3R0KA

Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : tartrate bound, no mg
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
362
structure length
355
Chain Sequence
b'VSKIIDIKTSIIKIPLKRTFIHIDSLAVELTLDNGVKGYGVAPATTAITGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKANSIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGADFNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEINKYSLNVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDNLKGFGFNLAENLYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enzyme of enolase superfamily
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Francisella philomiragia
molecule tags Metal binding protein
total genus 117
structure length 355
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3r0kA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3r0kA01
3DGBA 3ZVIA 3RR1A 1JCTA 1EBHA 4J1OA 3CB3A 4FI4A 3IJLA 3MWCA 2GGEA 3OP2A 3FV9A 3MKCA 3DG7A 2PMQA 4E6MA 1ONEA 2PPGA 3UJSA 3TJIA 1TE6A 3IK4A 4MGGA 3GD6A 2PTWA 4IL0A 3QKEA 3PK7A 4HCDA 4E8GA 3GY1A 1JPMA 2PSNA 3CYJA 2GGJA 2HZGA 3TWAA 2HXTA 2PP0A 3H8AA 3ZVHA 2MUCA 5J04A 3T9PA 3ZLHA 4KT2A 4ENLA 3OTRA 4IL2A 1JPDX 3OZMA 3TW9A 1KD0A 2QJJA 3S5SA 3DG3A 3VA8A 4HNCA 5FJUA 1PDYA 3RO6A 2O56A 2PU0A 2XH7A 3Q4DA 5EU9A 1SJCA 2OZ8A 2RDXA 4A3RA 3H12A 4EWJA 4KWSA 5ENLA 3ZLGA 2GSHA 1BKHA 2OFJA 4G7FA 3DIPA 2QVHA 2QJNA 2QGYA 3PWIA 3UJ2A 3SQSA 3R0KA 4FP1A 3UXLA 3GO2A 3STPA 4Z17A 2P3ZA 3EEZA 3BSMA 2HXUA 1NELA 3OPSA 3U4FA 1RVKA 1IYXA 2PS2A 3SN0A 3ES7A 4M6UA 3VCNA 3V5FA 3UJRA 2OO6A 4H1ZA 3FCPA 3ZVHB 3QPEA 7ENLA 3NO1A 4GIRA 1MDLA 3RITA 3QN3A 2QDDA 3MY9A 3SJNA 2PGWA 3SBFA 3SSZA 4GFIA 3NXLA 1EC8A 4G8TA 3TQPA 3UJFA 4HPNA 3R25A 4K8GA 4GYPC 3U9IA 3ZLFA 3I6TA 4GISA 3BJSA 3UXKA 2AL2A 2HNEA 2PP1A 1EC9A 3JZUA 3MSYA 3FXGA 3DDMA 5FJPA 2OX4A 3OW1A 1TZZA 3TWBA 2P8BA 3N6HA 4DWDA 4Z1YA 3R11A 2GL5A 1MDRA 3DEQA 3H70A 3FJ4A 3IJQA 4H83A 3VC6A 3VCCA 1BQGA 3N4EA 2FKPA 4JHMA 1SJBA 4DN1A 1ELSA 1TKKA 4ROPA 2XSXA 3MZNA 1L8PA 2PODA 3JVAA 3FVDA 4GGHA 2PTYA 2PCEA 1FHUA 3I6EA 1R6WA 3T4WA 5BOEA 3TJ4A 5BOFA 4DYEA 2FYMA 2XGZA 2XH4A 5FJTA 3UCDA 3DERA 4IT1A 1SJAA 4J3ZA 2P0IA 2PGEA 2I5QA 3P0WA 3CK5A 3DESA 4H2HA 5FJRA 3NFUA 4IP5A 2OG9A 3DFHA 3NZGA 3DFYA 3CXOA 2GGHA 4A6GA 1XPYA 3V4BA 1F9CA 2AL2B 2OKTA 3SN1A 1FHVA 4JN8A 3GC2A 4HCLA 4HYRA 4GGBA 2POZA 3I4KA 1W6TA 2GDQA 1WUEA 3K1GA 4HN8A 1JDFA 3SN4A 3Q45A 4YWSA 4DXKA 3R1ZA 2QQ6A 2PTXA 4IP4A 2OLAA 4JN7A 2PTZA 3FYYA 3TOYA 2DW7A 3OZYA 2GGGA 3R10A 3N4FA 3T8QA 4DHGA 3B97A 1NU5A 2PU1A 4MMWA 3R0UA 2OVLA 3QLDA 1KCZA 2DW6A 3D47A 1P43A 3RGTA 2OZ3A 3HPFA 3H7VA 2GGIA 2OQHA 4K1WA 3V3WA 1WUFA 3CAWA 3JW7A 2OPJA 2XH0A 4HCHA 4K2SA 3KUMA 1KKRA 4E4UA 2ONEA 3S47A 2QDEA 3P3BA 3MUCA 3VFCA 4MKSA 3PWGA 3UJEA 3N6JA 4GYPA 2PP3A 3MQTA 3UCCA 3TTEA 1EC7A 3RRAA 4ZCWA 4IHCA 1E9IA 2ZADA 3THUA 4IZGA 3ENLA 3QTPA 4H19A 2P88A 4M0XA 3PFRA 2P8CA 3V5CA 2AKZA 1DTNA 1MUCA 1MRAA 4GMEA 4E5TA 1OEPA 1PDZA 4KEMA 2OQYA 3VDGA 4F4RA 2QJMA 2ZC8A 5IDZA 2XH2A 1MNSA 3DG6A 2NQLA 2OZTA 2PA6A 3T6CA 1EBGA 5FJOA 3ES8A 1R0MA 1SJDA 3CT2A 2CHRA 4DX3A 3IJIA 4E4FA 3EKGA 2AL1A 1P48A 4ZA0A 4HNLA 4KPLA 4A35A 1YEYA 2MNRA 3TCSA 1KKOA 3D46A 6ENLA 2AKMA 3BOXA 4X2PA 1ECQA 3RCYA 3VC5A 3UGVA 1XS2A 3P93A
chains in the Genus database with same CATH superfamily
3S5ZA 2NXIA 2NX9A 3USZA 3SCVA 1QNVA 4J1OA 3GXNA 3PG9A 2OXNA 3LN3A 1CIUA 2YJQA 7REQB 4DWSA 1ME7A 1KV8A 3GRSA 3RM8A 1S3TC 2CLOA 1OFBA 3WF0A 1UWIA 2NLYA 2ZRVA 3NR0A 3MBDA 2VJXA 2CZEA 3S9ZA 3HURA 3GAKA 4JHOA 3R89A 1DJXA 1FH7A 4I7UA 1Q2RA 2I5GA 1GOQA 1W91A 1OFDA 4M80A 3GIQA 1E6XM 1K9EA 2Z1VA 2YAUA 4XTDA 2GOKA 1EPXA 1E4IA 1LQ0A 1U1UA 3WNPA 2VMFA 3HQPA 1HP5A 1G5AA 4LBSA 3WZ0E 1C93A 4L9YA 3QBUA 1KD0A 1EJXC 4DBWA 2O9OA 2W63A 4WJ8A 3WY1A 2G8ZA 4HNCA 3PWAA 4O15A 2Z2AA 3W84A 1KWGA 3UCQA 4ACZA 2JIWA 4XISA 1TTJA 4HJFA 1B4EA 1J11A 1EUAA 4K6AA 3S6DA 4RE4A 5IM51 1S2AA 3TOPA 1VJSA 4FNUA 4J9JA 4RV8A 3VD3A 2NSOA 2A7NA 1U5JA 4LRSA 4H4ZA 3OO2A 4YN5A 4UR7A 3WEZA 3FEMA 3QOKA 1OFRA 2KX9A 2UWFA 4H8UA 1R3QA 3WQCA 3W22A 1BEUA 2XGBA 4FP1A 3LK6A 1C7TA 4JD4A 5LHEA 4F0HA 1TJ1A 3VNIA 3PTDA 1JF5A 3UEQA 1VPQA 3K8LA 1JRPA 3ARWA 2OLSA 3RPDA 1TV5A 4RL3A 1NELA 3UA4A 5C9ZA 5A6MA 2A7PA 5JBFA 5GJMA 1R2SA 2HK1A 4PRWA 1XDJA 3KBJA 4DZHA 4ZQOA 4AWTA 1ZDLA 1VS1A 1M7XA 2WSRA 3PSVA 4PL2A 1Q6CA 4LW7A 2EPOA 4L65A 4GBDA 4U5IA 4L5ZA 5CZTA 3MY9A 3GRTA 4OU1A 4CU8A 3S1XA 4J3VA 4GINA 4GFIA 3A47A 3RFAA 1D3GA 3KCOA 3CUIA 4AC7C 3KAOA 1K8CA 1VD6A 4F0MA 3F5JA 5FAJA 3Q67A 3N4AA 2CFFA 2XVNA 3IAQA 1DTUA 5DT5A 2GVEA 3QC0A 4X63A 1S7MA 3CPUA 2HNEA 2R9ZA 3I7QA 5FA5A 1OCNA 1EC9A 2CLIA 3TNBA 2CU0A 3FKRA 4OFCA 4NJJA 4J7RA 1KV5A 1A0CA 1EDTA 4AY8A 3KWXA 4GXWA 3VX1A 9XIMA 2HQAA 2V82A 3GFYA 1DL3A 1OB0A 2RGMA 3PPHA 2YW3A 3OGSA 3GC5A 3ATYA 1XGZA 1KM1A 3KRZA 1W2VA 1ZAJA 5F2MA 1Z69A 3Q2DA 3SQMA 4GGHA 4JGDA 1JZ8A 1M7PA 1LUCB 1H1ZA 1O68A 1JXJA 2FDSA 1UWUA 3OB8A 3CQJA 2GZXA 4RKAA 2Z0IA 1SJAA 1OVDA 1UC4A 1VYSX 4MJZA 3L4ZA 5JMUA 3K1DA 1MZHA 3NFUA 4DY1A 2FGBA 1OG0A 4MB4A 2WK2A 5BYWA 3QY7A 1XPYA 4PFHA 3ZIZA 3JS3A 1WDDA 3QFEA 8TIMA 1P0NA 1DNCA 3GNXA 4U10A 3ZJ7A 5LIYX 4IFOA 4ZVJA 1BHGA 1FH9A 4HN8A 4CUCA 4Q22A 1FFVC 3AWOA 1CENA 3UR8A 1ISWA 1PPIA 3NDZA 2DPEA 1J79A 5J5RA 3WUGA 2GWGA 1BGGA 2DW7A 3HV8A 3DXIA 3PBWA 3WF2A 1X39A 3W75A 3CLMA 3T07A 1LRTA 5CAKA 5I3DA 3A7RA 3LV6A 4JFWA 5A6SA 3AU2A 3QLDA 5GVJA 4G1KA 2ZZ4A 3LNPA 4JIIX 2WBKA 6CGTA 1TPH1 2GGIA 4LCRA 4GJJA 3WJWA 1T41A 4BK9A 3K8KA 3LOTA 2YCKX 4GZJA 2X41A 3QLLA 3DFNA 3QR0A 3O0HA 3N6JA 5ECUA 1EEPA 1QOXA 1VBRA 1W9DM 1UUMA 1DPMA 2YCLB 3ZR5A 1ONFA 2OEKA 3OLEA 1OWQA 1B30A 4AMCA 3NXFA 3ENLA 1J2BA 1NSJA 4B5SA 2P88A 4H6EA 1F05A 3NEHA 1LVLA 2HMCA 2P8CA 3F03K 3PFRA 4KPRA 1YBQA 1PZ0A 4IPIA 2YX0A 2TPSA 2Y5EA 3SB0A 3ZS4A 2FZNA 1VFTA 1KXQA 4HTYA 1MW2A 3L5LA 2ICSA 3M9YA 1CBGA 3LHTA 2OQYA 3W2UA 3WNMA 4FO4A 1YNQA 3D6NA 4BQ4A 4PUKA 3PBUA 2J25A 1HVQA 1NM9A 3V1HA 4C6EA 5C55A 1SZGA 2YL6A 3GUWA 1O7AA 1CCWB 3TYCA 2HVMA 3OBAA 3EKGA 2WMHA 1B4KA 4HA1A 4ORIA 4XV0A 4MB3A 1W3TA 3G0UA 3ITXA 4S3GA 2YXOA 4AF0A 2FDMA 3E2RA 2GOUA 3ARRA 3D46A 3NEVA 5AVNA 4F2TA 1D3HA 5HJXA 3LGEA 4WR3A 4I5XA 4QAWA 4H9VA 5CSSA 3AMGA 3BZJA 1SR9A 3K5XA 1GVQA 1A49A 3FGCB 4UTKA 3V35A 3QHNA 2VL4A 4U2ZA 2WPEA 1Q7MA 1O66A 3QW4B 2ATSA 2F7FA 3P84A 3T55A 2ALDA 2Z7GA 3ANUA 1OGBA 1A3XA 1GOXA 3T81A 4LQ1A 1PHQA 2B31A 2XM2A 4B4FA 4YTQA 4PR4A 3CZLA 2J9XA 2TAAA 3UBPC 3TTOA 4KWOA 2G3MA 5IOBA 5DMYA 1KTBA 2VX4A 1LL6A 2XHYA 4LEFA 3BURA 1QK0A 1UH2A 4J4KA 1KRMA 4ZEPA 4GZIA 5HPCA 5I6SA 4OBTA 1RQHA 1UJQA 2ISWA 3SCOA 4O17A 1B54A 1PKYA 1BQCA 3AIRA 4NZ5A 3GDLA 5CPOA 1U30A 3MHGA 1NWRA 1E5NA 1TVLA 1H09A 2WCGA 3S5SA 4K38A 1QHOA 3U0HA 4WDWA 3SUSA 3OVGA 3RO6A 1OCBA 4A8NA 2O56A 4PFMA 4TO8A 4DNHA 2X1SA 1M65A 3S2NA 3MANA 3H12A 3LZ3A 3LPPA 1WX0A 3GTFA 3WD2A 3DZ1A 1GKRA 4IJCA 3ZMRA 3WQWA 2OWCA 2PC8A 5CZ0A 4WGXA 4I5RA 2NSXA 2PZ0A 1KO0A 2YSWA 2RKXA 3NO3A 5C7VA 1OBAA 1IIGA 1QWKA 2QIWA 1GKPA 4LAOA 1UP2A 3LRLA 3GO2A 1EIBA 1GZJA 1XC4A 1J96A 3CV7A 3GR4A 1K7EA 1GQLA 1B3YA 3N2CA 1A5NC 3HQNA 2XFRA 3TAKA 5KZ6A 5HMFA 1QPRA 4ZOEA 2W55A 3OIXA 5I79A 3HA1A 1GTEA 2V8ZA 4CNTA 3KCLA 3ABOA 2VC7A 5IXEA 1QPOA 2YBVA 1TO3A 3LERA 3GFXA 3SJNA 4QQUA 1OX4B 1R8LA 2L5HA 3HJEA 2BOFX 5J8LA 4X0VA 1EC8A 2XFWA 3T0CA 2Y7GA 4IQJA 2CEQA 2ZICA 4NEWA 2OWXA 3H7RA 4LUJA 1EIXA 1ZCOA 3KVKA 1G1YA 4Z2HA 1RALA 4GISA 3NIYA 3RR4A 2E6YA 4JTDA 1I60A 1OF8A 2YVFA 4ERAA 3WQ4A 5FJPA 2D1ZA 2CDUA 4FX8A 4AD0A 1M41A 1GJWA 4NYYA 3S1UA 3TJLA 2VXNA 4GNVA 1O1ZA 3PC0A 2GL5A 1MDRA 3W7OA 2E3ZA 3HPSA 3DEQA 8XIAA 2VUYA 4JTAA 3IJQA 4PUWA 3BV4A 5C7HA 3C8FA 4CGTA 4XK2A 4XKYA 2CIPA 4JCMA 4QJ5B 1SJBA 3NS1B 1NFPA 3PUDA 1L6FA 4AHQA 3P82A 1JUBA 2PODA 3KDOA 4L9XA 3WK2A 4GIEA 4TV5A 3H2MA 3KOXA 4M52A 2PCEA 2CLEA 4P7RA 2X8RA 1IIHA 3T4WA 1VHNA 3MHFA 3NURA 3PSWA 4PCPA 5AHEA 2OTDA 1MXDA 3WNOA 3TZFA 1WDRA 1TR1A 5C5YA 2W5FA 2FYMA 5FJTA 1R3RA 4WKAA 5KVHA 4RNHA 3VGFA 1A5SA 3LG3A 2C14A 3VOIA 4LPCA 1TWDA 1Q2SA 1NIUA 1LWJA 3KDNA 5XINA 1V79A 1S39A 4BEQA 4E4PA 2V3DA 3AI0A 3KVMA 3VUSA 3U6WA 1W32A 1AQ0A 4LBRA 4FLSA 4JTSA 1IT8A 1DXFA 2NUWA 1GPFA 3C2RA 1C8YA 4GY0A 3AIVA 5GNYA 2ZRXA 4G5DA 2I57A 2INFA 3GVQA 1DXLA 2AGTA 1H5YA 1FTXA 2WV8A 5A95A 3C2VA 4DM1A 1DE6A 2OODA 3L5AA 3OEXA 1O95A 1UZ1A 4H4TA 4HNTA 2ZE0A 4URIA 4MB1A 3B9NA 3EXSA 1B1YA 3N04A 1TJ2A 4EAMA 4Q3MA 3EWZA 4NJGA 4DJEC 1WKFA 2NVKX 3AHTA 3EKZA 2FVKA 2XVKA 2PDLA 3RGTA 1WBHA 2HJPA 3EWDA 3HPFA 1UR3M 3VIKA 3LHYA 2DH3A 1IR1A 4B5XA 1P7TA 2C6QA 2AGKA 4GXPA 1K77A 2X8CA 1UWRA 1W17A 4K2SA 2REQB 3KUMA 2C8NA 1KKRA 1KM5A 4JPGA 3TX9A 3G1HA 1VIZA 2QDEA 1SPQA 4BR1A 3GG8A 2BFGA 3LXBA 4HA4A 1ZGDA 1THFD 7CGTA 2OCZA 4GCXA 5JVLA 3BTNA 4ZTYA 1HIZA 1EC7A 5I3JA 3RRAA 1CGYA 1OYCA 4ZCWA 1M1BA 3E5PA 4JX4A 3PTMA 1B31A 2GJXA 3QTPA 2DIJA 1AD1A 5EA9A 1MSSA 2V38A 1UW9A 3EKLA 4I3GA 5HBFA 2V5CA 2E0PA 3UGRA 5CCZA 2AMGA 4M56A 1E6ZA 3IVUA 4GMEA 1OEPA 2GYIA 4HMNA 3SRDA 4W7UA 3AMKA 3MP3A 3VDGA 3T0AA 2IXUA 2H6RA 5M3WA 1I8JA 3K8MA 5FS7A 1MNSA 4JNZA 3H2OA 2PF8A 1TPC1 1RPXA 2ISDA 5D30A 4UNIA 3RILA 1OX6A 5AC7A 4CU7A 1XLCA 1HZYA 2BDQA 2G37A 3G77A 5GNZA 3GHTA 1PCKA 3W7GA 1GVFA 4OWGA 4CNOA 1LG1A 3QY8A 2J7EA 3M6DA 2A3AA 3CWHA 7A3HA 4LUTA 5H2ZA 2RUSA 4N9CA 4CQCA 5BMWA 2J8TA 4ZTXA 3RNMA 2I5IA 1MQPA 5PTDA 4IMDA 4N02A 1TV3A 3NQVA 4EPEC 3LCFA 1TMHA 1LPFA 3NTYA 3MT1A 2CLMA 4IQDA 4I7VA 4EKJA 1IEXA 3CHDA 3NDYA 4NYUA 4WX2A 2R9RA 4W88A 1LYXA 3G0XA 2EKGA 2IKJA 2VCCA 3EOOA 3FV9A 2XGIA 1ZJBA 1C9WA 3IUIA 2GJRA 2FFIA 3BAJA 1Q45A 3HGJA 4R7JA 1FWFC 3PM6A 3A9BA 1YE4A 1ONEA 4I9AA 2V3EA 1X96A 1GRGA 4DJFD 3RU6A 3N11A 1GW9A 1HKMA 2ISSA 2CPUA 4YPJA 1ZUAX 3VKAA 3AJ7A 2BY3A 2VFFA 1TWSA 4J40A 4IJBA 5JIPA 4H6KA 3OODA 4RE0A 1V6UA 4HPXA 1HW6A 3FOKA 2OSXA 1TRDA 3IANA 3GNPA 4QAIA 4NZCA 4S2BA 2D24A 2IUZA 1JPDX 2QJGA 2RH9A 1XIIA 3EEGA 3O07A 2O9PA 1X7IA 5AC8A 1Z89A 4GC4A 5AC4A 3KP0A 1LLWA 4PGLA 3BJFA 2VFGA 2PU0A 3W7LA 4PE8A 3W1PA 3W7DA 3SCSA 3O0FA 3WDIA 3NQAA 1E43A 1B2YA 2Z6JA 2D2HA 1EOMA 1QAPA 3BG3A 4KWSA 3WDHA 1E4MM 2WJEA 2Y5SA 5M03A 3VM7A 1Q65A 4IX0A 1HN1A 3A5FA 3BL3A 3UESA 3WBEA 3CUXA 3QYSA 1GERA 1WB0A 4KCVA 1TJPA 4YS1A 4U31A 4M19A 3K2GA 3S5OA 5KMYA 2FTPA 4FLOA 4GI4A 3LXCA 3G1RA 3OPSA 1HJSA 4ADWA 3MZ2A 4L7ZA 3E96A 4M6UA 8A3HA 4W8LA 5LGXA 1GVRA 4E3TA 3UETA 3ZVHB 3APYA 3NVZB 1XX1A 1A3HA 4WSJA 3ORWA 3PZGA 1JEZA 1U1HA 1F6KA 1G0CA 2TMDA 3K13A 4AZ5A 1EJRC 2RDWA 3EZ4A 3RLUA 2Y8UA 3WSUA 1W5MA 1UBPC 3EX4A 4JTQA 1FCVA 4R88A 3E38A 4KEUA 2QDHA 1GRBA 3MPGA 3W7MA 3ARXA 2GVJA 2YZRA 3SRKA 1VLIA 2QPXA 3AAMA 1Z3NA 1A5LC 3DDMA 1N62C 3AM9A 3WMSA 2WM1A 4DLFA 5ABFA 3CGBA 2BX7A 2VI0A 4ZXOA 3FG2P 1H7XA 3PJTA 3QQWA 4IICA 3DC0A 3AOFA 5I06A 5BMXA 1NDZA 5F7UA 2BBFA 4U3AA 2GR2A 4H4XA 5EMKA 3HV9A 4WY0B 4CEUC 3PG8A 1C8XA 5C0QA 3BW2A 3S1WA 3RM9A 2ZWYA 4MNJA 2BLEA 2DFAA 3PAJA 3BE7A 3AS0A 3PPCA 1OT1A 4IOTA 5F4XA 1VLWA 1FHUA 1BAGA 4UTWC 3ERPA 4Q4MA 4Z2KA 2ZIDA 4H6QA 1UR0A 2GQ8A 2J13A 2QCMA 5AECA 2QHAA 3QZAA 1GYNA 3SDOA 4X3ZA 3UWZA 3UPBA 3C52A 2XGZA 3C0SA 3CIVA 3BZGA 3O16A 5IRPA 3CV2A 4IT1A 4D9PA 4XBSA 1GREA 1W1YA 3M0YA 1CGXA 3N34A 2D0GA 3OJGA 4P7NA 4FMVA 5G2HA 4EANA 1ZXIC 4N4PA 1V59A 1SYTA 4V15A 3BQ5A 1SZFA 3KLJA 1F9CA 1FWDC 2B7PA 3WFLA 4F9DA 4JL2A 1EUNA 1JCYA 1RY8A 2WCSA 4IFKB 1QMLA 4Q4OA 1W6TA 4PMDA 3RMJA 1SFJA 3PZNA 4B3LA 3G8EA 3Q45A 2BXYA 1QRQA 4PZVA 1W9XA 2F84A 3RJYA 4EMWA 2J7CA 2E5BA 2NUYA 3TYZA 1TTIA 1FEAA 3CL6A 1XD1A 3H7UA 4NAFA 2W67A 3NVTA 5HOSA 1KCZA 1XIHA 2EHHA 1EP3A 5C9RA 4HZ8A 3FS2A 2NWRA 5T8GA 3NOEA 4BCEA 2PDFA 1RP8A 2AAQA 1J4EA 4PTMA 1AW1A 4MKSA 4INFA 1XYLA 1O94A 1VFUA 1K9TA 5CZSA 4LIIA 1UC5A 3UZJA 1F3XA 1G67A 2QCLA 3DJJA 3MVIA 4GFSA 4DO5A 1ML1A 3IEBA 1XLBA 2JE8A 2XM1A 3II4A 3OBKA 3SQLA 4IZGA 2V3BA 1KXTA 4UTFA 3WQ5A 3CH0A 4JYDA 5HQMA 3L66A 4AD3A 1QOPA 2VCBA 1XG3A 2V6OA 3QXBA 1UR8A 1A5BA 3ITLA 3W7NA 1NFGA 2HDJA 4F4RA 3QQ0A 3WUBA 1VFSA 2GVYA 1GW1A 2V5BA 4NJKA 2DUZA 5HNUA 4MJ2A 3VD4A 4AVFA 2OZTA 3CL7A 1V6YA 4QIUA 2WMIA 1TR9A 5CSYA 2WW5A 2D0HA 3I3BA 2J6VA 3CM4A 1E70M 2BZNA 2WYSA 2G0WA 3ZZ1A 4IM4A 3M7SA 2WO5A 2DSKA 1GVYA 2ZX7A 1XQLA 3MB9A 1C29A 4GH1A 3CASA 4TR9A 3HMJG 3MUXA 3N2TA 2YZ5A 3RAOA 2JIEA 1VENA 2OT1A 3E0LA 3R94A 1DWIM 4TX9A 3DGBA 3BMXA 4K7YA 1GETA 4FI4A 3VIMA 1PZ3A 1YTDA 2G3JA 2HVNA 2XFFA 4N9DA 4HD5A 3KL0A 4ZENA 1OC7A 3EX3A 4CN4A 3QEZA 3EB3A 4O18A 2PWEA 1XFCA 1A0EA 2XISA 4IQLA 1K8YA 1RD5A 2A0NA 3LSCA 1WAUA 3GD6A 1GOOA 3DECA 2VX7A 3BLOA 3W7RA 3RYSA 1KRAC 4HCDA 4BQ2A 4JIPA 3DCPA 4UMCA 1EA0A 3BK0A 3VNYA 2H8XA 4C6DA 3GXMA 5HULA 2ZXQA 1UIOA 3D9XA 3CU2A 4TVYA 1I45A 4A8IA 1HG3A 1QI3A 2OYLA 2Q71A 3I3DA 3KRBA 2DZPA 1BF2A 2JKEA 3SR6B 1V77A 3CYVA 2WLYA 1C90A 1YPIA 4U28A 4D6JA 4AIEA 3PPGA 2VT0A 1YRRA 2QIIA 1Q4NX 3Q4DA 5I7GA 4MUPA 5EU9A 1E72M 1AZ2A 5CC6A 1YKWA 1LOSA 1RPKA 2H3DA 3ANYA 3MCMA 4Y9MA 5CPLA 4H7CA 1PL9A 2NQ5A 5A6LA 1BKHA 4Z0JA 1RV8A 2OWWA 2GSJA 4H4SA 1N8IA 4DZ5A 3GS6A 2DZTA 3SQSA 5F2GA 2E8ZA 3IAPA 3W2MA 4GWEA 4YLWA 1L6YA 3GNRA 3SW6A 2PS2A 3BGAA 2AAMA 1RQEA 2YBTA 2Y70A 4GO9A 2ZUTA 3LXAA 1F73A 3S83A 3PANA 4XZBA 1J0HA 1BGAA 2XG9A 4QG6A 1XUZA 1BSLA 5H8UA 1ONXA 3RN6A 1Q7QA 4ZOAA 4JKKA 3UZYA 3C2EA 3T4CA 3GNNA 3A4XA 5FESA 3C0JA 2Z1XA 3UVIA 2DVTA 3NXLA 4UC5A 2HV5A 4GNKB 1UR1A 1E6SM 4FIRA 3GBEA 3EUB3 3P5ZA 4OUIA 1E0TA 2QZRA 3EDEA 1VCGA 1EA9C 2R1LA 3OW1A 4ZR8A 4W9TA 1TWZA 4GIYA 4IQEA 4PUNA 5A94A 1ZK7A 4ML9A 2WZHA 3QGKC 2BNJA 4JTKA 3JR2A 3RJXA 2PRHA 1RSCA 5I3HA 3T2QA 4YMZA 3AMCA 5AOUA 2XSXA 1OABA 4JTTA 2ZVIA 3H2NA 1OZQA 1J2WA 4PTDA 4YCOA 1AA1B 6PTDA 2W79A 4CEXC 2XIMA 4JICA 2PRMA 4YTRA 4HMCA 2QMJA 4IIBA 4HNNA 4GBUA 2ZUWA 1X8CA 2VEFA 4UMAA 2FHFA 2YW4A 5DRCA 1KGWA 3UG3A 1O6IA 3KTSA 3QF0A 3GTIA 5AYXA 1L0PA 4AEFA 4AWUA 2P0IA 5HMSA 1YNYA 3SFKA 2VQTA 1S5VA 3FY1A 3CXOA 1J0ZA 2WWDA 1HL8A 4CNNA 1DP0A 1OFAA 2Y5JA 4S3FA 3EX2A 1CXLA 3AIUA 5C9XA 3OYZA 4KWUA 2HISA 3GHUA 4LYRA 1GRFA 4IIDA 4KESA 5HJYA 1CT5A 2GDQA 2YKKA 2XVLA 2WM0A 1Q3NA 2J27A 1E6NA 4EMJA 4DWSC 4DXKA 4UTHA 4GE8A 5A2CA 4U33A 2WOWA 3V7PA 1R86A 3W24A 5HANA 3KM8A 2WPCA 1K3UA 4H9TA 3OZYA 2GGGA 3FEQA 2R24A 1XC6A 4RZBA 1RBAA 1RA0A 1HKWA 2WLZA 2CBIA 3INPA 1GJPA 4Q8PA 3M7WA 3VABA 4BF9A 3T08A 3NQEA 5E0FA 2IKHA 2ODOA 2VEIA 1OYAA 2JK2A 3D47A 3FA3A 2V5DA 3STGA 2OMAA 5FI8A 4IF2A 5CPMA 4OTKA 2ZUUA 4NZ4A 2CZVA 3ZJKA 3M0LA 4N6FA 1YLVA 1TQJA 1RBOB 3ABRA 1MNZA 1JAKA 1XRVA 3AZSA 3CIWA 2VZUA 4HPJA 3URHA 4DAIA 1B3WA 3ARTA 2XVPA 4R7OA 4FX7A 3GIYA 2DV0A 3QOMA 1NF0A 3GTHA 1IEVA 3H24A 1EGMA 1GESA 2SFPA 2FPTA 3O15A 3FYOA 3IRDA 4ZB5A 4R53A 1CLVA 1O5KA 1T3QC 1XW8A 3F5KA 5E9AA 3GFZA 3M0ZA 2NPXA 1W5PA 1IWBA 1A53A 4RUBA 1CLXA 2CKSA 1XYBA 5TAOA 3LBMA 1MUCA 5K9DA 4RDZA 4CQBA 4L1XA 2RGLA 3FJLA 1OYBA 1N8FA 1XH1A 2YYUA 2XH2A 1EOKA 4MWAD 3A13A 3EF6A 4YYCA 3RLGA 1F07A 4N4QA 1ZU8A 1E6PA 3MUZ1 2BCPA 1DXIA 1TREA 4UTLA 4HU0A 1FDJA 1MO9A 6A3HA 4AZGA 5FF2A 1V3IA 2V2HA 4ZQCA 4A8LA 3VDHA 2UY5A 4WQ6A 4WJXA 3VNZA 5GJPA 1KKOA 1H49A 1S46A 3RHGA 3ZT6A 5C2XA 1JNDA 1E4LA 4RK8A 4LGXA 4LF2A 2E28A 3UGVA 3MUIA 2GJLA 2WMFA 5AHNA 3ZVIA 4O1CA 3RK8A 3F4DA 1QHZA 5HR7A 3H2AA 3CB3A 4NAEA 4JTHA 2P5NA 5AHIA 3VIJA 4XUYA 1FDYA 2GGEA 2X2GA 5D02A 2HVOA 3W73A 5AHMA 5AFDA 3ZSSA 4Q7IA 4DBEA 2CZDA 5C2CA 1E55A 1TE6A 3W1NA 4FZIA 2GR0A 5H91A 2PTWA 3SZ8A 1DE5A 5FS6A 5EY5A 1LP6A 2PD5A 3KLKA 4H04A 3BANA 2YR1A 3BPWA 3NYZA 3ARQA 3VDBA 1UZ4A 1BTCA 3KOZA 2BASA 2GGJA 5CLTA 3TWAA 5HAOA 4AEOA 3LA4A 2PP0A 4XD3A 5IHRA 2H9AA 4HN4A 1H60A 2ACRA 4PMYA 5F1UA 2VZOA 4F79A 5HUPA 3CIXA 3LCXA 4GUJA 3IUDA 1QI4A 3U57A 3NSXA 3DKJA 2HCVA 4FK9A 2PWFA 4QEHA 3TXVA 5G1TA 3WG6A 4QS6A 2QCCA 4YVPA 5HWMA 2BG5A 1VRXA 3MI6A 4L1GA 3BOLA 4G7EA 4HU4A 4MJ4A 1XR2A 4D6GA 5IFTA 4FB7A 1WQ5A 4PMNA 3VNLA 4FS9A 3B9DA 2GSHA 4JDBA 3H4GA 3S42A 4C6QA 1FWIC 1OFPA 1QI5A 2GFTA 3W2JA 2O55A 1FP9A 1Q7ZA 3G1DA 5K9XA 5LNRA 2JQXA 4Z17A 3BOFA 4QM1A 4Y9OA 1EYWA 2Z00A 2PDIA 3PPFA 3CT7A 1H2JA 4MY9A 2A6NA 4IGNA 3WJZA 3W7HA 5EMUA 1H0IA 3IPWA 1FOBA 2IS7A 2JFEX 2QCEA 1QWGA 1LL7A 3WF1A 4UTTA 2Y0FA 1U5VA 4DNAA 2YPIA 2J78A 2QDDA 1AH3A 4PC8A 3QRHA 2VEPA 4UIOA 1REQA 3HTWA 3ARPA 2XZ7A 1L6GA 1UWTA 3OHIA 3TQPA 4H3DA 1BYAA 2JEPA 2DVXA 1A80A 1ZZMA 3F2BA 5DMNA 3IUHA 3VYLA 1E71M 1OK6A 2ZRWA 3UXKA 2ZRZA 3V1PA 2PP1A 3C2YA 4Q8NA 3RNDA 3EX1A 2TPRA 1G4PA 3KHDA 1FFQA 3TWBA 2TRSA 3UR2A 3ISIX 1HO4A 3E9AA 3W1UA 4EMIA 3KS6A 1MEHA 1H61A 1BPLB 1HTIA 4L6DA 3CAVA 3KFTA 1T0OA 4BFAA 1KM6A 3O9NA 2C0AA 1PV8A 3LCHA 4ROPA 3W85A 3USBA 4JIEA 4AIUA 1L8PA 1EZWA 1SFLA 3C61A 3LENA 2DSWA 3GW0A 1FXPA 4M82A 3HOJA 1R6WA 5CPQA 2A85A 3W1RA 4DF0A 4GVGA 4GVIA 3SAZA 1NQ6A 2VR2A 1W1B1 3UT0A 1BVNP 2ABAA 4GOAA 4HHMA 1KR0A 3TYAA 4D72A 4HPGA 1DJWA 1JCJA 3DFYA 2E7FA 2W4XA 3DH7A 1JR1A 3IWPA 3SN1A 4JN8A 3IIVA 4B4HA 4GGBA 2VVSA 1UJPA 2X7VA 1IXOA 2CLHA 5J5DA 4DJFA 2OO0A 5I07A 1TPB1 3DGHA 3WQEA 3SRFA 1VQZA 3TYBA 1GVEA 3VIHA 2PTXA 4OUEA 2OLAA 2EQ6A 4LFYA 2Z1SA 2YL9A 4WKFA 5JCNA 4Z08A 3CS2A 4KKXA 3N4FA 2WKLA 1UA7A 5I23A 1VAHA 4JY8A 4MMWA 1W5NA 1AQFA 1JG9A 2X1UA 4KCWA 5HQEA 1LOLA 1B3ZA 5FOOA 4L61A 4MPQA 3S0CA 3FK4A 1QW9A 1W31A 3L4YA 3OVQA 3NGJA 3UNDA 1SO6A 4L1WA 2ZZCA 3RCMA 1QW7A 1PEZA 3T0DA 4B92A 2OPJA 1XSIA 4WSHA 3SGUA 2GRTA 1TV8A 1CB7B 1SGJA 2YDSA 3AS1A 2X99A 3WH5A 1VHCA 4GYPA 1NOUA 3ZJ6A 3M0HA 4LWWA 3W53A 1CEOA 1Z8AA 2EF9A 4GJIA 4O1BA 3TJXA 4GO8A 4QNWA 3W82A 3L2MA 4H9YA 4IHCA 1R3SA 3EWXA 4E2DA 1QNOA 4BI6A 4PCSA 3ITTA 1XDMA 3EWWA 4CVUA 4A3HA 1NOWA 2NXHA 5EMLA 5A8PA 2H90A 3QC3A 2XIBA 5DY3A 3N3TA 3ZT7A 3SSJA 4X9YA 2OU4A 1KFEA 4ORMA 4UR9A 4IISA 3N14A 5T91A 4HSHA 3PBVA 2GK1B 3IIOA 3HG4A 1Q6LA 2WXDM 4GZEA 3AROA 3K30A 1VEPA 1G94A 2ZXDA 3LX9A 4US5D 3QSTA 2E5CA 3MV11 1WDWA 2CHRA 3R8GA 3IJIA 1JCXA 4L6HA 1S5TA 3UD6A 1N2VA 4M7TA 1KCXA 2PBGA 2Y85A 2A3BA 3TFXA 3VILA 1XQKA 3DENA 1X97A 3TN4A 1CX9A 2IPGA 2WB5A 1AJ0A 3M0IA 4N9EA 3WQOA 3LBOA 1OY0A 2ZRUA 4WJEA 2F8QA 5FEPA 1UCWA 2PDHA 2ZA1A 4LAZA 4IGSA 1PYMA 1KBIA 3WQ8A 4XD5A 3C2OA 4GQRA 4POCA 1WKDA 2EG8A 4ICNA 4GC3A 1M6IA 2GQWA 2R82A 3RR1A 4EM3A 4IIGA 3CH9A 5BCAA 1NH6A 4YWOA 2WOIA 4AG0A 3QZ6A 1EZ2A 4F0LA 5B80A 3OC4A 4JEJA 3WLJA 3WLIA 4CQDA 3VKCA 3GSMA 1UKSA 4PUMA 2VD9A 4MNLA 3DYMA 5DT7A 1J0YA 5BXPA 3P67A 1UHVA 4HIBA 3WMLA 3IK4A 1IEWA 4Z1CA 1FKWA 3TW6A 5CSUA 1FWCC 4H9ZA 4NL1A 2INEA 3A7AA 4E2VA 3MC5A 3WD0A 1M68A 2ADAA 3VIFA 1Z41A 1PSCA 2HXTA 3EOSA 1JZ4A 2F6UA 3FGCA 3QZEA 4E3VA 2VVNA 1FIQB 3UWYA 4WRHA 4E38A 3LNMA 3NPWA 5ABEA 2P53A 2PWDA 3CMFA 4H6RA 1ZENA 5EBAA 1W1IE 4W84A 4YXGA 3N15A 5HUOA 3UYIA 4P2VA 1F8MA 3VNJA 1F74A 4J3UA 4EX4A 4O28A 3G1AA 5TR3A 4Q8QA 4HZMA 4EWJA 4A21A 2DZXA 2Y62A 3SUVA 4NU7A 1GT8A 4DWSB 3MVTA 1GGOA 2OFJA 4IUOA 2QUVA 3UZWA 4GNJA 2I9UA 4Y9NA 1Y5VA 1LQAA 3UXLA 3EEZA 4ADTA 2VOTA 2YFOA 2IMRA 1I2OA 2C3ZA 2B0MA 3W26A 1B9BA 4OVXA 3SM0A 3BAXA 1IYXA 1MRQA 4JIHA 3TQVA 3ZWSA 3GTNA 1A4MA 2NVCA 2R91A 3OG3A 3CLWA 3GHRA 2YXXA 3K4WA 1EF2A 4V2XA 1TV2A 4LV4A 3B9AA 1TFVA 3D5HA 3O63A 3V16A 2E6FA 3TVAA 3I65A 3LU2A 1ZAIA 3CZ8A 1KB3A 2CLFA 1TTQA 2VR4A 1EJWC 4RW3A 1NHPA 5HWNA 3QHOA 4F8XA 3H55A 4ADSA 2FTYA 4A29A 2PUZA 4BKNA 3TYEA 3VKKA 2LLEA 3KE0A 3UR5A 3TFCA 1XXXA 2XWDA 5EYWA 1CGTA 1W2PA 3WCZA 3DFPA 2AL2A 3QFAA 3U5UA 2PB1A 4HTBA 4DPQA 2OX4A 1TZZA 2OB3A 3OA3A 1CWYA 2PWHA 4UB9A 1PE1A 3BAYA 1KN0A 2BS9A 4WIWA 5A5WA 2E9LA 3HIJA 1AFSA 5D8ZA 3TC7A 1QJWA 1LT7A 2V81A 2VURA 1Q8JA 1W8GA 2ZX8A 3R5EA 1UP0A 4XZIA 1R3VA 2CXEA 3WH8A 4H00A 1NF7A 3EA3A 2GVGA 4TVCA 3A24A 2J4GA 2EPHA 1A3WA 3FN9A 5G5GB 5T9BG 4ZO7A 4QSFA 4R34A 2V2CA 1IT0A 1XSJA 5FSEC 5U1OA 5BOFA 3CGDA 3TLQA 1UBSA 3UG5A 2A1YA 2PLMA 2XH4A 3UCDA 1Q66A 3DERA 1CXHA 4U4MA 1AZ1A 3BMVA 1RCQA 3RRXA 4GIAA 3CQIA 3L2LA 4CD4A 3PG6A 4QDPA 5XIMA 5LNUA 4H2HA 4PMOA 2Y24A 3TKFA 3NZGA 4IP7A 4NXSA 3WQPA 2WMKA 4LB3A 3NSMA 3SY8A 2J75A 1D8CA 3I4KA 4K68A 3K1GA 1H1NA 1JDFA 3A64A 3NL6A 4UQEA 1UMYA 5AYYA 2DORA 4XZNX 3W4RA 4JN7A 3U48A 1SFSA 1K4QA 3R10A 1SMAA 1TWWA 3UR7A 4YU1A 3TCEA 1HVXA 3VDAA 4F2BA 1K4HA 2PDXA 3TN3A 3EB4A 2BY0A 2Y63A 4AC1X 1XIBA 3HQOA 3VI2A 3CAWA 2VGFA 3MDWA 1N5WC 1W3IA 2Y88A 1I4NA 3AICA 3TTSA 3B40A 5E09A 2IPWA 1MVYA 2FTWA 4KCUA 4HZ7A 4TIMA 1E6QM 3B0XA 4YTSA 2QLYA 1GRHA 2UV8G 2QUTA 1UA3A 1BXBA 3MS8A 3H2CA 5D2VA 1X1ZA 3RLVA 2CBJA 1GVIA 3EDDA 3L23A 3W7QA 2WP6A 4PMVA 3OBEA 6ALDA 1VIWA 4PULA 5DEZA 2IPFA 4N7QA 1EJTC 3FKKA 3UXDA 4ZSTA 1E4NA 2J88A 3H4KA 1T6MA 4PSPA 3C8NA 3VK5A 4ZODA 1ZBCA 1H4PA 2X05A 5HMEA 1TB3A 2QJIA 4DO6A 4XUGA 3GG1A 3S9YA 1Y65A 1K7XA 1NQKA 1OINA 1UD4A 3NWRA 1NAL1 4QNEA 4G6CA 2YB1A 1F4HA 3B0YA 2GH5A 1IXQA 1RAKA 2WHMA 1JI1A 1X8FA 2ISVA 5D09A 4LAUA 3G6LA 1CB2A 1QDSA 1LOQA 5KETA 3DAQA 1GJUA 1LL4A 3BJTA 4GQ0A 1XHGA 4GKLA 1ECQA 3GQYA 2WKJA 4AHOA 2PC4A 4JIRA 4G56A 1JDEA 3TU9A 1TWIA 1YW1A 1EBHA 3AXMA 1GYMA 1VJZA 4ZO8A 1TV4A 4AD1A 4A2RA 2OKOA 2G3FA 4PMQA 3CTLA 1E9YB 1A5KC 1XKJA 5CBIA 5HR6A 3VAVA 3DG7A 3DFQA 2F6XA 3VE7A 3LLXA 3U2OA 4HOWA 2Q01A 1UOKA 3GKFA 3IACA 5EKYA 3GLCA 1DWJM 4EXQA 4BA0A 1HP4A 3NZPA 1W3HA 1CXEA 3GZAA 1KGXA 1L6WA 3WBXA 1CXIA 1UR4A 2DT0A 4DI8A 2CZFA 2YQUA 1PUDA 3VPLA 1G7VA 2BSLA 2WC4A 3WFAA 4AF0B 4JTGA 3VIGA 4C7FA 3MI3A 2V5JA 1GVOA 4KH2A 1X6LA 3AS2A 3LCIA 3LGDA 4JXCA 1W9VA 1JPKA 4HSNA 1LDCA 5K3VA 3AMZA 3M07A 2OZ8A 4NNCA 3BLEA 4Q8UA 4MKVA 2JALA 3APGA 2W62A 2EEXA 3ZM8A 4FALA 1Q6RA 3OQEA 2NVDA 4QR6A 4XAYA 3TNOA 2P1FA 4MM1A 1I2PA 2VNCA 4A05A 4WCJA 3D3FA 2BY1A 4EP8C 2WNQA 1CXKA 1UPPA 2QF8A 1S1PA 3H21A 4EAYA 4QTGA 4BS0A 2WPBA 4EF8A 2HXUA 2EPNA 3HPZA 1J5TA 2DU2A 1Y7VA 2DVUA 3FIGA 3W74A 4XZLX 1DJHA 2RDTA 3U4FA 3VCNA 1U83A 4RCXA 3SGZA 3FCPA 2W3ZA 5E6ZA 1BYCA 2VWTA 1RQBA 3H22A 5G4EA 1GG1A 4N2YA 2BHZA 3NO1A 2BGQA 3PHAA 8CGTA 5CPSA 4UTIA 4C7DA 4JCLA 4MYAA 2VC5A 4NNAA 1FCBA 2ALRA 3R12A 4K3ZA 5DCEA 5K4XA 4NI3A 4JTJA 4HNVA 3P8IA 3TP4A 3QGVA 1V7AA 3R25A 2OX1A 1HKVA 2TODA 2FHCA 4GYJA 3E0VA 4C1KA 2WSYA 3WK0A 1R85A 4MY1A 2A4AA 4B15A 2R6OA 2F6KA 1US2A 3FXGA 1W37A 1MQRA 3G3MA 3PUOA 4Z1YA 5H8MA 1I2NA 1Z9AA 1TTPA 1QPNA 4AD2A 5D9PA 3H70A 4MWAA 3TC3A 3PZIA 3G22A 1JULA 4DN1A 3K46A 2FJKA 5TIMA 4V27A 2GUUA 3SCUA 4K7VA 4JTRA 2BWGA 1G4TA 4PN2A 1VGAA 2QCFA 4DYEA 3RX4A 5IFPA 3T2PA 1C92A 2WVVA 4AHPA 4UQBA 1NWSA 1VBUA 4LJ3A 1UD6A 3B9EA 2JGQA 3EMCA 1ZSXA 4O1DA 3TR2A 3VKJA 3WD3A 1U5HA 1KFCA 2A3EA 5M17A 3T2OA 1EGZA 4KRZA 3A12A 5F2IA 1JYVA 1FHVA 1IXPA 3QR3A 1JD9A 2NZLA 1Q6DA 2POZA 3W88A 2B4GA 1XYCA 4MZ8A 3AYVA 1J6PA 4JN6A 1BVZA 1RY0A 3R1ZA 2QQ6A 1X1NA 4MIMA 3EWYA 3J7HA 4QQ3A 2YA2A 4XKYB 1W3NA 4HMEA 5GNXA 4CVWA 2G4JA 4K8DA 1UYQA 2FH8A 1EQCA 1WYGA 4YVVA 1NU5A 2VEGA 4O0QA 3MSGA 3NL5A 1H6VA 4GRSA 1SZNA 2VFEA 2QCDA 3CAKA 3B8SA 3L67A 3K4DA 4WSKA 3FLUA 3OLDA 4Z1DA 1JZ6A 4FNPA 1KXVA 3MMUA 3SCQA 1PTDA 4IFKA 3IJ6A 3F4CA 1KFJA 3CUFA 3EGJA 3Q94A 4KFPA 2ZE3A 4I90A 2D23A 2I9EA 2QEZA 5A2AA 5CC5A 3KBMA 3LUTA 1EJVC 3PWGA 3UJEA 1JF6A 1VYPX 2R1MA 2X50A 1WPCA 1JPIA 4Q8OA 1GXFA 1BD0A 1US0A 1EJUC 3LI0A 2XDFA 3GH7A 2VQUA 1B57A 4GACA 1TX0A 3THAA 2BMBA 4HJWA 2YVGA 2OSWA 2VUNA 2NQ9A 1DWFM 4KIEA 1TPEA 4FNTA 2QDGA 3W1MA 3BSGA 4K8HA 3DYOA 4X2RA 4ZO9A 3TN6A 3UPWA 3TMQA 5K2ZA 4DM2A 4YHEA 4PEEA 3MBFA 4C6NA 3LD5A 5JRBA 3KBSA 3MO7A 4EIVA 1PDZA 1H7NA 3SRHA 4PTVA 1TVNA 3P8JA 4KFOA 2QCGA 4C60A 3VMPA 3L4XA 4Y96A 1GRTA 5G1YA 3NQ2A 1PB0A 1YDYA 4ICMA 1TUFA 4OZOA 1LLZA 1ADSA 1WE5A 3PNUA 4LYKA 1AK5A 1N5XA 2G97A 1DJNA 1P7TB 2Y7EA 2O9TA 3CAQA 2PCQA 1VBGA 4GUGA 1KA9F 2KAUC 3T09A 3KVJA 1TMLA 1A50A 3F4VA 1A4LA 4S3EA 2X09A 6ENLA 2ZZ6A 3GKAA 2JBMA 4IFRA 4ZFMA 3DH9A 1FQ0A 4YVXA 4X2PA 4XZHA 4ILSA 3LM7A 1Z42A 1HL2A 2HWGA 3P93A 4MZYA 1WZLA 4PEKA 5I5RA 1JCTA 2NX3A 1H5VA 3SUWA 2GJXB 2VD8A 1DORA 2Z6IA 2Y4SA 3LRMA 1H51A 1NTHA 1AL7A 2V2DA 3SCRA 1FWWA 4Z2GA 3LB0A 3B9JB 3S6TA 4J35A 1ESWA 2FVMA 2PPGA 1QT1A 1EDGA 3NSNA 3RUBL 1ADDA 1DJGA 3QW3A 5BXRA 2E09A 4DELA 3WKZA 1H3GA 4MLRA 1MUWA 4W4QA 4IPJA 3C3NA 3MUAA 1JOAA 1MWOA 3UP8A 1QVBA 1HQTA 2P10A 1UOZA 2YXGA 3UVAA 3UZXA 4XWUA 4DF2A 3WUEA 5LGZA 4JQ9A 1ZRQA 3SURA 1FKXA 2MUCA 2DSUA 3I10A 1XBVA 3G1SA 4O4VA 5DF0A 1YPXA 2ZA2A 3F4NA 2BC0A 3W7IA 3PZVA 3VVGA 3H6OA 4LUTB 3WEOA 2FQIA 5AZ1A 3NL3A 1SZEA 3VA8A 4NIRA 4FDCB 1E0XA 3STCA 4WOQA 1PDYA 2A79A 4UTMA 4W85A 3PZUA 2IKIA 3KZSA 1E1CA 3BLDA 1J6OA 2DZWA 4Z1BA 3CEUA 1CLKA 2OJPA 3VD7A 1V0MA 2PDJA 1IEIA 5TNVA 3QKZA 7TAAA 1F6PA 1RXOB 3IJ7A 3DK8A 3WH7A 4D6EA 2VFHA 5E6YA 5LKYA 2NLIA 3B8IA 1EWDA 1SQ7A 5ABGA 3SI9A 3EPMA 3OLIA 1LZOA 2R14A 2Y6ZA 2W3SA 3UG4A 2XPKA 1WOAA 1RJPA 5CXPA 5BRQA 1E5JA 1RVKA 4H4QA 3ES7A 1DBTA 4D6DA 4ZQRA 1EO7A 4HOXA 1CXFA 3NUKA 1XCXA 3PBYA 1JZ7A 2DIKA 5DFAA 2I17A 5KVIA 3WNLA 1MDLA 1V02E 5A8QA 3L12A 4ZO6A 1KQZA 4K39A 4IJRA 2Q3RA 2QUMA 4JKMA 4W7VA 2Y7FA 3LCLA 2HPMA 1GSNA 5C8BB 5BWFA 1V0NA 3FA4A 4EF9A 4NX5A 5DXXA 1S5NA 3ZLFA 1IEQA 3O6AA 3THCA 3I6TA 4KW2A 1NJJA 2X1TA 1V97A 2QT3A 4NEVA 4HK5A 3N2OA 4S38A 5BZAA 4JFVA 3ONCA 1IZKA 4FX6M 5AZ0A 5DMMA 2VGBA 3L65A 1YQZA 3JZUA 1WZKA 5JCLA 3MCNA 2FZMA 4O52A 4ZGYA 1I1WA 1X2HA 2V30A 4OV4A 4S2CA 4DJDC 3BG9A 3R11A 3C56A 3BV7A 1PXGA 2WHJA 4X61A 3P7YA 1R7AA 4PUJA 2Z27A 4TX6A 4US5A 3P81A 2Z2UA 1H11A 2DH2A 2ZDRA 3R07C 4JX6A 2ZX5A 1EF3A 2IXVA 5AYIA 4WKHA 3AFBA 1PX3A 3E3HA 4A2SA 1E1EA 1W5OA 5BOEA 3ONBA 3TJ4A 4H50A 1P6BA 4MDOA 3CPGA 1PKLA 3WLHA 1W9PA 3AMLA 4RXGA 1ADOA 3GVRA 4NF7A 1QTWA 1ISVA 2H8ZA 4ROQA 4KCTA 3WL1A 1VH7A 3W37A 3CPRA 5DX7A 4DAFA 4R9XA 1FP8A 3VNDA 4C6BA 3AALA 2X0HA 2XSAA 1MUMA 4LC6A 3AXIA 3S4TA 5FIPA 1GQIA 4WOZA 1W0MA 2WVTA 4FXRA 4PA8A 1L6SA 1ZX9A 3NVVB 2E9BA 2R1NA 2WZEA 3ALGA 2CZ5A 3GHSA 5DO8A 4O0KA 2PWVA 1FHDA 1BWLA 3E0WA 1JUEA 4DHGA 3W25A 1ZCCA 1SVDA 3FA5A 4E8CA 3OG2A 1WBJA 1YDVA 4TXEA 3N2BA 2PI6A 1JYXA 1ZY9A 1RVGA 1VDVA 4OOZA 1HKJA 4AEEA 4Z0SA 3WF3A 3PN8A 3L0NA 1FA2A 2ZQ0A 3EX6A 8XIMA 5D04C 3WLOA 3VX0A 2XUCA 3P3BA 1GPWA 5BW6A 4LH8A 2DSZA 2XJ7A 1RUSA 3PFMA 3W7JA 2BGNE 4I8DA 3ITOA 2Q8ZA 4D6HA 1ITQA 1R9YA 4F0RA 1NWTA 5HINA 5AC6A 2CWXA 3GVVA 5LIKX 1P5BA 3QY6A 5LA0A 2HROA 2GDVA 3CHEA 5M1TA 4RLIA 3IK2A 4QG9A 4TTGA 1QK2A 2X8HA 2X1RA 3QPYA 1WP6A 2PDYA 4CKQA 1ITUA 4P8XA 1JYWA 4NAFB 4EM4A 2ZCGA 1MYRA 1GQJA 5BXTA 1QNRA 4I5UA 4WK9A 3W86A 5CGMA 4PODA 4EPKA 1JYNA 3PR2A 2J7DA 3SFWA 1ZALA 3VOFA 1HKIA 3V5OA 4DX3A 2X40A 3EAUA 5A8MA 4Q32A 3TV8A 3HG3A 1RLCL 3CZJA 4AY1A 4UTTC 1P48A 4ZA0A 4HNLA 4A35A 4CQ8A 4WGHA 1XIDA 3VGHA 4X0NA 2BOGX 3OA5A 4H01A 3PUEA 1WCGA 2ZUSA 2I16A 3HU7A 4MFDA 5HNNA 1XM3A 2HTMA 4HQVA 3HZ3A 4GK8A 2OT0A 3VGBA 3LZ5A 1F76A 4L4LA 4UTUA 3URBA 4J2MA 3UWUA 4S3DA 1IXNA 5A6KA 5K9CA 3CBWA 3BLKA 1IGWA 3W3OA 2EQ7A 5TD4A 1AOGA 4TQTA 5FJJA 2V63A 2XU2A 2ZX9A 1AMKA 1ODZA 4UUIA 1PKNA 3A4JA 1UQYA 1DIOA 1L2QA 2FB3A 3WK1A 3P14A 2GR3A 1PIIA 2WMIB 3TR9A 5G2WA 5DANA 4EQXA 3II1A 3HPAA 4Q4QA 1KLYA 1NDAA 4FAMA 3CMGA 1IV8A 3R0DA 5AN7A 3CB8A 4Q7BA 1XBXA 3I6RA 2WJZA 3DBPA 5D03A 4J3TA 4ATLA 4C1NA 3ZSTA 2WPGA 1FO4A 3QVQA 1NDVA 1H50A 4J3WA 4UFLA 3NOYA 4BI5A 1EEXA 3CO4A 1FY6A 2IQTA 2VC9A 1ME8A 2J74A 2DZVA 1F6YA 1UPMB 3DN5A 4IWWA 1FEBA 3IJDA 5HJLA 3UG8A 3WENA 4FX9A 4H4IA 3FHAA 5FAGA 1I0DA 3WLPA 4CQ9A 3FVMA 2MANA 1XUUA 3QV9A 3TSMA 4NZFA 4DJFC 4P8VA 2W91A 3FDGA 1ZY8A 2QPUA 5ABHA 4DF1A 4LV9A 2W92A 4XO7A 2UZ9A 3U7VA 1HJQA 3TQKA 3URAA 3R8RA 1Q6GA 1JZ2A 1S2CA 1R47A 3CV6A 3G5EA 3IS4A 5E0CA 4H1ZA 2BVWA 4CN6A 2V3AA 4JFTA 5JBDA 2EJ1A 3JUGA 5D2WA 1LRQA 2OOGA 2ZZ1A 1GOIA 5I00A 4GIRA 1LCOA 4LUSB 1AH4A 5MKGA 2E1DA 3KRUA 4ML4A 1E51A 1B0IA 4JR5A 3EAOA 4D6CA 3E02A 1G7UA 2DJXA 2PDBA 1R9XA 3LXDA 4KMQA 4AX7A 2YB4A 1XLFA 3NPXA 1KBLA 1SW3A 3WX7A 4K8GA 4GYPC 3B8DA 3OYXA 3L4UA 3BJSA 3EA1A 3NZ1A 3TQ0A 3WD4A 4GQBA 3L7RA 1LLOA 5ABTA 5BWAA 3DHDA 1I2RA 4FIQA 1HT6A 4GUHA 4B2DD 5KZDA 2D73A 1FWNA 1Y5WA 3HF3A 1TQXA 3WQVA 3MKVA 1YIXA 3EANA 1J01A 2EQ8A 2I56A 2PWGA 1W54A 3D3AA 1MXSA 2FKPA 2FPYA 6REQA 4LY8A 3ITYA 2FZDA 1XCFA 3M16A 4LUYA 2YVJA 3URNA 3I6EA 3SCTA 3UY8A 3DHPA 3NVYB 3W29A 4HA3A 5LXEA 3A22A 2E40A 1WA3A 3DU0A 5FEWA 1ZFJA 2FB2A 2ZUMA 5CEWA 1TA3B 2PGEA 3GXPA 4LS2A 2VR5A 3KL5A 3N9RA 4IP5A 5I3KA 2PEVA 1NP2A 1FHLA 5LZLA 3M5ZA 2WWCA 1DYSA 2CERA 4LT9A 2J3NA 2X0SA 5LIUX 3GUGA 2O92A 3L0KA 3BGJA 1M03A 2CHOA 4DPPA 2ESCA 5JCIA 1F8IA 4XB3A 4Q4KA 4JDYA 1HFBA 5IHSA 3TYUA 4HHPA 3GX9A 4C6JA 5B7YA 4PSRA 1TYTA 4DNMA 4LA1A 3H4WA 3AZTA 3APTA 1DJZA 2P50A 3L4VA 3B04A 1MFUA 3PJXA 1RM6B 1PWLA 3UFYA 3GDKA 1IWPA 3Q58A 3GR8A 1FFRA 2DZUA 4F48A 2VRJA 4LYPA 4XIMA 4XSLA 1FH8A 1MEWA 4N6EA 1EBDA 4QLLA 2IW0A 2Z1KA 4NZ3A 1H7RA 1QW8A 2VHLA 1WO2A 4IIFA 2BXVA 3W1AA 1N55A 3KLLA 4ASTA 4AYSA 5IBXA 4E4UA 1U33A 1WAWA 3ETRB 4DXVA 1BWCA 3UA3A 1VEOA 3NDOA 4MSSA 1F7BA 4CD8A 1V08A 2XVGA 1ZLPA 3XIMA 2GPTA 1OK4A 5CJ5A 5FACA 4BJHA 3PP7A 1VB9A 3SO7A 2ACQA 3BXWA 4BV6A 4XSMA 2PD9A 3M6YA 4O10A 3QV6A 1QNPA 2A8XA 1V7YA 4J3XA 1E6RA 2EGZA 4FOJA 4I6KA 3UNTA 4ZOHB 2VKZG 1R5YA 4XZWA 2FLIA 4GYKA 4D8ZA 1DJQA 1P4CA 3N73A 1CDGA 4UOQA 4ZQMA 3M46A 3POHA 4Q8VA 3TC6A 4V28A 3KTCA 3HGRA 3C3UA 2W61A 1V51A 4RW5A 3BWWA 1XANA 4UQAA 1OCQA 3B8VA 1WXYA 3GB6A 2ZZ0A 5FS9A 3AS3A 1MO0A 4LVFA 3GRIA 3PTQA 3REQA 3GNOA 3OIHA 5JCMA 1O1HA 4DUVA 2WP5A 3VC5A 4XG1A 4ZB2A 3WIJA 4PMXA 3PVFA 2QUUA 3G1FA 2GK1A 2QXWA 1V02A 3DFTA 3D0CA 3VGDA 3WBWA 4RE3A 3AQUA 1W8SA 4B3KA 4LB4A 4AZBA 1DOSA 3IIZA 2F2HA 2WPFA 3UJSA 1UB3A 3WLNA 4MGGA 1XI3A 2GWNA 3PZOA 5C71A 4H9UA 2FVLA 1XLHA 1XFBA 1LWHA 5BROA 2WVUA 5H1WA 2XIQA 1PTAA 4EE9A 5H6HA 3Q65A 1ZP4A 1ISXA 4RXFA 1F5ZA 4Z2LA 4RPPA 3AN1A 3LMYA 3OTRA 5K4ZA 2DQWA 4UFJA 3AUOA 4OT7A 2QJJA 2JGYA 2HBVA 3WLQA 3WJXA 2D2OA 4HGXA 3G8RA 3W71A 5JH2A 2W66A 1RA5A 1BXCA 1WV2A 1SJCA 5G5IA 3NO5A 5IDIA 1QCWA 1UWQA 4NAEB 4O8AA 2HPIA 2NT0A 5CKSA 2VDHA 4AU0A 3EBVA 3HM7A 4KGLA 3W0KA 3ZLGA 4Q4SA 3ARZA 3GDTA 1RK5A 3BVJA 3G24A 4XO6A 4EOUA 4W7WA 4C1LA 2FMNA 3W7PA 2QGYA 4C6PA 1MW0A 3VD5A 4KERA 1XISA 2ZWZA 3NZRA 1E1FA 3TMLA 5ECVA 4ICCX 2OELA 2IQ0A 1ZBWA 3EA2A 2P76A 2BB0A 5JXQA 1BRLA 3SN0A 1EB3A 4JL1A 4P5UA 3PB2A 3ZYZA 1BVWA 2H9AB 2VDGA 1CW2A 2DGAA 1GOMA 2HS8A 3E49A 4MY8A 3PTKA 1RK6A 5TQLA 2J66A 3UXAA 4Y8FA 1T99A 3R43A 4H8NA 3QN3A 5EGRA 5BOOA 4GPNA 3CZGA 4QEEA 1TZ7A 4MNMA 4I9TA 2V5LA 1EHNA 2YL8A 3MA8A 1U1JA 3QFWA 3PS7A 1UH4A 4HU3A 4V33A 3UJFA 1TMQA 3W6MA 4FEZA 7TIMA 5TF0A 2ZVRA 3IGHX 4G7EB 3W6LA 5A8NA 4H4VA 2X8GA 5F1VA 4Y9PA 2FZ9A 4JS3A 4HT3A 3MSYA 2DZSA 4H9MA 1TYPA 2DEPA 3WELA 4PMRA 3W02A 3B03A 3EMQA 1LROA 1JL8A 4EWND 3CUHA 1V6WA 1OQFA 2PAJA 4H83A 4NP7A 3MTWA 2Q6ZA 3EOLA 3JU2A 3M44A 1DJYA 3A6OA 5LIXX 3QJAA 5I3GA 1UKTA 3TONA 4DVOA 2QVNA 4AQLA 4C6CA 3LI1A 1ZPTA 1SUXA 1D2KA 1KBKA 3BMWA 2OEJA 2PDGA 1GZ1A 2INZA 1R3TA 1GONA 2V5KA 1S2VA 1HGYA 4PYSA 4GY7A 4FXFA 1T5AA 1REQB 4LS0A 5U4NA 3CQ0A 3GH5A 3TE9A 1GHSA 4J3ZA 5AY7A 1BTMA 1AG1O 3ITVA 1Z48A 1XDIA 2OG9A 1TVPA 3WUFA 4YWIA 3GAYA 2D3LA 3F2DA 3LTYA 4W87A 4LVAA 3BLPX 2QV4A 4WF7A 4H7VA 3DC8A 4HCLA 3T7VA 2PDKA 3W38A 1YHTA 1HGWA 3L0GA 3W9ZA 2CW6A 1IWAA 1KQYA 2PGFA 4FSAA 5C6MA 4YWSA 1PYFA 5A3HA 4DIAA 3OHMB 4AZ6A 4GR1A 2I7GA 4C7GA 3PAOA 4F2UA 1EO5A 1V8EA 5EFDA 1KGUA 4TX8A 5FMHA 3MMTA 4QJ3B 2PU1A 3NVDA 4GA8A 4AWEA 5D9MA 5CC3A 1TYGA 3R0UA 3TXZA 5K7JA 2GLKA 3KVLA 3VCRA 4C6MA 1VZWA 5GPRA 4AZ7A 4JQ3A 3N13A 3G2GA 2ZUNA 3H7VA 3W83A 4PUDA 1JUKA 3HPXA 3BW4A 4FOKA 2HBXA 2ONEA 5HNTA 3VFCA 2QF7A 2C3DA 3UWEA 3QV8A 2PE4A 2Y2WA 5CJNA 5I3FA 2ZKMX 3NQ8A 1NOFA 4A22A 3MUY1 3UXIA 1W1A1 4GG9A 2FHBA 1E9IA 1DWAM 2A3CA 2DT3A 4M5PA 3B0VC 3QH2A 4H19A 2WHKA 1D8WA 4O8RA 4LVDA 4JIQA 3S5YA 2NXGA 3RU8X 1J10A 2J6XA 3T44A 1GWJA 2EKCA 3KOFA 1KW1A 1UIPA 3W00A 2XWEA 3I68A 4QCEA 3UU0A 4IG2B 3GYEA 4XVDA 1F3TA 4JTLA 5CJMA 3LCWA 4P7LA 1U2YA 1KM3A 3B4YA 4QRNA 3T6CA 3GWQA 3NA8A 1EQPA 2WCAA 2ACUA 2ZA3A 3UW6A 5A8GA 3SY5A 4JQ1A 3RPTA 4KPLA 3M0KA 2PDQA 1X2GA 1Q4WA 3CTTA 1XYMA 3AHYA 4PL1A 3UF9A 3CQHA 1N8WA 1ZTVA 3V18A 2CETA 4HYVA 1W1TA 1H0GA 4IMAA 2R8WA 5FF0A 4GX8A 2O7SA 2QAFA 1XS2A 4LU0A 2V68A 2GSEA 4GYFA 4OECA 1CTNA 1CGUA 4PB5A 3CO8A 4BF7A 3VKDA 4YTUA 4EQRA 3W27A 3CHVA 1XF0A 4KEZA 1JXKA 3C0LA 3AHZA 3MKCA 4IMCA 3TAOA 1H1YA 4H4WA 4NNBA 1K9FA 1XIMA 4CNUA 4E6MA 3EDJA 4MWAC 4GCAA 1HF6A 2WMJA 3GW3A 1Q6FA 2WHLA 1KBBA 4IGMA 1XLAA 2P3EA 4RZ5A 3I7RA 1HJVA 2XIJA 2QULA 2CESA 2CYGA 1OM0A 3PK7A 1KC7A 2C18A 4E8GA 1JRBA 2BHYA 2V67A 4D6IA 4FHAA 3BW3A 4AZCB 5HPOA 1N60C 1GRAA 3VNMA 5TBOA 4DUWA 3L4TA 4O19A 4C90A 4DZAA 4W86A 1PO9A 1JDAA 3U8GA 3L21A 2QS8A 1BWVA 4BWLA 1QPKA 1RCOB 5JUVA 1V03A 2EPLX 1JQVA 3TA6A 3FHQA 5FF7A 1E56A 2EQ9A 4US6A 1O4UA 4K7ZA 4QS5A 1VJIA 3PZQA 2XN0A 5LNVA 3NQ6A 2YIHA 2AQVA 5M2FX 3UWVA 1MXGA 4G7FA 3DIPA 4XVEA 3V36A 1Q1RA 4AXNA 3PWIA 1KTCA 4TUFA 1GNXA 3COTA 3ITCA 3STPA 1UH3A 1WZMA 1POKA 1D7YA 1OSEA 2POTA 5CG0A 4R3UA 4CLMA 2A3LA 3W7KA 1IHIA 4M1BA 4JYEA 2DDXA 3V5FA 2VELA 1TPVA 4FOUA 4HK7A 1YTEA 2BODX 3N29A 1QU4A 4YTTA 4QSHA 4KF1A 4G2DA 1FCQA 4LALA 3RITA 3TEVA 1JGIA 4JTFA 2Q09A 2J9ZA 5MF5A 3OQ8A 1HX0A 3NJ3A 1YQ2A 4BF5A 2C91A 3CZKA 3KW3A 3TN5A 3MU7A 2UY3A 2WZMA 5EBUA 4J56A 2CHNA 1BYBA 3E1F1 1MFVA 2YBUA 3NYDA 5CPTA 3LV5A 3ZXWA 4B5WA 1M53A 4IPPA 5EFFA 4PTXA 3TSDA 3G1YA 3DJGX 4O14A 5KTLA 1UD8A 4XIAA 3DGRA 1Y0EA 1DQUA 3DOPA 4C6LA 1V0LA 3NCOA 3HW2A 5HDRA 3PULA 4EPDC 4OQVA 1W1PA 1UR9A 3EDFA 3WQGA 1ZAHA 5HQLA 1RP9A 5BU9A 1PAMA 2RHGA 1DWHM 4QITA 5I03A 4M6VA 1AODA 2X16A 2ISFA 4UQDA 1CYGA 2CCRA 1M04A 2JK6A 1GOKA 3MHUA 4AFYA 4AYGA 5A6BD 5DCBA 2Q8LA 1M01A 4NJHA 5CPNA 5F2LA 3FNDA 3HN3A 4ATDA 3TUUA 3EWCA 4I6VA 3L5MA 4MZ1A 3IV8A 4K36A 5REQA 3EMZA 1T8QA 3VFLA 3GD3A 1Z6KA 1P6WA 3H4XA 3QGAC 3WLTA 2VX5A 1XYFA 1FWEC 4CNSA 2XIOA 4DJDD 1T96A 3V75A 2H3BA 3DK9A 2AL2B 4MUZA 4CCEA 1XKYA 4DZIA 4HOZA 5KSWA 2AOSA 2E25A 4APNA 2F5ZA 4HVXA 4PB4A 1B3VA 2VEKA 2E5AA 4CCDA 2ACSA 3WNKA 2FH6A 2D0FA 3VD9A 3M47A 1XSKA 4LNCA 4UXDA 3C4UA 5JU6A 4QE5A 3H54A 1A47A 3PNZA 2JKPA 3AIEA 3CMJA 1KCLA 1W56A 4TVDA 1HJWA 1V6XA 2OLHA 1VPYA 4ERIA 4PBGA 3P74A 1MZRA 1KFLA 3WBAA 3PZMA 1IR2A 1YNPA 4JAWA 1MQQA 3BAKA 4REQA 3E2VA 4B9YA 4GVFA 1IZCA 4NI8A 1W3LA 4TV6A 3B8UA 2C19A 4UBPC 2OQHA 3VO0A 1ISYA 1F8WA 1JI2A 4LVBA 3HMCA 3S1GA 1HO1A 4GABA 2OGJA 4NZJA 1WZAA 3LHWA 4X9SA 3QFBA 1TG7A 4QISA 4A3UA 3TYDA 3A5VA 5CGTA 3UYCA 4AB4A 1EGVA 4O12A 3M5VA 3TTEA 1W5QA 1XIGA 2J77A 3TSBA 4AH7A 3BCJA 3RO8A 1HL9A 3THUA 3YPIA 3EWBX 4ZQNA 3GNDA 4CN1A 1BFNA 3M0VA 1UMLA 7REQA 1K6AA 3LPOA 4FF5A 2B7QA 4B5TA 1R2TA 3R7MA 4D2JA 5C70A 1ZJAA 2DSVA 4JTUA 4YHGA 1AW2A 3ALFA 3L2IA 1GQKA 2QJMA 4PRTA 3F2CA 3TDFA 4LAMA 2VFIA 4B5VA 1WYIA 2VOMA 3UWQA 1IT7A 4MADA 3LYEA 4FNQA 2X30A 1BF6A 1ZB5A 3FSTA 4LTSA 3BLLA 5JCKA 5CZKA 1NHRA 2F61A 4E8DA 4GJ1A 3GK0A 2AL1A 1AJ2A 3KTXA 4GI8A 1VR6A 5CBBA 4JTIA 1I9CB 3RLHA 4LS1A 3U2ZA 4J28A 4MOZA 4J3SA 1VFLA 1VFMA 3GU9A 3I4EA 3BH4A 3LLFA 3HO8A 1RHCA 4LYQA 2P0OA 4TVWA 3ABQA 4M6PA 3P80A 2Z24A 4B2DA 4O57A 1CGVA 4YNGA 3NQCA 3A3WA 3BUVA 2WSKA 1DXEA 3OP2A 1I75A 1S3HA 1OD0A 3O05A 1A5AA 4H9XA 3CJPA 3ABSA 3GXDA 4QBXA 1M9HA 3BARA 2BGSA 5DBUA 3STFA 3RM4A 1XLLA 3GE7A 1TIMA 1X6NA 1H7OA 3GR7A 2NWSA 3MMDA 4ZFCA 2Q3OA 3WJSA 2BOEX 3QMRA 3WK3A 5FEXA 1Q1WA 1C8QA 1TJ0A 4CCZA 2XINA 1P1MA 1Y5XA 1KLZA 1JCMP 1WXZA 3T9PA 3AMDA 1CI1A 3T1GA 1W9BM 1G4EA 4JY9A 4KQNA 2Q8XA 1XLKA 3H23A 1SR0A 4NT0A 2VX6A 3MYPA 1GZGA 2XH7A 3VGGA 1GQNA 5DLCA 4NILA 5ENLA 5CGQA 1XWYA 1XLGA 4IXXA 3W2KA 1BWKA 1GEUA 1DHPA 3DGZA 5C9UA 3MCOA 3KOYA 3QQ1A 4MF4A 1DIKA 1O5XA 1VCFA 2HE5A 3EB2A 1N61C 3E0FA 2QJNA 2Z7KA 2Z4GA 4PUEA 3WO8A 2YLLA 3VU2A 4NY2A 3R0KA 3LTPA 4QE4A 3AIWA 3LPFA 1P0BA 4FR6A 5CZJA 1LWIA 4RNFA 1PIGA 2X7WA 1M7JA 1Y8BA 4AVOA 1TX2A 2WOVA 6XIAA 2OO6A 4MVAA 1K7FA 4YYFA 1QNSA 1UD2A 1LF1A 4Q8WA 4GXMA 1LUCA 4LEQA 4LXFA 4AISA 3IIPA 4MDPA 5AYZA 1KFWA 2WJDA 3GIPA 2NV1A 1FWAC 1ZP3A 1K4GA 1PZ2A 1RH9A 1KR1A 2DY3A 4EVZA 3HB9A 1ZJIA 4M3PA 2XN1A 4HPNA 4BQ3A 1PX4A 4LAKA 5U25A 2D3NA 3RIKA 1V3KA 5G2IA 1P0DA 4HB7A 1VBJA 1T7LA 2YDAA 2ZRYA 1R7OA 2OEMA 2OR2A 3MJYA 4UZUA 1DVJA 4PTWA 3VZXA 1BKSA 5I09A 4XAGA 4RZ4A 2VFDA 3H53A 4M1RA 1GUVA 4JNYA 5BRPA 5GRTA 2CLKA 1OFOA 2Y8VA 3E2QA 1QBBA 3F1QA 1LM1A 2YA0A 2OSYA 3E2SA 1EP2A 5HXMA 3LCGA 3FYPA 1J12A 1R3WA 4C6KA 4Q4PA 1UKOA 3GXTA 3MZNA 4MJMA 4U5KA 4P8UA 3LHVA 1BG9A 4QLKA 1J9YA 3P60A 1FX6A 2TSYA 2J62A 4DJED 1R2RA 5KZEA 1QATA 3QTGA 1SM9A 4HA0A 2HK0A 4R7WA 4KETA 1E9ZB 4KWWA 3THDA 3IC9A 2D22A 3EYPA 4C65A 4MB5A 4PUUA 5FD0A 1CECA 1OADA 1YXCA 4IIEA 4O50A 4PTNA 5LYRA 5A6AA 4U3CA 3G6MA 4AW7A 1XHCA 3KHJA 1SFTA 3TW7A 4P8WA 1PCWA 2YCLA 4FA3A 3LEPA 3NGFA 4O54A 2YCIX 2QAPA 4S23A 3HBLA 2WQPA 2FGLA 3LLDA 4HYWA 1NDYA 3FX4A 4HHHA 3SN4A 2OGYA 3WDRA 4MWAB 3MWAA 3WBYA 4IP4A 2EG6A 2NQJA 4ZE4A 3FYYA 4Q6JA 2VZSA 4BQ5A 1NPXA 1UASA 3T05A 4G1NA 4AD4A 3WQ6A 3A21A 2B7NA 4RNIA 3SGGA 3T8QA 2PDCA 4ZBCA 5CC7A 1RJQA 3R79A 2HNHA 4R9OA 1A5CA 3R13A 2WVVB 2D2JA 3V3WA 3GBDA 4XAFA 1J0KA 1WUFA 1XP3A 1TRIA 3WLSA 1QBAA 4GKTA 1OC6A 3L5OA 1Q13A 4QJ1A 2PDPA 4HBKA 3HGSA 4PBEA 4HNUA 3R6IA 3WLMA 3L4WA 4LRTA 1F3PA 5T26A 3QYQA 3I3EA 1WDQA 1E0UA 2W6RA 3LPGA 3AJXA 4HPHA 4U2YA 4R27A 3W1TA 3P5YA 3NG3A 1V6VA 1X98A 4HNOA 4DXXA 1DHKA 1ZQ5A 4J27A 3AWNA 2HSAA 4RX0A 2PDWA 4IH3A 2VENA 2ZC1A 3N18A 4CU6A 4ZQPA 4IXHA 1GTHA 3SJ3A 3MMWA 2XZ9A 3IGXA 3BG5A 3DG6A 1RBLA 2NQLA 2CLPA 2QCDB 3ZWTA 2Z1BA 4PCFA 2E3TA 5CH9A 1XRSA 2GQAA 1EBGA 5F4WA 4A3QA 5AB3A 4NRSA 4KWVA 4UNKA 2F38A 5HWJA 1YXDA 4L80A 5SWUA 2MNRA 4ZXLA 2ZXBA 4QG8A 2W0UA 2WOQA 4UNLA 1V4YA 4BEUA 3DHUA 2Z28A 3FAWA 4FLRA 3WDJA 3GDMA 3O0KA 5C2GA 1JRCA 2UY4A 1EWEA 2TYSA 3C2FA 3W1QA 5BRBA 5E9XA 2VYOA 5L6UA 4CD5A 3FJ6A 3LMZA 1FBAA 5A69A 4N42A 5E1QA 3TLLA 1LG2A 2ZYFA 2VDIA 1XINA 5FCZA 4IIHA 4IMEA 3V0UA 4JTEA 2ANUA 3NL2A 2WC3A 2PMQA 3V0TA 1G69A 4ACZB 1POJA 3TJIA 5I3IA 2X2YA 2C0HA 2BV9A 1XRFA 4B9ZA 1JDDA 3CUZA 1DEDA 3M0MA 1QHPA 3WJYA 3QMTA 1FWRA 4FNRA 2BHUA 2E4TA 4TU1A 4UTJA 1K03A 3IJ9A 4IGHA 4W5UA 2ZZ2A 3GY1A 1CGWA 1AMYA 1A0DA 1GEHA 4QROA 1LT8A 1ALDA 2E6DA 5I0DA 4LCQA 3H8AA 4OHQA 1FDZA 2O9RA 3GDRA 1PS9A 3BAIA 4ENLA 2XYLA 1BZLA 4E0CA 4IL2A 4IPLA 2DT1A 3C0QA 3P61A 2BP1A 1N82A 3HJZA 3OZOA 1VFOA 3DK4A 3LHUA 1XL9A 1UP3A 1H7PA 2PGRA 5E70A 1OX4A 1X38A 2J47A 2E5DA 3KX6A 2QMKA 3ABXA 4V1XA 3ZJ8A 2PDUA 2ZZ5A 3GU1A 4V1YA 1KTNA 4HMDA 1QXLA 3O3RA 1PHWA 5CQ1A 1W1ZA 4MAZA 2J79A 3BDKA 4RJEA 2Y7DA 1WKYA 1XLIA 3RDKA 1MW1A 1R46A 4DRSA 3ATZA 2JF6A 1Z32X 4M6QA 5G4WA 2QVHA 3I7SA 4L4OA 3UJ2A 4M81A 1JNEA 4XTIA 5JBEA 2JEQA 2YGYA 2C1IA 4JQ2A 2FIQA 3O7UA 3MSRA 3NNTA 4M51A 4B5UA 1TCDA 3EXTA 2QYGA 4D71A 4MTVA 1K9DA 3TROA 3DBNA 4PMJA 4UMBA 1RCXB 3AIQA 3UQNA 1RD6A 4JTCA 3GM8A 7ENLA 1I0BA 3S8HA 1NEYA 3U5YA 3ZO9A 3GG7A 3W70A 1TPWA 1IF2A 2GUBA 4H8HA 3CGEA 1UZDA 3CXBA 1VF8A 4N0RA 4OBSA 1H2IA 4RDVA 5IBXC 2O4QA 1E1CB 2WZIA 4B90A 4UCGA 3MKKA 3VOJA 3CUJA 1FRBA 3FSUA 1EKOA 2Z2BA 3ICJA 1Q6EA 3S46A 6TAAA 4NXKA 1BSIA 3NQ7A 2XSBA 3A9IA 3ITGA 3SEPA 3GVGA 3LY0A 3CWOX 2CLLA 1KFKA 4W8BA 5G4HC 2DZAA 3GVWA 3MSDA 3XINA 4GHRA 2Y8KA 4H7ZA 4DLMA 4LUSA 3VCCA 4Y7EA 3IGUA 3S2LA 1EXPA 3H2FA 4HKPA 3N2MA 2G3NA 1PJ9A 3WD1A 2E67A 3THQA 2A6LA 3WYZA 3BCDA 1TPUA 3RXZA 1OFEA 1AQMA 1FCUA 3S2JA 4QE1A 3UY7A 4NQ1A 1NDWA 4AXKA 3VZZA 1A5OC 3CC1A 3UWWA 2A3HA 3NRZB 1GK8A 2VM8A 1BXNA 4M29A 5LA2A 2V9DA 2REQA 3P0WA 3CK5A 2NVAA 3NVWB 2V0TA 3W1XA 5FJRA 2WKGA 3RPMA 4A6GA 4FR1A 3LADA 4IMFA 1C7SA 4F66A 2FJUB 3GC2A 1KRBC 1ZKQA 3O6YX 1JFHA 1BG4A 3F7JA 1F61A 1WUEA 2NUXA 3O1NA 1JIBA 4ADUA 2GJPA 2G5WA 3T42A 3GYCA 5JH1A 4KRUA 2PBOA 2ZDSA 2WNNA 4K8EA 2CITA 1IZJA 4EXBA 1BYDA 2NQZA 1EP1A 1TCMA 4EACA 1T8XA 3TOYA 1QNQA 4RZ6A 4NHVA 4JFUA 1NWUA 1TA3A 3L68A 3S1VA 5A1AA 1XYZA 1QASA 3WLKX 1GORA 2NT1A 4XBKA 7ODCA 1IGSA 1YBQB 5T9CE 5LA1A 2QPSA 2O7QA 1P43A 4LNYA 5D38A 2V3FA 3G1VA 4NASA 1R38A 3JW7A 2AAAA 3KCJA 4W8AA 3MI2A 4ZB0A 4Q6XA 5FSDC 3A4WA 1Z44A 3LDVA 2RABA 2PP3A 4TMCA 3BLIA 3AISA 1XJBA 2OZ0A 3MQTA 1LTDA 1AH0A 1UZHA 2DP3A 3LM3A 3T8LA 1XPGA 5FF4A 2RJGA 1Q6OA 2PLKA 9CGTA 1M7OA 1TJRA 5LNSA 2C3CA 4FXSA 1E0WA 1OCJA 4AY7A 5GJNA 2EQDA 1KM0A 2ZUVA 3V5CA 2OYKA 1DTNA 2A5HA 1XGDA 4PCNA 5D37A 3NQFA 1E0VA 1RJRA 4KEMA 4WDTA 5AHLA 1FWBC 4AIBA 1TUXA 4FNSA 3S2CA 4NRRA 4I8YA 2JF7A 2HQMA 1S38A 2O0TA 2OOFA 5AVHA 2DT2A 3B0UX 4GZ7A 3WEMA 3L8KA 3W07A 3M5YA 4AZHA 2ZZ7A 1SSGA 3TA9A 3DFSA 3RMEA 1FFUC 1AUSL 4J2PA 4LANA 1YEYA 3DX5A 4LOCA 2PFHA 3P2VA 1YDNA 2A21A 4D8AA 4Z1AA 4MG4A 3QM3A 3AU6A 3RCYA 1QFEA 1VKFA 5LNWA 5D32A 5L9FA 1EH9A 4HP5A 4DUOA 3N3MA 1EJ7L 2J24A 1GHRA 4C6OA 4E2OA 1YDOA 1U22A 5LSMA 3BQ6A 3KBNA 1F2JA 2BTMA 3AYSA 4GUIA 3AHXA 5AKQA 5A6BA 3LB8A 4CCCA 5EPDA 1XGEA 4HZ6A 1ZMCA 5I78A 1O60A 1SSDA 1SB3B 3C6CA 4IL0A 3TTQA 3LRKA 1N7KA 1GOWA 1DQXA 1JPMA 2PWUA 2ZXAA 5FF3A 2PSNA 1I2QA 1VPXA 3N17A 3CUGA 1AJZA 2E9MA 3HGOA 3ZVHA 2CNCA 3VUPA 1JD7A 2J8GA 4PCTA 4ZOBA 3ZLHA 4KT2A 5RUBA 4DB7A 1L8NA 3B06A 4XKMA 3IVSA 4DJDA 1D3CA 3OZMA 1NVMA 1D7FA 3SIMA 3M1ZA 3GC4A 5A6TC 3KBWA 2DZBA 4NJIA 2ZBTA 2DIEA 2Y1HA 2VRQA 2RDXA 2NQHA 1UROA 3JZEA 3ZFHA 1K1DA 2UBPC 3IV3A 2V3GA 1XICA 1XBZA 1P1XA 2FGZA 1Q63A 2GQ3A 4UQCA 3VDCA 1XIFA 2QKFA 3PB0A 3H26A 1MW3A 3AZRA 4AMAA 3G3DA 3MJMA 2GUYA 3S9IA 1XG4A 2J9YA 3BSMA 2Y61A 3FJNA 2OQLA 1DWGM 4Z42C 9XIAA 4WY0A 5FJIA 1YPFA 4MHBA 1TELA 3NAVA 4H4PA 2D2GA 5HATA 1QPQA 5FKYA 3VE9A 4AX6A 1I1XA 5D2YA 4IUGA 2R94A 3ME3A 1NP0A 5JQ9A 3SCWA 1IE7C 2QCHA 2C16A 4I7WA 1NY1A 3IGSA 4Z2IA 4NVTA 1KWKA 2BC1A 2C1HA 2NV2A 1XLMA 4C1NB 2ZX6A 3RG6A 4L56A 4YJ5A 4A8RA 3OVPA 5CLWA 4DEFA 3V0SA 4MPKA 2BVYA 1W9UA 2BVDA 3S3GA 1TV7A 6TIMA 1XLDA 4X60A 1A5UA 4W93A 4LF1A 2VO5A 2YL5A 3FFSA 3OGRA 4WHBA 4XZMX 3URQA 4KEVA 4FF7A 4O11A 4H41A 2NV9A 1C8VA 1ZNNA 4ECLA 4R85A 3NM1A 4DWDA 3SCNA 1XYAA 2Z25A 3FJ4A 4Q7NA 1XIJA 4HU8A 1XRTA 2Q02A 1XD0A 3HQ1A 1JZ3A 1BQGA 1IQ8A 1H7WA 3TZNA 4XZ9A 4DWSD