3R1FA

Crystal structure of a key regulator of virulence in mycobacterium tuberculosis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
TTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRSGNRTNPSGATMAALANFFRIKAAYFTDDEYYEKLDKELQWLCTMRDDGVRRIAQRAHGLPSAAQQKVLDRIDELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title EspR, a key regulator of Mycobacterium tuberculosis virulence, adopts a unique dimeric structure among helix-turn-helix proteins.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords ESX-1 secretion-associated regulator EspR
total genus 33
structure length 123
sequence length 123
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature
pdb deposition date 2011-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3r1fA00
4X4GA 2KZ8A 3LFPA 1E3OC 4YBAA 1ZZBA 2LYJA 3F6WA 2KEKA 1YSEA 4PU4C 2KEJA 1JFTA 3JXDL 1IC8A 1HF0A 5A7LA 3OP9A 1QQAA 1QPZA 3ZHMA 1ZZCA 2KPJA 4GHJA 4YG4A 1PNRA 2PUAA 3CROL 4JQDA 2KEIA 2IVGA 2AW6A 2A6CA 3CECA 1UXCA 3DNVB 3BDNA 1QP4A 3QYXA 2B5AA 2MEZA 3O9XA 3KXAA 1BDHA 2L49A 1ZUGA 2XCJA 3BD1A 2R1JL 4YG1A 3FMYA 2ICPA 3EUSA 3KZ3A 4IVZA 4Z5HA 4OB4A 3MLFA 3UFDA 2LYKA 4FN3A 3S8QA 2IU7A 3D1NI 2O49A 3FYMA 3F52A 1Y7YA 4Z58A 4X4CA 1R69A 2PUBA 1R63A 3R1FA 4X4HA 2CSFA 3JXCL 3FYAA 1QQBA 5K98B 1ZZ6A 2XJ3A 2XSDC 2PUEA 3F51A 1BDIA 2PUCA 3HZIB 1RZRA 3U3WA 1ZZ9A 3BS3A 1JFSA 2LYSA 1ZAYA 2AXUA 1NEQA 4Z5DA 2AXZA 4Y42A 2OR1L 4MCTA 2PIJA 3SCHA 2XI8A 3L1PA 1SQ8A 4F8DA 1X2LA 1O4XA 2D5VA 3G7DA 3GN5A 1CQTA 2HSGA 1ZS4A 2EF8A 2LYPA 3B7HA 1PRVA 2MQKA 4JCYA 4MCXA 1WH6A 2AXVA 2XIUA 3QQ6A 1UTXA 1Y9QA 1EFAA 1OSLA 2L8NA 3PXPA 2LYLA 2LYQA 2WIUB 3IVPA 1WETA 1WH8A 2BNMA 1S7EA 2JCGA 2CROA 3QF3A 3VK0A 1LLIA 2GRLA 3KJXA 2H8RA 2PUDA 2BNOA 2BJCA 1JWLA 1QP0A 4YG7B 2EWTA 1LCDA 3OQMA 2O38A 3GN5B 4X4EA 1LCCA 1JH9A 3GBFA 1PRAA 2LCVA 3ZKCA 2IUOA 3CLCA 1ZZ7A 1ADRA 2PUGA 4IWRA 2ICTA 3G5GA 1L1MA 2JVLA 2O4AA 1DW9A 2BNNA 1UXDA 2PPXA 4J1WA 3QWGA 4X4IA 2AWIA 1GT0C 1ZVVA 1LQCA 4I8TA 2AUWA 4X4DA 1OCTC 1DWKA 4J1XA 1POUA 2IVQA 4FBIA 3ZHIA 4PU3C 4JCXA 3OQOA 1RPEL 1RZRD 2R63A 3TRBA 1QP7A 1NERA 2EBYA 3H5TA 4IA8A 1X57A 3JXBC 2GRMA 2IVBA 3SCGA 2FJRA 2PUFA 3LISA 4Z5CA 4O8BA 2WUSR 2OFYA 4Z59A 4X4FA 1VPWA 1ZZ8A 2IV1A 4I6UA 4NDWA 2LYRA 3OQNA 3RZZA 4I6TA 1CJGA 4I6RA 1PERL 4GQMA 2HINA 1RIOA 2PE5A 1LMB3 1WIZA 1ZPQA 1XWRA 3OMTA 1AU7A 1PRUA 4X4BA 1RZSA 4PU8A 4PU7A 4YARA 1B0NA 2GZUA 3SCFA
chains in the Genus database with same CATH superfamily
1E3OC 3SR4A 3F6WA 1YSEA 1IC8A 3ZHMA 4JQDA 1MFQC 2IVGA 2AW6A 3CECA 3ME5A 1UXCA 5DRYA 2B5AA 2MEZA 2R1JL 4YG1A 3FMYA 5DTRA 4IVZA 2PXKA 3D1NI 2O49A 3SX0A 4Z58A 1R69A 2PUBA 2CSFA 1JFSA 3OWQA 2LYSA 4Y42A 2HCNA 2PIJA 1SQ8A 2D5VA 3GN5A 2LYPA 2MQKA 4JCYA 4MCXA 3ZPXA 2XXPA 3QQ6A 1NW3A 2L8NA 1OSLA 2LYLA 1S7EA 1LLIA 3KJXA 2H8RA 2BNOA 4YG7B 2EWTA 3GZCA 1LCDA 1U2ZA 1LCCA 1JH9A 3GBFA 2LCVA 3CLCA 2PXLA 2O4AA 4EZIA 4X4IA 4I8TA 1OCTC 4J1XA 4JCXA 1RPEL 3KL4A 1NERA 3H5TA 1X57A 3JXBC 2IVBA 2FJRA 4Z59A 1ZVVA 4I6RA 4EQZA 3UWPA 4X4BA 2XXQA 2KEKA 2KEJA 4DE8A 1HF0A 2XXAA 1PNRA 4GHJA 1ZUGA 2ICPA 3MLFA 4FN3A 3F52A 1R63A 4X4HA 5DTQA 1QQBA 2LLWA 2PUEA 2PUCA 3HZIB 1RZRA 1ZZ9A 2AXUA 4Z5DA 3A9ZA 2XI8A 4F8DA 1O4XA 3G7DA 2ODRD 3B7HA 4EKIA 1WH6A 2XIUA 1UTXA 1EFAA 3PXPA 2LYQA 1WH8A 2BNMA 1HQ1A 2CROA 2J7WA 3VK0A 3LQXA 1QB2A 2O38A 3GN5B 3TEPA 1PRAA 3ZKCA 2IUOA 5DSXA 4IWRA 4OBMA 4HRAA 4J1WA 2AWIA 3A9YA 1GT0C 1LQCA 1POUA 2IVQA 2PXTA 3A9XA 5DRTA 3R09A 3NROA 2PXFA 2R63A 3TRBA 4IA8A 5GAGi 2GRMA 2PXPA 4EKGA 4X4FA 2IV1A 4I6UA 3RZZA 1PERL 3OMTA 4DE9A 1AU7A 1RZSA 4PU8A 1B0NA 2KZ8A 3LFPA 4YBAA 1JFTA 2LYJA 4PU4C 1QPZA 3JXDL 3OP9A 4YG4A 3CROL 3DNVB 1QP4A 3QYXA 2L49A 2FFHA 3EUSA 1DULA 4OB4A 3S8QA 2YBDA 3GZDA 2IU7A 2HCSA 1Y7YA 4X4CA 3R1FA 3JXCL 3FYAA 5K98B 1ZZ6A 2XSDC 4WVLA 3F51A 1BDIA 3U3WA 3BS3A 3QFIA 3GZDC 4MCTA 3L1PA 1CQTA 2EF8A 2AXVA 1Y9QA 3IVPA 2WIUB 2MXDA 2JCGA 4ER6A 3QF3A 3DM5A 1JWLA 1QP0A 4Q2JA 4X4EA 3NDBB 3TFLA 1ZZ7A 2J7UA 2ICTA 1L1MA 1DW9A 2BNNA 4ER5A 5GAHi 3M9LA 2PXUA 3SCGA 3TELA 2PXBA 4O8BA 2WUSR 2OFYA 1ZZ8A 4NDWA 2LYRA 1CJGA 1LMB3 1RIOA 2PE5A 1ZPQA 1XWRA 1PRUA 4ER0A 4YARA 4PU7A 1ZS4A 4X4GA 1ZZBA 3OKZA 1QQAA 2PXEA 5A7LA 1ZZCA 2KPJA 2PUAA 2KEIA 2A6CA 3BDNA 1BDHA 3O9XA 3KXAA 3BD1A 3GUUA 2XCJA 3KZ3A 3UFDA 4Z5HA 3G0TA 2LYKA 5JUWA 3FYMA 2JQEA 2VEOA 2HFZA 3QOXA 3QOWA 2XJ3A 2L1PA 1ZAYA 1NEQA 3NXHA 2AXZA 2OR1L 3SCHA 1X2LA 2HSGA 2PXDA 1PRVA 2LNMA 1WETA 2LLVA 2GRLA 2BJCA 2V3CC 2PXQA 3OQMA 5DT2A 3PE5A 1ADRA 2PUGA 3G5GA 4EK9A 2JVLA 3NZLA 1UXDA 2PPXA 3QWGA 4ER3A 2M4HA 2AUWA 1QZXA 4X4DA 1DWKA 4PU3C 4FBIA 3ZHIA 3OQOA 1RZRD 1QP7A 3MEJA 2EBYA 2PUFA 3LISA 4Z5CA 2PXVA 1VPWA 2PUDA 3OQNA 5DTMA 4I6TA 4GQMA 2HINA 1WIZA 4ER7A 3VWSA 2GZUA 3SCFA
chains in the Genus database with same CATH topology
4X4GA 2KZ8A 3LFPA 1E3OC 4YBAA 1ZZBA 2LYJA 3F6WA 2KEKA 1YSEA 4PU4C 2KEJA 1JFTA 3JXDL 1IC8A 1HF0A 5A7LA 3OP9A 1QQAA 1QPZA 3ZHMA 1ZZCA 2KPJA 4GHJA 4YG4A 1PNRA 2PUAA 3CROL 4JQDA 2KEIA 2IVGA 2AW6A 2A6CA 3CECA 1UXCA 3DNVB 3BDNA 1QP4A 3QYXA 2B5AA 2MEZA 3O9XA 3KXAA 1BDHA 2L49A 1ZUGA 2XCJA 3BD1A 2R1JL 4YG1A 3FMYA 2ICPA 3EUSA 3KZ3A 4IVZA 4Z5HA 4OB4A 3MLFA 3UFDA 2LYKA 4FN3A 3S8QA 2IU7A 3D1NI 2O49A 3FYMA 3F52A 1Y7YA 4Z58A 4X4CA 1R69A 2PUBA 1R63A 3R1FA 4X4HA 2CSFA 3JXCL 3FYAA 1QQBA 5K98B 1ZZ6A 2XJ3A 2XSDC 2PUEA 3F51A 1BDIA 2PUCA 3HZIB 1RZRA 3U3WA 1ZZ9A 3BS3A 1JFSA 2LYSA 1ZAYA 2AXUA 1NEQA 4Z5DA 2AXZA 4Y42A 2OR1L 4MCTA 2PIJA 3SCHA 2XI8A 3L1PA 1SQ8A 4F8DA 1X2LA 1O4XA 2D5VA 3G7DA 3GN5A 1CQTA 2HSGA 1ZS4A 2EF8A 2LYPA 3B7HA 1PRVA 2MQKA 4JCYA 4MCXA 1WH6A 2AXVA 2XIUA 3QQ6A 1UTXA 1Y9QA 1EFAA 1OSLA 2L8NA 3PXPA 2LYLA 2LYQA 2WIUB 3IVPA 1WETA 1WH8A 2BNMA 1S7EA 2JCGA 2CROA 3QF3A 3VK0A 1LLIA 2GRLA 3KJXA 2H8RA 2PUDA 2BNOA 2BJCA 1JWLA 1QP0A 4YG7B 2EWTA 1LCDA 3OQMA 2O38A 3GN5B 4X4EA 1LCCA 1JH9A 3GBFA 1PRAA 2LCVA 3ZKCA 2IUOA 3CLCA 1ZZ7A 1ADRA 2PUGA 4IWRA 2ICTA 3G5GA 1L1MA 2JVLA 2O4AA 1DW9A 2BNNA 1UXDA 2PPXA 4J1WA 3QWGA 4X4IA 2AWIA 1GT0C 1ZVVA 1LQCA 4I8TA 2AUWA 4X4DA 1OCTC 1DWKA 4J1XA 1POUA 2IVQA 4FBIA 3ZHIA 4PU3C 4JCXA 3OQOA 1RPEL 1RZRD 2R63A 3TRBA 1QP7A 1NERA 2EBYA 3H5TA 4IA8A 1X57A 3JXBC 2GRMA 2IVBA 3SCGA 2FJRA 2PUFA 3LISA 4Z5CA 4O8BA 2WUSR 2OFYA 4Z59A 4X4FA 1VPWA 1ZZ8A 2IV1A 4I6UA 4NDWA 2LYRA 3OQNA 3RZZA 4I6TA 1CJGA 4I6RA 1PERL 4GQMA 2HINA 1RIOA 2PE5A 1LMB3 1WIZA 1ZPQA 1XWRA 3OMTA 1AU7A 1PRUA 4X4BA 1RZSA 4PU8A 4PU7A 4YARA 1B0NA 2GZUA 3SCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X4G A;  2KZ8 A;  3LFP A;  1E3O C;  4YBA A;  1ZZB A;  2LYJ A;  3F6W A;  2KEK A;  1YSE A;  4PU4 C;  2KEJ A;  1JFT A;  3JXD L;  1IC8 A;  1HF0 A;  5A7L A;  3OP9 A;  1QQA A;  1QPZ A;  3ZHM A;  1ZZC A;  2KPJ A;  4GHJ A;  4YG4 A;  1PNR A;  2PUA A;  3CRO L;  4JQD A;  2KEI A;  2IVG A;  2AW6 A;  2A6C A;  3CEC A;  1UXC A;  3DNV B;  3BDN A;  1QP4 A;  3QYX A;  2B5A A;  2MEZ A;  3O9X A;  3KXA A;  1BDH A;  2L49 A;  1ZUG A;  2XCJ A;  3BD1 A;  2R1J L;  4YG1 A;  3FMY A;  2ICP A;  3EUS A;  3KZ3 A;  4IVZ A;  4Z5H A;  4OB4 A;  3MLF A;  3UFD A;  2LYK A;  4FN3 A;  3S8Q A;  2IU7 A;  3D1N I;  2O49 A;  3FYM A;  3F52 A;  1Y7Y A;  4Z58 A;  4X4C A;  1R69 A;  2PUB A;  1R63 A;  3R1F A;  4X4H A;  2CSF A;  3JXC L;  3FYA A;  1QQB A;  5K98 B;  1ZZ6 A;  2XJ3 A;  2XSD C;  2PUE A;  3F51 A;  1BDI A;  2PUC A;  3HZI B;  1RZR A;  3U3W A;  1ZZ9 A;  3BS3 A;  1JFS A;  2LYS A;  1ZAY A;  2AXU A;  1NEQ A;  4Z5D A;  2AXZ A;  4Y42 A;  2OR1 L;  4MCT A;  2PIJ A;  3SCH A;  2XI8 A;  3L1P A;  1SQ8 A;  4F8D A;  1X2L A;  1O4X A;  2D5V A;  3G7D A;  3GN5 A;  1CQT A;  2HSG A;  1ZS4 A;  2EF8 A;  2LYP A;  3B7H A;  1PRV A;  2MQK A;  4JCY A;  4MCX A;  1WH6 A;  2AXV A;  2XIU A;  3QQ6 A;  1UTX A;  1Y9Q A;  1EFA A;  1OSL A;  2L8N A;  3PXP A;  2LYL A;  2LYQ A;  2WIU B;  3IVP A;  1WET A;  1WH8 A;  2BNM A;  1S7E A;  2JCG A;  2CRO A;  3QF3 A;  3VK0 A;  1LLI A;  2GRL A;  3KJX A;  2H8R A;  2PUD A;  2BNO A;  2BJC A;  1JWL A;  1QP0 A;  4YG7 B;  2EWT A;  1LCD A;  3OQM A;  2O38 A;  3GN5 B;  4X4E A;  1LCC A;  1JH9 A;  3GBF A;  1PRA A;  2LCV A;  3ZKC A;  2IUO A;  3CLC A;  1ZZ7 A;  1ADR A;  2PUG A;  4IWR A;  2ICT A;  3G5G A;  1L1M A;  2JVL A;  2O4A A;  1DW9 A;  2BNN A;  1UXD A;  2PPX A;  4J1W A;  3QWG A;  4X4I A;  2AWI A;  1GT0 C;  1ZVV A;  1LQC A;  4I8T A;  2AUW A;  4X4D A;  1OCT C;  1DWK A;  4J1X A;  1POU A;  2IVQ A;  4FBI A;  3ZHI A;  4PU3 C;  4JCX A;  3OQO A;  1RPE L;  1RZR D;  2R63 A;  3TRB A;  1QP7 A;  1NER A;  2EBY A;  3H5T A;  4IA8 A;  1X57 A;  3JXB C;  2GRM A;  2IVB A;  3SCG A;  2FJR A;  2PUF A;  3LIS A;  4Z5C A;  4O8B A;  2WUS R;  2OFY A;  4Z59 A;  4X4F A;  1VPW A;  1ZZ8 A;  2IV1 A;  4I6U A;  4NDW A;  2LYR A;  3OQN A;  3RZZ A;  4I6T A;  1CJG A;  4I6R A;  1PER L;  4GQM A;  2HIN A;  1RIO A;  2PE5 A;  1LMB 3;  1WIZ A;  1ZPQ A;  1XWR A;  3OMT A;  1AU7 A;  1PRU A;  4X4B A;  1RZS A;  4PU8 A;  4PU7 A;  4YAR A;  1B0N A;  2GZU A;  3SCF A; 
#chains in the Genus database with same CATH topology
 1E3O C;  3SR4 A;  3F6W A;  1YSE A;  1IC8 A;  3ZHM A;  4JQD A;  1MFQ C;  2IVG A;  2AW6 A;  3CEC A;  3ME5 A;  1UXC A;  5DRY A;  2B5A A;  2MEZ A;  2R1J L;  4YG1 A;  3FMY A;  5DTR A;  4IVZ A;  2PXK A;  3D1N I;  2O49 A;  3SX0 A;  4Z58 A;  1R69 A;  2PUB A;  2CSF A;  1JFS A;  3OWQ A;  2LYS A;  4Y42 A;  2HCN A;  2PIJ A;  1SQ8 A;  2D5V A;  3GN5 A;  2LYP A;  2MQK A;  4JCY A;  4MCX A;  3ZPX A;  2XXP A;  3QQ6 A;  1NW3 A;  2L8N A;  1OSL A;  2LYL A;  1S7E A;  1LLI A;  3KJX A;  2H8R A;  2BNO A;  4YG7 B;  2EWT A;  3GZC A;  1LCD A;  1U2Z A;  1LCC A;  1JH9 A;  3GBF A;  2LCV A;  3CLC A;  2PXL A;  2O4A A;  4EZI A;  4X4I A;  4I8T A;  1OCT C;  4J1X A;  4JCX A;  1RPE L;  3KL4 A;  1NER A;  3H5T A;  1X57 A;  3JXB C;  2IVB A;  2FJR A;  4Z59 A;  1ZVV A;  4I6R A;  4EQZ A;  3UWP A;  4X4B A;  2XXQ A;  2KEK A;  2KEJ A;  4DE8 A;  1HF0 A;  2XXA A;  1PNR A;  4GHJ A;  1ZUG A;  2ICP A;  3MLF A;  4FN3 A;  3F52 A;  1R63 A;  4X4H A;  5DTQ A;  1QQB A;  2LLW A;  2PUE A;  2PUC A;  3HZI B;  1RZR A;  1ZZ9 A;  2AXU A;  4Z5D A;  3A9Z A;  2XI8 A;  4F8D A;  1O4X A;  3G7D A;  2ODR D;  3B7H A;  4EKI A;  1WH6 A;  2XIU A;  1UTX A;  1EFA A;  3PXP A;  2LYQ A;  1WH8 A;  2BNM A;  1HQ1 A;  2CRO A;  2J7W A;  3VK0 A;  3LQX A;  1QB2 A;  2O38 A;  3GN5 B;  3TEP A;  1PRA A;  3ZKC A;  2IUO A;  5DSX A;  4IWR A;  4OBM A;  4HRA A;  4J1W A;  2AWI A;  3A9Y A;  1GT0 C;  1LQC A;  1POU A;  2IVQ A;  2PXT A;  3A9X A;  5DRT A;  3R09 A;  3NRO A;  2PXF A;  2R63 A;  3TRB A;  4IA8 A;  5GAG i;  2GRM A;  2PXP A;  4EKG A;  4X4F A;  2IV1 A;  4I6U A;  3RZZ A;  1PER L;  3OMT A;  4DE9 A;  1AU7 A;  1RZS A;  4PU8 A;  1B0N A;  2KZ8 A;  3LFP A;  4YBA A;  1JFT A;  2LYJ A;  4PU4 C;  1QPZ A;  3JXD L;  3OP9 A;  4YG4 A;  3CRO L;  3DNV B;  1QP4 A;  3QYX A;  2L49 A;  2FFH A;  3EUS A;  1DUL A;  4OB4 A;  3S8Q A;  2YBD A;  3GZD A;  2IU7 A;  2HCS A;  1Y7Y A;  4X4C A;  3R1F A;  3JXC L;  3FYA A;  5K98 B;  1ZZ6 A;  2XSD C;  4WVL A;  3F51 A;  1BDI A;  3U3W A;  3BS3 A;  3QFI A;  3GZD C;  4MCT A;  3L1P A;  1CQT A;  2EF8 A;  2AXV A;  1Y9Q A;  3IVP A;  2WIU B;  2MXD A;  2JCG A;  4ER6 A;  3QF3 A;  3DM5 A;  1JWL A;  1QP0 A;  4Q2J A;  4X4E A;  3NDB B;  3TFL A;  1ZZ7 A;  2J7U A;  2ICT A;  1L1M A;  1DW9 A;  2BNN A;  4ER5 A;  5GAH i;  3M9L A;  2PXU A;  3SCG A;  3TEL A;  2PXB A;  4O8B A;  2WUS R;  2OFY A;  1ZZ8 A;  4NDW A;  2LYR A;  1CJG A;  1LMB 3;  1RIO A;  2PE5 A;  1ZPQ A;  1XWR A;  1PRU A;  4ER0 A;  4YAR A;  4PU7 A;  1ZS4 A;  4X4G A;  1ZZB A;  3OKZ A;  1QQA A;  2PXE A;  5A7L A;  1ZZC A;  2KPJ A;  2PUA A;  2KEI A;  2A6C A;  3BDN A;  1BDH A;  3O9X A;  3KXA A;  3BD1 A;  3GUU A;  2XCJ A;  3KZ3 A;  3UFD A;  4Z5H A;  3G0T A;  2LYK A;  5JUW A;  3FYM A;  2JQE A;  2VEO A;  2HFZ A;  3QOX A;  3QOW A;  2XJ3 A;  2L1P A;  1ZAY A;  1NEQ A;  3NXH A;  2AXZ A;  2OR1 L;  3SCH A;  1X2L A;  2HSG A;  2PXD A;  1PRV A;  2LNM A;  1WET A;  2LLV A;  2GRL A;  2BJC A;  2V3C C;  2PXQ A;  3OQM A;  5DT2 A;  3PE5 A;  1ADR A;  2PUG A;  3G5G A;  4EK9 A;  2JVL A;  3NZL A;  1UXD A;  2PPX A;  3QWG A;  4ER3 A;  2M4H A;  2AUW A;  1QZX A;  4X4D A;  1DWK A;  4PU3 C;  4FBI A;  3ZHI A;  3OQO A;  1RZR D;  1QP7 A;  3MEJ A;  2EBY A;  2PUF A;  3LIS A;  4Z5C A;  2PXV A;  1VPW A;  2PUD A;  3OQN A;  5DTM A;  4I6T A;  4GQM A;  2HIN A;  1WIZ A;  4ER7 A;  3VWS A;  2GZU A;  3SCF A; 
#chains in the Genus database with same CATH homology
 4X4G A;  2KZ8 A;  3LFP A;  1E3O C;  4YBA A;  1ZZB A;  2LYJ A;  3F6W A;  2KEK A;  1YSE A;  4PU4 C;  2KEJ A;  1JFT A;  3JXD L;  1IC8 A;  1HF0 A;  5A7L A;  3OP9 A;  1QQA A;  1QPZ A;  3ZHM A;  1ZZC A;  2KPJ A;  4GHJ A;  4YG4 A;  1PNR A;  2PUA A;  3CRO L;  4JQD A;  2KEI A;  2IVG A;  2AW6 A;  2A6C A;  3CEC A;  1UXC A;  3DNV B;  3BDN A;  1QP4 A;  3QYX A;  2B5A A;  2MEZ A;  3O9X A;  3KXA A;  1BDH A;  2L49 A;  1ZUG A;  2XCJ A;  3BD1 A;  2R1J L;  4YG1 A;  3FMY A;  2ICP A;  3EUS A;  3KZ3 A;  4IVZ A;  4Z5H A;  4OB4 A;  3MLF A;  3UFD A;  2LYK A;  4FN3 A;  3S8Q A;  2IU7 A;  3D1N I;  2O49 A;  3FYM A;  3F52 A;  1Y7Y A;  4Z58 A;  4X4C A;  1R69 A;  2PUB A;  1R63 A;  3R1F A;  4X4H A;  2CSF A;  3JXC L;  3FYA A;  1QQB A;  5K98 B;  1ZZ6 A;  2XJ3 A;  2XSD C;  2PUE A;  3F51 A;  1BDI A;  2PUC A;  3HZI B;  1RZR A;  3U3W A;  1ZZ9 A;  3BS3 A;  1JFS A;  2LYS A;  1ZAY A;  2AXU A;  1NEQ A;  4Z5D A;  2AXZ A;  4Y42 A;  2OR1 L;  4MCT A;  2PIJ A;  3SCH A;  2XI8 A;  3L1P A;  1SQ8 A;  4F8D A;  1X2L A;  1O4X A;  2D5V A;  3G7D A;  3GN5 A;  1CQT A;  2HSG A;  1ZS4 A;  2EF8 A;  2LYP A;  3B7H A;  1PRV A;  2MQK A;  4JCY A;  4MCX A;  1WH6 A;  2AXV A;  2XIU A;  3QQ6 A;  1UTX A;  1Y9Q A;  1EFA A;  1OSL A;  2L8N A;  3PXP A;  2LYL A;  2LYQ A;  2WIU B;  3IVP A;  1WET A;  1WH8 A;  2BNM A;  1S7E A;  2JCG A;  2CRO A;  3QF3 A;  3VK0 A;  1LLI A;  2GRL A;  3KJX A;  2H8R A;  2PUD A;  2BNO A;  2BJC A;  1JWL A;  1QP0 A;  4YG7 B;  2EWT A;  1LCD A;  3OQM A;  2O38 A;  3GN5 B;  4X4E A;  1LCC A;  1JH9 A;  3GBF A;  1PRA A;  2LCV A;  3ZKC A;  2IUO A;  3CLC A;  1ZZ7 A;  1ADR A;  2PUG A;  4IWR A;  2ICT A;  3G5G A;  1L1M A;  2JVL A;  2O4A A;  1DW9 A;  2BNN A;  1UXD A;  2PPX A;  4J1W A;  3QWG A;  4X4I A;  2AWI A;  1GT0 C;  1ZVV A;  1LQC A;  4I8T A;  2AUW A;  4X4D A;  1OCT C;  1DWK A;  4J1X A;  1POU A;  2IVQ A;  4FBI A;  3ZHI A;  4PU3 C;  4JCX A;  3OQO A;  1RPE L;  1RZR D;  2R63 A;  3TRB A;  1QP7 A;  1NER A;  2EBY A;  3H5T A;  4IA8 A;  1X57 A;  3JXB C;  2GRM A;  2IVB A;  3SCG A;  2FJR A;  2PUF A;  3LIS A;  4Z5C A;  4O8B A;  2WUS R;  2OFY A;  4Z59 A;  4X4F A;  1VPW A;  1ZZ8 A;  2IV1 A;  4I6U A;  4NDW A;  2LYR A;  3OQN A;  3RZZ A;  4I6T A;  1CJG A;  4I6R A;  1PER L;  4GQM A;  2HIN A;  1RIO A;  2PE5 A;  1LMB 3;  1WIZ A;  1ZPQ A;  1XWR A;  3OMT A;  1AU7 A;  1PRU A;  4X4B A;  1RZS A;  4PU8 A;  4PU7 A;  4YAR A;  1B0N A;  2GZU A;  3SCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...