 4US5A 4PRWA 2WOQA 3K8MA 2JKPA 3S6OA 4DEFA 4X0VA 3W73A 2YOCA 2QZRA 5C9ZA 3Q58A 3C3NA 5CG0A 1MRAA 3DK9A 5IOBA 4GC4A 3W2JA 4BS0A 3CGEA 4H00A 1RHCA 5BCAA 2CLPA 4GBUA 1OFBA 1TUFA 2DT0A 1L6FA 1X39A 2NT1A 3D47A 4GUFA 1MEWA 3QOMA 3D3FA 4AISA 3SECA 2EG8A 4V15A 1S5VA 1IXQA 1LRNA 2AGTA 3R6IA 2B81A 4DX3A 1DQUA 1Q3NA 5LKYA 3AAMA 1KM4A 2CLHA 3UXLA 3SJ3A 1PCWA 3UCQA 4KMQA 2DUXA 3G1HA 4AU0A 3M0XA 5I07A 5JCMA 3DFTA 5CLWA 4JIQA 1AJ0A 4XKYB 3W72A 1MXSA 3VMNA 3HO8A 1T0OA 4EANA 1X6LA 3BV4A 5AVNA 4LCQA 5ABFA 2WP6A 1SFTA 5A6LA 3AYTA 3CGTA 4MHBA 4GVHA 3TMQA 1ZBVA 1XIDA 2YPIA 2OGYA 1HKWA 1JZ6A 2IPGA 1XKYA 1GZ1A 4B4FA 2D73A 2HBXA 3WDIA 3NQBA 1NAL1 4W87A 3WH6A 1UPMB 2WKLA 5I00A 3MCOA 3CGDA 4MNMA 4XSLA 4DZIA 2C3CA 3OYZA 1ZY8A 3I6TA 3CUHA 4RDVA 1LTDA 2EQ8A 4ZGYA 3UXDA 2CKSA 1C7SA 1QJWA 2B0MA 1K02A 5I23A 3E12A 2NQ9A 3EAUA 5AZ1A 4HOXA 5FF3A 1E1CB 1H7WA 3L5MA 5G1YA 4QG9A 1XHCA 2G4JA 1DVJA 1KTCA 1VFSA 3WH7A 3NPWA 3WD1A 3F4WA 5C5YA 3LYEA 1TV4A 3LZ5A 1KM6A 1V0MA 3MO4A 3PTQA 4LUJA 1QHPA 1DJIA 1PZ1A 4TMCA 3UWWA 3ZR6A 3B0PA 3P60A 4HCDA 4Q8MA 4KETA 3NVDA 4ENLA 4JIRA 5AC7A 5F4XA 3S6DA 3TYDA 1WB0A 2QXWA 3W1UA 1BTCA 3VTRA 3IK2A 2P3EA 4DZAA 4HZ8A 1PHWA 3ME3A 4M1BA 1JIBA 1HKJA 3CYJA 4S3KA 3STEA 2EXOA 3TYCA 1KWKA 3L4VA 3L4XA 3MWCA 3UYCA 1VCFA 1WAWA 1UYQA 3LRLA 1GUVA 1E73M 1H4PA 1VBGA 3EB4A 3KBVA 4DPPA 4HU8A 3A21A 2DPEA 1T3QC 3ZYZA 3H2CA 4EXAA 1L6WA 4HK5A 2IPJA 2ALDA 4PMNA 4Z17A 2DZWA 3HPFA 5XINA 2WBAA 4L6HA 5DT5A 4ZOBA 1HJWA 1ML1A 1XLCA 5G4HC 3N6HA 1SZFA 3AI0A 4MWAD 4H2HA 6CGTA 5BWFA 2XGIA 1BG9A 3LADA 3U7VA 1KR0A 3AMCA 3J7HA 3W02A 3WBEA 1Z44A 1X1NA 4FNTA 2OGJA 2XFWA 2PODA 1X96A 4R53A 4PBGA 3O63A 1XISA 3T7VA 3LBMA 4RNJA 1X6UA 3OLGA 3BVJA 5FF4A 4KCTA 1YXYA 2C71A 1YE6A 1PBGA 4OIFA 3W76A 3TR9A 1VIWA 3RM4A 2VDGA 3N25A 4AD2A 4M3PA 2PDPA 2GQ3A 3DAQA 4C5ZA 3JZUA 1OT2A 3DZ1A 5EL1A 4IWWA 2E5CA 5FL0A 2W3RA 3CGCA 2HTMA 2YCIX 4YVPA 1PZ3A 4GHRA 3LK6A 5AHNA 3C0QA 1XS2A 3GZAA 1JF6A 1EZWA 3DI0A 2XGZA 3I65A 4G6CA 4O18A 4AVFA 2G50A 2OQHA 1TV3A 4LUSA 5MHBA 1UD5A 2WMKA 3UZXA 2O56A 3PBMA 1EOMA 1MUMA 2BOFX 3KVJA 4YVXA 3WLRA 3EDEA 2ZX7A 4KS0A 5CPMA 1S2VA 3GVQA 3WBYA 4GI6A 4MWAB 1EO7A 3V1PA 4MNKA 3CLMA 5FS9A 3O8AA 3A6OA 3GB6A 2WKJA 4MGGA 1CPUA 3S5OA 1QK0A 3S2NA 1BKSA 3M0VA 1BSIA 1TWZA 1JDFA 2X41A 2UY4A 1EP1A 1HJXA 2E40A 4IPJA 3WDQA 4DF2A 3THQA 1LRTA 1A0DA 4PH6A 2P88A 4H50A 4O0KA 2WNWA 1JG9A 3BC9A 4N9CA 1O60A 3H4KA 2QIIA 1BVZA 3FX4A 1P0KA 2E1WA 3OVGA 3SFKA 1FEAA 4JDYA 1GVRA 4LBRA 1SSDA 1PX8A 2CHRA 1RV8A 4D6IA 1FH8A 2VGFA 2FTYA 1MEHA 3AZTA 5FJTA 4RW5A 4DUOA 3VIHA 2WZMA 3SM0A 4PFMA 2WPCA 4YS1A 4J3UA 1YTEA 3N15A 2B4GA 1E9ZB 1UKQA 3RLHA 4PN2A 1FY6A 1HUVA 4LC6A 2YJQA 3EUB3 4HTBA 4H4RA 3UNDA 3GYCA 1PKMA 1OC7A 2Q3RA 4GXPA 2XJ7A 5JBEA 2Z7KA 3M1ZA 1JI2A 1H2IA 2F38A 4JFUA 3UJEA 3AXIA 2XISA 3ONCA 4H7CA 4HNUA 2VUNA 4S39A 3CUXA 5GJMA 3IIZA 3M5XA 1YIXA 1V02A 1FFVC 1EQCA 3T44A 5C6MA 4AZCA 4HHMA 2FVMA 5D9MA 4DBWA 3OO2A 5DEZA 3RPMA 1M6JA 2QR6A 1XFCA 1T40A 3URHA 1FDYA 5KMYA 3QKEA 3AWNA 4AZ5A 2X8RA 1FWTA 1H60A 3OBEA 2VEIA 1ZJBA 2BNJA 4GG9A 2WJFA 4KIRA 5A6SA 2YL9A 4YN5A 1EF2A 1BKHA 1AJZA 1CNVA 2P5NA 3I7RA 3MDUA 3ZVHB 1JGIA 4I5XA 4FR1A 3OQ8A 4BF9A 3HGOA 4XUYA 1PXGA 4FR6A 3LMYA 4H7ZA 5CAHA 5U1OA 3AMZA 3NVZB 4L65A 4IFKA 1K8XA 4AEOA 1F2JA 1XIMA 3UGRA 1XYAA 3G1AA 2YBUA 1SO6A 3LU2A 1EXPA 3T0TA 4TX6A 3TJ4A 5CSYA 4HA1A 2QCDA 3VDHA 1XQLA 2L5HA 4OQVA 3ITGA 3O07A 3F2BA 4MFDA 2C91A 2W63A 4BEQA 3MCMA 3VNZA 3SI9A 3ARPA 1K4HA 3H55A 1GYLA 3GWQA 1XLBA 1Y5WA 3QHMA 1XLGA 4AIEA 4OE7A 1SB3B 2PDMA 2E9LA 4GH3A 4H4ZA 4PCNA 3TXVA 3GNNA 2YL5A 3BQ6A 4FALA 1R86A 4ZOCA 1P43A 5A6TC 4A8LA 1RLCL 1N7KA 2YVFA 1IZKA 3K4WA 4X2RA 4F9DA 9XIMA 1OM0A 2DSVA 1RQEA 2CZEA 1WYIA 2WJZA 5I3KA 1UD4A 4YTTA 1CLVA 5LNWA 3Q2DA 1EYWA 4OECA 2OB3A 3FK4A 4PMRA 1X8CA 3TXZA 2PGRA 2R94A 1TWIA 4GQ0A 4GR1A 5HQLA 3WJZA 3VAVA 3KVLA 1CECA 2GPTA 3ZWSA 4E0CA 2QT3A 4FS9A 4PEEA 3KDNA 3QQ0A 1SO4A 2J7CA 1PL9A 3H53A 4EVZA 3RYSA 4C7FA 1DWGM 3OTRA 3ZLFA 1I6NA 1Z7AA 1W9UA 5A2CA 4DJED 5LNSA 4UCGA 4HK7A 1DPMA 3PBWA 3O9NA 1CYGA 3NVWB 3TH6A 3ZLGA 4ADTA 8CGTA 3USBA 1I2OA 4RE3A 2DSUA 4ZO8A 4CEUC 4JCLA 4QLKA 4KEUA 4CCEA 2WM1A 3LD5A 1JUBA 3QGAC 2WWDA 3BG9A 1OSEA 4R85A 3STPA 4K7YA 5G2WA 1QDSA 4IPPA 1W56A 3AS2A 5TAOA 2ZE0A 1TRIA 3N9SA 4OKDA 2DEPA 1IT0A 3ERPA 1WKFA 2HROA 1EX1A 4YPJA 4MB1A 1GVEA 1QPOA 3EGJA 2WMIA 4Z1BA 2FGZA 2ZVIA 1M7XA 2NX3A 2QDEA 1FKWA 1UA7A 1BRLB 2W0UA 2ZICA 5K2ZA 1RBLA 3LNMA 1V97A 1FWSA 3KWSA 3P74A 4OV4A 1KBIA 4O13A 2PS2A 2VELA 1V3LA 3A9IA 2F6XA 3PTDA 5AC8A 3NO3A 4ZTYA 1HJSA 1FEBA 5G2HA 1BQGA 4YHEA 1CWYA 1X98A 3PZGA 4MLJA 4P8WA 2VC9A 3N17A 1XLAA 1LM1A 4AWUA 1MI3A 3CASA 3EMZA 2GVLA 4DAFA 3E02A 2J6XA 3W24A 4W8AA 1ONFA 1VD6A 3VZZA 3RMJA 1W37A 5D33A 1K6AA 3BAWA 2ZXAA 3CHFA 1I45A 2YZRA 3ARVA 2PGWA 3K2GA 1A5UA 3QV7A 5ER0A 4B5WA 1UZ4A 4JQAA 4YU1A 4QISA 4GZEA 4WDUA 3VMPA 5T8GA 1WOBA 3G1VA 2GSEA 3SUVA 1LOQA 4AZIA 1SGJA 3IAQA 3B0UX 5F7UA 3HOJA 5A3HA 3C2VA 1J93A 2YR1A 3MSGA 1AQHA 2YIHA 3DDMA 4O4VA 4H4YA 2DZSA 1YBQA 3UR2A 1TQXA 3NNTA 3SFWA 3W1QA 1TJ2A 3OA3A 1HG3A 4YYCA 2GGGA 2ATMA 3AIRA 1RH9A 2D1ZA 2D3LA 4AUBA 1NWTA 3NQ6A 3MO7A 2WVVA 1MRQA 2VD8A 4JTDA 2A3EA 4ATWA 4CN1A 3UT0A 4S3FA 3W70A 2RJHA 3RIKA 3N29A 1ZS2A 1R8LA 5M3WA 1JULA 4NAFA 1W9DM 2YFNA 1LL6A 3CHEA 1F4AA 4IG2A 2R9RA 3W2LA 2EPLX 4C65A 4QQUA 4WX2A 3R12A 2YQUA 1UWSA 2VZVA 2GWNA 4RZ5A 1KQZA 1GVOA 3QR3A 2XWDA 3GXFA 2VZSA 2C6QA 4FX7A 2ZKMX 5J5RA 2GUBA 3B8UA 5BXPA 5I6SA 3O1NA 2QUVA 5BXTA 4OFCA 2QUUA 1K8YA 2OXNA 3HU7A 1GV4A 4AX7A 2AGKA 3C56A 4FNPA 2BC0A 2G3MA 4P8UA 3OHIA 3EPOA 1EGZA 1XJBA 5ABGA 5G5HB 2IKIA 3MP5A 4YLWA 1YX1A 3COTA 3VIFA 2DIEA 4WVXA 3GD6A 1S1PA 5JUVA 3WLJA 4QG6A 1F5ZA 4O15A 4D6CA 5FS6A 3R1ZA 4CCCA 4MVAA 3PTKA 4RW3A 1CGUA 2VDIA 4Y9NA 3LGDA 2NVCA 1YXDA 2HNEA 2W91A 1W5OA 2BXVA 1VB9A 4GYJA 4PA8A 3KE0A 3T0BA 4DAIA 1F6YA 2BS9A 3CAKA 4EX4A 3EEZA 3L0NA 2P0OA 3E3HA 2E6DA 4XB3A 2A85A 4E8DA 5G2IA 3SQLA 4A21A 2RDXA 4ZE4A 3FJNA 2HVMA 2VFEA 1FUYA 4R7JA 2QPUA 3W7QA 4IT1A 3U2OA 2Y1HA 3IJQA 2PLMA 1Q13A 1WXZA 3N4EA 3VNYA 4AD1A 2QDGA 1KRAC 4D8ZA 3O6CA 3F5LA 1H1YA 2YA1A 4FXRA 2EHHA 5CZTA 1W3NA 4L80A 3GK0A 3CLWA 1WQ5A 2PC4A 4UQCA 2Y5EA 3W6LA 3BQ5A 3SZ8A 2WCAA 5CJMA 1NWRA 2JALA 2E1DA 2ZIDA 4PODA 1OWQA 4BFAA 3L67A 2VT0A 3G1RA 1H0IA 4D1JA 3ZT7A 3N2XA 4I5RA 5E0CA 4YTUA 3WO8A 1UR2A 3EXSA 2GQAA 3HMCA 4K39A 4LALA 3AOFA 4JDBA 1XRTA 2E28A 1UZDA 5E0KA 1R3WA 1VKFA 5EKYA 4H1ZA 3QGVA 5BOOA 2GYIA 4YIWA 5DFAA 3W7HA 1ISYA 1GOXA 5IHSA 5HNTA 1YTDA 5CZSA 1K9EA 4YJ5A 2ZWZA 3P61A 3MS8A 4JN7A 4S3GA 2HE8A 4DELA 1Q6DA 4F0LA 4RJEA 1ZP3A 4DB7A 3S3GA 1F8MA 3NS1B 4WD0A 3SIZA 4MKSA 4UOQA 4K7ZA 3WLMA 4B5VA 3UW6A 1QNOA 1LUCA 1GTHA 2WHLA 2W66A 1AW1A 4H9MA 2INEA 2ZBTA 4PMZA 3TC6A 4JTJA 4EP8C 4MB5A 5T26A 2FDSA 1SFLA 2JBMA 4E4PA 1UQZA 1FXQA 2EPHA 4CNNA 2INZA 4QS5A 2VZOA 2ZQ0A 4L4MA 1FTXA 2DT2A 5FEPA 3DGRA 1C9WA 2FZNA 1XH1A 4J1OA 4EPEC 1OFAA 1ZJAA 1LVLA 2GR0A 2FFIA 3E9AA 3VK5A 2E9BA 2BWGA 4C90A 3C0LA 4XZBA 3SQPA 2FPYA 3IGSA 4H9TA 4U3CA 1PIGA 3GVWA 2PDXA 3ZM8A 2X7WA 1H7RA 3QYQA 3PUOA 4J40A 2X16A 4B9ZA 2AAQA 1NQKA 5HNRA 2PDYA 1V6YA 3P5ZA 4IIHA 3PANA 4IOTA 2DVUA 3WLTA 1B31A 4PUUA 4GKLA 3C3UA 1XANA 4FF7A 3W74A 1GGOA 2HPMA 1STZA 1R3SA 3GTNA 2HBVA 4NRRA 1TV2A 3QR1A 1Q4WA 4GFIA 1HVXA 4O53A 3ITLA 3GG1A 3GUGA 3OVQA 4HCHA 5I3FA 1QI0A 2O9TA 4S3DA 2OX4A 4Z1DA 2PTYA 4I3GA 1JNDA 4RNHA 2DY3A 2WMHA 4MAVA 4QXIA 4PMOA 3WX7A 1EP3A 2J24A 3TA9A 1TREA 1R6WA 2Y8KA 3W23A 1C92A 4E3VA 4AY1A 3EOEA 4DXKA 4HIBA 1IR1A 1UD6A 2Z0IA 4NXKA 3PJWA 5CLTA 1UB3A 1K70A 3T9PA 3WH8A 4URIA 3GDKA 2YVGA 7REQA 2ABAA 2DUZA 1LP6A 4TVYA 2VNCA 1GT8A 3QPYA 1Q7ZA 1WXJA 4JTUA 2ZVRA 1F8IA 3VIIA 2FZ8A 2OT1A 4BURA 1F76A 3MKKA 3ZR4A 3BLOA 2WBGA 1UD2A 4GLEA 4X60A 7TIMA 4U5IA 4I6VA 3WLKX 4F3HA 3SSZA 5AYYA 4LANA 1LQ2A 3A4XA 1YQ2A 3AO0A 4JY8A 4W85A 1PWLA 3PG8A 4KCVA 4KT2A 2UBPC 3MTWA 2FMOA 3TTEA 5DY2A 2YB4A 3KS6A 3PWGA 3QBUA 5A8PA 2C1GA 1EUNA 5TD4A 2CLMA 2PUZA 2FQIA 2VHLA 1DXFA 1SW0A 3R25A 3HN3A 2A8XA 3WK0A 1EA9C 4UR8A 1MFUA 4UMCA 3P93A 3I7SA 3CWOX 4JEJA 1TR1A 3ABRA 1AW5A 1R2SA 3SRKA 1F3WA 1GWJA 3T2OA 2JIWA 4DRSA 3HFYA 4ROQA 1YADA 1IEXA 3R13A 5GNXA 3QSRA 4LBUA 3TAKA 2WPFA 4E5TA 4NRSA 5EBKA 4RK8A 3LMZA 3L5AA 4LVBA 1TA3A 1DWAM 1BGGA 3GO2A 2ZC1A 1FFQA 5EMUA 1EL3A 4KGLA 4I8DA 3U5YA 3W7GA 1V3MA 3HPXA 4S3EA 1O95A 4O1FA 4XAFA 1CLKA 2FB2A 3R0KA 4FLSA 2V2DA 3RLGA 1E0UA 4UC5A 1TE1A 2ZCGA 4HPXA 4EQXA 3GR8A 3O6AA 4XX6A 4ZQPA 3YPIA 4GUGA 5HMEA 1TJ1A 1JFHA 3Q65A 1KNWA 2QF7A 4QBXA 4DNAA 4C6OA 1K1DA 3JU2A 3AJXA 3WDHA 3E1F1 1N82A 3OEXA 5A95A 4NU7A 1VQTA 3A3WA 3DFYA 4X2PA 2FTWA 3OU8A 1KR1A 2H8ZA 5BNKA 2C0HA 3I4EA 4GC3A 3CL6A 3TJIA 3MUXA 5M17A 2A3BA 3TQVA 1BVNP 2D0HA 1UKOA 1CI1A 1L0PA 5JBFA 2WC4A 5DQPA 3W2NA 3GHSA 2H8XA 3KTXA 2J4GA 3TTQA 1VEPA 3KM8A 3VIPA 4MNJA 1IIGA 4LNCA 3EX4A 3O16A 1VDVA 4PL2A 1UUMA 1N62C 4BI7A 3AWOA 1GQIA 2GDVA 3HFTA 3LDVA 1HKKA 3UXIA 1W1YA 3L7RA 3BUVA 1XICA 4H9ZA 3FKKA 3UY7A 4CQBA 3KLKA 5HWMA 1SPQA 1WNOA 3CPUA 4PB4A 4W9TA 3HPAA 3DHPA 4OT7A 1VRDA 4HHLA 3AHTA 3DFSA 1CGXA 4ML9A 2TPRA 1FH9A 4ZB2A 3CL8A 3KL0A 2VOMA 3RU6A 3GC4A 3NDZA 3TLQA 4AEFA 1YW1A 3P6LA 5D9OA 3UFYA 2NW0A 4M8UA 4P7NA 1MEIA 2CITA 1XSKA 2BXZA 4W84A 5FEZA 4U31A 3MV11 3TFCA 1GHSA 4MJMA 1YXCA 1J18A 4QR6A 3WD0A 4YTQA 5LYRA 5EMJA 1ISWA 4REQB 2I14A 3E74A 2PF8A 1N55A 3L4TA 2W6RA 4O10A 5CSSA 2VFDA 1ZAHA 4H4PA 1BYDA 4ZB0A 3FY1A 4PSPA 3UNTA 2EEXA 1H11A 3KHDA 2EQ9A 1H7NA 1HP4A 4TMBA 4AH7A 1B0IA 1E6NA 4Z42C 1X1OA 1O1HA 4YMZA 4NSBA 4K38A 2OODA 4IGNA 3NUKA 3OQEA 2GDQA 3N9KA 2NUXA 3PJUA 1P0DA 4LC8A 4O8AA 2POZA 3B3DA 2EF9A 3TK7A 1IXNA 1BLIA 4QJ4B 3WNOA 1E6RA 3BARA 3W00A 1H41A 2CLEA 1V93A 3Q94A 4POCA 9CGTA 4WGHA 4QCEA 2D24A 2WV8A 1JCLA 1TUXA 2V82A 3W2UA 3Q6JA 4D8AA 2CBIA 5CH9A 5BYWA 2E8YA 2WXDM 1HL9A 3SCOA 3QR0A 1UBPC 4MKVA 4D6GA 3CO8A 1T6MA 1KB3A 2J79A 1SJDA 2O7QA 1HT6A 3DFNA 1JRBA 3N18A 2C3ZA 4P7QA 2TAAA 3UWVA 1HNYA 3TZFA 1D9EA 2TRSA 4ZR8A 4JTAA 3D3AA 4MZYA 5HOSA 4QGCA 1TWSA 5HUPA 3A13A 1PIFA 4FZIA 1ZNNA 3LHTA 3AMKA 5REQB 8TIMA 4UTUA 2EG6A 2XFRA 1J79A 2IMRA 4GISA 4H8NA 5AN7A 2R91A 4ADUA 1A53A 1SFSA 2P8CA 3URNA 4QITA 4K7VA 4FA3A 2VGBA 3TQPA 1O66A 4HGXA 5FF7A 3U3HA 3GRIA 1PEZA 5CGQA 3TYAA 2FGBA 5BRQA 3TCEA 2G3IA 1Q6RA 3B8WA 4P7RA 4NIRA 2D22A 4MTVA 2VXNA 3SB0A 5BZAA 4IMAA 4UNLA 1LCOA 4FNRA 2NVKX 5E6ZA 5M2FX 3MUAA 3NQ2A 4X9SA 4PMVA 2QF8A 1KM5A 2A21A 3W29A 4RNIA 1RSCA 1VFOA 2YAUA 1W1A1 3LOTA 1JZ5A 1CDGA 1S7MA 5K4ZA 5FL1A 2QUMA 3G0XA 2D2GA 2DZBA 1THFD 3L21A 4PUEA 4ICCX 1LT8A 2XPKA 5G4EA 1YPFA 2RGLA 8RUCA 3K8KA 4DJEA 4XZLX 1GEUA 1EHAA 3NQCA 1EOKA 3TOYA 4U4MA 4ADSA 2QHAA 3PZOA 2AQVA 4HA4A 3DK4A 1VBJA 5F1VA 1EBGA 1E9LA 3N6QA 3GVRA 4DHGA 3T42A 3GR4A 4HCLA 1DOSA 2NLIA 5LIYX 1S2WA 5A94A 3IIOA 1C91A 3E2RA 1JD9A 3UVIA 2PDKA 1TTJA 3LCLA 1XIFA 3MP4A 4N42A 1DIEA 1POJA 5FS8A 2A4AA 4HU0A 3CPGA 2R82A 1KFWA 5CXPA 1FVPA 1EP2A 3HPSA 4QRNA 3S2CA 1ONEA 4IMFA 3KRUA 2HNHA 1VFFA 3CK5A 2IQTA 2XU2A 4AHQA 3WH9A 1RBAA 1XGDA 3E0VA 3PPCA 3QY7A 3RO8A 1GJPA 1RD6A 1TQJA 4XD5A 4ECLA 4ZOHB 3GXNA 1JVNA 3EDDA 3TNOA 2XN1A 1FCQA 3GU1A 2NV1A 3M7WA 1K8ZA 3CEPA 4FX8A 2JEQA 2A3HA 4PTDA 1IXOA 2OKOA 3HQPA 3OLEA 3DC8A 3PZTA 5CKSA 4H4WA 4N9BA 2F8QA 1J96A 4P8XA 2Y4SA 4TOQA 3U7BA 3ZZ1A 5HWJA 1FWRA 1Q7MA 1SUXA 4NYYA 3ZLHA 3DBNA 3PB2A 2YCLB 3NGFA 3CZ8A 1L6GA 1X1ZA 4AD5A 2PDHA 3WDRA 4ZCWA 2ZRYA 2NX9A 3BLKA 2QMJA 4PUKA 5FCZA 2R1MA 1U5JA 2J27A 5JXQA 3CQ0A 3AICA 3PF3A 1OZMA 1JCNA 4H19A 1EO5A 1O5QA 3EZ4A 4GMEA 4BHYA 2BFGA 3B9JB 4V27A 4MAZA 1ZBCA 1GG0A 1PKLA 1GQJA 3ZSTA 1HZYA 4ZVJA 4UBPC 1LYXA 3CV2A 3LXBA 3NVVB 1FHDA 3L8KA 3S9IA 1AK5A 3TCSA 1DIKA 2J75A 2PLKA 1UH2A 5A1AA 1E6XM 3H54A 2P0IA 3JR2A 3KHJA 1AG1O 3V0TA 1HJQA 2W5FA 1H62A 4GZ7A 3ZJ7A 1KXVA 2HSAA 3FYPA 3MQTA 2FDMA 3FA3A 4ZODA 2PP3A 1W1VA 5JIPA 1TMHA 2QJIA 5A6AA 1CENA 4UOJA 3FCPA 2A3AA 1GONA 1WKEA 3WD3A 2ON3A 3IPWA 3SUSA 1L2QA 3CIVA 3Q67A 3E2QA 3UPBA 3AYSA 1G69A 5I78A 4UTMA 2IQ0A 1HQTA 5GRTA 3N11A 1W9PA 2QUTA 3KUMA 3MKCA 4K8EA 2Y70A 2YW3A 1XYBA 3TUUA 1UASA 2V30A 4TX9A 2ACUA 2FFCA 1CXIA 1U30A 1OGSA 5PTDA 1UKTA 3NGJA 4B3ZA 1OG6A 1KFLA 1ITQA 3CMGA 3R89A 3T2QA 3ARSA 2UY2A 2ZUMA 2PE4A 3INPA 5A2AA 2PDBA 2CBUA 3HQ1A 3XINA 4NJGA 4KWSA 2F6KA 1M03A 3CO4A 4DLMA 1FWHC 3LPFA 4ZQNA 1JQVA 2WPEA 3QMRA 5D38A 5CBBA 1TV5A 4GZIA 2G3NA 3CTTA 2E3TA 1PE1A 2YL8A 3AFBA 1ICQA 1K77A 4GWEA 5JCIA 1I9CB 4J4KA 4IISA 5AYIA 2GQ8A 5SWUA 1I8JA 4NI3A 3SCQA 2VX7A 1EJSC 2Z2UA 5HJYA 1GOOA 2PDWA 4H2CA 4UQAA 1S39A 2DQXA 2AKZA 3ZQ9A 4GQRA 3R5EA 2EPMX 1HVQA 4CLMA 1RVGA 1B3ZA 1DIOA 1W3IA 3KL3A 3PWAA 4WRHA 3S5SA 3EKZA 3W1RA 3V0SA 1UJQA 5AFDA 2DZAA 3PZIA 5E93A 2ONEA 4N9EA 1W3KA 4FIQA 1OX4B 3G3MA 4PMXA 1F3EA 4ZE5A 1C3FA 2OZ0A 4R9OA 3W84A 4DF1A 3B9EA 3LHYA 4RV8A 1VCGA 3GE7A 1MUWA 3GIYA 4YCPA 3W3OA 5CEWA 1REQB 4W89A 3PK7A 1NHPA 4XZ9A 4H9UA 5KITA 3GDRA 1JCYA 3IVUA 3PZUA 5IDIA 2ZZ2A 4N6FA 4J3WA 5HR7A 1KO0A 4JS3A 5LHEA 4QNEA 4LUTB 3ANUA 2J47A 3H21A 2JF6A 2OKTA 1PUDA 4IQEA 1T5AA 1RCOB 2A79A 4B2DD 4Y8EA 3OP2A 2TYSA 4QDMA 2V3EA 4D6DA 4LWWA 5D05A 4HSOA 4DUVA 3FVMA 1V4YA 4K68A 2GUUA 3ZJ6A 2KAUC 2CXEA 3TN5A 3USZA 3WQWA 2DDXA 5MKGB 1P7TB 2CNCA 2ACQA 2VZTA 2DORA 1GVQA 4XZNX 2YDAA 4N4QA 3BICA 1GOWA 4JTGA 1H09A 3ZR5A 5FSEC 4H4SA 2GGHA 2XWEA 3PUDA 2HK0A 3BZGA 1DXLA 4PTVA 4PFHA 1FWFC 3CS2A 5DO8A 4CEXC 2PBOA 4EMWA 5KSWA 3SAZA 3T2PA 2XFFA 4Y9PA 3GNRA 4FNUA 1BYCA 1HF6A 4UFKA 2RABA 1PYFA 4MKNA 3NG3A 3U5UA 1ECEA 5JBDA 1OGBA 3NO5A 5DCDA 3B9AA 4WOQA 3UWEA 1CTNA 1XIJA 1BSLA 2CFFA 3APGA 3WJWA 4JYDA 1Q8AA 1V7YA 1ZL1A 1LWHA 3WLIA 1DJYA 3KZSA 3C86A 4ZTXA 3NCOA 3CT2A 1ZGDA 4CD7A 4IGMA 1Q65A 5D2XA 3L2MA 4WCJA 5KZ6A 3VKAA 4H4UA 4JTEA 1UC4A 4NJHA 1HTIA 1LT7A 3BH4A 4UQDA 3U0HA 3EWWA 1JDCA 4UMBA 3AIBA 3EDFA 5E9AA 1H2JA 2H9AB 3VIMA 3NYDA 4MWAE 1W2VA 3AXKA 2GOKA 2ISDA 4I9TA 3IIXA 1US0A 4IMCA 2V5DA 4P61A 3QW3A 1EFZA 3PG6A 4ZOAA 1E40A 3DG6A 2IUZA 4H4IA 3ABOA 1KLZA 3FGCB 3VX1A 4AVNA 3U2EA 1NU5A 3VCCA 1KW1A 4S3JA 3GFYA 3HJZA 1TTIA 4EMIA 4KGJA 3LZ3A 1D8CA 1F73A 3BAIA 4J2MA 5JMUA 4KFPA 2A3CA 1QUMA 3GH7A 1QBAA 3UPMA 3HV9A 4NX5A 1YDNA 2V63A 4ONVA 3ATZA 4IFOA 2ACRA 1VS1A 2HPIA 2IKJA 5CC3A 2VX5A 3B9NA 3IGXA 1S3HA 2IPWA 2NQHA 1MFVA 3T05A 5JH2A 3N73A 2CFYA 2BLEA 5HQEA 3MC5A 4JBRA 4RV3A 1XDLA 1F8WA 3NXLA 3VNLA 1BGAA 1K9DA 3G0UA 1MNZA 5GPRA 1IE7C 4FOKA 1XCFA 4R3UA 4O54A 5AKQA 1KA9F 3TSDA 5LZLA 3QFAA 4J3XA 5CQ1A 3WNNA 2GVJA 1J11A 1UIPA 2IQDA 4U2ZA 4W93A 4FSAA 1AZ2A 4HJWA 2AMXA 1NIUA 3T0AA 7CGTA 4FX6M 4A4AA 1RPXA 2D0FA 3N13A 3WLSA 3H2OA 3M0JA 3WFLA 4LSBA 3PSWA 3L23A 1XSIA 1EKOA 3B05A 1US3A 3SN0A 2OU4A 1TPB1 4GABA 4H6QA 5DT7A 4IMDA 2W54A 2HS6A 2WQPA 1B3WA 2XM1A 2HVOA 2HMCA 2PDCA 1XM3A 4G7EA 3FDKA 4J3ZA 2DJXA 4OVXA 1LWIA 2E5DA 1G4EA 2OELA 3AIEA 1WZAA 3TW6A 1VPYA 2OG9A 4A22A 3SCSA 1QXLA 1ZHAA 4CU8A 4C6EA 1Y8BA 2G37A 3O6DA 3FEQA 3P14A 1GQLA 2PAJA 1PKYA 4HBKA 3TN4A 3W07A 5HWNA 4GINA 4XWUA 3HV8A 1I2PA 4BF7A 3NVTA 1XIBA 1BEUA 1S2UA 2F7FA 3RLVA 2HK1A 3AQUA 3VNMA 5ABFB 3EXTA 3UZJA 2DZXA 2V6OA 1T8QA 4R7WA 4HT3A 5A6KA 4N7QA 4QROA 3CPRA 1V6TA 5KINA 5D9NA 4B5TA 4B3KA 4H01A 1W8GA 4L9YA 3GH5A 3DYMA 5F4SA 2VDHA 4PCFA 4JNMA 1CB2A 1ZBWA 5BRPA 2VEGA 4J28A 4JFWA 4GBDA 2E77A 4MUPA 3EAOA 4O11A 1D7YA 3K13A 1BF2A 3QRHA 3T08A 2QVHA 4CQ8A 1QFEA 3GG0A 2QMKA 4IIFA 3WELA 1DJWA 1LORA 2BGNE 3VGHA 4Q8OA 2CDUA 1M04A 2NPXA 4TIMA 3T55A 1ZENA 2WVUA 4PZVA 3NQAA 3FG2P 3FXGA 4CQCA 1HKMA 1QATA 2XDFA 4J2PA 3IIPA 3OHMB 2X1IA 4CN6A 2Y7EA 1FWIC 1PVNA 2NUYA 2FZ9A 5BXSA 1OFQA 1JRPA 3P67A 4X63A 1PCKA 4UCFA 4NZ4A 1TPWA 2Y24A 2CLKA 1X6NA 4FB7A 1DJHA 3B9OA 2VVSA 4DNHA 2XSBA 3QZAA 3GR7A 3VXGA 1K03A 3AZRA 1E0WA 2XIIA 2VFFA 1GESA 4PCPA 3RM8A 3C61A 4HNVA 1B2YA 1GOMA 2JE8A 2Y63A 2OZTA 1A5CA 3BLDA 1SMAA 1TX2A 4UQBA 4XK2A 4CVUA 3HPZA 3KEHA 2XIBA 4QLJA 4I6KA 4YTRA 3TP4A 1Q5MA 4MSSA 2VWTA 5HDRA 1CEOA 5BU9A 1IGSA 3EX2A 2GR3A 6A3HA 1B4EA 1NJJA 3N6JA 4LU0A 3NQFA 1SU5A 4C6CA 3QGKC 3UF9A 1JXJA 1XBZA 2BY1A 2RAGA 3ARYA 3VNIA 3UA3A 2Y5SA 3MCNA 4PMYA 1OC6A 1Q8JA 3F4VA 1EJXC 3LB8A 3NURA 1P1XA 6XIMA 2NLYA 4E2DA 3NJ3A 1GKRA 4NXSA 5LA2A 4JOMA 1HL8A 2QPXA 2ISSA 2JKAA 4C6FA 2ZZ5A 4L5ZA 1JUEA 3SN1A 4MYAA 2E3ZA 4BR1A 3GU2A 3O2LA 3DK8A 5FF2A 4IQLA 3T0DA 4D1IA 2YDRA 3FSTA 1VYPX 3N2CA 3RLUA 2VEKA 1IWBA 1F3TA 1I0DA 4Q7NA 3VC5A 3AROA 2VVNA 4MMWA 1UMLA 1DEDA 1E3XA 1OX5A 3CXBA 1FCUA 3LRMA 1P6CA 1DHPA 2YCJA 1GKQA 4H83A 4ZFCA 3E5BA 5K9CA 1FKXA 3OVPA 1UR1A 4TVWA 4LUSB 3CB8A 4PMDA 1TCMA 4HNLA 1QI3A 1XYFA 3C52A 5F2IA 1H50A 1H7PA 1HGYA 4IQJA 4JYEA 5LNVA 5KEZA 2GR1A 2H3BA 3QTPA 1E4IA 5FAGA 1S2CA 2BY2A 2R9ZA 2ZZ0A 2QJHA 3PUEA 3WLLA 3K46A 3WEZA 4M6QA 3G8EA 2YCLA 3S9ZA 4WIWA 3W1TA 5CCZA 1HJUA 3LI1A 1GRGA 4F2UA 1BG4A 2X99A 1X2HA 4GNKB 5TR3A 1XIGA 1VYSX 3QC3A 3RPTA 2E67A 4AYSA 1IT8A 1JEHA 4DJFC 2PP1A 3QLLA 4Q3MA 1BF6A 1LBFA 4EXQA 4AC7C 2J9ZA 1O68A 1UOZA 4DI8A 2ODOA 4KEMA 2BX7A 2Z6IA 2VWSA 2XN2A 3TVAA 5G4WA 3KW3A 1RJPA 1FFUC 2ASHA 2DH3A 5J04A 2TODA 4C7DA 3A3HA 4G5DA 1OQFA 3GXPA 2WCSA 3VX0A 2YCKX 4LEQA 1W1PA 5I3DA 4JKKA 4RZ6A 1YPXA 1C90A 2XINA 2JQXA 3UD6A 4IX2A 1B57A 3WQVA 5CZ0A 3WLOA 3VCRA 1FCBA 4JIHA 4WZHA 1ZX9A 4MLRA 2OPJA 2RDUA 1EEPA 3WUEA 1YE4A 1VC4A 4F40A 1FQ0A 4TU1A 4PYSA 2D2JA 2ZX6A 3IACA 1UKPA 3U2CA 3B04A 4ORIA 2F61A 3KBSA 4IM4A 3N04A 4KCUA 1TE6A 2V81A 3TW7A 1J4EA 4AZCB 2REQB 3STGA 3U4AA 3LHVA 2TSYA 3DESA 4MG4A 1MW0A 2F9RA 1CXLA 2WSRA 3L0KA 1EIXA 3GHRA 3WLPA 1BYAA 5CPQA 3P0XA 3WEMA 3F2CA 2BGQA 3FN9A 2CKRA 4LRSA 4C60A 4ATLA 4I9AA 1XDMA 4RCXA 1RVKA 5C71A 3E2SA 3W7PA 4IXXA 4Q4MA 4GY1A 4L6DA 4NI8A 2GJXA 2Z1SA 1UH3A 3B97A 3QZ6A 4B5NA 2WOVA 2R1PA 1L9WA 4GJ1A 3GDLA 4UTIA 3N14A 2NQLA 4FNQA 4IFKB 2VM8A 2W67A 3SGZA 5JIWA 2B31A 4JAWA 1NOWA 3GBDA 4DNMA 3LCXA 3DBPA 4NAEA 1UWQA 1WKYA 2QCDB 1EB3A 1GOQA 1DXEA 1OYAA 4XSMA 4Y9OA 5DX7A 2YGYA 1BHGA 2YBVA 6REQA 1OG0A 4LBSA 1FDJA 4XTIA 2FH6A 4QHRA 2Y2WA 4B5UA 2QAEA 2X50A 4LUYA 2W27A 4ES4A 4HNNA 3LCGA 5DCBA 2YCEA 1JPMA 4HPGA 3UEQA 1AL8A 3MYOA 2AQWA 3HRDC 5H8PA 3R4IA 4GJJA 4LV9A 1J2BA 4C6IA 2HWGA 4IHCA 1D8WA 2ISWA 5D2TA 4A35A 3DC0A 3MSDA 1FWAC 1VR6A 1W1TA 9RUBA 3R0UA 3IC9A 1O12A 2E8ZA 3A3XA 1QW7A 1UWTA 4A3YA 3GG8A 1TPUA 3VIKA 3VE7A 2W92A 4EK7A 2E0PA 4J27A 7PTDA 4ZSTA 4ZL1A 1RR2A 1VLIA 1O4UA 3BK0A 4Q8QA 5CJ5A 3VFLA 3FJLA 2HCVA 4FF5A 2JK6A 1NTHA 4UXDA 4FOJA 4A05A 3GTHA 1OYBA 1XLMA 5HANA 4LAKA 1P7TA 3G8RA 2C14A 1GORA 1XBYA 1UZ1A 3ZO9A 1KWGA 4A3RA 1VENA 3HZ3A 3M0ZA 1GQKA 4O4WA 1FWNA 2WMGA 1V6WA 3AXXA 4LAZA 2FPTA 4ACZA 3P62A 3LLDA 4AQLA 3N3TA 1EX5A 4NF7A 3W7MA 3ZVIA 2ZADA 2YKKA 4W86A 3MY9A 1YTKA 3R07C 1XINA 2D2OA 4C1KA 1EC8A 1RD5A 1B30A 1W91A 3AHYA 4C6MA 4HMEA 1FWDC 3M0LA 2ZUTA 1PDYA 3H4WA 1J6OA 3A47A 1XPYA 1R30A 3LPGA 1W32A 2VD9A 4C5YA 4Y9AA 3B40A 2PRMA 1GHRA 1M41A 2WMIB 4EOUA 3WDJA 1PAMA 3T1GA 2VQUA 4PRTA 2DZTA 4X3ZA 3N19B 2QQ6A 1UW9A 3A7UA 3LTSA 4NVTA 3FAXA 5E9XA 3VC6A 2BCPA 3MMDA 1Q85A 1W0MA 3O6YX 4NY2A 3MT1A 3BAJA 2PSNA 5D30A 2ZZ1A 2I9UA 3NPUA 1HXJA 4D6HA 4R7OA 2YDSA 4LX4A 4LYQA 1SZRA 3OZYA 1WDWA 1Z3NA 1JDAA 5DBTA 3ARUA 2C7FA 3TONA 5T9BG 5AC5A 3WUGA 4M80A 2POTA 3ABZA 3PBYA 1B4KA 5EPDA 1CLXA 3VPLA 4ZZ9A 3H2FA 3SRHA 2D23A 4AHPA 1KFKA 1OEPA 2VX6A 3NFUA 1XGZA 1J0YA 3Q37A 4GYPC 2LLEA 2J74A 2EKGA 4YWSA 1JNEA 1W31A 3GG7A 1ISVA 4C1LA 2EQ6A 4DQWA 1RUSA 1MXDA 3ONBA 4H4VA 3ANVA 3O15A 4Q4QA 3B8TA 1S2TA 4K1WA 4QDPA 1N8WA 1MNSA 2EPOA 3PHAA 3UWQA 3M6DA 4XZMX 1TX0A 2HEJA 4MOZA 5LIXX 1YBQB 3B4YA 1JI1A 1JJKA 3NSNA 4UTWC 3CNYA 3GNXA 4ZQOA 1LL4A 3DEQA 3OJGA 1NP2A 3ENLA 1JF5A 3H2NA 3EA1A 2UWFA 1H5VA 4B3LA 3FAWA 5CGMA 1TV8A 2WZHA 1KM1A 3LY0A 2XUCA 1VAHA 4GUJA 4H9XA 4GCAA 2YXXA 5I03A 2XZ9A 3D5HA 3VIOA 5C7HA 4IG2B 4I8YA 3VGDA 3LENA 4NJJA 1BWCA 3CZGA 8XIAA 1HKIA 3RMEA 3H8AA 4JTIA 3JZEA 2XM2A 4IX0A 2GJLA 1M7OA 4Q8WA 3WQ4A 1RY8A 4DF0A 4KWOA 2BVTA 4NNAA 3W26A 5D2VA 4WDTA 4EKJA 1NDVA 3CAWA 1WKDA 4TV6A 4K8DA 4RDYA 3NL2A 1L8PA 1E0XA 3THDA 4EM4A 1VBRA 3CIWA 1EH9A 4HN8A 4IUGA 1EZ2A 1E4LA 2QCGA 2V5JA 1EJRC 2XVPA 1V3HA 3VM5A 5AYXA 2ADAA 1W5QA 3VZXA 4C91A 4V33A 2XSXA 1LOLA 2V9DA 4PMJA 5KETA 3H6OA 4D6EA 1R46A 1EJ7L 2YA0A 5DELA 5E5CA 3LGEA 4NZJA 3GUWA 3WQFA 4LS1A 5AYBA 1WV2A 4NHVA 1HO4A 1U1UA 3IV8A 1W9BM 3LCFA 5FAJA 3AM9A 2FTPA 4DBDA 4RDWA 2GWGA 3SUTA 3TEVA 3MMTA 1XXXA 3LQGA 2HRWA 1I1WA 1I60A 3HG5A 3NEHA 4JFTA 3A7RA 2XTKA 1VJIA 1MW1A 2XIOA 2NZLA 1K4GA 4IICA 3CHCA 3KL5A 3TC3A 1JR1A 3TNBA 2VEMA 1NVMA 4ZQMA 4B90A 2X8HA 4S3BA 2QCNA 1E6ZA 1ELSA 1W3HA 4DVOA 5CPTA 1I1XA 3NL5A 3SCTA 4Q6JA 3FA5A 2PLCA 1YQZA 2G8ZA 5EMYA 2W61A 3U4FA 3WH5A 3CGBA 1J01A 1LLWA 2PWFA 1FHUA 2DQWA 1HKVA 1VZWA 3WLNA 3OBKA 3KCOA 2YBTA 1M6IA 1V03A 3C8FA 3QMTA 4IPLA 1TVNA 2PBGA 3QLDA 1IXPA 2VC7A 4KRZA 6TIMA 3EPNA 5FA5A 3S1WA 5TIMA 2J78A 1PSCA 1KGWA 1GRBA 1VQZA 3M46A 4JZ5A 5IRPA 5DF0A 4JFSA 4WF7A 2Z1BA 2EQ7A 3S1VA 3U2ZA 3IJ9A 1LUCB 3GC2A 3DH7A 4HVXA 1K7EA 4HHPA 5A6JA 5CAKA 4G7FA 3ARXA 1SW7A 5E6YA 1O6IA 4JIIX 4WQ6A 3AMLA 1A5SA 1ZK7A 3CEUA 4UFMA 1NFPA 2OQYA 4DO6A 3M0HA 1F7BA 4BQ5A 3S0CA 1V59A 4BEUA 4L1GA 2QPSA 1Z69A 1FWGC 5L6UA 4DWSC 2GR2A 3LN3A 3M5YA 4AD3A 1CT5A 4BQ4A 1T8XA 4JHZA 1N61C 1EJTC 3ES7A 5J8LA 4QP0A 3VIJA 1GYMA 2PWEA 2C16A 3SN4A 4S2CA 3TW9A 2EG7A 3NL6A 3N4AA 4JTCA 1RA5A 4O50A 2BBFA 2GVYA 1KBBA 5C7VA 8XIMA 5HR6A 3NZ1A 1MW2A 2QS8A 3ID7A 2VEPA 3CUFA 4X0NA 3PAOA 3IIVA 4D72A 1NHRA 5BOFA 4XKMA 4ORMA 5U4NA 3WL0A 4OUEA 3RILA 1VLWA 4Q4KA 3CAVA 4H9YA 3VMOA 3JRKA 1XPGA 3O0FA 5LIKX 4ZXOA 5CPNA 3CT7A 1IGWA 5A69A 3EMCA 1K4QA 2ALRA 4FLQA 4LA1A 4NNBA 1PKNA 2VQTA 3WBXA 3STFA 3WG6A 4LH8A 3UXKA 3GQYA 4ML4A 1OT1A 4ZFMA 5CGTA 4CD4A 2JFEX 4BQ2A 4Z08A 4CD6A 1DIDA 1V08A 2WNZA 3BLPX 2VFIA 5D03A 4QFUA 3N9RA 3QC0A 2OO6A 4XVEA 1L6YA 3QQWA 4QCFA 3M41A 3BMXA 2PTDA 5G1MA 3PSVA 4GPNA 4IP5A 4NILA 3NPXA 4DBEA 7REQB 5FACA 4O28A 2QJJA 4OBRA 1GOKA 4PMQA 4Q8PA 4GNVA 2NSOA 1QNPA 3ISIX 3O3RA 4DO5A 1H49A 4PBFA 4GQBA 1TG7A 5FD0A 5JVLA 1H6VA 2QKFA 2VRKA 3H24A 1V6VA 2MUCA 3ATYA 1PTDA 3KTSA 3LPOA 1ZCOA 3ALFA 3GY1A 4KEZA 3GSMA 2EBNA 5G5IA 3WMLA 2B7OA 2NWRA 5FJRA 2W79A 2Z26A 5I3HA 5I24A 3W6YA 1Q6GA 4R88A 1ME9A 3CUJA 3UWUA 1YDVA 5XIAA 2FIQA 5LGZA 2SFPA 4U10A 5IM51 4PB5A 4TUFA 3HBLA 5LNUA 3EF6A 1FA2A 1ZQ5A 3OGRA 1U5HA 1UP0A 2NX1A 2D20A 1DYSA 1M7PA 1XQKA 4KFOA 1Z8AA 2G95A 3M5VA 1YKWA 1NY1A 3FW6A 1HO1A 3AMDA 1TA3B 3UETA 2NVDA 2C1HA 3NZRA 3S2MA 3LGGA 5FOOA 3NYZA 1UWAA 1XG3A 3S9YA 3LXDA 2I57A 2I5QA 1EPXA 1OJXA 5FIPA 1B9BA 2DUAA 4JR5A 1A3HA 3RO6A 2YW4A 2ZFAA 3DGZA 3MVTA 2Q3OA 1QHOA 3V5FA 3CTLA 4E8CA 3ITVA 1DTUA 4GVGA 3L9CA 4H4QA 2G5WA 3QY8A 3TX9A 3KX6A 2JIEA 3DCPA 3KCLA 3HMJG 5I02A 2PPGA 3QSTA 3TYZA 3STCA 2CU0A 3V5CA 1VHCA 2WVSA 3EX1A 2VMFA 4NZCA 2CXGA 1G6CA 1G7VA 1O7AA 3VNKA 1TPC1 4AZHA 2ZX5A 4LPCA 2PA6A 2ABBA 4GI4A 1FWEC 3NO1A 1WCGA 2REQA 4NNCA 1XLIA 2YYUA 3N2TA 3MSYA 4TTGA 2QEZA 4X22A 3VU2A 4EF9A 1X38A 2PU0A 1TZZA 4QJ5B 3MHFA 4H6KA 5BWAA 4B5SA 1NOUA 2VRQA 3GBEA 4O17A 1BXCA 1WBHA 2FB3A 1W5MA 1AH4A 2JEPA 1E9YB 1S3TC 1UR4A 4AWEA 2X8CA 4UUIA 2G41A 2WLYA 1AMKA 3GM8A 2QVNA 4AIBA 1V0LA 3TA6A 5CZKA 2GJPA 1GVIA 5DMMA 5A6MA 4KW2A 1WYGA 1TTPA 2P1FA 3RCMA 4ZO7A 4QDWA 4CNPA 2DT1A 1QPRA 4JHMA 3ANYA 2FGLA 1DHKA 1V51A 4BV6A 1GJUA 4OTKA 4V1YA 3V1HA 3UVAA 2CEQA 4F0KA 1PJ9A 5I77A 3CHVA 4Y90A 3DXIA 4DJDC 3OW1A 1J8VA 2W55A 4RPQA 3WL1A 1JYXA 3EKLA 3L12A 3TMLA 1XV8A 2NXGA 4UR9A 1OCJA 1I2NA 3OLDA 4IGHA 3W7DA 1XC4A 4UIOA 1Z32X 4HJFA 2ZZ7A 3XISA 1TYPA 2ISFA 4LFYA 1TJ0A 4JICA 4HYVA 1XKJA 2C0AA 3UZ5A 3R11A 1AJ2A 1HFBA 1XD1A 3CAQA 1FCVA 4I7UA 2ZA3A 2Y89A 2W9MA 3S1XA 5I79A 1WDRA 2V5CA 5D2WA 4LT9A 4DYJA 3M9YA 3E96A 5CC6A 3BW2A 3GD4A 1EEXA 1PB0A 3TJLA 1E0TA 2ZE3A 3PY2A 3KRSA 3WZ0E 3AYRA 1ZCCA 3DGBA 4J3SA 1J6PA 4UFLA 1ZFJA 3KVMA 3M0YA 2NVAA 4AMAA 1S2AA 4MWAC 4MY8A 3CXOA 2NT0A 1XR2A 1BQCA 5H8MA 5IFTA 4P7OA 3QVQA 3IVTA 4ALDA 3V35A 1V3IA 3OIXA 2C13A 3ARWA 3VD5A 4HPHA 2Y8UA 3VZYA 6ALDA 3QW4B 3FFSA 3KZPA 4B4HA 1UA3A 1UQYA 1SSGA 2Z1WA 3F03K 1GNXA 1I0BA 3LG3A 1DL3A 3ARTA 1VIZA 4Q7BA 2FKPA 4Q8VA 3A22A 1E5JA 4L56A 1Q2RA 4BQ3A 2F84A 2I7GA 1J0JA 2TMDA 2ZXQA 5I06A 4WY0B 1AQ0A 4O8RA 3FOKA 3ARQA 3ZOAA 5H91A 1G0CA 1I2QA 2ZRVA 3VNJA 2FH8A 4CNOA 3PFRA 3LX9A 1H7OA 1SZGA 1XF0A 2X05A 5HJXA 1IEVA 5DMNA 2YB1A 3VKDA 3DGHA 3ALGA 3GRTA 1ZMDA 5JCKA 2Y8VA 1WDSA 4Q32A 3EB3A 5FJJA 2ZTJA 1UCWA 1TYGA 1UZHA 4IL0A 4GX8A 3SY8A 2JGYA 2V5KA 4XQ6A 2O0TA 3H23A 4F0RA 1M1BA 2QNEA 4HPNA 3NDOA 5F4WA 1OX6A 2OSYA 4LJ3A 1S46A 1AH0A 2R6OA 2VGIA 2XGBA 4NZ5A 2Z4GA 1XRVA 4WLCA 3VILA 3LHUA 4ROPA 3EWZA 4HSHA 1PHQA 5AHEA 1DNCA 3LBOA 3L4WA 3APYA 1E9IA 1FECA 3BE7A 3RAOA 1GRAA 2BG5A 1TB3A 1SYTA 2AOSA 4QEEA 3S4TA 1RM6B 1Q6EA 3B03A 4GXWA 3AMGA 2VOTA 1B1YA 2OTDA 1YNQA 3K4DA 2WANA 3WJYA 4AAJA 2GGIA 2PLJA 2D0GA 1E0VA 4JNYA 4ZQRA 3TWBA 3GX9A 1TCDA 1JCXA 1JAEA 1HP5A 4W8BA 3EKGA 1OFOA 2DH2A 2CBJA 3PBGA 3FXYA 1CCWB 3SQSA 1QK2A 4MPKA 2PRLA 1MUCA 5EYWA 3DFPA 4Z2KA 5J5DA 3W2KA 5HJLA 3E0FA 5FJIA 2MNRA 1IEQA 4N2YA 3HIJA 1UR3M 1V0NA 2GVGA 1DE5A 2EAWA 4O1CA 1U1HA 3LXCA 1OCNA 4GY0A 3KBMA 1BZLA 3C2OA 3MYPA 1KKOA 3FJ6A 3MUY1 2ATSA 1K6WA 3MI2A 2J9XA 3WCZA 3B0XA 3EWUA 3MUZ1 4JQ1A 4Z0SA 3SQMA 1TPH1 1R9ZA 3VKKA 4AD4A 5CSUA 3SCRA 1KXTA 4Y7EA 1OJTA 2I17A 1UD3A 4CVWA 1LOSA 4GUHA 1G4PA 3TYUA 3THAA 1FWCC 1V3JA 2OLAA 4QTGA 5E70A 1EC7A 1IF2A 1TJRA 4MDOA 1KD0A 4LB3A 1H61A 3L5OA 1QWKA 4TX8A 1KLYA 1E6QM 4RNFA 1A4MA 2J7GA 1M65A 3WNLA 4TVCA 1JZ7A 3NOYA 1OB0A 5CG7A 2VC6A 3NAVA 5C2CA 3OIHA 4H7VA 5G1TA 4RPPA 3GRSA 1YMYA 3OB8A 1EUAA 5E0FA 3ZJKA 1FX6A 4GVFA 1Q6QA 2DIJA 3W7EA 3VNDA 4E2OA 3LA4A 3TYEA 5D04C 5IBXC 3RX2A 3W1LA 3MI6A 4O1EA 3M7SA 4R27A 3JVAA 5I5RA 3P2VA 1ZJIA 1FHVA 3VOGA 5C8BB 1I75A 1IV8A 5HPOA 1TRDA 1WXYA 2VYOA 1Q2SA 4JX4A 4MDPA 4L9ZA 4RE0A 5C2GA 1UKSA 1EXBA 3PJXA 3TWAA 1XI3A 4XBSA 3TE9A 4B5XA 2OWCA 4XZWA 5DRCA 2PD9A 5K9XA 2XIJA 2PD5A 5EY5A 1YDYA 3NQ8A 3OYXA 4Z1AA 4D6FA 1TWWA 1RLDA 3BW3A 3FYYA 5JCNA 4JY9A 1B5TA 4PTMA 2DP3A 3N34A 3WQDA 3MHUA 3H7VA 1EBDA 2ZUNA 1MXGA 3KDOA 1H1ZA 4LEFA 2EPNA 1D3GA 2Z1VA 1T41A 2WMFA 3M64A 3H2MA 1P1MA 1W9XA 3MV01 4M24A 2GOUA 3WEOA 1XLDA 4LUIA 4UTTC 4WDWA 3QZEA 4K8GA 4OU1A 4V28A 5T9CE 4YNGA 2BB0A 1O1ZA 3I6EA 2CETA 4ILSA 3MWAA 1A4LA 3R8RA 5D37A 4R34A 2Y62A 2OOFA 2X2GA 4B91A 3W85A 1DKWA 3R58A 1GRTA 4M19A 4LAUA 3KTCA 5FESA 4ZA0A 1QPKA 2X1TA 3UGVA 4LYRA 2Q09A 1K3UA 2AMGA 1AA1B 4GRSA 3S46A 4PTNA 3SY1A 1OHLA 5LHFA 5GJPA 4K1GA 4GE8A 1JQXA 1PPIA 2OCZA 4RZ4A 1O5XA 4XD4A 3TV8A 1A5BA 2YZ5A 2OFJA 5HMDA 1CGTA 4QJ1A 5KTLA 2WPGA 1F61A 2PGEA 3NDYA 1TZ7A 3W86A 3B0VC 2GQ9A 4US6A 4WR3A 1T7LA 4D71A 1C8YA 1IZCA 3IJ8A 4KH2A 1QU4A 2PDIA 1NH6A 5C9WA 4Z2IA 3AIVA 2DT3A 4GNJA 1ME8A 1RQHA 2X30A 3UG8A 1QNQA 3CU2A 1NARA 3ITXA 5C9XA 3GS6A 3B4UA 3HF3A 1ADOA 5DLCA 1TSIA 4RE2A 3WJSA 3OZOA 2JKEA 4KQNA 2H6RA 3NTYA 4GK8A 1RK6A 3KAOA 4N0RA 4M82A 4U2YA 1LLOA 4FXSA 1QVBA 3T09A 4F2BA 2QUNA 2A6LA 3EEGA 3SURA 3PB0A 3LSBA 3G1YA 1WBJA 3VD9A 4EIVA 2OLHA 4OHQA 3W2MA 4I9JA 2VGGA 2CZDA 4PCSA 1Z9AA 3GXMA 4AFYA 4DI9A 2PB1A 3P8IA 3TROA 5G5GB 2CPUA 4PUJA 3P82A 4JXCA 4L7ZA 3U57A 1KN0A 4CKQA 5AOUA 1MSSA 1ONRA 3KS5A 2J66A 3MI3A 4NP7A 1GOIA 1XYMA 5AZ0A 2Q01A 3ABQA 2Z6JA 2FJKA 3KOXA 3FDGA 1EDQA 3BLIA 1HN1A 1GETA 3ELFA 3IGUA 2O92A 3MPGA 1C8XA 1X8FA 4LYKA 4AIUA 1VPQA 3DU0A 3UCCA 1SJAA 1FWBC 1VGAA 3MUCA 4AF0A 4AY8A 1R85A 2DGAA 3GNOA 3IARA 1EYEA 3NA8A 3IK4A 3FYOA 4NQ1A 1EJWC 4M56A 4XVDA 2BOGX 2Z25A 1WOAA 4LTSA 2GK1B 1G4TA 3SCPA 3VABA 1RALA 1LF1A 1GW9A 3C2EA 2DZPA 3PG9A 2VEFA 3PN8A 1WDPA 4DJFA 3SBFA 2J8GA 2WB5A 1WO2A 2O9RA 1WZKA 4R5EA 1W1ZA 1OFPA 1NQ6A 1DWJM 1O5RA 2WBKA 1QO2A 1MMFA 1DWIM 2J13A 4L64A 1TELA 3LNPA 4WJEA 3FJ4A 3S1GA 4G1KA 3FNDA 3RCNA 3W27A 4EPBC 2XVLA 1MYRA 3VCNA 1XHGA 4MF4A 4WXZA 1XYZA 1V6XA 3DG7A 3VD3A 3I3EA 3TR2A 3LI0A 4L9XA 2GUYA 7XIMA 1TFVA 4NX0A 1Z48A 2QJMA 2E09A 1KRCC 3L66A 5F2LA 3IJIA 4QE4A 1DJGA 2PI6A 1V02E 2I1OA 4XV0A 1WDQA 3QYSA 2V3GA 4X9YA 4DJDD 3EWXA 1LZOA 1TIMA 5EMLA 4EE9A 4U28A 1AQMA 3A4WA 3QY6A 1A80A 2PWDA 3P8JA 2DSZA 1JCJA 3N12A 5I09A 1JGMA 3MZNA 4K2SA 1ONWA 4UFJA 1TVLA 3NPVA 3VIGA 3AU6A 3CWHA 3G0SA 1I2RA 4G7EB 3TIMA 3B9DA 3UZWA 2AL2A 3MUIA 1W8SA 2PWHA 4CGTA 2JF7A 3AZSA 4S38A 4IPNB 3FHAA 2XH4A 4EQRA 1F3XA 1VFUA 1MZRA 2J6VA 2PRHA 2WZTA 1V5XA 3PFMA 1TVPA 2VR4A 3E38A 3EX3A 6XIAA 1JCTA 2CC0A 4BJHA 3DG3A 4MB3A 3VD4A 3G24A 1TO3A 3TKFA 3MU7A 4JTSA 4S2BA 5EBAA 5I0DA 1SQ7A 4JN8A 2Z29A 1ECQA 4LCRA 3MA8A 3ZJ8A 3CZJA 1J0ZA 2HQMA 4AIOA 4EWND 4GX9A 1ODUA 3L2LA 3RRAA 1OINA 3NIYA 1ALDA 3V75A 3VA8A 4UWMA 1X7FA 1QNVA 1DV7A 5D9PA 2EGZA 3KRZA 3R0DA 3WUFA 1D3CA 2QCLA 2ZWYA 2VCAA 2QULA 3SCNA 4Y9MA 5BROA 4DZ5A 2EPKX 4BZYA 4ADWA 2WOWA 3NQVA 4AW7A 3I3BA 1YLVA 4C1NA 3LRKA 4PMUA 4WOZA 3HG3A 2PWGA 1MQPA 1U1JA 3LXAA 4F9JA 3WF2A 1GPWA 4A29A 1FRBA 5HUOA 5B7YA 1BWLA 3N2OA 2NUWA 3HJEA 4N6EA 1TTQA 1ZP4A 2FLIA 5AHLA 3GZ3A 1AMYA 1E6SM 2DZVA 1NDZA 1X2GA 1UR0A 3SCWA 3L65A 3QHNA 3UR7A 4LRTA 3LUTA 1TPEA 4CD5A 4OWGA 1RAKA 3GH4A 4E8GA 3C2YA 2WSYA 4AD0A 3G5EA 2IS7A 2QCCA 4PSRA 3G1XA 2Q8XA 1PTAA 4BWLC 4K3ZA 3CV1A 5JQ9A 3ITTA 4J3VA 1R7OA 4LB4A 1OBAA 3M4HA 5TNVA 2XSAA 1IQ8A 3TN6A 1ZY9A 3MZ2A 4GIRA 2RDTA 4HZMA 1FHLA 4WY0A 4UB9A 4M81A 2X0YA 4I9MA 1A5AA 1CXFA 2ZOXA 1OD8A 3UG3A 9XIAA 1VEMA 3G6LA 1A50A 4KEVA 4WKAA 4FOUA 4LVAA 4ZB5A 1RA0A 2E6FA 2ZUUA 4OUIA 2OOGA 1M53A 4AZBA 1MZHA 2R24A 3EXRA 5F1UA 2PDLA 1JPDX 3OG3A 2ICSA 4TXEA 4PTXA 3WQOA 3CWNA 3T40A 3L4YA 3KBJA 1P48A 1N5WC 1I4NA 2FYMA 4QEHA 4LY8A 1ZAIA 1EWDA 2YLAA 4HB7A 3URQA 3QJAA 1DJXA 3P84A 2VC5A 3HTWA 2PU1A 3IV3A 1K7XA 1FO4A 4APNA 4YWIA 4D9PA 4U3AA 2GSHA 4HSNA 4UTHA 4HMDA 3LCIA 2HE5A 3MKVA 2PZ0A 4WUIA 1JRCA 5DBUA 1C93A 1JDDA 2XHYA 4DWDA 1QR7A 2IW0A 2I56A 4UOZA 1W1IE 2GL5A 4LV4A 1P0NA 1V79A 3BG5A 3DUGA 3DX5A 3W4RA 4GYPA 3TC7A 4OBSA 3S5NA 1P4CA 4IMGA 1ZAJA 1D3HA 3VM7A 1QMLA 4IIDA 3R10A 1IWAA 1JD7A 2QJGA 2VL4A 3W37A 1PX4A 4IPIA 3R94A 4Y8FA 3RF9A 5C54A 3DHDA 3GNDA 7ODCA 4XTDA 3MMWA 4UTWA 5I7GA 1JZ8A 1A49A 2NV9A 3MP3A 3V7PA 3RNMA 2EKCA 2INFA 2KZHA 1G1YA 4H6RA 4A6GA 1XSJA 1KM3A 5LIWX 1GVFA 1ZU8A 3QFWA 4LW7A 1CGYA 3ZS4A 1JFXA 4J3TA 1UWRA 1Q63A 1YRRA 4F4RA 2CLFA 3CQHA 4FAMA 1OD0A 1G94A 5CC5A 3I7QA 3TTSA 5CJNA 1SFJA 1E15A 4G2DA 1GJWA 1SZNA 4GH1A 1G67A 2GH5A 3NQ7A 2O4QA 3IUHA 2WCGA 1A3XA 1TJPA 2BSLA 3OLIA 1PO9A 4ERAA 1VBUA 1C8VA 2GSJA 2Y61A 2Y0FA 4K8HA 3C2RA 4IXHA 4V2XA 1R47A 2PZNA 2EO7A 4EACA 2NXIA 2WO5A 3SO7A 2O9OA 4A8IA 3QTGA 3QPEA 1AH3A 2WVTA 4EM3A 3G22A 2V3DA 2BASA 3PC0A 2RDWA 4XUGA 4JN6A 4W5ZA 3RRXA 2ZYFA 2ZRWA 4XISA 3UWZA 5FJUA 1CIUA 5L9FA 2ZX8A 1KCZA 2J3NA 3AS0A 1LPFA 1ME7A 1V0KA 4KKXA 1LROA 4B92A 3M6YA 2FHCA 2VO5A 2A5HA 2OEJA 5GVJA 3BLEA 1IZJA 4UNIA 5GQBA 1EPVA 3KOZA 1GSNA 1UC5A 3NWRA 3CC1A 3GW3A 3BG3A 4LXFA 3PBUA 1UP2A 3CV7A 3KLLA 2ZA2A 1AL7A 1R0MA 2ZZ4A 1V77A 2YLLA 1GEHA 1XIIA 1S5WA 4XIAA 1Z41A 4BY3A 4KCWA 1KFBA 2V38A 2EJ1A 1KXQA 3SGGA 3QMSA 4PULA 2V3AA 1A0CA 1QT1A 4J57A 3WF4A 4PB3A 4NJKA 1NFBA 3IS4A 3RR1A 3REQB 3CMJA 3IEBA 1GK8A 2GJXB 2PDFA 3W1AA 3G6MA 4HD5A 3BMWA 1XLLA 4JL2A 4YYFA 1Z42A 2ZX9A 3WY1A 3L68A 1XCXA 2XYLA 1UR9A 1ZSXA 4AZ6A 3AHVA 4B9YA 1OCBA 5XIMA 1IT7A 1NELA 4NAEB 1JPIA 3QV9A 5AC4A 3RPDA 2ZZ3A 3P81A 1TV7A 1E56A 4RXGA 3D6NA 6REQB 3DKLA 3GDTA 3GHUA 3UWYA 1RCQA 2VR2A 2XIQA 2CZVA 3CZKA 1DE6A 3WFZA 4LIIA 1EWEA 1OK6A 5A5WA 4R9XA 2RFGA 2E5BA 2YDQA 1XFBA 2X1UA 4XAZA 2BODX 3BOXA 2QDDA 2QGHA 3DFQA 1TIWA 4CN4A 5FF0A 2UV8G 1VJZA 2ZUVA 2F5ZA 4XIMA 2RUSA 3DJGX 2DVXA 4GCXA 5E1QA 3CQIA 1WUFA 1Y5VA 4L4PA 3B8SA 4DWSA 4O0ZA 1PDZA 4H8UA 4JKLA 1WP6A 3LSCA 1RQBA 2CZFA 1G9HA 4WK9A 2OWXA 1KCXA 1Q45A 3SW6A 3BANA 3LHZA 1JZ2A 5D02A 3V18A 3MBFA 1QNRA 3NM1A 3RGTA 2WSQA 2ZRXA 3EOLA 3ZMRA 3QM3A 3TOPA 4AZGA 3BJFA 3V0UA 3AIWA 3NOEA 3ITCA 4GZJA 1XUUA 4IJRA 3W82A 2HS8A 3II1A 1FIQB 4ACZB 4F66A 3N4FA 3Q45A 3C8NA 1HW6A 3KRBA 2OVLA 4LGXA 1CXHA 3H26A 3OOQA 2PWVA 1R9XA 2P8BA 4BA0A 3SGUA 4UR7A 2XZ7A 4MY9A 1EBHA 3DENA 4JCMA 3MW7A 4WKHA 4KRUA 1R9YA 2RJGA 2V69A 1YHTA 5AVHA 2I5IA 2FMNA 1ONXA 4A3UA 4O1AA 3D0CA 1LJYA 3NZQA 4FI4A 1LLZA 1XRSA 1LQAA 4QS6A 3H12A 5A8GA 2VX4A 5M1TA 4WJXA 3BSGA 1EHNA 1OABA 1OADA 3GAYA 4LVGA 1J5TA 1QASA 1YNPA 3SR7A 3RCYA 4C6JA 3GNPA 3HGJA 4U33A 4JFVA 1W3TA 4YTSA 1HL2A 4DBUA 3M16A 3UJFA 3EWBX 1F05A 3LV6A 5B80A 3DYPA 4OOUA 1VFHA 3A7AA 3CM4A 5BXRA 3SUUA 4QG8A 4M1RA 2NQJA 3EA3A 1R3VA 1S5TA 4Z0JA 1W1B1 1J0IA 1BD0A 3HGSA 3VUPA 3ZSSA 3MSRA 1SM9A 3ITYA 4XKYA 3QH2A 2C1IA 2GK1A 2X0SA 2BDQA 1QPQA 3BGGA 4HOZA 3BAKA 3P80A 5E09A 1FFRA 1BWKA 3GTIA 5D4YA 6PTDA 4QAIA 5ABTA 1EDTA 3R8GA 1QWGA 2FPVA 3CMFA 3M44A 4JGDA 4YHGA 2A6NA 3R7MA 1UOKA 4IFRA 3CUGA 1KBKA 4IMEA 3WMSA 4CU7A 4UTFA 1DP0A 4IUOA 2RHGA 2CLLA 3RM9A 1PYMA 3TZNA 2PTZA 3VOJA 4E4UA 3M5ZA 1ZUAX 1W17A 1W3JA 4GGBA 4O57A 4GGHA 3UR5A 5DY3A 1B3XA 1VP5A 2A3LA 4KERA 1SJBA 3ZWTA 1P0BA 4PBEA 3T4WA 3U8GA 1PV8A 3WMCA 3AXHA 4GQGA 3B8IA 1OGGA 1WDDA 4NYUA 3S1UA 3EB2A 4M7TA 1KTNA 4FLOA 4PGLA 5H2ZA 2W4XA 1E1CA 3V36A 1D2KA 1GRHA 3II4A 1J12A 2DVTA 4C7GA 4D2JA 2CCRA 1GZJA 3W01A 4P8VA 4RUBA 1R2TA 4C6KA 4OV9A 2NSXA 3MDWA 4U5KA 1VFLA 1LL7A 3K30A 5MF5A 1OFRA 1OCQA 4TTUA 2OYKA 3G77A 4JHOA 3AIQA 3SRFA 3WENA 1H5YA 4KPRA 1AODA 2OR2A 2UY3A 3BWWA 1B3OA 2I16A 3LHWA 3NVYB 3M07A 4XD3A 1XDIA 1V3KA 2OWWA 5D8ZA 3A12A 3TTOA 4WHBA 3UG4A 3WNKA 1YPIA 1VBHA 1B9ZA 3BOFA 5LGXA 3WKZA 3TLLA 3GC5A 5F2GA 2VURA 3AYVA 2CESA 5KVIA 4H8VA 4OGZA 1MO0A 3I4KA 1TMQA 1OC5A 4YVVA 3IRSA 4FX9A 4J35A 1VHNA 2CBVA 3BCJA 3HG2A 4LF1A 2GFTA 4LF2A 3A4AA 1ITCA 1XBVA 4M6PA 4C6LA 1VF8A 3RHGA 1ICPA 1YNYA 1ZPTA 2J7BA 1QRQA 4CQAA 1CXK