3R0SA

Udp-n-acetylglucosamine acyltransferase from campylobacter jejuni
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
256
structure length
252
Chain Sequence
b'KIHPSAVIEEGAQLGDDVVIEAYAYVSKDAKIGNNVVIKQGARILSDTTIGDHSRVFSYAIVGDIPQDISYKSGVVIGKNATIREFATINSGTAKGDGFTRIGDNAFIMAYCHIAHDCLLGNNIILANNATLAGHVELGDFTVVGGLTPIHQFVKVGEGCMIAGASALSQDIVPFCLAEGNRASIRSLNLVGIRRRFDKDEVDRLSRAFKTLFRQGDLKENAKNLLENQESENVKKMCHFILETKRGIPVYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acylt
publication title UDP-N-acetylglucosamine acyltransferase from Campylobacter jejuni.
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Transferase
total genus 98
structure length 252
sequence length 256
ec nomenclature ec 2.3.1.129: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase.
pdb deposition date 2011-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF13720 Acetyltransf_11 Udp N-acetylglucosamine O-acyltransferase; Domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1180.10 Mainly Alpha Up-down Bundle Udp N-acetylglucosamine O-acyltransferase; Domain 2 Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 3r0sA02
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3r0sA01
3R5BA 2ICXA 3T57A 1XHDA 1T3DA 3GVDA 1Z90A 3NZ2A 1OCXA 4R7PA 1KK5A 2W0WA 3SPTA 3R8YA 5F42A 3DK5A 1FXJA 4DCLA 1J2ZA 5E3PA 4N6BA 2V0JA 3VBPA 4AA7A 1HV9A 3C8VA 3OU9A 2JF3A 3P1BA 4HZCA 1SSQA 3V4EA 2IC7A 3R5AA 3F1XA 4HZDA 3BSYA 4ISXA 2VHEA 4EGGA 2V0IA 4N69A 4J18A 1V67A 4E6UA 2WLFA 3DHOA 3Q1XA 4G3QA 3P47A 3OTMA 2P2OA 3R1WA 4MZUA 2VD4A 1QQ0A 4G3SA 2NPOA 4AAWA 2GGQA 1KK6A 3TK8A 1QRLA 5ADXV 5L6SA 5AFUV 4E1KA 3CJ8A 4M9CA 4MYOA 3R5CA 3VBKA 2Q4JA 3KWEA 4G87A 3KWDA 3D98A 3HSQA 1QRGA 4E75A 1KRRA 4R36A 3D8VA 4M2BA 4EA9A 1MR7A 2IUAA 4H7OA 1KHRA 2ICYA 2WLEA 3BRKX 4M28A 4HUSA 3FS8A 2V0HA 4M99A 2W0VA 3GOSA 3HJJA 3BFPA 3R2WA 1YP3A 3MQHA 3FOQA 3KWCA 2AQ9A 4R37A 1SSMA 1YP2A 3FWWA 2OI6A 3TIOA 1KK4A 3ECTA 3BSSA 2V0LA 3R0SA 4KQLA 4FCEA 1SSTA 3VBIA 4EAAA 4M98A 4HCQA 3VBMA 3EG4A 4EABA 3FSBA 3ST8A 1LXAA 2IU8A 4E6TA 1HM9A 3IXCA 2WLGA 3MC4A 3MQGA 3BXYA 5E3QA 3OW5A 3R3IA 4KNRA 4AC3A 2IU9A 3EEVA 2OI7A 3VBJA 2TDTA 2QIAA 1G97A 4N27A 4KPXA 5DEPA 3OTZA 4HURA 3FSYA 5DG3A 3GUEA 4IHGA 2WLCA 3FSXA 1HM8A 1KQAA 1QREA 2FKOA 2OEFA 4IHHA 5L6VA 1V3WA 2XATA 3TISA 3EH0A 4K6RA 3FSCA 3R3RA 1HM0A 2V0KA 2I5KA 4IHFA 1TDTA 3JQYA 4N6AA 1FWYA 2QKXA 1MRLA 2JF2A 3VBLA 2WLDA 5DEMA 3I3XA 1G95A 5U2KA 4J09A 3R5DA 1QRFA 1YP4A 4G3PA 1XATA 3OUPA 2OI5A 3TDTA 2GGOA 1KRVA 3DJ4A 3VBNA 4EA8A 3IGJA 1KGTA 4KNXA 4EQYA 3I3AA 3SRTA 5ADXU 1KGQA 1THJA 1MR9A 5AFUU 4EA7A 1QRMA 1S80A 3TWDA 3VNPA 4M2AA 3TV0A 1KRUA 5E3RA 3FTTA 4E79A 3BSWA 2OEGA 2QIVX 3PMOA 4KPZA 2RIJA 4MFGA
chains in the Genus database with same CATH superfamily
3R5BA 3GQ7A 2ICXA 3T57A 1XHDA 1T3DA 3GVDA 1Z90A 3NZ2A 1OCXA 4R7PA 1EWWA 1KK5A 2W0WA 3SPTA 3R8YA 5F42A 3DK5A 1FXJA 4DCLA 1J2ZA 5E3PA 4N6BA 2V0JA 3VBPA 4AA7A 1HV9A 3OH2A 3C8VA 3OU9A 2JF3A 3P1BA 4HZCA 1SSQA 3V4EA 2IC7A 3R5AA 3F1XA 4HZDA 3BSYA 4ISXA 2VHEA 4EGGA 2V0IA 4N69A 4J18A 1V67A 4E6UA 2WLFA 3DHOA 3Q1XA 4G3QA 3P47A 3OTMA 2P2OA 3R1WA 4MZUA 1M8NA 2VD4A 1QQ0A 4G3SA 2NPOA 4AAWA 2GGQA 1KK6A 3TK8A 1QRLA 5ADXV 5L6SA 5AFUV 4E1KA 3CJ8A 4M9CA 4MYOA 3R5CA 3VBKA 2Q4JA 3KWEA 4G87A 3KWDA 3D98A 3HSQA 1QRGA 4E75A 1KRRA 4R36A 3D8VA 4M2BA 4EA9A 1MR7A 2IUAA 4H7OA 1KHRA 2ICYA 2WLEA 3BRKX 3GQ8A 4M28A 4HUSA 3FS8A 2V0HA 4M99A 3OH4A 2W0VA 3GOSA 3HJJA 3BFPA 3R2WA 1YP3A 3MQHA 3FOQA 1Z2FA 3KWCA 2AQ9A 4R37A 1SSMA 1YP2A 3FWWA 3OGZA 2OI6A 3TIOA 1KK4A 3ECTA 3BSSA 2V0LA 3R0SA 4KQLA 4FCEA 1SSTA 3VBIA 4EAAA 4M98A 3OH3A 4HCQA 3EG4A 3VBMA 4EABA 3FSBA 3GQ9A 3ST8A 1LXAA 2IU8A 4E6TA 1HM9A 3IXCA 2WLGA 3MC4A 3MQGA 1L0SA 3BXYA 5E3QA 3OW5A 3R3IA 4KNRA 4AC3A 2IU9A 3EEVA 2OI7A 3VBJA 2TDTA 2QIAA 1G97A 4N27A 4KPXA 5DEPA 3OTZA 4HURA 3FSYA 5DG3A 3GUEA 4IHGA 2WLCA 3FSXA 1HM8A 1N4IA 3GQAA 1KQAA 1QREA 2FKOA 2OEFA 4IHHA 5L6VA 1V3WA 2XATA 3TISA 3EH0A 4K6RA 3FSCA 3R3RA 1HM0A 2V0KA 2I5KA 4IHFA 1TDTA 3JQYA 4N6AA 3OH1A 1FWYA 2QKXA 1MRLA 2JF2A 3VBLA 2WLDA 5DEMA 3I3XA 1G95A 3OH0A 5U2KA 4J09A 3SUCA 3R5DA 1QRFA 1YP4A 4G3PA 1XATA 3OUPA 2OI5A 3TDTA 2GGOA 1KRVA 3DJ4A 3VBNA 4EA8A 3IGJA 1KGTA 4KNXA 4EQYA 3I3AA 3SRTA 5ADXU 1KGQA 1THJA 1MR9A 5AFUU 4EA7A 1QRMA 1S80A 3TWDA 3VNPA 4M2AA 3TV0A 1KRUA 5E3RA 3FTTA 4E79A 3BSWA 2OEGA 2QIVX 3PMOA 4KPZA 2RIJA 4MFGA
chains in the Genus database with same CATH topology
3R5BA 2ICXA 3T57A 1XHDA 1T3DA 3GVDA 1Z90A 3NZ2A 1OCXA 4R7PA 1KK5A 2W0WA 3SPTA 3R8YA 5F42A 3DK5A 1FXJA 4DCLA 1J2ZA 5E3PA 4N6BA 2V0JA 3VBPA 4AA7A 1HV9A 3C8VA 3OU9A 2JF3A 3P1BA 4HZCA 1SSQA 3V4EA 2IC7A 3R5AA 3F1XA 4HZDA 3BSYA 4ISXA 2VHEA 4EGGA 2V0IA 4N69A 4J18A 1V67A 4E6UA 2WLFA 3DHOA 3Q1XA 4G3QA 3P47A 3OTMA 2P2OA 3R1WA 4MZUA 2VD4A 1QQ0A 4G3SA 2NPOA 4AAWA 2GGQA 1KK6A 3TK8A 1QRLA 5ADXV 5L6SA 5AFUV 4E1KA 3CJ8A 4M9CA 4MYOA 3R5CA 3VBKA 2Q4JA 3KWEA 4G87A 3KWDA 3D98A 3HSQA 1QRGA 4E75A 1KRRA 4R36A 3D8VA 4M2BA 4EA9A 1MR7A 2IUAA 4H7OA 1KHRA 2ICYA 2WLEA 3BRKX 4M28A 4HUSA 3FS8A 2V0HA 4M99A 2W0VA 3GOSA 3HJJA 3BFPA 3R2WA 1YP3A 3MQHA 3FOQA 3KWCA 2AQ9A 4R37A 1SSMA 1YP2A 3FWWA 2OI6A 3TIOA 1KK4A 3ECTA 3BSSA 2V0LA 3R0SA 4KQLA 4FCEA 1SSTA 3VBIA 4EAAA 4M98A 4HCQA 3VBMA 3EG4A 4EABA 3FSBA 3ST8A 1LXAA 2IU8A 4E6TA 1HM9A 3IXCA 2WLGA 3MC4A 3MQGA 3BXYA 5E3QA 3OW5A 3R3IA 4KNRA 4AC3A 2IU9A 3EEVA 2OI7A 3VBJA 2TDTA 2QIAA 1G97A 4N27A 4KPXA 5DEPA 3OTZA 4HURA 3FSYA 5DG3A 3GUEA 4IHGA 2WLCA 3FSXA 1HM8A 1KQAA 1QREA 2FKOA 2OEFA 4IHHA 5L6VA 1V3WA 2XATA 3TISA 3EH0A 4K6RA 3FSCA 3R3RA 1HM0A 2V0KA 2I5KA 4IHFA 1TDTA 3JQYA 4N6AA 1FWYA 2QKXA 1MRLA 2JF2A 3VBLA 2WLDA 5DEMA 3I3XA 1G95A 5U2KA 4J09A 3R5DA 1QRFA 1YP4A 4G3PA 1XATA 3OUPA 2OI5A 3TDTA 2GGOA 1KRVA 3DJ4A 3VBNA 4EA8A 3IGJA 1KGTA 4KNXA 4EQYA 3I3AA 3SRTA 5ADXU 1KGQA 1THJA 1MR9A 5AFUU 4EA7A 1QRMA 1S80A 3TWDA 3VNPA 4M2AA 3TV0A 1KRUA 5E3RA 3FTTA 4E79A 3BSWA 2OEGA 2QIVX 3PMOA 4KPZA 2RIJA 4MFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R5B A;  2ICX A;  3T57 A;  1XHD A;  1T3D A;  3GVD A;  1Z90 A;  3NZ2 A;  1OCX A;  4R7P A;  1KK5 A;  2W0W A;  3SPT A;  3R8Y A;  5F42 A;  3DK5 A;  1FXJ A;  4DCL A;  1J2Z A;  5E3P A;  4N6B A;  2V0J A;  3VBP A;  4AA7 A;  1HV9 A;  3C8V A;  3OU9 A;  2JF3 A;  3P1B A;  4HZC A;  1SSQ A;  3V4E A;  2IC7 A;  3R5A A;  3F1X A;  4HZD A;  3BSY A;  4ISX A;  2VHE A;  4EGG A;  2V0I A;  4N69 A;  4J18 A;  1V67 A;  4E6U A;  2WLF A;  3DHO A;  3Q1X A;  4G3Q A;  3P47 A;  3OTM A;  2P2O A;  3R1W A;  4MZU A;  2VD4 A;  1QQ0 A;  4G3S A;  2NPO A;  4AAW A;  2GGQ A;  1KK6 A;  3TK8 A;  1QRL A;  5ADX V;  5L6S A;  5AFU V;  4E1K A;  3CJ8 A;  4M9C A;  4MYO A;  3R5C A;  3VBK A;  2Q4J A;  3KWE A;  4G87 A;  3KWD A;  3D98 A;  3HSQ A;  1QRG A;  4E75 A;  1KRR A;  4R36 A;  3D8V A;  4M2B A;  4EA9 A;  1MR7 A;  2IUA A;  4H7O A;  1KHR A;  2ICY A;  2WLE A;  3BRK X;  4M28 A;  4HUS A;  3FS8 A;  2V0H A;  4M99 A;  2W0V A;  3GOS A;  3HJJ A;  3BFP A;  3R2W A;  1YP3 A;  3MQH A;  3FOQ A;  3KWC A;  2AQ9 A;  4R37 A;  1SSM A;  1YP2 A;  3FWW A;  2OI6 A;  3TIO A;  1KK4 A;  3ECT A;  3BSS A;  2V0L A;  3R0S A;  4KQL A;  4FCE A;  1SST A;  3VBI A;  4EAA A;  4M98 A;  4HCQ A;  3VBM A;  3EG4 A;  4EAB A;  3FSB A;  3ST8 A;  1LXA A;  2IU8 A;  4E6T A;  1HM9 A;  3IXC A;  2WLG A;  3MC4 A;  3MQG A;  3BXY A;  5E3Q A;  3OW5 A;  3R3I A;  4KNR A;  4AC3 A;  2IU9 A;  3EEV A;  2OI7 A;  3VBJ A;  2TDT A;  2QIA A;  1G97 A;  4N27 A;  4KPX A;  5DEP A;  3OTZ A;  4HUR A;  3FSY A;  5DG3 A;  3GUE A;  4IHG A;  2WLC A;  3FSX A;  1HM8 A;  1KQA A;  1QRE A;  2FKO A;  2OEF A;  4IHH A;  5L6V A;  1V3W A;  2XAT A;  3TIS A;  3EH0 A;  4K6R A;  3FSC A;  3R3R A;  1HM0 A;  2V0K A;  2I5K A;  4IHF A;  1TDT A;  3JQY A;  4N6A A;  1FWY A;  2QKX A;  1MRL A;  2JF2 A;  3VBL A;  2WLD A;  5DEM A;  3I3X A;  1G95 A;  5U2K A;  4J09 A;  3R5D A;  1QRF A;  1YP4 A;  4G3P A;  1XAT A;  3OUP A;  2OI5 A;  3TDT A;  2GGO A;  1KRV A;  3DJ4 A;  3VBN A;  4EA8 A;  3IGJ A;  1KGT A;  4KNX A;  4EQY A;  3I3A A;  3SRT A;  5ADX U;  1KGQ A;  1THJ A;  1MR9 A;  5AFU U;  4EA7 A;  1QRM A;  1S80 A;  3TWD A;  3VNP A;  4M2A A;  3TV0 A;  1KRU A;  5E3R A;  3FTT A;  4E79 A;  3BSW A;  2OEG A;  2QIV X;  3PMO A;  4KPZ A;  2RIJ A;  4MFG A; 
#chains in the Genus database with same CATH topology
 3R5B A;  3GQ7 A;  2ICX A;  3T57 A;  1XHD A;  1T3D A;  3GVD A;  1Z90 A;  3NZ2 A;  1OCX A;  4R7P A;  1EWW A;  1KK5 A;  2W0W A;  3SPT A;  3R8Y A;  5F42 A;  3DK5 A;  1FXJ A;  4DCL A;  1J2Z A;  5E3P A;  4N6B A;  2V0J A;  3VBP A;  4AA7 A;  1HV9 A;  3OH2 A;  3C8V A;  3OU9 A;  2JF3 A;  3P1B A;  4HZC A;  1SSQ A;  3V4E A;  2IC7 A;  3R5A A;  3F1X A;  4HZD A;  3BSY A;  4ISX A;  2VHE A;  4EGG A;  2V0I A;  4N69 A;  4J18 A;  1V67 A;  4E6U A;  2WLF A;  3DHO A;  3Q1X A;  4G3Q A;  3P47 A;  3OTM A;  2P2O A;  3R1W A;  4MZU A;  1M8N A;  2VD4 A;  1QQ0 A;  4G3S A;  2NPO A;  4AAW A;  2GGQ A;  1KK6 A;  3TK8 A;  1QRL A;  5ADX V;  5L6S A;  5AFU V;  4E1K A;  3CJ8 A;  4M9C A;  4MYO A;  3R5C A;  3VBK A;  2Q4J A;  3KWE A;  4G87 A;  3KWD A;  3D98 A;  3HSQ A;  1QRG A;  4E75 A;  1KRR A;  4R36 A;  3D8V A;  4M2B A;  4EA9 A;  1MR7 A;  2IUA A;  4H7O A;  1KHR A;  2ICY A;  2WLE A;  3BRK X;  3GQ8 A;  4M28 A;  4HUS A;  3FS8 A;  2V0H A;  4M99 A;  3OH4 A;  2W0V A;  3GOS A;  3HJJ A;  3BFP A;  3R2W A;  1YP3 A;  3MQH A;  3FOQ A;  1Z2F A;  3KWC A;  2AQ9 A;  4R37 A;  1SSM A;  1YP2 A;  3FWW A;  3OGZ A;  2OI6 A;  3TIO A;  1KK4 A;  3ECT A;  3BSS A;  2V0L A;  3R0S A;  4KQL A;  4FCE A;  1SST A;  3VBI A;  4EAA A;  4M98 A;  3OH3 A;  4HCQ A;  3EG4 A;  3VBM A;  4EAB A;  3FSB A;  3GQ9 A;  3ST8 A;  1LXA A;  2IU8 A;  4E6T A;  1HM9 A;  3IXC A;  2WLG A;  3MC4 A;  3MQG A;  1L0S A;  3BXY A;  5E3Q A;  3OW5 A;  3R3I A;  4KNR A;  4AC3 A;  2IU9 A;  3EEV A;  2OI7 A;  3VBJ A;  2TDT A;  2QIA A;  1G97 A;  4N27 A;  4KPX A;  5DEP A;  3OTZ A;  4HUR A;  3FSY A;  5DG3 A;  3GUE A;  4IHG A;  2WLC A;  3FSX A;  1HM8 A;  1N4I A;  3GQA A;  1KQA A;  1QRE A;  2FKO A;  2OEF A;  4IHH A;  5L6V A;  1V3W A;  2XAT A;  3TIS A;  3EH0 A;  4K6R A;  3FSC A;  3R3R A;  1HM0 A;  2V0K A;  2I5K A;  4IHF A;  1TDT A;  3JQY A;  4N6A A;  3OH1 A;  1FWY A;  2QKX A;  1MRL A;  2JF2 A;  3VBL A;  2WLD A;  5DEM A;  3I3X A;  1G95 A;  3OH0 A;  5U2K A;  4J09 A;  3SUC A;  3R5D A;  1QRF A;  1YP4 A;  4G3P A;  1XAT A;  3OUP A;  2OI5 A;  3TDT A;  2GGO A;  1KRV A;  3DJ4 A;  3VBN A;  4EA8 A;  3IGJ A;  1KGT A;  4KNX A;  4EQY A;  3I3A A;  3SRT A;  5ADX U;  1KGQ A;  1THJ A;  1MR9 A;  5AFU U;  4EA7 A;  1QRM A;  1S80 A;  3TWD A;  3VNP A;  4M2A A;  3TV0 A;  1KRU A;  5E3R A;  3FTT A;  4E79 A;  3BSW A;  2OEG A;  2QIV X;  3PMO A;  4KPZ A;  2RIJ A;  4MFG A; 
#chains in the Genus database with same CATH homology
 3R5B A;  2ICX A;  3T57 A;  1XHD A;  1T3D A;  3GVD A;  1Z90 A;  3NZ2 A;  1OCX A;  4R7P A;  1KK5 A;  2W0W A;  3SPT A;  3R8Y A;  5F42 A;  3DK5 A;  1FXJ A;  4DCL A;  1J2Z A;  5E3P A;  4N6B A;  2V0J A;  3VBP A;  4AA7 A;  1HV9 A;  3C8V A;  3OU9 A;  2JF3 A;  3P1B A;  4HZC A;  1SSQ A;  3V4E A;  2IC7 A;  3R5A A;  3F1X A;  4HZD A;  3BSY A;  4ISX A;  2VHE A;  4EGG A;  2V0I A;  4N69 A;  4J18 A;  1V67 A;  4E6U A;  2WLF A;  3DHO A;  3Q1X A;  4G3Q A;  3P47 A;  3OTM A;  2P2O A;  3R1W A;  4MZU A;  2VD4 A;  1QQ0 A;  4G3S A;  2NPO A;  4AAW A;  2GGQ A;  1KK6 A;  3TK8 A;  1QRL A;  5ADX V;  5L6S A;  5AFU V;  4E1K A;  3CJ8 A;  4M9C A;  4MYO A;  3R5C A;  3VBK A;  2Q4J A;  3KWE A;  4G87 A;  3KWD A;  3D98 A;  3HSQ A;  1QRG A;  4E75 A;  1KRR A;  4R36 A;  3D8V A;  4M2B A;  4EA9 A;  1MR7 A;  2IUA A;  4H7O A;  1KHR A;  2ICY A;  2WLE A;  3BRK X;  4M28 A;  4HUS A;  3FS8 A;  2V0H A;  4M99 A;  2W0V A;  3GOS A;  3HJJ A;  3BFP A;  3R2W A;  1YP3 A;  3MQH A;  3FOQ A;  3KWC A;  2AQ9 A;  4R37 A;  1SSM A;  1YP2 A;  3FWW A;  2OI6 A;  3TIO A;  1KK4 A;  3ECT A;  3BSS A;  2V0L A;  3R0S A;  4KQL A;  4FCE A;  1SST A;  3VBI A;  4EAA A;  4M98 A;  4HCQ A;  3VBM A;  3EG4 A;  4EAB A;  3FSB A;  3ST8 A;  1LXA A;  2IU8 A;  4E6T A;  1HM9 A;  3IXC A;  2WLG A;  3MC4 A;  3MQG A;  3BXY A;  5E3Q A;  3OW5 A;  3R3I A;  4KNR A;  4AC3 A;  2IU9 A;  3EEV A;  2OI7 A;  3VBJ A;  2TDT A;  2QIA A;  1G97 A;  4N27 A;  4KPX A;  5DEP A;  3OTZ A;  4HUR A;  3FSY A;  5DG3 A;  3GUE A;  4IHG A;  2WLC A;  3FSX A;  1HM8 A;  1KQA A;  1QRE A;  2FKO A;  2OEF A;  4IHH A;  5L6V A;  1V3W A;  2XAT A;  3TIS A;  3EH0 A;  4K6R A;  3FSC A;  3R3R A;  1HM0 A;  2V0K A;  2I5K A;  4IHF A;  1TDT A;  3JQY A;  4N6A A;  1FWY A;  2QKX A;  1MRL A;  2JF2 A;  3VBL A;  2WLD A;  5DEM A;  3I3X A;  1G95 A;  5U2K A;  4J09 A;  3R5D A;  1QRF A;  1YP4 A;  4G3P A;  1XAT A;  3OUP A;  2OI5 A;  3TDT A;  2GGO A;  1KRV A;  3DJ4 A;  3VBN A;  4EA8 A;  3IGJ A;  1KGT A;  4KNX A;  4EQY A;  3I3A A;  3SRT A;  5ADX U;  1KGQ A;  1THJ A;  1MR9 A;  5AFU U;  4EA7 A;  1QRM A;  1S80 A;  3TWD A;  3VNP A;  4M2A A;  3TV0 A;  1KRU A;  5E3R A;  3FTT A;  4E79 A;  3BSW A;  2OEG A;  2QIV X;  3PMO A;  4KPZ A;  2RIJ A;  4MFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...