3R0MA

Crystal structure of anti-hiv llama vhh antibody a12
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
AVQLQESGGGLVQAGGSLRLSCTASGRISSSYDMGWFRQAPGKEREFVAAISWSGGTTDYADSVKGRFAISKDNAKNAVYLQMNSLKPEDTAVYYCAAKWRPLRYSDYPSNSDYYDWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Llama VHH A12
publication title Single-Headed Immunoglobulins Efficiently Penetrate CD4-Binding Site and Effectively Neutralize HIV-1
rcsb
source organism Lama glama
molecule tags Immune system
total genus 25
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3r0mA00
5FYKH 1M05B 3TO4A 3HE7C 1TJGH 3TBTB 1IAKA 3AAZA 4OB5H 4U31A 3AREA 1RUKL 3MOAH 4WWKD 2CIIA 2YD7A 1JI2A 1ERNA 2YD9A 5DDHB 1VFMA 3D9AL 2JCCE 3P4NB 5FYJD 2ARJQ 1HHGA 2HRPH 4JN2B 1DBJH 2RB8A 3PWPB 5F6HJ 1RZFH 5I8CA 4P4KB 5DJZA 2BDNL 4LVNC 4Z0BL 3GMRB 2VDLH 5SWZA 3DMMD 2ERJC 1T4KB 4XNUH 2JK5B 3UTQB 5FGCE 2YC1A 4WCYH 2G75A 3B4NA 3TYGL 2BMKB 4QRRA 4OUUA 4RZCB 3H3BC 5JW4N 1AGBB 3KLSA 2BC4B 3RAJH 4LASL 1BF2A 2W9DL 4OD1H 1ORQA 4EVNB 2XRAH 2DD8L 1KEMH 5I73B 2PCPA 2ADGA 1H9VA 1FO0B 1UWGH 5CBEB 5M94B 1M71A 3KPSD 4HPYH 1YMMD 4HCRH 3JZ7A 2W91A 4NZRL 5IJKC 2WAHA 1U2CA 3U7WH 2UUDK 3DYPA 2JJUA 4B41A 1FZJB 1PKQA 5JW4R 1SJHB 3HAEA 1YNKH 4R26L 5JW3L 1BZ9A 5LXGL 3NMEA 3T09A 1OAQL 5E56A 1YYLL 1FVEA 4R8WH 1I85A 1MJ8L 3FO2B 5T3ZH 4ONOA 1HILA 3LQAL 4PP1D 4UNUA 3QUYD 4LARH 2DKUA 1T3FA 4BZ1L 3I6GA 4KKLC 5E2VH 4XPAH 5C2BL 3D48R 5ICXB 5JQHC 1CBVL 2XG5A 4OZHB 2HN7A 5KSBA 3SDDD 2QLVB 4J3TA 3SJVA 3F12A 3OKOB 4ZUSB 4XCFL 2FX9L 3QQ9C 2FJHA 5CD3B 5EBGA 1TVDA 1NDMA 1JNNL 3LVEA 2VDKH 4J4PD 4XBEH 3ZKXB 3QRGL 1I1AA 3TCXA 2YD4A 5HHXH 4XXCA 4XMPL 3WKML 5IB4A 3HI6L 3CFDA 4F7TB 4OFDA 1MY5A 3U7YH 5BOPA 5FOBB 1QEWB 2BNUB 3CCHB 3MRMB 3MCKB 1FVDA 1QLEH 4HMCA 3UEZA 1XGPB 3BHBB 4F7MA 1FYHB 3Q2CA 1RQ5A 5F8QC 1L4IA 4KKCD 3PGCA 1QFPA 2BNRB 5TDOB 1TCRB 3X11A 5DC9B 4ALAH 3T2OA 5JORA 4JZJB 5J9PB 1I3RA 2I9LA 1QVOA 4JRYB 3QHZL 3ALPA 5JW5A 4Z7VA 3QDMD 2AI0L 4JFDA 1TQCC 4LCWB 5IGXL 1YY8B 2BRRL 2VITA 1X4XA 4NQEE 3QUZC 1KB5B 2O5XL 3BVNA 4YH6A 1VCAA 4WW2C 5JMRA 4NT6A 3HPJA 2AGJL 5K59F 3ZKSD 5GJSL 5JXAL 3MLSL 4MS8D 1FPTL 5LWYH 4JFEB 2OSLB 1EA9C 5KW9H 4QCIA 3NABL 4JPIA 4NNXA 2DYPB 3W5NA 2X4NA 3HC0B 1U8LA 4WNQA 5HHNA 1NKRA 3MLUH 5A3ID 2ZUYA 5BJTB 5CINH 3UO1L 1KLUB 4KQ3L 5HYQB 3UYRL 4GAGH 4ONFL 4E5XA 2OTPA 5I76B 2E9JA 4GKNB 3ULVE 5IBTL 3OKMA 2P1YA 4AENB 1G84A 3SGEH 1HEZA 1A6ZB 2C3VA 3PABA 3UDWC 3ROLB 2FR4A 4YFEA 5CJBA 4JGJA 1G7JB 4WWKA 4A6YA 1RJCA 1A6WL 5FGBA 4P2OB 2P5WD 4WFGD 3MRIB 5B21A 4JCLA 3RDTD 3GMPB 4FQQB 5BQ7B 4K8RC 1RUAH 1EHAA 5FAAA 5B3JF 4O58H 5TE7H 2A6DA 5D2NA 1HDMA 1N5YL 4J12A 4NIKB 3KJ4C 1FFOB 5I2IA 3DMMA 2HT4D 2R69L 4NBXB 3JWOH 3IDGB 1KLFA 1DSFL 3QXDB 1CLYL 5IVNA 4NQCB 3U1SH 1SQ2N 3GRWL 2H2PC 1I3GL 3BXNB 2AABH 4ZDHB 3VXRB 4JO2H 4AT6B 1XIWC 5CHNA 1G9EA 3RX5A 1IC4L 4HKZA 4O2EB 5ILTH 4LNRA 2GHWB 1JGLL 1C12B 3IJYA 4GRWB 4UT6H 3PDGA 3KPSA 5EUOF 5EDXA 3F7RA 1FDLL 2HJKA 2OMBA 4R7NB 5DR5L 4PY8I 1D9KD 4MB4A 4JHAH 5BCAA 4Z0XA 3EO0A 3P9LA 5KBNC 3L3KB 1ZHLA 4OKVA 2P8LB 1R5VB 4P0DA 3BIKA 2YXFA 5BW7A 5ENWA 4HH8A 3B2VH 4G8FA 4NQSA 4ETYA 4GXUM 4RSVA 5DJAA 4LHQB 5KS9E 3EDFA 4S1RL 5I66A 2IQAB 4G6JH 3ULVH 3QUYA 3WV0A 1GIGL 1MQKH 3Q0HA 4MJ5A 4IMLB 1NGXA 2V2WA 4YX2H 4GRLD 1L0YA 4X6EB 3SDDA 4PB9L 4G9FD 4AM0B 5CBAB 5F9OL 3S4SB 4PJEF 4M02A 4IBLT 1CL7L 3CXDH 4P4KC 4YR6B 5ANMB 3CH1B 4QHLB 1ZVYA 1NGQL 3QIWD 4P23C 4HZAA 1GGCH 3VE0B 4J4PA 5D4QA 4EUPG 5D70H 4KRMB 4Z18A 3E6HB 5DUPL 3PWVB 2UYLA 4YZFF 12E8L 3GEWB 3EUUA 3HZMA 1IGYB 4XAKD 1KNOA 5BS0E 2CR3A 4KY1L 1ZGLB 4Q7DA 1GC1H 2CIKB 4WI9A 3WBDA 1VFBA 3TFKD 3NN8A 4KK5D 4I3RL 4BH7A 4Z9KB 2Y6SD 3NAAL 5EIIA 5I1DB 5C0AB 1BAFL 3DVFA 4KUZL 4GFTB 3D2UB 4S2SA 2Y07L 3IJSA 5JTWA 4PP2B 5FYKU 1QLRB 2YD1A 4Y1AB 3QDMA 3A0OA 1EDQA 4IM8A 1CVSC 3D18A 1RZGA 2DS4A 5GS0D 3KWWA 4WI5A 1X5AA 4QNPE 4URTB 1KXQE 3Q1SH 5HGBA 4JDVA 3HB3D 1FNEB 2O26U 1P84K 4K7PL 3C5ZC 4MWFA 3S3SA 3RVWC 4Z7WB 1Z3GL 2D7QA 2JF1A 2ZWLT 3WIHH 4FFVD 5IW6A 1CE6A 3C6LB 3BWAA 3GI8H 4N0UA 4C55A 4G8GB 4JQIL 5D9SB 3HC4L 4MCZB 1BGXL 3TNMB 2BSSB 3TZVA 1NCDL 4QRUA 5C9JA 1LEGA 1C16B 1QRKA 1VKXA 4U1JA 1EH9A 2WP3T 4H1LH 1NEZG 1H0DB 1NH6A 4ODSL 3MUGB 3F7VB 3CLEL 3I75B 4HKJA 2FATL 1G9NC 1QSEE 4S1DC 4S11A 1ZT7A 3ZYIA 2P44B 3LDBC 4O4YL 3H9YA 5T1DH 3DUSA 5L2JA 5D5MB 4QTHA 2P5WA 3KVQA 2F53E 3RDTA 3CDFA 4UQ2A 3QEHB 1H8NA 4EUPA 2VDMH 4JZJC 1P69B 1MRCL 1KPUB 1F2QA 1KACB 4DZ8B 1CICD 4GAFB 4M62L 3HR6A 1SYSB 3CVIH 2G5RA 5TE6L 1VA9A 2FDBP 1IBGL 2GAZA 2VZVA 3O6KL 4L8SC 1QPPA 1W72L 2W92A 4I2XA 4NUJA 4B7LA 4M4RA 2BVOA 4PJHE 3LEYH 1UQSA 5I1CH 5GZND 3IDIA 3P0YH 3MJ6A 4NKMA 5B39G 1SEQL 1IFHL 4XGZA 1D9KA 1BQLL 3VFOA 5FK9A 4JY5H 4U05A 3STBA 3TWCH 5FO8A 1NCUA 4Q74A 4KDVA 2CMRH 3KPRB 3H42L 1G1YA 3IS1X 2YHGA 4PJFF 2YOCA 4F7EA 2IGFH 5DA0B 1FJ1A 1CLOL 4MVBD 3RA7L 3SGDH 1F6LL 4IIQB 3GBNL 2V7HA 3FQTB 3QZWG 4OM0L 3BRFA 2VERN 3GIZH 5T3XL 2LAAA 3MA9H 1N8ZB 4GRLA 5FA4B 4G9FA 1E6JL 3BYTA 4P2OC 2DQDL 1CE1L 1KT2A 3D3VE 4M5YL 3K0WA 1K4DB 5CFHA 2R29H 2NY4B 1FGVH 4PB0L 3QIWA 3ULSB 5IOPB 1NEZA 2E9BA 3RL1A 1HINH 3QHFH 3O11A 4HHAA 3UTTD 5J3HD 1N59A 4ZS6C 2NX5B 4MQTB 4P9ML 1HXMB 2OI9B 4MXQD 2NY1D 1HIMH 3SE4A 3QQ3B 2VDNH 4ODXB 3TH3T 1S9KC 4S1SL 5IQ9B 3K2UH 3QEGL 1TZHA 2ADFH 4X6DE 5HPMB 3KJ6L 1OLZA 3O6FD 3MRPA 4ZNCD 3IU4H 4NPYA 4HH9B 4XVSL 1HYSC 3QUKB 3VFMA 1MWAH 2GIYA 15C8H 3GB7A 4I77H 2J6EA 4JFHD 3ECBA 1NAMB 2BSTA 1BQHG 4W6XB 5CWSA 2YS4A 3PWNB 4PJDF 4ZXBD 5E2JA 1E28A 2F8OA 4LIQE 5FXCH 2FH6A 5HI4D 4YBQC 1MJ7L 1B0RA 3W9DA 2VXVH 3WHE1 4S1QL 3UC0H 2I27N 3JTTB 5IR1A 2ZNWA 1UM6H 5C0BB 5B39A 1QHOA 1T2QL 3X3FL 5I1EL 3FB8B 5IESL 1EJOL 1G7MA 5SV4A 4LPCA 3WNOA 3WFEL 1Z2KA 1U8JA 1HN1A 5IHBA 2V9TA 4HKXA 3JV6A 1QFWI 4KK9D 1HHIA 1NGWB 4R96A 2CLRB 4UDTA 5HI3D 1U8NA 2NW3A 4O9HL 1T7WA 1FL5B 3QIUD 4MJIB 1F4WL 4LPYA 3SE9H 3D39D 2YMXH 3CMGA 3JWDH 4J6RL 5F1KC 4MZ2A 4YLQT 4YNYA 1XF5B 4KH2A 1R5IB 4ZFOA 3W81A 5TQ2H 3FFCE 3STLA 2NYYD 3EW3B 4NQUA 5EORH 5IMOA 1Y18A 3HNVL 1S8DA 1XCTB 1MCLA 1KIRB 1T0NB 4LGSB 4YFLI 3FN0L 5IBUB 5EOQH 4XCCH 3G08A 1AO7E 1CICA 1YNTA 4H1LB 4CMMA 3NGBB 5D7JB 4LDEB 1MFBH 5C0NC 5GSRB 4Z7OE 4KGLA 4U1HB 1SVZA 2NW2B 5DD1H 1H3VA 3V4PH 3T4YA 1QSFE 4WFEE 1A6TB 4YWGL 3H0TA 1N64L 4Q58C 4QRPE 4UV7H 3IDYB 2V6HA 4LIQH 4MMXC 1WICA 2V2XA 3GJFK 1ORSB 1UB5B 5T1LA 3RTQB 1CF8H 5EZIL 5I8EB 4L4TE 5DFVD 3NCEB 2H32B 4YK4B 1S3KL 1UKSA 4P2RD 5D7LE 4G6AD 4BQ8A 2Q76B 1BQHA 4FQ2L 1CG9B 3W0WD 4KTDH 4ZYKB 3O81A 2WNGA 4HGKC 1WK0A 3NPZB 2NY0B 5JOFA 4JKKA 4XNXL 3NFSH 2OK0L 4XX1E 2LFGA 3P4MB 1BFOA 2VZ1A 3CC5A 4LLQA 3PHSA 4LAQL 5H2BA 1T83C 5E8NA 1MH5A 5I16A 3NIFE 3QG7H 3QWOB 1T6WA 1YDPA 2ICEA 4MB5A 4O00A 2VLKE 4PD4K 8FABB 2YPVH 2W9EH 3EOTH 5CJXC 4K94H 4Q6YA 3PDOA 4R9HA 4ZUVB 5DHYA 1EHLL 1JUFA 4XP4L 4N1CA 5EUKA 3WO4C 4OLUH 2IH1B 3DSNA 3UTTA 1NSNH 4W6WB 1RI8A 3BT2L 4U7MA 1CXIA 4L3ED 5E2WL 2IALA 1JTTA 1J0KA 5F9AC 4NNPL 2MKWA 1IAIM 1U6AL 5D71L 2D4DA 3PQYD 3V4VL 3O6FA 1SYVA 5H35A 1M7IA 1A1MA 5DUML 2HFEB 1TTGA 3OKLB 4NO2B 1VDGA 4K3JL 4P5KB 4OZIA 4OM1L 4S0TD 1CD0A 4G6FB 3W39B 3ROOA 2I07B 1KJ2H 1IM9B 2FBJL 1GAFL 3L7EA 3QUXD 5KVDL 2XZAL 1A4JB 4AG4L 5DRNA 4XWOD 3IKCB 4XI5D 4YHNA 3BN9C 5AG8A 4ZXBA 3MLPA 2AJVL 5E4EB 5E6ID 3DETC 4LK4A 4GBXD 3WUWG 1KCUL 3P73A 1IC7L 4N8VB 2A83A 3MV9D 2IWGA 3VRLE 1BJ1J 5LGJB 2P24A 3MBXH 2AJSH 4OZFH 4X6BA 1KN2H 1BVLB 1E4XH 1F6AA 3MV7B 4OD2A 4Y2DC 3QFJE 4OAWA 2NY4C 2NXYD 4JM2B 4JN1L 2ZUWA 4X9HA 2FO4A 4WGWB 4LHUD 2ZOLA 4MA8H 4KPHL 4HUUB 5CMAB 5F9WB 5ETUB 1OL0A 2AV7B 1FIGH 3IRZA 3ZT5A 3VFVB 3QIUA 2QHLA 4JG1L 4JKPL 5LAXB 3D39A 4D9QD 1U8KA 4DJMA 5J06A 2P45B 3OF6D 1QFHA 1MJUH 3K8MA 5J12C 1JJUA 4R3SA 4HS6A 1RIHL 3ZHKA 3PL6C 4JVWA 3VXSB 4C56D 4OV5A 1I3VA 2G5BA 4KHTH 1SM3L 4Y4KB 4M4PA 1IGJB 5IB1B 2NZ9C 1G7LB 1XF4A 1D5IL 3TN0D 2AXJA 4HXBL 4CW1A 4ZO9A 2DWDB 5IWLA 1YJDL 4EOWH 4MAYB 1W0VB 1NMBH 3BO8B 2OZ4A 4QRTA 5TF0A 1M6OB 2C26A 4G3YL 3VXQB 3IU3B 4C59B 4UTAH 2NXZB 1JTPA 5L6YL 1R3KB 3NCYP 3SY0A 1AI1L 3VWKD 5FCUL 4KU1A 3HA0A 4Z77B 2JJSA 2JB5L 5MENE 4BFIA 4P2RA 2JLLA 3ARSA 3HE6B 4NN5B 1NCWH 3W0WA 2EXYD 4IS6A 4TSCH 5F6IC 4UQ3B 1YYMH 3DUUA 3L3HB 4X7TA 1INEH 3RWGB 5EU5A 4FFWC 4LHUG 2YA1A 4HV8A 4W68A 1HKLL 1UYWH 5EBLB 3WUWA 1BBDH 4CADB 3L1OL 5A2LH 3GBMH 3CFEB 3SCMC 2FJGB 1OSPH 5C0IA 4Y4FD 5I0ZA 1FLRH 4JAMA 3DWTA 5ADOL 2EYTA 3HMXH 4JQXC 2QQKL 4YHZH 2F53D 3VFNA 3S88L 1F90H 1KTDB 1I9EA 3QPXL 3O4OB 5L7XL 3DX8B 4KHXL 2NY3B 3NCCB 1HWGB 4BZ2L 1C7TA 4RGNB 3N50A 5D7JC 3SDYL 4L3EA 2BXZA 5I0DA 3PWPE 1UZ6F 3DVNA 4UDUA 3STZB 4BFEA 4BJLA 4HIHB 4PGDA 5JMOC 3PQYA 3I84A 4K8RH 2EDYA 2EEBA 3IDXL 5IHUH 4CJ1A 3IDYC 3BP4B 4XPTL 3VRJB 1GGBL 3VFGH 4G6KH 3SQOH 1CIDA 1YEIL 3K8KA 4JREB 5MP6L 4WW1A 2A6KB 2JIXB 3QUXA 5MEPB 3CFBA 3PHOB 3ULUC 4Y88A 4G80B 4N1HB 3BZEB 2ATPA 3VMPA 2F19H 2WBJB 2PYEB 3G6JA 5DUBA 3WNNA 1BFTA 3FQRA 3I02B 4H8WL 1LEKB 5E6IA 5GS1B 4ZNEE 1RUKH 3RNQA 1FCCA 4GBXA 2VDPL 3VFUA 1Y0LA 1UJ3C 2ZSWB 3D9AH 4X9IA 4FN0A 2L0DA 5IK3A 1WWCA 4LQFL 2NTFA 2BDNH 4PRAA 4Z0BH 1DCLA 2XKSA 1KJ2B 2C1OA 3D3VD 1P2CA 3WFZA 2DLIA 3V5DA 3WFBL 4OZGE 1A3LL 1XR8A 3RP1A 2Q3ZA 3M45A 4LHUA 2AJUL 4OFYD 3UMTA 4JHWL 3TYGH 4PIRF 3FMGL 1ZVHA 3ARRA 4NQDB 2X4RB 2W9DH 4LASH 2EKJA 2XY2A 2WWMD 5JDSA 1WUNT 3GJFA 4XBPB 4QY8B 1QA9B 2DD8H 2GKIA 1LO0L 4XRCB 4X8JB 5BS0A 4AH2B 4D0CB 3OF6A 4NN6C 4JO4L 4Y16A 4PJXE 4OGZA 4Q9CA 4NZRH 4OZFB 5HDBE 5GS3A 3VA6A 1AQKL 2FX7L 5GJTL 4C56A 2X2YA 1KG0A 1JV5B 3ZHLA 5DK2B 3K3QA 2AQ1A 2IQ9L 3F7YA 4RMSA 1E27A 4R26H 5JW3H 5LXGH 1OAQH 4RBPK 4QXUL 1CFVL 1YYLH 3TN0A 1MJ8H 3LQAH 7CGTA 5I74B 4EEEA 5IMMA 1CBVH 2V5SA 5C2BH 4NYLB 5AD0B 1WAAF 4TUJA 1JMXA 3RWJA 2EO9A 2YUXA 1RIVL 1J1OL 1X4ZA 3JUZA 3KLDA 5F1NB 1D3CA 4XCFH 3VWKA 2FX9H 3ARDB 3WDHA 4U6YB 2Y5EA 4BKLA 2EXWC 1KC5L 2FJFA 4TN9A 4GRMB 2XWBA 4XP9L 5D1ZC 1JNNH 3DTXB 4HWEL 1GOFA 1FFNA 1I9RL 3AS0A 1NBYA 4DN3L 4JM2C 1KV3A 3N1PC 2F54B 2PR4L 1BFSA 4JFEE 1KCSL 4XMPH 3WKMH 3BZFA 3HI6H 2O5ZL 5F9WC 4BSWA 5IROA 3N1QC 5I17A 2XTJB 4L8DA 4PLJD 2NZIA 4WI4A 4Y4FA 4WI8A 4FQJL 3NCFB 5J0BA 2YWYA 5HBBA 1PAMA 5EZOL 1T5WB 1FH5L 2ID5A 2OTUB 2F53A 4JJ5A 2YN3A 5LQBL 4GXUN 1T5XB 1L9MA 4JM4H 3NACL 1FL6A 1WQVT 3QHZH 3HE7D 5KZCB 2AI0H 1BVKB 4BK5A 5GQBA 2VLLA 4HAFA 4Y4KC 5IGXH 5JHDE 2BRRH 1AO7D 1MY7A 3QDGB 3O3UN 3LPWA 3JV0A 2O5XH 3IETB 3QG6A 2NY6D 1V7NL 2AGJH 3UPRB 1IAMA 1KJVA 5GJSH 3W11C 5JXAH 3MLSH 3VCLB 2BP3A 2YXMA 1FPTH 4CNIA 3TLRA 1YMHA 5C0DA 3NABH 1PKOA 3GDBA 3P4LA 4QRPD 1T22A 1P9MA 4YHLL 4FNLL 2P8MA 4NQCE 2Y25A 2B4CL 4PREB 4N8PA 2GEEA 3UO1H 4KQ3H 3VGDA 1I7UA 4LMQE 4L4TD 3EAKA 3UYRH 4ONFH 1HH9A 4NN5C 1NC4D 5DEGB 5GGTA 4PRPE 1IC1A 1GGIL 4LRIC 3QJHA 1BOGA 4GRWE 4PJ7A 3IDJA 1U3YA 3P9MA 5FEBA 4ZFFB 3MTRA 1JPST 5KVEL 4PGCA 4P2QB 4FABL 1A6WH 3IAGC 2IPTL 4B53A 4PRHB 3IJHA 3MRHB 4R97B 3FONA 5E5MB 4Z95L 2BJML 4EDXB 2C4XA 1N5YH 5L8JB 3D3VA 1AIFA 2R69H 3O4OC 1I1FA 5EO0B 4X4XB 1DSFH 1QRNE 1B6UA 1CLYH 2AXGA 4OFYA 2OM5A 4KKLD 4RQQB 2WUCL 3GRWH 1I3GH 3SGJC 4A2LA 4I3SL 3NPSB 2WM0A 1OWWA 1CD1A 3JV5A 1IC4H 1ODAA 1ZAGA 2NNAA 4HJ0C 1A6VL 3U30C 5E1AA 1JGLH 3W82A 4FXKA 1WSST 4F2MA 3U46A 3BWUC 1QLFA 1IEHA 4YHPB 1FDLH 3AUVA 4R4FL 4NJ9L 5DR5H 5HYJD 2XG4A 4HK3N 5KSUB 3BUTA 4EN3B 4TVPL 3QR2A 1F8TL 2X4QA 2FECL 3A6CL 2GK0B 2W1NA 5HD8D 1FL3A 4JDZA 4GG6F 1LP9A 2VZUA 3KS0H 4RCAA 4S1RH 3TPUA 5EPMA 4PRDB 4GW1B 3V6OC 3LKPA 4Y4HB 1GIGH 4MJ6B 4YHML 2Z31D 4M93B 1K8DA 5IB5B 4YEEA 4LLYA 4PB9H 5CSZB 4ELMA 3MRKA 3AGVA 1J8HD 5INCA 1SMOA 5F9OH 4DGVL 3U83A 4WJ5A 3VD9A 1CL7H 3VWJD 5SX5H 4PGBB 3DRTA 2UVEA 1NGQH 4NGHL 1XGUB 4JFFD 1ONQB 4AYFA 3QFJD 1I9JL 4HEME 5DUPH 4Z7WE 1ES0B 12E8H 3HUJF 4LU5L 4WRLA 2GT9B 2E3VA 4HKBB 5L0QC 4KY1H 2Y4SA 4PJCF 3LQMA 1NC2A 4G8GE 4JG0L 1JGDA 2XZQL 3G6AA 4I3RH 3NAAH 3TVMC 1OAZH 5ADPL 1BAFH 1EMTL 4KUZH 3U6RA 2Y07H 1RU9L 1UEMA 3ARFD 5L2KB 5SWQB 1QBBA 2P43B 4Z7NF 2HKFL 4WY7L 3HE7A 1FORH 3MREB 3RUGB 1YPZA 3ARZA 2VUOA 2R1XA 4FTVB 3DV4A 3GSXB 4XC3H 1AO7A 1U8PA 5IQ7L 4K7FA 3EZJB 5D5ME 3LN5B 4RMRA 2PTVA 4U7KA 1D5MA 5IJVA 5MHSD 3KLHC 2DI9A 3OL2A 2KBGA 2QTEA 5GGSY 3QI9D 2XKUA 4K7PH 5BRZB 1CDJA 1Z3GH 5SWSE 1IMHC 3LQZB 1DN2A 3A67L 1DE4A 3BZ4A 4QRPA 4XNYL 3RVVD 3DXAB 1CDYA 1IC5L 3WS6A 3UCRA 4U1LB 4JQIH 3B5GA 5DTFA 1JNJA 2X7LA 3HC4H 5EC1B 4L4TA 3E3QC 1BGXH 1NCDH 5MEND 1DUZB 5D7LA 2H45A 2FGZA 1XIWD 1BIHA 1NC4A 3QPQC 2VXTL 1LK2B 1WCBA 2D7MA 4ODSH 1BLNB 3CLEH 2IPUK 3VFSB 1XCQA 3NZHL 5T3XE 2FATH 4KRPD 3SEPA 4NWTL 3T08A 4XXDB 5GSVB 3SDAB 5IJKA 4KUCF 1ZT1B 3IFOA 5HYSB 2J3SA 4POYA 4O4YH 4MLIA 3KPRE 4M9PA 3ISWA 2JJTA 2AJZA 2VLKA 3GSNB 1MCWM 5DO2D 1FNSL 1ETZA 2Y72A 5J8OA 1XR9A 1P1ZA 1MRCH 3V2AR 4U1SB 1N2RA 3QIBB 2VH5L 3K4ZA 4M62H 1WJ3A 4YE4L 1DANU 1ZHNB 5TE6H 2Q6WA 5C9KA 5EU4B 1IBGH 3MFFA 2CLVA 3RJDA 3O6KH 2A2QT 3CMOL 3FTGA 1CD9B 1W72H 3ZDXF 2YK1H 4P4KD 3TCLA 3TA3C 1NCNA 5ERWB 5HYJA 1SEQH 1IFHH 4GQPH 5C09B 1BQLH 5DJ6B 4C4KT 1QR1A 3ILPA 3P4OB 1K4CB 3D0LB 4MYWB 3H42H 5A43C 5DHVB 5C07B 3D5OF 4U33A 4Z78A 3BZDA 1UB6B 1CLOH 2N4IA 3RA7H 4OFVA 1R24B 4KGJA 1EGJL 3GBNH 4CVWA 4YHYB 2OR9L 5C8JA 3BD3A 3D25A 2CKBB 1UWXH 4OM0H 2Y9RT 5KG9B 2Z31A 5T3XH 3O3DB 2UVFA 1KJMB 1A1NA 1J8HA 1E6JH 2DQDH 1CE1H 4M5YH 4R4BA 5DXWA 3VWJA 3H3KA 1WBXB 5EA0L 1ZLVH 4PB0H 3WHE0 2AJ3B 2GTWB 3KR3L 4JFFA 3QFJA 2JE8A 2ARJA 5IVXB 2X89D 1AGEA 3V0WL 1M7DB 4UIMA 3FQNB 3DROA 5CZVL 4P9MH 4UNVA 2KQNA 2ZCLH 3RVWD 3O41A 4GXVL 2JCCF 1MUJA 2ADIA 4OZ4A 4HWNA 3WE6A 2D03L 1TVBB 3BH8A 3DVGB 4KDWA 1GSMA 3SDCC 4S1SH 3QEGH 2WP3O 4HBCL 2AAVA 3KJ6H 4MA1C 4I1NB 3ARWA 3ZLQC 4JFOA 3Q6FB 4XVSH 3UPCA 3WCYA 2EDHA 3KXFB 1Q94A 1D5XA 3UJJL 5F9JA 3ARFA 1UC6A 4M61A 2Z0BA 1CGSL 2DQUL 3LZFL 1BX2A 4JY6A 1RJYB 3FZUC 4WV1C 1DLHA 2CRYA 5C0RL 1TTFA 2R0LL 5F9DC 5BXFB 2D2OA 3IDMB 2D3VA 1MJ7H 2HG5B 3T4AA 1H3GA 4S1QH 5I1AB 2BNRD 3T0XA 3QI9A 3HC3L 3SKOB 4APQB 4XTRD 5CSGA 2FHBA 3H7BB 4M7ZB 1DN0B 4OFPA 4JRYD 5HHQB 1UENA 5GZOC 1ZT4B 3X3FH 5I1EH 1KENL 5IESH 4HC1A 1IAOA 3PHQA 2FX8H 3MV8B 2CH8A 1BP3B 4JFYB 2PW2B 3WFEH 4LCWD 3QAZC 1LE9A 3FHQA 5MENA 4XMLL 2YD5A 1XIWA 3O2WH 1I75A 1WC7B 3CDYA 5F93C 3HLAB 1FYTE 5FYLD 1TVHA 5J89A 2Z92B 1TDQA 4QT5B 4O9HH 3UTPE 5T5NF 2DYPD 1F4WH 4Q9BA 4U6XB 2VZSA 1FV1A 4J6RH 4RGMB 4ZUUB 4HWUA 1UXSA 4FQPA 4OGAD 1CXKA 1FHGA 3ULUE 3HZVB 3UTSB 3GNML 3HNVH 1HSAA 1MHHA 3VXTA 5F7DB 4IJ3B 2BOBB 2P48B 3VI3E 2OXGA 3FN0H 4WU5A 1A1OB 1UH2A 4PJIF 1M05A 3T0EB 3TBTA 1UM5H 5DJDB 1X6LA 5J1SC 3BAEL 4OD3L 3MA7B 5DDHA 3P4NA 3KPPB 4P2OD 4AEHL 3KYAA 4JN2A 3GHBL 3PWPA 4U1KB 4YWGH 4P4KA 2YPLE 1N64H 4LDLB 5TH2B 4P48A 4R0LC 3GMRA 4MA7L 2QSCL 5CLTA 4ZO8A 3O0RL 3GGWB 5EZIH 1T4KA 2GCYB 1C7SA 2JK5A 1CWVA 2B39A 2LV4A 3UTQA 2Q86B 5LJYH 1S3KH 1DR9A 5D2LB 2B1HL 4HUVB 2BMKA 3LKQB 4RZCA 4XC1L 5FYKD 4FQ2H 3VXRD 1AGBA 4P3WA 3RIAK 2BC4A 1DQQB 2ESVB 4EVNA 1WWAX 5DI8B 1XT5A 3V7AE 4XNXH 1FO0A 1ZLSL 4NP4L 2OK0H 5CBEA 3ZKMD 2YZ1A 4OLYL 4LAQH 5A40E 1REIA 2WWKT 2BY1A 1FZJA 1IGTB 4GQ9L 1FE8L 5D6CB 1MAKA 5B4MC 1SJHA 3ORJA 3ULVF 4X6CE 4KDTA 3CDGB 2CSPA 5C0CB 4MDJB 2W0KA 4NBYB 1EHLH 2WSKA 3IRPX 4XP4H 2X89A 1PX4A 3FO2A 3C2AL 4YBQD 5LBSL 4KXZI 1Q8MA 4KJQD 3S37L 3BT2H 4X7FC 1WWWX 5ICXA 3ARXA 2EIBA 1QOKA 2IBBA 4OZHA 4UMGA 1IEAB 3OXSA 3UTZB 4NNPH 3MV7E 1U6AH 3OKOA 5D71H 4ZUSA 2NY2B 3V4VH 1A7BA 1S7WB 3IAPA 3T77B 3V9FA 5DUMH 4KJWD 2BNQE 4DN4L 2VLRB 4IRSB 4K3JH 4OM1H 3JVGC 3VDBA 1HKFA 4HFWB 5F88B 4FZEL 1GAFH 3QEQB 5KVDH 1NCCL 4F7TA 5D93B 2XZAH 4AG4H 5FOBA 1QEWA 2BNUA 3MRMA 4V2CB 3MCKA 1XGPA 4JDTL 3BHBA 3ZYOA 1AQDB 3VXUD 2AJVH 3TT3L 5EBWB 2VLJE 2BNRA 5TDOA 1KCUH 1CIUA 2H26B 5C0AD 1IC7H 1QBML 3D2UD 4JZJA 5E8OB 5J9PA 4F9PA 2CJUL 1NJ9B 4JRYA 2VQ1B 3IXAB 4Y1AD 4LLUB 1IL1B 4PJGF 5F71A 4LCWA 1YY8A 2DI7A 5KS9F 5DD3L 5CEZE 2JJVA 1KB5A 2HMID 5IBLC 2X5PA 3LPFA 4KPHH 4JANB 4JFEA 1WBYB 4N90D 4KROB 4OF6A 5KSAC 3V5KB 4JG1H 2DYPA 4JKPH 4Z7UB 3HC0A 1KPRB 5CJOL 3TJHC 3C6LD 3WS3B 3ME0A 1DLFL 1DP0A 5BJTA 4G8GD 1KLUA 3S4SG 5HYQA 4HX1B 5E2TL 1RIHH 4Y5XC 1WT5C 2QEJA 5I76A 4GKNA 5D6DA 4KRLB 4AENA 3DNKA 2AVGA 4NKIL 1UXWB 4GUPB 1A6ZA 4PD4J 1YN7B 4A6YL 5EG6C 4I0PB 3ROLA 1MFCL 1NEUA 1G7JA 1D5IH 4NRYB 1SJVA 5FHBL 4HXBH 4BFBD 4P2OA 1YJDH 3MRIA 2HTKC 2NQCA 4DKFL 3GMPA 1J5OL 4FQQA 5BQ7A 3B8YA 1NFKA 4G3YH 3RI5K 1JYNA 1FFOA 3CVHB 4PV9B 4QHMB 5L6YH 1F5WA 1AI1H 3I3BA 3QWQB 3IDGA 4X99B 5FCUH 3M8OL 5GISH 5DYOB 2JB5H 3QXDA 1L0XA 4NQCA 5GRYA 1DVFB 3TO4C 3BXNA 2R0WL 4QNPF 3VXRA 3AREC 4AT6A 1FZOB 1DUYB 4O2EA 1HKLH 1AP2B 3EO9L 1C12A 2R2HB 1IJ9A 1GVIA 3L1OH 5AWNL 1A9BB 4LVOC 2UWEB 4R7NA 5I75B 4J3UA 1H8OA 1WGOA 4OUOA 3QISA 4RGMC 3DV6B 4P4RB 3CXHK 3TIEB 3EFFB 3L3KA 1KCVL 3KPRD 5ADOH 4C83B 2NTSP 2P8LA 1HWHB 1R5VA 2QQKH 4WHDA 3S88H 3WN5B 5FYJU 3QPXH 5L7XH 3V6OE 4YIQB 3RWFB 4Z76B 3EYVB 4KHXH 4IOFC 2IQAA 2BHZA 5GGRB 3OKDA 1T0PB 1J87A 3T0EC 3WFCL 4JRWA 4X7SL 3SDYH 1IQDB 4IMLA 2Z35B 1MHCB 1AY1L 2DKSA 4X6EA 1ZHKB 4AM0A 5CBAA 1YEJL 43CAB 1MRDL 4NCC1 3S4SA 3I50L 3IDXH 4YR6A 5CD5D 2NY4D 5ANMA 4PRIE 3CH1A 5IW1B 4QHLA 4XPTH 1ITCA 1GGBH 1R3IL 3VE0A 3EDEA 1Q9WB 1YEIH 5MP6H 1OGAE 4U1NB 1BQSA 3E6HA 3PWVA 1I85C 2NX5D 5CEYB 1IGYA 3MXWH 2VC2L 1ZGLA 3ES6A 4PJHF 2W0FB 1NUDA 4H8WH 2X1PA 2CIKA 3TBVB 4FQ1L 2FD6L 5HVHB 4G6ML 5D7IE 5TJWK 2VAAB 1X5YA 1UH3A 2VDPH 5I1DA 1QZ1A 3LH2H 5C0AA 3GMMB 3D2UA 4PP2A 3EO1B 4LQFH 2KKQA 3ZTJG 1I1AC 5K9QI 1QLRA 4NFCA 4B5EA 4Y1AA 1KPVB 5HJ3B 4XHJD 2FHCA 5GRVK 1UADC 1T03L 2X1OA 3WFBH 4QWWD 1A3LH 2BFVL 2AJUH 4JHWH 3N1MC 3FMGH 5TGBB 1FNEA 3ZSTA 5EIVA 4Z7WA 5C0BD 4DQOL 2HH0L 1OW0A 1LO0H 5ICZB 3E3QE 1CDGA 4RGOL 3C6LA 2NY2C 4JO4H 1CFSB 4G8GA 5D9SA 5GRWA 4MCZA 5L88L 2BSSA 3BIAX 4JO1L 1C16A 1AQKH 3TPKA 2FX7H 5GJTH 3LKRB 4U6VL 2NY5L 1X9QA 4KVNH 1H0DA 1BZ7B 4KI5D 4MZ3A 1YEGL 3MUGA 3F7VA 4IDLA 2BVUA 3I75A 3FAWA 2IQ9H 2P5ED 3E8UL 1JHTB 4TUKL 4QXUH 4MJID 1MJJB 1CFVH 4HDIB 3ZL4L 4X6DF 4D0DB 3AS2A 1AC0A 2E7LA 5D5MA 1TPXB 4U1GC 5HDLA 2WIMA 3VH8B 1AXSB 1K6QL 4V1DB 2B5IB 1DFBL 2GJ6E 3QEHA 1P7HL 3OAZH 1RIVH 3RVXD 1J1OH 3O3BB 2IANB 2MOVA 3V52L 3OQ3B 1KPUA 3S96B 3I2CH 4DZ8A 1KC5H 5AUMB 1SYSA 4XP9H 4HWEH 3WIFB 4POUB 1I9RH 3S37X 4DN3H 5D1QB 1Q38A 2PR4H 4WWKC 3E2HC 3N1FC 1KCSH 5FGBC 2O5ZH 4D0BB 2MCPL 3CH8A 2BHYA 1Q72L 4PY7B 4MLSA 2P46B 3EOBB 4M5ZL 3RTQD 3JWNC 3VDCA 1XH3B 1AHWB 4FQJH 3DMMC 3GHEL 3KGRA 5C0FB 3WJJC 4LFHG 3QDJB 5EZOH 32C2B 3KPRA 1FH5H 5JPNB 3HG1B 5E4IA 5LQBH 3NACH 3LCYA 1VACB 2NY0D 4IIQA 4ENED 3GFUA 4XB7A 2ITCB 4NKOB 4L4VB 2R15A 5CIPH 1RJZB 3FQTA 5IG7B 1CI5A 4PRHE 4YAQB 1GXEA 4QXTB 1V7NH 1N8ZA 5FA4A 1FZKB 1K4DA 1PYWB 3V0AC 4ZUTB 3V8OA 3ULSA 5IOPA 4TVPE 3RBGA 1I8KB 4YHLH 1RK1B 4FNLH 2B4CH 4LSQL 5IBUG 2HAZA 1B2WL 4ZUWB 4Z7OF 2NX5A 4PP1C 1HXMA 3QUYC 2EH7L 3UPAA 1TLKA 3QQ3A 3RKDD 4OF7A 1GGIH 1IAII 3BW9B 4CBPA 4GLRH 5DMIL 3EFDL 4M6NL 4ODXA 5IQ9A 3SDDC 5HPMA 5KVEH 4FABH 4NO3B 1BF8A 4AEFA 5DQ9B 3AM8A 4HH9A 4WWID 4ISVB 2J6EL 5I75C 2IPTH 4PJBF 4G6FD 2CXGA 3QUKA 4PUBL 4J4PC 3MACL 3OB0H 4Z95H 2AK4E 4JHZA 3BI9X 2BJMH 1NAMA 5FF6B 3VFTB 2MNUA 1X5GA 3WN5C 3PWNA 5DMJB 3U0TB 4MHHI 4WTXA 2VTFA 1UWEL 2WUCH 3JTTA 5EU6E 4KKCC 2YEZB 4I3SH 1NAKL 1KCLA 4NCC2 5C0BA 2SEBB 3B5HA 2E5EA 5DVKA 3HS0B 4XNZB 5DD5L 1A6VH 3FB8A 4P3DB 1BMGA 2YRLA 3MV7D 4WUUE 5J6GB 1FNFA 3DRQB 4NHCL 3MV01 4R4FH 4NJ9H 3S5LB 1INQB 4YDKL 1EIBA 1CFQB 3C5JB 2GSIB 1UH4A 4UT7L 1NGWA 4TVPH 1F8TH 2VE6B 3A6CH 2CLRA 1NUFA 1CT8B 1OGTB 3TV3L 2LVEA 4ZFOL 1FL5A 4MJIA 5BVPL 3K1DA 3HHRB 5JNYB 4WI7A 4J7RA 3WIHA 1XF5A 1R5IA 4YHMH 4JQXA 2Z4QB 4L8BB 5A3IC 4JO3L 2YN5A 3KLAB 3VXSD 2B0SL 1XCTA 1KIRA 1AFVL 1T0NA 5E5UB 4DGVH 4FTVE 2W60B 3LRSB 3B6SB 5FOJA 4H1LA 3RY5A 2WBKA 1UCTA 4NGHH 3OKKB 4I4WB 5D7JA 4AJ0A 1I9JH 4TPRH 4LSRL 5F8RC 5GSRA 2HTLD 3BFOA 3W11D 4U1HA 2VUYA 3KYKL 1MI5B 2NW2A 4MAYD 1LEIB 1A6TA 1ZLUK 4LU5H 3VRLF 3DXAE 3PDDA 4K9EL 1VENA 1D5ZB 3RDTC 2NXZD 1EO8L 4WUKL 4E42B 3HZYB 4N8VG 1ORSA 1UB5A 3RPIB 5EUOB 1IT9L 3RTQA 5C7XL 2XA8L 4JG0H 2Y7QB 4CN1A 2C3WA 5I8EA 2HT4C 4WW2F 2XZQH 2H32A 5IIEB 2Q76A 5GPRA 3HE6D 5ADPH 4P5TB 1EMTH 3MLWL 1CG9A 1F97A 3MYJA 5HHOE 4GKSB 1RU9H 3LD8B 4ZYKA 2HVJB 2HKFH 3MFGB 4WY7H 2EE6A 4NUGL 3BESR 3NFNB 4MD4B 3P4MA 1EFQA 3DO7B 3T0WA 5IQ7H 2QKIB 3TYFB 3V6ZB 1WLHA 3V6FB 3QWOA 1QSZA 2DBJA 3VMNA 2X1XR 3D85B 3WXVL 3S8WA 2BVEA 2H2SD 1TPXC 1LWRA 8FABA 1D9KC 4RWHA 4KKAD 2B5IC 4ZUVA 4PJEB 1OCWH 3A67H 5AG9A 5CEXB 4XNYH 5JIIA 1IC5H 2NY3D 4YC2C 1V7ML 1K2DB 3S34L 5C71A 2IH1A 1OSZB 4RGND 3C5SA 3PGDB 3MRCB 4OLEA 3BPLB 5DFWH 5F7HA 2VXTH 2HLAB 4G5ZL 1S7TB 2DQJL 2X4SB 3RU8L 3NZHH 2ITDB 4NWTH 4QHKJ 2DLEA 2OR7A 2W59A 5CP7A 1NBZB 2HFEA 3FHAA 4LSTH 3BUYB 1HYRC 3OKLA 2IC2A 4NO2A 4P5KA 3QIWC 1AHWC 3W39A 2I07A 5E99L 1IM9A 2JIXD 4PGJA 1FNSH 3DGGB 3WFHB 1A4JA 2VL5B 1EAPB 1L9NA 3IKCA 2WBJD 5JW4M 2PYED 3SE4C 4HGMA 1I4FB 1HQRB 4WI6A 2VH5H 3NIDE 4YE4H 4ZTOL 1KBGL 1OB1B 2XV6B 5L8KB 3QNXB 1EPFA 2EEDA 3TFKC 4N8VA 5EOCL 3CMOH 3ALWA 4KK5C 5LGJA 4NM8L 4W81A 1BVLA 5ESQB 3MV7A 1I9IL 3EZ8A 4C57C 3R0MA 3IAQA 5I1JL 4LPUA 4JM2A 1YEKH 3ARGB 2JTDA 1NANI 3U9PL 2R56L 1Q9KB 5GS0C 1U8HB 4JFQB 1N3NB 1OQOA 2AEWA 4HUUA 5CMAA 5ETUA 3MLTB 4H20L 4FA8A 1YEDB 1U58B 2CRIA 4LCYB 4QOKE 2AV7A 4NQDD 4PPTA 1KUMA 1NKOA 1YEFH 3HB3C 5DWUL 3VFVA 4E41B 5A16A 1EGJH 5LAXA 4FS0A 2OR9H 2AKRB 4PJAE 4FFVC 2VL4A 1OAUL 4GH7B 1MAJA 4V2BA 1G0YR 5DLML 2W0LA 3VXSA 2LVCA 1FGNL 1K5NB 4TUOB 3R06B 2NLJB 2B8OT 3DURB 1I7ZB 4Y4KA 1IGJA 5EA0H 3CGTA 5IB1A 1G7LA 4C54A 3KR3H 3ARPA 4M3JA 4RA3A 3V0WH 1P7QB 2DWDA 5KVFH 3EIFA 2XT1B 4MAYA 1W0VA 3BO8A 5CZVH 1WEJL 4GXVH 1BEYL 3O6LL 4F7CB 3KPNB 1M6OA 5DD0L 3VXQA 3IU3A 4Y2OA 3CX5K 2D03H 3R8QA 3X3GH 1R3KA 4TVSa 3OMZA 2KL6A 3ARDD 4CU7A 3LKNB 4HBCH 4Z77A 3DOSA 4OI8A 4QRQB 3BMVA 4OZGF 1N6VA 3HE6A 1CICC 1LO4H 2DMKA 4GJTB 3UJJH 4LRIA 1UA6L 2F54D 4PJFB 3L3HA 3RWGA 1DDHB 3VGGA 1CGSH 2DQUH 3LZFH 2FIRT 4TNWK 5DD6B 2WW8A 5EBLA 4ESKA 4XVUD 2R2BB 5DURB 1KXTB 2XTJD 5SWZE 3TO2B 3WO3B 4CADA 3O3AB 5JXED 2VOTA 5C0RH 3CFEA 2FJGA 2R0LH 5GZNC 3KPMB 4PJXF 5J11C 1EUTA 4QRRE 5HDBF 2X41A 3HC3H 4K9EC 4OZFG 1KTDA 1OOAA 3DX8A 3T0EE 1KENH 4ZG1A 1JPTH 4MVBC 5KZCD 1I1RA 1NGZB 2DTML 3QDGD 4XMLH 1KFAL 2K7PA 1I8MB 4ZD3L 2DM4A 3MV9B 2GITB 1KLGB 3STZA 1JZ3A 4C4KO 4HIHA 1HXYB 4LSPH 1JZ7A 3BP4A 3VRJA 3WYRA 4PJ9B 5ID0B 3LMJL 4ERSL 2A6KA 3Q5OA 3GNMH 2CUMA 1Q9LB 2ESVE 2JIXA 4HXAL 5MEPA 3PHOA 5J3HC 4EXKA 5KSBE 2DI8A 4G80A 3BZEA 1QR4A 2ZUSA 2YD6A 2WBJA 4MXQC 2PYEA 2NY1C 3LEVL 5C6PB 1MCEA 3MRNB 3V6OA 4UAOC 3I02A 4PJDB 3REVB 1LEKA 1AR1C 4P2QD 5GS1A 4OLVL 5CJQL 4WFFD 3BAEH 4OD3H 5DJ8B 3O6FC 2ZSWA 1F00I 4AEHH 3GHBH 4KZDL 4HT1L 2QSTA 2K9UA 2ZKHL 1BJ1H 1NMCC 1Z6JT 2QSCH 4HW6A 4MA7H 1KJ2A 4NOBA 3O0RH 2NY7L 4M7KL 2YR3A 1XFPA 3QH3B 3IYLW 5DJXB 4I3GA 3K7UA 3I3DA 3S36L 3EYFB 4OIIL 2B1HH 4ZXBC 4HSQA 4WTZG 4XC1H 2EYSB 4L9LB 3H7LA 5HI4C 4I0KA 4NQDA 2X4RA 3BPLC 3QUMB 1A6UL 4PTTB 4XBPA 4QY8A 2EO1A 1QA9A 1UKQA 4ZOBA 1OAYL 4HAGA 4XRCA 4OCMC 4X8JA 4Z7VE 4XAWL 4WGVB 1ZLSH 1F4HA 4NP4H 4JFDE 4AH2A 4D0CA 3NIGE 4I9WD 4D94A 4O2CB 3KYMB 4OLYH 2A38A 4OZFA 1EERB 5CUSL 3MC0A 3HAEH 3LAFA 5BV7L 2A9MH 4Z6AT 3RZCB 2M1KA 3QRFM 1UJTA 3QEQE 4GQ9H 1FE8H 4PYGA 1QD0A 1GGTA 5DK2A 1KGCE 4EN3D 1W0YT 3FZUD 3WUZA 4KK9C 4Y8DC 5DMKB 3D69B 4GRWF 3IFPB 5HI3C 5GHWH 5FM5M 4D9RE 3C2AH 1DBML 3QIUC 3MMEB 5LBSH 1PQZB 4Y4HD 4N1EA 1S7XB 4NYLA 4AQOA 5AD0A 1CTOA 2OJZH 5GIRB 2VQUA 5KN5B 3THML 1MVFA 2NYYC 5F7LB 5F1NA 5F89B 3ARDA 1RUPL 1S7VB 3T8XB 4IEFB 2MPAH 5SX4H 3VMOA 2XYCA 5F44A 4GRMA 1IGIL 3DTXA 3CIQA 4DN4H 5FYJE 3C87A 2F54A 1ZOXA 3C09B 4FZEH 2PXYB 1DQDL 1NCCH 4M03A 4XP1L 5IWLC 4N0FB 1XGTB 4ZFGL 1MRFL 3RHWF 4JDTH 1R3HA 2H3NB 3TT3H 1WZLA 3MRGB 3HI5L 1ZXQA 1T5WA 4ZTPL 2JJSC 5DFVC 2O61B 1QBMH 2EC9T 2OTUA 3IS0X 1Q9OB 4G6AC 2CJUH 1T5XA 5L2KD 4OCYL 4O5LL 3AVEA 3KPSE 4WTZA 4MMZC 2VN7A 1YMME 1LGVA 2VDQL 1Z9SA 2EDOA 3CSPA 4X4YB 5DJCB 3QDGA 3VI4E 1OAXH 3O8XB 3IETA 4JY4B 2A1WL 4JHBA 3UPRA 5CCKL 4WEBL 3VCLA 2N7BA 1EHNA 3FT2B 5BRZD 5JDJA 2CQVA 2ZZUT 1BPVA 3DHJA 4GS7C 4G42B 3OWEA 5CJOH 1DLFH 4PREA 3P0GB 5GGTL 4RX4D 3U4EB 2D7PA 1TMCB 5E2TH 5ACZB 1WV7T 5SX5K 5DEGA 3OXRB 4M1DL 2WWKO 4NKIH 1I7TB 3ARVA 2FEEI 2L4OA 5E8EB 4A6YH 4R4ND 1S5HB 4ZFFA 1U8MB 1MFCH 3SDAD 4P2QA 4YXHL 1H5BB 1Q0XL 4RISL 4W4NA 4KTEL 4HZLB 4PRHA 3EGSB 1S7QB 3MRHA 4DKFH 1J5OH 5E5MA 2E8ZA 4HJGB 4EDXA 5JQ6L 4RMWA 3QUXC 1GRWA 4N9GB 4FG6D 3RHWK 2XQYK 4CU8A 4XWOC 3M8OH 5EO0A 3ZDYE 4X4XA 3QIBD 4XI5C 2DIBA 3M1BB 4PTUB 5E9DD 2CIIB 2H1PH 4RQQA 2YA2A 5D5MF 1YQVL 2R0WH 4KJYB 5E6IC 5CGTA 1OM3L 2VN4A 4UINL 4NHUB 3SDXB 3H8NA 4XWGL 3WNPA 3U0WL 3QDME 4DFIA 3AB0C 3EDJA 1TXKA 4C58B 5AWNH 4QXGL 5CSBA 4YHPA 3PXHA 3DBXB 1D6EB 3AROA 4YEFA 5BZWB 5C09D 5KSUA 2NXYC 1KCVH 5GS2H 1PDKA 4EN3A 1W8NA 5C07D 2EZ0D 2GK0A 4WV1A 4X98B 1MIEL 2AK4A 3S35X 2VMFA 2OJEB 1ZWIB 4PRDA 1U36A 2BXYA 4GW1A 3BD5A 3WFCH 4LPVA 4Y4HA 2JKXA 4MJ6A 3MZGB 4X7SH 4PV8B 1EEYB 2VKWA 5IB5A 5HYSG 1AY1H 4ZMAT 1S78D 5CSZA 4PBWD 5FM4A 1YEJH 4ZAKB 1MRDH 5J7CC 1MFEL 1IZJA 3I50H 4QHKI 3OGCB 4F3FB 4PGBA 5C08D 2DM3A 2XXMB 1R3IH 1XGUA 5BV7C 1ONQA 3UJIL 2L7UA 1KF9B 1EFXB 2X6MA 4HF5L 2P5WE 4WFGE 4PY8J 3AC0A 5TDNB 3TN0C 3JXAA 3AFLA 1JYWA 1ES0A 3GSUB 2DICA 4YDLC 1HHHB 1A8JH 4L9LC 2GT9A 4HKBA 4N0YL 1G7HB 5IEKB 3TJHD 3LB6C 2D0GA 4AL8L 1KSRA 5ABDE 4FQ1H 2FD6H 3VWKC 3S9DB 4G6MH 3PIQB 4G8EB 3OG4B 4YXKL 3KXFD 2J8HA 5L2KA 5SWQA 5TPWL 5IEHB 4X8XA 3QA3B 1XEDA 3MREA 3RUGA 3GSOB 4FTVA 1TJHL 5FUZL 3GSXA 3NCBB 4WO4B 1T03H 1BD2B 1PX3A 1YEEL 3BQUB 1A6AB 2BFVH 3LN5A 4ODHL 5IROC 2ZG3A 1X4YA 5DSCB 2HTKD 3DUHA 3FQUB 3C08H 5LCVL 4DZBB 2A77L 4J3OC 4Y4FC 4I5BB 1JWMB 5BRZA 4APQD 3T1WA 1X5HA 3LQZA 4DQOH 4YBLC 1UWXK 2HH0H 1F2XK 3BPCB 3DXAA 1U93B 1FVCB 4RGOH 1PW3A 3HNTL 3MV8D 1QYGL 4RX4A 4U1LA 5EC1A 5L88H 1FG2B 1GGYA 4JO1H 2I9TB 1DUZA 3B2UD 2ZUQB 4KC3B 4U6VH 3SE3A 2NY5H 5IM7B 4G9FE 1ZLVK 1LK2A 1YEGH 3FRPG 1BLNA 3VFSA 3U2SB 5I8KL 5HGHB 4Q9RL 3B9KB 2GK2A 3T3PE 4XXDA 3E8UH 1T20B 5GSVA 3SDAA 3D6GA 1ZT1A 4TUKH 4CJ0A 1S7SB 5HYSA 1JTOA 3ZL4H 3CPLB 3L3OB 4LCIL 3T0AA 1JHLL 2F5AL 3MGOB 4EUPH 3HG1E 3UTSD 1K6QH 4NRXB 1Y6KR 5DGQA 1DFBH 3GSNA 4XAKE 3CFJB 4Q6IB 1UGNA 2VKXA 4X5WB 4R90L 3V52H 1CDIA 1SJEB 2D0HA 4U1SA 4TSBL 3QIBA 2ARWA 2PW1B 1ZHNA 1JGUL 4RNRB 1RZIB 3SO3B 2DIAA 5EU4A 1G6RB 3QJFB 1ZK9A 2IG2L 2R0ZL 3IXTB 5I1HL 3O8XC 2MCPH 5LGHL 1Q72H 1O0VA 4GAYB 5ERWA 3RWHB 2YKLL 3FO1B 4M5ZH 1U91B 3JVGA 5FO7B 2XQYG 5C09A 3GHEH 5DJ6A 3IGAB 3BGAA 4EJ1C 3P4OA 5C1MB 1K4CA 3D0LA 5DHVA 3U79A 5C07A 1RVFL 2ESVD 1UB6A 1R24A 2WWMC 6FABL 3MRBB 3LEXB 2CKBA 4PG2A 4P9HH 25C8L 4LAJH 5IUSA 5KG9A 3WXWL 4LVHC 5GGVL 2XACC 3REWB 3ULUF 1N6UA 3O3DA 1KJMA 2ZSVB 1KN4L 1IM3B 4U6HB 3T2QA 5C0CD 3EYUL 1WBXA 2VABB 2YWZA 3VI3F 2AJ3A 2FRGP 2GTWA 4JB9L 5IVXA 1RMFL 4LSQH 3FRPA 1M7DA 1B2WH 3FQNA 1U3JA 2Y06H 4GG8B 2EH7H 1U3HB 4I48B 3V8CA 1V3MA 1TVBA 5DMIH 3DVGA 3EFDH 4M6NH 5I9QB 4AK1A 5D96C 1HSBB 2NY2D 1G7QB 4BYHA 4Y5VC 3LHPL 3MNVB 3WKNA 2VLRD 3Q6FA 4IRSD 2DWEB 3KXFA 1OTUC 1JRHL 4PUBH 5DVLA 3IFLL 2ADJB 3MACH 3QEQD 4RFEB 4BQ6A 4OT1L 1RJYA 4HUKB 3PGFL 4ZPTB 3G9AB 1BECA 5IMLB 2G2RB 5HYIA 3H9SB 4PLJC 1T7VA 4ZOCA 3IDMA 3BN3B 3L3JB 4WHYG 2HG5A 1UWEH 5I1AA 3PWLB 4HC1L 4I8DA 4YFDB 1NAKH 5F21B 3SKOA 1QHPA 4APQA 4S0SD 2PF6A 3H7BA 3LKSB 1DN0A 4UUJB 2R39A 5DD5H 5HHQA 3BKYL 1ZT4A 1VERA 4X6CF 4ZAKC 3SBWA 3BP6B 3MV8A 4LP5A 4JFYA 2OL3L 2PW2A 4P46B 2AERT 2LQRA 4F9LA 3MJGX 1MI5E 3MOQA 4YDKH 1AXIB 4NC1E 2J8UF 2FB4L 1WC7A 4RAUB 3OB8A 3HLAA 4UT7H 1C5BL 3N0PB 2Z92A 2NY6C 4TSAL 2CLZB 3BKML 5D1XB 1W0WB 5DA4A 4QT5A 3TV3H 5EUOE 4KROD 5INDB 1T7YA 5BVPH 3BMWA 4RIRB 3NA9L 4IDJL 4MNGB 4U6XA 3CZFB 4CN6A 4ZUUA 5I1GL 4JM2F 3UTTE 1F42A 2WV3A 1U8QB 4EQ2A 3WS6C 4JR9L 1FSKC 3HZVA 3UTSA 1MLBB 4JO3H 5L9DL 3FB5B 2B0SH 4K07A 5F7DA 4LBEB 2BOBA 3VGAB 4KKBD 2XZCL 1A1OA 1FAIL 2BK8A 5A2IH 4I0PD 4M7JL 3T0EA 3GSVB 4ZO7A 5DJDA 1CK0L 4LSRH 4OZIE 3MA7A 3VFRB 3G6DL 3KYKH 4LF3B 3KPPA 1JGVL 4MAUL 4D8PB 2GJJA 4U1KA 4JFHE 5TH2A 1S9WB 4K9EH 2JJTC 1BIIB 1EO8H 1KELL 4WUKH 5C7XH 1IT9H 3GGWA 2GCYA 2XA8H 3LN9A 5C70A 2Q86A 5D2LA 5EZLB 4HUVA 3LKQA 1DVFD 1LO3L 2QQLL 3MLWH 1FO0L 3SKJL 1DQQA 2ESVA 3L5WB 2ZUQC 2F5BL 5DRWB 4PJ5B 5DI8A 4GG6B 4NUGH 5F7WC 2FL5B 1DL7L 2DN7A 1MCHA 3U9UB 1IGTA 3WXVH 5D6CA 1V3LA 2RQ8A 2D7NA 5C0CA 3CDGA 4MDJA 5CJ5A 3D39E 5HD8C 4F15B 1U9KA 1XGQA 1V7MH 2AEPL 3S34H 3PE9A 4X7EC 3MLZL 2XFXB 4JCMA 1IZKA 3RZWA 4GKZB 3ZO0A 4Y5YB 3ZTNL 5FO9B 5IHZB 5DZNA 1IEAA 2Z31C 3HUJB 4G5ZH 3U48A 3UTZA 3WLBB 2WANA 3RU8H 3D1MC 3X12B 5GGUB 4PJCB 2VYRE 1S7WA 3T77A 4UNTA 2XN9B 1G9NL 1GZPB 1OPGL 3VWJC 3U4BH 1P4IL 4IRSA 4RDQG 4ELKB 5IV2B 2ORBL 1R3LB 4HFWA 5F88A 5JPMB 5E99H 1JE6A 3FO9B 2X05A 3SGEI 4LLDB 3QEQA 1KTLB 3C6SB 3DARA 5FGRA 1SVCP 1AQDA 4ZTOH 1KBGH 4P2RE 2FGWL 5EBWA 3BH9B 2PO6B 2ED9A 3W0WE 2H26A 4CRPA 4ODTL 5EOCH 5E8OA 1RURL 1N7ML 5DMYA 1NJ9A 2DJSA 3ZYJA 1VADB 2VQ1A 4NM8H 1KB5L 3IXAA 1DJSA 1I9IH 3ARFC 4LLUA 1IL1A 3EKCA 3IT8D 5I1JH 1RULL 5IVZB 5B22A 2AXFB 1MELA 3U9PH 1DBAL 2R56H 4Y0GA 2XWJB 4JANA 4LLWB 3MJ7B 4ZOAA 4H20H 3EJYD 2HWZH 2K7QA 3PJSB 1WBYA 1U3HC 3C60B 5DWUH 3QI9C 3V5KA 5EC2B 1KCRL 3VG9C 4Z7UA 1S9VB 1KPRA 2W0PA 3WS3A 3RVVC 3WJJA 5JHLL 3JSSA 5A2JH 1OAUH 3P11H 1N0XL 4HX1A 4L3EE 2X9WA 5DLMH 1OTTC 1FGNH 2JELL 3BISA 3ARQA 4XHQA 2V5YA 1UXWA 5DZOA 3QZWB 4GUPA 1YN7A 1I7RB 3I6LE 3PQYE 3VD3A 4I0PA 2CDFB 3MNZB 5J1TC 1Q0YL 3BKCH 4KRPC 1YMMA 4NRYA 3RVUD 1RZKH 4XPGL 3F8UB 1Z5LB 4P3CL 3NCJH 5D7IF 5IMOB 2LU7A 2CKNA 3EDDA 4V1DD 1WEJH 1BEYH 3O6LH 1H8SA 5DD0H 4DK6A 1U95B 4IRJD 2IAND 3G6JE 3CVHA 4PV9A 2DBLL 4QHMA 5DO2C 2IJ0C 2V17L 2V7NB 4X99A 3U0PB 5DYOA 1TENA 1CGYA 1OTSD 3NZ8B 1DVFA 2Z93A 3MV9E 1PSKL 1UA6H 2GYSA 5D1QD 4GKOA 4X80L 1FZOA 1GZQB 1DUYA 4NQXB 3RGVB 1TITA 1E6OL 2EDQA 1AP2A 2R2HA 4QO1A 4X4ME 5D1XC 3KG5A 1A9BA 2OTWB 2UWEA 2HT3D 3BSZL 4QHNB 3WMSA 3DV6A 5E70A 4YPGB 4P4RA 3RY6C 3TIEA 3EFFA 3QDJD 4C83A 3HG1D 1ZE3C 4Z7QE 3WN5A 1QQDB 3TC9A 2DKMA 2WZPD 4PJDE 4YIQA 3RWFA 3CU7A 4Z76A 4D9QE 5K9OB 4OLZL 4L4VD 1NUNB 5GGRA 3VXUB 5I73C 1AKJB 2DTMH 1MCQA 1PEWA 1JP5A 4IOSD 4XNMB 1IQDA 1KFAH 4C56E 2Z35A 2E7MA 1MHCA 2EDXA 2JCCB 1ZHKA 43CAA 4HUWB 2X70B 3VH8G 4NC0B 1GL4B 2V5MA 3QP3A 5IW1A 3TGXA 3PV7A 3OZ9L 1A7NH 2DQEL 1WZMA 4KDTC 4G8IA 2UY6A 5IT2L 1Q9WA 3OAZK 4YUEL 4H25B 4ERSH 5DJYB 3BGMB 2DM2A 4HXAH 4WTWA 5CEYA 5KTEL 3LEVH 2W0FA 1QPXA 1A5FL 3TBVA 4JGMA 3ZE2F 5F7EL 4OLVH 5CJQH 5AYUL 2VAAA 4MQ7B 3GMMA 1PY9A 3VGBA 4M7LT 3EO1A 3PP3K 3ZKXC 1JN6B 4KZDH 4HT1H 5FV2A 2ZKHH 1KPVA 5HJ3A 3CK0L 1JYVA 2DOCA 3CX5J 2NY7H 2EDNA 4M7KH 4LLAA 1JMZA 2EH8H 1L7IL 3S36H 2DJUA 1PG7X 4ZS7H 4OIIH 1T6VN 3JV4A 5TGBA 2DLFL 2YD2A 1QP1A 1A6UH 4PRNB 1OAYH 5ICZA 4XTRC 4XAWH 1VHPA 4F9PC 4XNQB 4JFXB 1CFSA 1WTGT 5EWIL 1HK6A 5CUSH 5ITFB 1ZSDB 2VAJA 2ZCKL 5BV7H 1C1EL 5M95B 3TT1L 2F8VA 3LKRA 3SGDI 1I8LA 1BZ7A 3FOLB 4WENB 3K4AA 4PJIB 4KAQL 3ZE1E 1JHTA 3QO1B 4BQ9A 1MJJA 4HDIA 4LHJB 4D0DA 2LAGB 1DBMH 2QADB 4WHTA 3O3EB 3L3GB 5E00B 4I0CC 3ZDZE 3VH8A 3CNKA 3MLXL 4V1DA 3HFML 4OGAC 5GGVY 4LCUB 4QTIL 1I8IB 3THMH 4OJFL 2X1QA 3O3BA 2IANA 4PJ7E 1L6ZA 5D6DC 1RUPH 3S96A 5AUMA 5I15L 1A6PA 4JLRB 1JGEB 3OB0K 3QULB 3WIFA 4CW1B 1P53A 4NQEB 2EIEA 2RBLA 5D1QA 2X4PB 1MI5D 1EEUA 1DQDH 2CGRL 2VLMD 3W9EA 2J88L 4D0BA 3RWCB 3V0VB 4XP1H 4Z5RB 4ZFGH 1MRFH 4PY7A 3GSQB 4QXWA 3EOBA 1VPOL 4HEPG 2ENSA 1XH3A 1AHWA 3H2WA 4NSKB 2N7AA 3HI5H 5C0FA 3FT3B 3QDJA 4PGEB 32C2A 4U2ZA 5HGAB 3QXWA 4ZTPH 4P5TD 3DIFB 5JPNA 3HG1A 3ILQD 3MLYL 1T2JA 3S5LG 4OCYH 2MKLC 3MRJB 1VACA 4O5LH 1W2KT 2CRZA 3HN3A 2ITCA 1AR1D 3AY4C 4NKOA 2Q20A 4L4VA 2VDQH 4U0RB 1RJZA 7FABL 2YRZA 5IG7A 3CD4A 1LDPL 3ZKMC 2GJZA 4DW2H 4YAQA 4U1MB 3D85D 2A1WH 4QXTA 3RVTC 1LD9B 5CCKH 4WEBH 2EDRA 4NN7B 4X0KB 1FZKA 5EZJB 2JB6B 4KFZC 3HRZB 1PYWA 4EI5B 3HRPA 4ZUTA 1LP9E 4XPFL 4OI7A 5K9QG 3ZE0E 1I8KA 1RK1A 5GGTH 3H9ZA 4CVUA 2IAMB 2MCG1 3ESUF 5F1IB 4ZUWA 4KRNA 1JYXA 3OG6B 3SDXE 4KJQC 4ELME 4BK4A 3CZJA 4UDUB 4M1DH 3BW9A 1MOEA 1S7UB 1C5DB 2LTQB 1MCNA 3CXDL 3F7QA 5FECB 3OTTA 2FZ3B 3M17B 1F45A 2BRQA 4YXHH 4NO3A 1FG9C 1Q0XH 5DQ9A 4RISH 4BA8A 4OI9A 4OCXL 4ISVA 1I1YB 1NAML 4KTEH 2QHRL 4KJWC 4NNYB 1NGPL 1DEEB 2Q7NA 2HT2D 5DVMA 3SO5A 5FF6A 3VFTA 5CLWA 2P5EB 4PJGB 2QJDA 3VDAA 3U0TA 5KS9B 4OQTA 4X4ZA 2G9HB 3EDKA 1YQVH 1EAJA 2YEZA 1XF2B 2MSPA 3HS0A 5DT1L 4XWGH 4QRSB 4TRPL 3U0WH 1J12A 4P3DA 1YPZE 5J6GA 4QXGH 5F7FA 3WD5L 3DRQA 4BSJA 4E9LA 1B0GB 3S5LA 2EDWA 1INQA 3ARGD 1CFQA 3C5JA 3O9WB 2GSIA 2HMIC 3V5HB 4FP8L 2VE6A 3Q6GL 1CT8A 3HCVB 3WIHL 1OGTA 3GSRB 1MIEH 4E41D 1CFTB 5JNYA 2HJLB 1AE6L 1OW0C 2XI9A 1ZANL 2Z4QA 3C6LC 4L8BA 3L5HA 2YD8A 3QQNA 1V05A 1KG0B 3KLAA 4L3CB 2QQQA 1YNLL 3INUH 1IGML 4TTDD 3MBEB 1MFEH 4QF1B 2W60A 5I8OL 2XKNB 3LRSA 1BD2E 3B6SA 3DI3B 2X42A 2E6QA 2XNAB 4DCQB 4JZOB 3SKMB 3OKKA 4I4WA 5E7FA 3UJIH 3NIDF 4HF5H 3RNKB 1P7QD 5LKNA 1MI5A 4B0MM 2A0LC 5EN2B 1LEIA 2E7LC 2KQMA 3CFCL 1D5ZA 4N0YH 3VXNB 4E42A 3HZYA 3RPIA 1ITBB 2DIJA 5EUOA 3QT2A 3ULUL 2DQHL 4LDOB 4OBRA 4AL8H 2Y7QA 2AEQL 2I60L 2FYYB 5ESVB 3TH2T 5I19L 5DF0A 5KANI 5IIEA 4MXVE 2OP4L 4P5TA 5BVJB 2DQGL 4LSVH 4YXKH 3X14B 4XCEB 5E08L 4GKSA 4GW4B 4P49A 2HVJA 1ED3B 3K4DA 4HGWB 3NFNA 1RY7B 2XWTB 4MD4A 4RAHA 4WI2A 5DURD 3KPOB 5FUZH 3ARBB 1QSEB 3F62A 3I6LD 1YEEH 5HYJE 2QKIA 2VR4A 1GGUA 3TYFA 3V6ZA 4ODHH 4PJAF 3V6FA 2XTLA 1RK0B 3D85A 5LCVH 2DAVA 3RX8A 2A77H 1M4KA 5C86A 5E8PB 4DTGL 1E4XI 1KYOK 4YGVB 2GY5A 5IB3B 3JWOC 4PJEA 3UBXB 3LRGA 3OBAA 1XGYL 5CEXA 4NRZB 9CGTA 4LGPB 5B8CB 1K2DA 3HNTH 1EZVX 1QYGH 1DQML 1OSZA 3G5VA 4IIQC 1VGKB 4ONGL 4HLZH 2FLRT 3PGDA 3MRCA 4MHHG 1H3PL 1AD9B 2Q8AL 2HLAA 1J8HE 1S7TA 2X4SA 3U36B 1MF2L 2MMXA 4M6ML 5I8KH 1A7OL 1PJ9A 2ITDA 2H9GB 4JRXB 1TQBB 4PJHB 4R2GB 1CU4L 2VQTA 4JFFE 1MWAB 2AK1L 1NBZA 4XPHL 3BUYA 4PJ9D 5CD5C 4LCIH 4HJJL 1JHLH 2CDGB 2F5AH 4UOJA 5ICYB 4DEPB 4FQIL 1K3IA 5J1AB 3KPLB 1K3ZA 5LVEA 4NQVB 1T0MB 1IILE 3DGGA 4PRBB 2VL5A 3WFHA 4OGXL 1EAPA 3OKNB 4R90H 3V4UL 4HS3B 4KK6D 2OI9C 1I4FA 4ACPA 1HQRA 4TSBH 2WBWB 5HGDB 1OB1A 1JGUH 5EO1A 3SKUD 1VFAB 1F3JB 3QNXA 1WAAE 3O2DL 2IG2H 2R0ZH 5I1HH 3AM8C 2ZCHL 1EEZB 2EE9A 2BY0A 1OY3B 1HNGA 2YKLH 1CXHA 3WHXB 4XHJC 4HULB 6CGTA 1L7TL 3ARGA 4LOUD 2NCMA 1Q9KA 5MHSE 4Q97A 1WZ1L 1ZHBB 4QWWC 4NO0B 1U8HA 2E7CA 1N3NA 3NFPB 4JFQA 3VD5A 2R8SL 2IAMC 1F02I 3MLTA 1YEDA 1U58A 2AJXL 4LCYA 1RVFH 5I18L 1GC1C 3LB6D 4E41A 1VB9A 3LV3B 4H26B 2AKRA 5F7YC 6FABH 2EYRB 5ELIA 2HFFB 3P30L 4X6DB 4YDIL 4LVEA 2M2DA 3WXWH 4FQXB 5GGVH 3IVKB 1NCBL 1A7RL 3RZCD 3MCLL 5E2UH 1K5NA 1OWRM 1KN4H 4TUOA 3R06A 2NLJA 5KSBF 3DURA 1I7ZA 2J12B 3EYUH 4KI5C 5CEZL 3RL2B 3SE9L 2ICWI 4JB9H 2DM7A 1ZKAA 1BBJB 3GK8L 1RMFH 1RHHB 4FQCL 1A7PL 1P7QA 4P57B 3EJZC 1IQWL 2R2CA 4YO0B 2KDGA 3N85L 4X83A 4NBZB 4CVZB 1DZBA 2Q1EA 4LLYB 4GT7A 5JZ7D 3KPNA 5F96L 1IE5A 4RFNB 3QO0B 1QFWL 1ROWA 5AZ2L 3L5IA 4F80A 3LKNA 3RVXC 4DWHA 2BY3A 3LHPH 1YZZA 3NTCH 5FA3B 3QCTL 4QRQA 1MPAL 3MXVL 3GMLB 3NGBC 4O2FB 4XCNB 5F3HB 4JFPB 2EDKA 1JRHH 4XH2B 2P7TB 3IFLH 1G0XA 3K81A 4PJFA 2PXYD 2PN5A 1DDHA 5EO9B 4DKAA 1FN4B 4X9GA 3FRUB 5DD6A 4OT1H 4U1IB 2R2BA 5ALBL 3TO2A 3PGFH 3O3AA 1BWWA 4Z7VF 2WQ8A 3NIGF 2B20A 3KPMA 2Z8RA 3RTQC 3ET9F 3FFCB 4QHUB 5ACLA 4YK4C 2W07A 3GSWB 1JIBA 1IKNC 4G43B 5HY9B 3QBTB 5F72S 3BKYH 3SPVB 3EYQD 3C8HA 4UZGA 4XP6L 2X10A 5K93A 4TNVF 2OL3H 1NGZA 4UIKL 2NY0C 3F7PC 4ENEC 2J8OA 1PBYA 1EZVY 2E9IA 3O8XD 1I8MA 1OD7A 4HQQL 1HCFX 1C5BH 3MV9A 4K55A 2GITA 1KLGA 4OF5A 1ZA3B 4TSAH 1QSFB 3BKMH 3DX9B 1HXYA 2ERJB 4BH8B 5A1AA 1KEGL 3NA9H 4X4MA 4IDJH 2D31B 4LLVB 4U6TA 4PJ9A 5I1GH 1F4XL 5ID0A 1LNUB 1CGXA 4PJBB 4JR9H 1N6QL 1Q9LA 2Q3AA 4DKEL 5L9DH 3O4LB 3FT4B 4OZHE 4KI1A 1PFCA 4GG6E 3VU2A 2XZCH 5D7SL 4OBSA 1FAIH 3MRNA 3RKDC 3BP7B 3QQ4B 4M7JH 4PJDA 5EU7C 5JW4Q 3REVA 2AS5M 1S9YB 1ZMYA 3DX7B 1CK0H 1XGRB 1NFDB 3G6DH 4NDMB 3L9RB 5JLZB 5EOTB 5C0JB 1JGVH 4MAUH 5GRJL 1SY6L 1UG9A 1HHKB 1RUML 3QSKB 2FWOB 4JPWL 1KELH 2F58L 3QWRD 2E8YA 2XIDA 3QH3A 4JKMA 1CDBA 5DJXA 3VGHA 3EYFA 2BNRE 3CDCA 4FMKA 3VI4F 5E4EC 1U92B 3FQWB 1TZIB 1LO3H 2EYSA 2QQLH 1FO0H 3QXUA 4L9LA 3SKJH 4YDJB 4BZ1H 1J86A 2F5BH 3QUMA 4JRYE 4PTTA 2C7UB 1CLZL 5MERB 5FGSA 2OXHA 4HIEB 1DL7H 2R0KL 5TE4L 1FFPB 2NR6D 5JUEL 4LCWE 2BVQB 4O2CA 3KYMA 4PLKD 4R2GC 4NFBA 1C8PA 1NFIB 4N8CL 3B9EA 1OTUD 3WFDL 4PYHA 3RZCA 1UM4L 3QRGH 1NMAL 3MLVL 5FYLE 3CX2A 3AMLA 3T2PA 5F7NC 5AAMA 4ZFZB 5DMKA 3D69A 3IFPA 1JVKA 4FMFA 5HI5D 4F37F 1ZEAL 3MMEA 3MLZH 4KZEL 1PQZA 4X5XB 1YC7A 1S7XA 1F3DH 4NCDA 3ZTNH 1CQKA 1ADQA 3SGKA 5GIRA 1QKZL 5KN5A 4S10A 3T1FB 4OQ1A 1B4JL 4JPKL 4X6FB 1TQCB 4ZAKD 5F89A 1S7VA 1CR9L 3T8XA 4MX7B 3QUZB 3SE8L 4WW2B 1G9NH 1CGUA 1OPGH 3ZDYF 1P4IH 1PGRB 1EFXD 1F3RB 4UIMB 1DQJB 4FQHB 2G60L 2PXYA 2HTLC 2IFFL 3R4DA 5ITBL 4CDHA 1QG3A 4TULL 2V5RA 4N0FA 1U3ZA 4MAYC 1XGTA 1G7IB 3JWDC 3U4AA 4GAJL 2ZG2A 2H3NA 2OQJB 2NXZC 3PNWB 2FGWH 1T1ZB 1MCJA 3MRGA 3QXTA 1MCPL 5FYKE 3VXRE 2O61A 4TSCL 4ODTH 1Q9OA 1INEL 1RURH 3UYPA 1N7MH 3HE6C 5IBTH 3I9GL 4JY6B 1KB5H 2IPKB 2ICWB 2J5LB 4NO5B 2WLYA 1LDSA 4M1CD 1DLHB 1YN6B 4WO4D 1BD2D 1OSPL 1RULH 4EKXA 4X4YA 3BQUD 3OAUL 5DJCA 4LSSL 1A3QA 1DBAH 2GUOB 3O8XA 4JY4A 4XP5L 4IOIB 4MD5B 3KJ4B 3FT2A 4MD0B 2H2SC 1UZ8B 2P8PB 3TBWB 1KCRH 1IAOB 1YQ2A 4RFNC 4KKAC 4G42A 4NZUL 2O5YL 1CQYA 5JHLH 1NDGB 4N0CD 3U4EA 2NY3C 3LKOB 1QSVA 1DQTA 1N0XH 5ACZA 4ZQKB 2OL3B 4OFKA 1J1XL 4RGNC 3HKFA 3OXRA 2JELH 4WDIA 3GMQB 1I7TA 4LGRB 5E8EA 2VDOL 5J6HB 3B9KD 1QO3B 1S5HA 1U8MA 5ANME 1MSPA 1Q0YH 4POZD 4W70A 4HWBA 1B4RA 1H5BA 3FOMB 4RWYL 3T2NL 2CO6B 5HSFA 5HVFB 4KQ4L 4HZLA 4P3CH 3EGSA 5MEQB 1S7QA 3C8KB 3GMNB 2X9XA 4G9DB 5I1IL 4NKDB 1CL7I 1D6VL 4JREC 4PR5B 1TIUA 4HJGA 1RIUL 4N9GA 4UT9L 3R8BB 2DBLH 3QWRA 2V17H 3VXUE 3M1BA 2WBJC 4PTUA 3MJ9A 1VEMA 4KJYA 5C0AE 1PZUB 1A4KB 2I5YL 4GRWH 1PSKH 5GS1C 3IF1B 4NHUA 4X80H 5GXBB 3SDXA 2BVYA 4HK3J 4Y1AE 1E6OH 4Y5VA 4P23B 3HNSL 1HH6B 4JFZL 1E4WL 3DBXA 1D6EA 1OHQA 1IGFL 1R5WB 3BSZH 5BZWA 3S3JA 2DMBA 3O45B 5FB8B 4WIQA 1G1CA 2MHAB 4N90E 2K3TA 1B9ZA 3ZT7A 4X98A 2APTA 1A9EB 2VNCA 3DVIA 5TFSL 3T3PF 2OJEA 4OLZH 1ZWIA 1TJIL 4Q9QL 2A6IB 3BP5B 3MSPA 4PV8A 1EEYA 5JOPE 5AZEL 4PS4L 3F65A 4GSDL 4ZAKA 1T1WB 4QGYA 2Z91B 2DMCA 3OGCA 4F3FA 5GS2D 3OZ9H 1OP5H 4J8RB 2DQEH 2DLHA 4OZGB 1EFXA 5IT2H 4YUEH 2EDFA 3C5ZB 5TDNA 4R6UA 1JZ5A 3GSUA 4N5UA 3OXSB 1U3HD 1HHHA 5I74C 2CO7B 3DX6B 5KTEH 1G7HA 4UU9B 5IEKA 3EHBC 1RZ8B 4XBGB 2OS7A 1A5FH 4ZODA 5F7EH 3G5ZB 4PJXB 3ARDC 5AYUH 1T1XB 3PIQA 4G8EA 1OTTD 2IF7A 4K3DL 4PLNC 4R7DB 1FFQA 1MFAL 2RJMA 3O2VL 3ESVF 5IEHA 2C3XA 4PJIE 5F97E 3S3PA 3LSOB 3QA3A 2VXQL 4CMHB 3CK0H 3GSOA 3LDBB 5FDYA 3G04B 2DL2A 4WO4A 5IKCB 1BD2A 1MFNA 4ODUB 2AJYL 3BQUA 5IW3A 1A6AA 3L95B 4KJPD 1L7IH 4XVUC 4HPOL 2XTJC 3H9SD 3IFNL 5DSCA 5JXEC 3FQUA 4DZBA 4M48L 5TQ0L 4K3HA 4I5BA 5KOMC 2DLFH 1JWMA 4JM4L 1A7QL 4G7YL 3BPCA 5HVGB 1INDL 1U93A 1FVCA 1D5BB 1X5XA 2EKSB 4OF0A 4P46D 5EWIH 5H37G 1GOGA 2ZUUA 4L8SB 2ZCKH 1FG2A 5E9DB 2I9TA 1C1EH 3TT1H 3CUPB 5IM7A 5E94B 1WIPA 3U2SA 5HGHA 3B9KA 5D1XD 1T20A 4KAQH 4Z8FL 3MYZA 1F4YL 1S7SA 4XZUB 3CFKB 3CPLA 3GSNL 4B50A 3L3OA 1PD6A 2BHUA 3PWUB 1WIUA 4YHIB 3MGOA 2I24N 3TZVD 2NX5E 3MLXH 4NRXA 3HFMH 1BJ8A 3CFJA 4Q6IA 1LO5B 4QTIH 4BUHA 3KYOB 4OJFH 4X5WA 3ZZ1A 1L0QA 3MJ8B 1SJEA 1AR2A 1BVZA 3WDJA 3OJDB 2J5LC 3N1GC 4HLJA 5I15H 3VD4A 1J7VR 2PW1A 4RNRA 1RZIA 5JHDB 4XVJL 1AGFB 5EBMB 1G6RA 3QJFA 4BQCA 1T1YB 2JJWA 3IXTA 1YA5A 2CGRH 3VFWB 2J88H 3ZTJH 4P2CG 3OKEB 4R97C 4GAYA 1P84J 3RWHA 1X5ZA 2FCBA 2MFNA 4FFZL 3FO1A 1VPOH 5C08B 1U91A 5FO7A 1RD6A 4WFHD 3IGAA 5MI0B 1PEZA 3B9VA 5DRXB 1BOYA 3K2MC 5C0BE 3MLYH 2CKBL 1VSCA 4PRPB 4PJ5D 2Q7YB 2EC9U 3NPSC 3MRBA 3LEXA 4ORZC 7FABH 3QFDB 1LDPH 3REWA 2YPKB 1F58L 1WAAA 4KI5E 2ZSVA 5D8JL 1IM3A 3BEWB 4U6HA 1J88A 2P5EE 3C8DA 4PJGE 3BPOB 1JWSB 2VABA 4XPFH 4EN3C 1H3WM 1CYGA 4MJIE 3BGFB 3OKDB 2YRPA 4UTBL 2AQ3A 4N9OB 1QACA 1QRNB 4OIBA 2DLGA 4OZIF 4GG8A 2VRAA 1U3HA 2R2EB 4ETQB 4I48A 4Y4HC 5EU3B 5I1KL 3MCG1 3U7AA 2W65B 4M93C 1T2QH 4J3XA 1HSBA 4RA0C 1G7QA 2ZNXA 5T1MB 1EJOH 3MNVA 1TNMA 2XN9D 4OCXH 1NAMH 2DWEA 3MQIA 2QHRH 4UOW1 1GPOL 2CK0L 2ADJA 4F7PB 5J4MA 1NGPH 1U8IB 4RFEA 4MNHB 1NCAL 4OCSL 1AD0B 3CSBA 3ES6B 3LQAC 4ZPTA 1TZGL 2HVKB 5IMLA 2G2RA 2VB5A 3RIFF 4E0RB 3H9SA 2WINB 3RWEB 1OQXA 2VISB 3VXMB 2DQTL 1TFHA 3L3JA 1OAZL 1MVUB 3PWLA 2PO6D 4UUJA 3LKSA 5DT1H 4TRPH 2DQIL 1FORL 4OCWL 3BP6A 3ZSSA 4XC3L 3WD5H 4P46A 4F33B 2AEIT 2IPUG 3BIBX 1FQ9C 2GW5A 2DRUA 2M8XA 2C9AA 1SBSL 2J4WL 3UAJD 3FCTB 4RAUA 2GSGB 3AXLB 4I13B 4FP8H 3RQ3A 3Q6GH 5D1XA 2CLZA 1WF5A 1W0WA 2VZOA 3FQXB 3C60D 5DC0A 4HG4K 4TYUA 5INDA 3T3ME 4RIRA 1FNLA 4MDIB 4KUCD 4MNGA 3CZFA 3VFPB 4UI2A 1R0AL 3RY6A 1AE6H 2IADB 1U8QA 2FIKB 1ZANH 1MLBA 1Z9LA 3FB5A 3MRLB 1YNLH 4D3CL 5EU7E 4LBEA 1IGMH 1T89A 2VDRL 3SE3C 4LKXB 5I8OH 1XF3B 5E0QA 1W72B 4CMHC 3GSVA 4R4NC 4EI6B 2PKDA 2V2TB 2UZXB 3IDNB 4PJ8B 3SDAC 3RVTD 2H6PB 3VFRA 4LQ1A 4LF3A 4UV4L 4D8PA 3TJEL 1S9WA 3CFCH 1BIIA 4JE4B 2H32H 5SWSB 1WTLA 1AJ7L 3WO4B 5IVOA 3ULUH 2Q8BL 2DQHH 2YBRB 3MR9B 3RIFK 1T7XA 2AEQH 2I60H 5I19H 4FG6C 4KMTL 3OHXB 5HTSA 5EZLA 3P77B 2OP4H 1O5DT 3L6FB 2J7LA 3QIBC 4HWZB 2DQGH 4GW5B 3FB7B 4HS8L 5E08H 4AIZB 3L5WA 2XA3A 5E2WH 5DRWA 2YK1L 4PJ5A 1C5CL 4JRXE 3RGVD 4GG6A 5GGQL 2FL5A 3IKKA 2BCKB 5T1LD 1MHEB 5CD3A 4U3XA 4N68A 3U9UA 4DTGH 5ISZB 2Z8VC 2FBJH 4BELD 2Z8WC 5T3ZD 4F57L 4IMKA 1XGYH 3CCHA 2EZ0C 4D2NA 1JPGB 2CDEB 4HIIB 4M00A 1DQMH 2XFXA 4ONGH 1AKJD 4OF3A 3B3IB 4YHYC 4RFOL 4GKZA 4Y5YA