3R1LA

Crystal structure of the class i ligase ribozyme-substrate preligation complex, c47u mutant, mg2+ bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
b'RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title The structural basis of RNA-catalyzed RNA polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 22
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3r1lA00
2NLWA 1SJRA 2EK1A 1HL6A 3MDFA 3ULHA 2JVRA 2DNLA 3N9UC 3LPYA 3R1HA 4IO9Q 1W2BR 3G9CA 3H2VE 4WFNQ 1U6BA 2CQ4A 2YTCA 4W92B 1K9MT 1WELA 5DDQC 1VQ8S 2L08A 2LMIA 3MD1A 2ADCA 2M2BA 1SJFA 1VQ6S 1OPIA 5FJ4A 5CXTA 2DNOA 3DLLQ 2MQLA 2GO9A 4ZKAA 2MB0B 2CQHA 3P49B 2DISA 5JVHQ 2M4MA 4RU2A 1DRZA 2L41A 2MKCA 2CQGA 3PIOQ 2LXIA 1FT8A 1VQNS 3NNHA 2RQCA 2DGSA 1FO1A 2N82B 4YOEA 3I56S 5DDPC 1URNA 3VAKA 3RW6A 3P5TL 4J5OA 1WHXA 2MZTA 3G6ES 5ITHA 1U1LA 2VOOA 2DITA 2E5HA 2G4BA 1M5OC 2J0SD 2OSRA 3BO4A 1ZZFA 2DNNA 1H6KX 4FXWA 2KM8C 3L3CA 2ZJQQ 2YH1A 2JX2A 3CXCR 2M88A 3RW7A 4TU8A 4CIOA 3CCJS 2JVOA 1M5PC 1FNXH 2E5GA 2QFJA 2CPDA 2MZQA 1KOOA 4C4WA 3EGZA 2L9WA 2YH0A 3TYTA 1OIAA 2UP1A 2CPYA 2DGQA 3BO2A 5LJ5Y 2HZCA 3NS5A 1ZZNA 3SMZA 2HVZA 5HL7Q 1M90T 4F26A 3SDEB 1QM9A 2JRSA 3CMES 2MPUA 3R1LA 1UAWA 2KFYA 2DIUA 2MKJA 2CPZA 3MI7X 2E5IA 3FEYB 2DNGA 3US5A 1WG4A 2KVIA 2MQPA 3D2WA 3CC4S 2HYIB 3MOJB 1RK8A 5DETA 1YHQS 2AYBA 3S7RA 3CUNA 2MQOA 2M8HA 2D9PA 2XB2D 3CCQS 3VAJA 2CPFA 2N3LA 2MSSA 4IOAQ 1X5PA 5CYJA 3JB9k 1OWXA 3V4MA 2F9DA 2XS2A 2MQNA 1NU4A 1U1NA 3BS9A 2K3KA 2DNZA 1X4HA 3S8SA 5GADU 2EK6A 2KXFA 5IQQA 1PGZA 3S01A 2DB1A 1WHYA 3EGNA 1X4BA 2KH9A 2G0CA 2RRAA 4PKDB 3P3DA 1U1RA 2GHPA 2DNQA 1VQ9S 3CCRS 2CQPA 3VAIA 4UQTA 3BEGB 5DM6Q 1UP1A 1D8ZA 2DGVA 2ERRA 3ZZZA 2FPHX 2N7CA 2YKAA 2MZJA 1X4GA 4P6QA 4FXVA 4WCEQ 1WTBA 3G8TA 1Q82T 4W90B 2LKZA 3TO8A 2QEXS 4C0OC 1YJWS 2OIHA 1H2VZ 2Q79A 1VQMS 2LEAA 1PO6A 2MGZB 3VAFA 3G4SS 4BS2A 2J76E 2LQ5A 1SXLA 3CCVS 3HHNB 3OW2R 3Q2TC 1WEYA 2VONA 1A9NB 3CCMS 2YWKA 2CQDA 1BY9A 5DDRC 3G8SA 2I38A 5DM7Q 1VC0A 3CD6S 2HGNA 1F9FA 3S6EA 1KD1T 1WHWA 3J7ZT 2M70A 3MUVP 2KRBA 2X1FA 2LEBA 1VBXA 2MZSA 4LMZA 4ED5A 2KG1A 3EX7B 1U1KA 3I55S 2CPEA 3MXHP 2KN4A 3THTA 2MQQA 3CC2S 2XNRA 1G2EA 1X5OA 2CQ3A 4Z2XA 1X5TA 2VOPA 1K8AT 3U1LA 2V94A 1YWXA 1VC5A 1A7GE 1HA1A 3UCUP 2M8DB 2DHGA 3MUMP 5JVGQ 1VQ5S 1VQ7S 1P1TA 1JJHA 2MKSA 3G96A 1U1OA 4QU6A 1WI8A 2ZJPQ 1YJNS 2LECA 1U6FA 1N52B 5H1SV 2RQ4A 2MMYA 3LQVA 4TLQA 2K8GA 2MY8A 1H2TZ 3NMRA 1H2UX 2XS5A 1IQTA 1KQSR 2M9KA 1YI2S 4V19X 2E5JA 2DGTA 5IM0A 4OZ1A 1X4DA 1UW4A 2CPHA 4C7QA 2ADBA 1WI6A 2LXUA 1U1PA 1JJ2R 4LJMA 1RKJA 2RUGA 2DO4A 4IOCQ 2XS7A 2X1BA 2DNKA 2N3OA 2AYMA 1WEZA 3VAGA 5LSOA 4YB1P 3UCZP 3CCUS 2KT5A 2CQBA 5LXRA 1S72S 2LA4A 3CCES 1M1KT 4CQ1A 2LA6A 3J7YU 1VQLS 4LIRA 2FC9A 1QVFR 3NNAA 1VQKS 4Y0FA 2DNYA 4WIIA 2O3DA 1WEXA 1VC6A 1O0PA 3CMAS 4TU7A 2U1AA 2CQ2A 2DNRA 2MZRA 1WG1A 2CQ1A 1DHMA 1HD1A 1VQOS 3MURP 1X4CA 4QU7A 4PRFA 1FXLA 2CPJA 3VALA 2MSTA 1DZ5A 2MJNA 2AD9A 2DNHA 5MLCV 1VQPS 3CF5Q 4OZ0A 2RRBA 3VF0B 4F25A 2DNPA 2KYXA 4PR6A 2ZJRQ 2EVZA 1R8HA 2MXYA 2OTLS 4CH0S 2MZ1A 2MGZA 2FC8A 3VAHA 2MKKA 5CA5A 3UD4P 3CULA 3IWNC 1FJEB 4Y00A 5GAEU 2PE8A 1UFWA 1HD0A 2DH8A 2MHNA 2MY7A 1Q81T 2KXHA 2G1DA 3UE2A 2HGMA 5IFMA 3IRWP 4QQBA 2XSFA 2KRRA 2RS2A 2XNQA 3K0JA 2RNEA 2OSQA 2NZ4A 1X5SA 2FHOB 5GVQA 5EN1A 4IUFA 1L3KA 1JJ4A 1KC8T 5GAHU 2MKIA 5D77A 2DGOA 2DGWA 1M5KC 5GMKa 3P6YC 1VBZA 2WBRA 1YTYA 2DO0A 1X4EA 4TU9A 1FHTA 3U1MA 2A3JA 4U67Q 2LYVA 2J8AA 4EGLA 3G71S 5BJRA 1X0FA 2E44A 2B0GA 1XN9A 2DHAA 2CQIA 5HO4A 2F9JA 2RU3A 1YJ9S 5GAGU 2KM8B 2KXNB 2RVJA 1N8RT 3NS6A 3PIPQ 1QVGR 4WF9Q 2MYFA 4WKRA 1B7FA 4WFAQ 2MJUA 1YITS 1WWHA 2F3JA 3MD3A 4UY8T 1FJCA 2QA4S 2CQCA 3CPWR 2DH9A 1K73T 2CQ0A 3HI9A 1JMTA 5LSLA 2DHSA 1U1QA 2DH7A 3SDEA 2M52A 1CVJA 2PEHA 3MUTP 1R8PA 2AYEA 2BOPA 3CTRA 5DDOC 4A8XA 3CCSS 2OJ3A 2RT3A 1OO0B 4WFBQ 2SXLA 3UCGA 3FEXB 2DGUA 1WHVA 1AUDA 3B4MA 2CPIA 2CJKA 2FY1A 2J0QD 2M7SA 3BO3A 1P27B 3UD3P 1KOHA 3B4DA 1U2FA 4YUDA 1DBDA 3THPA 5IM0B 2VODA 2D9OA 3DXBA 2OTJS 2DNMA 5LJ3Y 1VQ4S 1M5VC 2X1AA 1WF1A 3SXLA 4QPTA 1WG5A 3ZZYA 5LXYA 2KHCA 2DHXA 2HGLA 2DIVA 1SJQA 2LCWA 2U2FA 2KI2A 3NNCA 1WF2A 2AYGA 1NO8A 5D78A 3VAMA 1SJ3P 1VBYA 1NJIT 1FJ7A 3R27A 4ERDA 1WF0A 2M0GB 3CCLS 2DK2A 1Q7YT 4M5DB 3TP2A 1N88A 1SJ4P 1Q86T 2I2YA 2CPXA 2DGXA 1ZH5A 1X4AA 2MQMA 3Q2SC 3H2UB 1YIJS 2X1GA 1D9AA 1S79A 1X4FA 1U1MA 2BZ2A 2JWNA 1N54B 2KU7A 2MKHA 4CH1A 2D3OR 4F02A 3UWTA 2RS8A 3CC7S 2KG0A
chains in the Genus database with same CATH superfamily
1FF2A 1NSAA 4WPAA 1SJRA 3SCKE 4AL6A 1RQ0A 2DRAA 5K8PA 1W2BR 3G9CA 5EWEA 1FRMA 1EZZB 4NYZA 4LVOP 1CQNA 3M6WA 5MAOA 4DZ6A 1VQ8S 3EJMA 1VQ6S 4ZVSB 4JI0J 2NZCA 3T9NA 3OVBA 5C5JA 1RT3A 4L76A 3O44A 2L41A 4RW8B 2CQGA 2NSCA 2KDOA 2QMWA 3T1HF 3M2VB 4CO5A 1V3ZA 2MZTA 3D67A 2E9ZA 1W25A 4Y2IA 3KK1A 3TZZA 1ZZFA 1CJUB 2YH1A 3VZHA 1NRKA 4GKJJ 4C6AA 2L9WA 2HFZA 2O66A 2B4OA 2HZCA 3SMZA 2XZTB 3KUHA 5HL7Q 4F26A 1QY7A 4I1TA 3GFZA 2WCXA 1BQMA 2K06A 3ILOA 2VBWA 2ASLA 3MI7X 2E5IA 4LFCF 2FZKB 3FSXA 2BQUA 2KVIA 3QT7A 2ZH1A 1X5PA 4M95A 1UA1A 4DUZJ 3X1LB 2MQNA 1U1NA 5KFLA 3PW2A 2HS4A 2GQ2A 3L9ZA 3IM9A 5KFNA 1YBAA 2HWHA 3KYLA 1ZOTA 3VAIA 1C4CA 4NCAA 4HT7A 5D4LA 3JSRA 2N7CA 1YRTA 1X4GA 1S7HA 5THWA 5KFRA 2GVZB 3J81j 1RT6A 3LF0A 2AJ2A 4LF6F 4I7FA 3GE9A 4E98A 4PQUB 1SXLA 2VONA 5F8LA 2NPFA 1HNZF 3I4PA 1RYRA 3E3XA 3AD9C 1HW9A 2UVRA 3L7OA 3M8YA 1KD1T 4LFBF 1SV5B 4ECTA 1IBMJ 2ZZNA 3MUVP 2XHWA 2YQ3A 2KG1A 4DV7J 3Q8RB 2XI2A 4LF5J 1HQEB 1YJUA 2VPWB 1A7GE 2YKMA 2QYGA 1RTJA 4DHVA 1TL1A 1AXQA 1U47A 1YKWA 2RKIB 2A2DA 3H25A 3KMSA 2FGCA 3O1LA 5GADI 1U1PA 4OHZA 1HW8A 3R5AA 4AUKA 2X1BA 2NXUA 4OYZA 4HHJA 1ZAXA 2LA4A 3QJLA 4Y0FA 3H8YA 3TA1A 5DGBA 1A0OB 3CGIA 1YGYA 2DT9A 2VG5A 4AL7A 3HK2A 2FQQB 2VDHA 5F8NA 4Q45A 1XMOF 1TR0A 3K17A 3MM6B 4DSFA 3R5JB 1HNWJ 2WRMA 1TL7B 2ZC4A 3C6TB 3W63A 4M5JA 5I3UB 3OHBA 1N5QA 5A8KA 2FC8A 4DL2A 4NLXA 2PE8A 1UFWA 4ZOSA 1JLGB 2KXHA 4DV0J 2HGMA 5C25B 4ZPDA 3K0JA 2OSQA 1QJHA 3M8PB 3H2LA 5GAHU 2MKIA 4C11A 4LSNA 4C8LA 1I51B 2WBRA 1SQGA 2DO0A 1G3OA 4EGLA 1B0VA 1FESA 5HJYA 4F4WA 3J80U 3BM7A 4ZPBA 2R9LA 4OYOA 3NS6A 2BR0A 3PHEA 3TZXA 3E2EA 2J5AA 4UY8T 1FJCA 4DV1J 3DOMB 1RWWB 1JMTA 2Q6CA 1WC4A 2VFVA 2ZNYA 2M52A 4NZ6A 2CVEA 1RT7A 1IBKF 5BYSA 5K8OA 2EFGA 2HQIA 4RW6A 1IKVB 4MK9A 2D9OA 3W66A 3DU6A 1JKHB 2WOMA 1WF1A 4ZN1A 1VK3A 4C48A 1RWOB 2CJ9A 3OTEA 4ES1A 3QT5A 3IP0A 4QWCA 1TP7A 3P5BP 1N56A 4BDPA 3GJRB 3VGTA 2DCUB 5F3TA 1R0BG 4JP8A 1JK9B 4A8FA 1HQ2A 2KU7A 4F02A 5RUBA 4K4TA 4LRBA 5HI7A 3DC2A 1RTIA 3NY0A 3N79A 3CE8A 3I96A 5DQHA 2L08A 4KT0C 3MEGB 4KRWA 3A8IA 2MQLA 1RAOA 5EUHA 1Y7PA 2HFSA 2HRYA 4CT9A 1LWXA 4DUZF 4ED1A 4C97A 1GMWD 5IV3A 3EZ5A 4CYUB 3FJ2A 4OZ2A 3M9OB 2FZGB 1DAXA 1CJVA 1SC1B 4CLSA 3GYXB 2FJDB 3HVTA 2V2ZA 4WP9A 4M5KA 3J7YI 4IYQA 3CCJS 3W65A 3N6MA 2MZQA 2C2KB 3V6KA 4DFMA 4IDKB 1F2GA 1M90T 1F9HA 2KFYA 3HX9A 4H4OB 4ED3A 5E41A 1SUQA 5HSPA 4IH5A 4FYYB 3AJDA 5DETA 3S7RA 4NXMJ 2VL1A 1IBLJ 1YVFA 4MKYA 3FFIB 2AIRB 4N8OA 1T03B 2EC0A 4LF5F 3KUEA 5LMUJ 2KH9A 2QA2A 3ITHB 3W2VA 1BHNA 1FE0A 4MK7A 1RWVB 1D8ZA 1B70B 4LF9J 2OFGX 4RUCA 3G8TA 2FLPA 3N6LA 4KE5A 1YK9A 4LR9A 3MAQA 2B6AA 3PYDA 2FJAB 1U8WA 2GJFA 2XYHB 4OI2A 1PO6A 4H54A 4ZLPA 4ZP6A 3IA0A 4M8LA 3HHLB 3LP1A 5HMWA 1QAJA 2IRXA 1KQKA 3CD6S 4DCJB 1GTHA 2IM3A 1WHWA 2F4FA 5ETRA 2X1FA 1AA1B 3FZBA 3RBXA 1G2EA 1NDKA 4DR3J 3TQ1A 2ZBCA 3K5PA 2UZAA 1HNWF 4N41A 5G0RB 4ETZA 4QU6A 3CDAA 1HLWA 1DQ9A 3P4UB 5H1SV 2MMYA 3MR6A 2UVWA 1EKRA 4J90A 4JI7J 1GQEA 1HBOB 1PILA 1Z1ZA 3RAMA 1G4CA 8ATCB 3DHXA 1RWXB 1WI6A 4DV0F 2XS7A 4EYHB 5J1NA 2R7OA 4ECRA 4GC7A 3PJWA 2CQBA 2LA6A 4U96A 1VHFA 3GG1A 4WIIA 1WEXA 3QFWA 2B5JB 1R0CB 1T02A 3CJKA 1SBRA 5FIIA 4KV8A 4PYDA 1X4CA 3D6HB 1GX5A 1DZ5A 2EBGA 4IH7A 4HL9A 3JSYA 4O3RA 3ZXWA 2DXEA 1EJ7L 1NKEA 4KGZB 4DR1J 5E5NA 3QRQA 4MMOA 3GJQB 2MXYA 4PUOA 1JNRB 4DFPA 4I2QB 4FF1A 3GTYX 5T7LA 4WK3A 3TAQA 5GAEU 3A3PB 4MIAA 2BJ7A 1Q81T 2AZ3A 2WAQD 2F63A 2RNEA 3MZIA 3R3TA 5KFPA 1BXNA 3OTDA 2YKNB 2H48B 1N48A 1IWAA 1X4EA 4XK8C 3KFWX 1RHRB 2OPQA 1XR5A 2UXCJ 3E01A 2Q6BA 1FD2A 2KXNB 1OY8A 3A3OB 3M8WA 2IMWP 5B7WA 2F3JA 1N5SA 2DH9A 1IKWA 2CQ0A 4IFVA 3KK1B 3FRYA 1ZS6A 4QJVA 3Q0AA 2BOPA 4UY85 4A8XA 4E0DA 4PG5A 3KNGA 4WFBQ 1F60B 2SXLA 1N4LA 4K5SA 3MHYA 2E1RA 3MMBA 4OYAA 4J37A 4KJIA 2OELA 2VODA 3LH2S 1RCXB 2BVZA 3HF5A 1RZMA 1CJTB 1FJGJ 4M94A 3R5BA 1TZ0A 4ELUA 3EMTA 3BBFA 1CPZA 1UVJA 3Q22A 2VKRA 2PN6A 2R42A 1JLAA 2A0FB 3BBCA 3DLEA 5HVHA 3J81U 5L39A 2OI2A 3ZTQA 2X1GA 4KKOA 1D9AA 1UWBB 2LLZA 2C2EA 1RTZA 5B0CA 9RUBA 4EFAC 4CT8A 3NCQA 1HL6A 3JQKA 3N9UC 2W1BA 4OYMA 3R1HA 2HEKA 1K9MT 2BJ1A 3M6VA 2ADCA 3LAKA 4I7FB 1E6YA 1DY3A 1E6VB 2YPYA 4ES3A 4X62J 2DISA 1IBLF 2HFUA 2NYHA 2LXIA 2VG7A 1Y00A 7AT1B 3F44A 5GMDA 1CG2A 2COLA 3PM9A 5LMUF 4ZK7M 4NXNF 4ILMA 1YLXA 2X7IA 2F1FA 3M9NB 9ATCB 4RUBA 2DITA 2B3TB 2YKMB 2I1RA 4IRCA 1RTJB 3NGSA 4WIQA 1WOSA 1NLKL 1NMEB 2PMHA 2CPDA 1S6PB 2GQQA 4YQWA 3R8YA 4K2JA 5DZ6A 2DTJA 2FJBB 3SDEB 4JI3F 1CJKA 4OV1A 1N36J 2MPUA 2QLWA 4DQIA 1P9YA 1XQIA 2MKJA 4ES2A 4CM0A 3NRBA 3DMJA 2HVHA 1PJ5A 4RNHA 4K4ZA 4NYOA 1QSLA 2E1PA 4Y65A 1S0VA 2AGPA 1J5EJ 3G82A 4DR3F 2VG5B 3OPKA 4DV4J 5A8RA 1MWZA 1VRTB 5E3RA 3ZZOA 1FRJA 5DM6Q 5SZTA 2MZJA 3KLIA 2J9EA 2HWTA 2QYCA 2LU2A 2CDQA 3DGPB 1RU1A 1YJWS 2DR7A 4CO4A 4UZBA 5A8KB 3NXZA 4YEAA 2C2NA 1FD8A 4OYIA 4ED4A 4O4GA 2JJ4D 5E0OA 3G4SS 4FF4A 2IA6A 3D54A 1SKUB 2IBOA 1OSDA 5DM7Q 3DYAA 2XY6A 3GP9A 4O3QA 2DXFA 2V4JA 3J7ZT 1IWGA 1IKXB 4ANDA 3UN3A 4G6VB 4C11B 4LSNB 2XM3A 4YR2A 3CC2S 2XNRA 1FK9A 2RDIA 3OSNA 1S1TA 3QJJA 1YZ7A 4UTGA 3C19A 3NGUA 4Y6IA 3NGDA 3TX8A 2HKEA 4HHUA 4DL5A 4XAKA 4DSJA 4BHQA 2ZJPQ 1YJNS 3H5YA 4I56A 3UNYA 4DR1F 1ZTTA 4DR6J 1RAGB 3OVSA 2K8GA 2HNZB 2ZOGA 3IG1A 2ZBRA 1YI2S 1TKXA 7FD1A 5KFQA 5IM0A 4ZVRB 1RT7B 4NI2B 1TU0B 1ICEB 5J2QA 3Q86A 1CC8A 1HQUA 4QZVB 2DNKA 4RW6B 2ZM6J 4HHHA 4FYWB 3R2CJ 1M1KT 3Q8PB 1W7WA 1OYDA 4CQ1A 3GYGA 4LIRA 1S1XA 1TFYA 4DQSA 3HO1A 4USMA 2D69A 1B99A 5KFMA 2MZRA 3TNVA 4TNOA 1VJQA 4ID5A 5ADZA 5HK4A 3OHAA 4FYXB 3K5MA 2VZ9A 4GKKJ 3MEEB 4OZ0A 3WIUA 4WE1A 1Y4ZB 3GIKA 1CULB 5F3ZA 1EQ0A 2ZHBA 4BBYA 1VHIA 5B0BA 3D3BJ 2XYPB 3ZNJ1 1UJ6A 4ZPCA 1U48A 1VRUB 4GO7X 5GVQA 5EN1A 5J1EA 4H4KC 1OYEA 1S6OA 5KFEA 3DRSB 1U24A 3A1YG 1HWLA 4DUYJ 3U1MA 3MM8A 1XN9A 4L75A 2A6OA 3W62A 1WSRA 3SFGA 3FK4A 1YJVA 3FBEA 1D3WA 4C3LA 4UOFA 1HPZA 4RBVA 1CJVB 3NLCA 2W7AA 3HVTB 3KLEB 5LOQA 5KG5A 3HMJG 4AXIA 2ABYA 4XPEA 4HDGA 2ZOFA 1JLQB 3WX4A 3T1YJ 1IUJA 2FY1A 2M7SA 3EXCX 1N5YA 1K44A 2V5HG 1S0NA 4WTOB 5C7PA 4X62F 3ZZYA 4A8QA 4F4YA 3NG8A 4M5LA 1S4FA 5HROB 3BH6B 3D1OA 2HAIA 2ZH6A 2W7OA 5D78A 4OYBA 4WFZA 1KVKA 4ERDA 4ZVQB 2O5DA 4EI2A 2NXJA 2IVYA 1SJ4P 2ZUAA 4CLWA 3W2VB 1PYTA 2BXJA 3QBCA 4LT6A 2D3OR 2G9OA 3W8PA 1LWFA 5LSRA 1WACA 4DX7A 3W8GA 2EK1A 2DNLA 3D68A 4LIWA 4ZVPB 2J0XA 2HHXA 1N36F 2UXDF 3ZZPA 2B6AB 5IT4A 4MYUA 1T9WA 4JI2J 3PJXA 4JB8B 4YHHJ 3LP1B 3C8YA 1S1WB 1FVQA 4J9MA 3GV8B 3MM7B 4PZVA 4JI4J 4DLGA 5KTQA 4LF4J 2DGSA 2XTJP 3W5YA 5AE2A 3VQTA 1H3DA 3QMQA 3VZIA 5ITHA 4O4RA 2YWWA 4WXWA 2OUGA 4G1QA 3B78A 3TRGA 1R8BA 3TVKA 2JX2A 1TAQA 4DF4A 2Q43A 3QFHA 2YX7A 5L1KA 1U4BA 4NZ0A 5LJ5Y 4B9NA 4XTTA 3KLHA 1QM9A 2GIRA 2DRBA 1M1GA 4FXDA 3CC4S 2H5JB 2F8HA 1Q8LA 2MQOA 3CCQS 4IOAQ 3OR2B 5HAOA 2UV8G 3BS9A 2OHDA 4Z37A 3W60A 4YMEA 2RRAA 3M05A 2DNQA 2PMWA 1NPRA 2ZWOA 4LR7A 1FXRA 4ECVA 3PR5B 1TAUA 3BZQA 4M5NA 1HBUA 4ZA1A 2VB6A 2NXEA 3KMQA 3GJTB 1FWPA 1NJYA 3OLBA 2D3UA 2NCKL 2LEAA 2HHVA 1PC4A 3OFFA 3OW2R 1T11A 4IFYB 3CCMS 3RBZA 3BSNA 2DR5A 3MGJA 1H7WA 1VBXA 4PPDA 2B43A 3QGHA 5A2QY 4K4SA 5EGYA 3J7Z5 2AJ0A 1HFEL 3TA0A 3ZO7A 2DHGA 3FQKA 1U6ZA 2R8HA 2HVDA 4U95A 5F9LA 1R0AB 2RQ4A 4K4VA 1IKWB 1FFSB 4IFVB 2AGQA 2M9KA 1QUPA 2Y1LB 3SCLE 3K58A 2BM0A 4DEZA 3C3LA 3UNGC 3V81B 4Y2MA 1HWUA 3CIMA 3MMBB 2PDAA 4Y2CA 1S10A 1B0TA 3IWLA 3I0RA 3MEKA 4DUYF 1VC6A 3QT8A 3SYZA 2U1AA 3PKYA 2I5JA 4GVBB 4G1PA 3CO9A 4OI6A 4PCQA 2CG8A 4KAIA 1HHQA 2CPJA 3FBBA 5IXUA 1XK8A 1LWEB 4KKOB 2OTLS 2PSZA 4ZVOB 2NUUG 2R3VA 3T1YF 2E1CA 3CVKA 1PAEX 4NE9C 3I32A 1UFKA 3IN5A 2UUAJ 4OJGA 3U7JA 1L3KA 1QSSA 1WSVA 4J9SA 1Z4UA 1VJWA 1FXDA 2DCLA 5GMEA 4ZPVR 3F41A 1RWNB 2VG7B 2J7WA 5GAGU 2KM8B 2IJFA 2AGOA 2OPPA 1NCLA 1SL1A 1AW0A 4MKAA 4AQYJ 1FDAA 4NZ7A 2VV5A 1RAAB 3HULA 4ZHRB 2EW9A 4H4MB 1SL0A 3Q23A 2OJ3A 1HBMA 2HLTA 2OEMA 4UUWA 3DLKA 3HFZB 1YDLA 4JI2F 3RB0A 1SL2A 1CJKB 1KOHA 3KJVA 1U2FA 2ROPA 4D3HA 3DMJB 3ENWA 3NS7B 1NKBA 1I1GA 2XY5A 4JI4F 2AX0A 3OR1A 2Z2YB 2XLIA 4KGKA 4LF4F 4Q43A 4ILRA 4Q7AA 2OKQA 3OL9A 4ED8A 1S9EB 3R27A 2V2QA 2POKA 2WK4A 2VH7A 1ZM4A 2DGXA 4ATNA 4QIGA 4TYAA 2W4PA 3JAMU 2R7TA 1UEKA 1JLBA 3M2UA 3EZUA 4PG8A 1Q95G 3KLIB 2JVRA 4DG1A 5CYQB 4O4GB 3M8QB 4AYBD 2CKWA 4GMKA 5KFYA 3ILLA 5A0YB 1GT8A 2FIUA 1H73A 1O5JA 3EXYA 3KWMA 2PO4A 3PY8A 3DYAB 1X60A 2JHEA 3MCNA 4KY3A 2HFNA 2V4JB 2J6UA 2RQCA 2QLXA 2V63A 3K8WA 4J9QA 4EBDA 3VV2B 3GLJA 3G6ES 3LALA 3BO4A 3IBWA 3WQPA 3ET6A 3RTVA 2HFVA 3PRBA 2QT7A 4M5HA 1FNXH 3DRRA 4NLPA 4FKXA 5D4PA 3IWXA 5C2CA 3KJQB 3M6XA 1WOOA 4OLPA 2IC3B 2YBVA 3JS9A 1UTAA 1R3NA 1JLFA 2DIUA 2GW8A 3D6FB 3TAPA 1Q7LB 3IAM9 2JEFA 5K8MA 2F7VA 2RILA 5J2QB 1KTQA 3MOJB 3HVRA 3HJVA 3UN2A 2XB2D 1ZBTA 2N3LA 5B08A 2H3EB 4ICLA 1VK8A 5G4DA 2HWIA 3CJQA 5I3PA 2DB1A 1RHUB 5IT9Y 4OMFG 1RT1A 1JX4A 3T6JA 4DU7A 2AJ1A 4ZLNA 5HMXA 4UQTA 3H5UA 2XZWA 3ZZZA 2FPHX 2VJVA 5HLFA 2QA4G 1S9GA 4WE1B 1FWLA 4C0OC 1ZM3A 4ED2A 2XGQA 1U8SA 4MJKA 3NEKA 2C2RA 1LWCA 1WNEA 1TFWA 3OXGA 1VC0A 3W64A 2QC3A 1C0TA 5J1EB 5ETQA 1Q78A 5B0GA 4CNZA 4HI2A 3NGKA 2ZH9A 1F6TA 4P52A 3UDLA 4J9KA 3DRXA 1KS2A 1GMWA 2XHCA 5F8JA 2EWHA 3LANA 1JJHA 4OHYA 3QO9A 1U1OA 1WI8A 2FLLA 1TELA 5DG8A 4IG3A 1LK5A 5ETVA 4ZVUB 4P2FA 1KFDA 3KJFB 2H1YA 1ZM9A 3DLBA 3MR2A 1HIYA 3FC9A 2N4CA 3MMAB 2BW2A 4RNMA 2V69A 2YQ1A 3AB4B 5A76A 1NDCA 2XO6A 4OL8A 1KONA 1T9TA 2DNYA 1DTTB 3MTJA 2KZMA 1KDNA 2Z2MA 4TU7A 4TLRA 1DLOA 1HD1A 1TL3A 6AT1B 3TW0A 4P10A 3EDQB 5J2PA 4PRFA 4J7CA 3TUJC 3VALA 1A6LA 1QAYA 2UXBF 4G3IA 3AY0A 2K1RA 4XDDA 3THVA 2VBYA 4K8RA 3C66A 4PWUA 1LWFB 4ECXA 3UD4P 3EPGA 4HEA9 1PJ6A 4FPIA 2QA1A 4X64J 3C16A 1ZAWA 5A2QU 4NA3A 4HACA 4ZJLA 4OJ1A 2XNQA 3TA2A 1VOMA 4MIBA 1S1UB 1VS3A 3Q8UA 5KG3A 1YTYA 3AHPA 4JYAF 2OMLA 4PXBA 2HNYB 5HO4A 1RACB 2HZVA 5IV4A 3PYGA 1RAHB 3DDNA 2PFDA 1KNZA 5DLGA 1QVGR 1B7FA 4F3MA 3G6VA 3BR9A 3G6YA 4KIAA 2EFNA 5ETLA 4G1QB 1NSKL 1HR0J 2AYEA 5DJBA 4NA2A 4J9OA 4ZPWR 2JLFA 4J9VA 1K1QA 5D0RA 2AJQA 1BGXT 2W2NP 3HPOA 3L95X 3Q89A 2DNMA 5KFJA 3SXLA 1HKAA 1NSQA 5LXYA 4KYZA 3R6GB 2AYGA 1TKTA 4F0MA 2Q3PA 1YZ6A 3IS9A 4O0NA 5IS2A 4HKQA 1B4SA 4LFAF 2CJXB 3GSDA 1N88A 2I2YA 3H20A 4WU3A 1ZH5A 2GMLA 4NASA 2ASJA 2DBBA 2W8LA 1OJ4A 1MROB 3RBDA 3CC7S 1U49A 4V1Ak 2NLWA 4HTIA 4KHRA 4C8YA 1C1CB 2W9CA 3MEDA 4JOUA 3NMAA 2CQ4A 2PFFB 4W92B 4C8KA 3FGVA 5M2UA 1BWVA 2BJ3A 2BMBA 3HHLC 4JBCA 1BMQB 2RDJA 4WZQA 2Z2LA 5JVHQ 2M4MA 4QYZJ 3NP5A 4B3SJ 4EYIB 3HSJA 1FO1A 1XMBA 4GO5X 3GCXP 2DPJA 5CABA 1KHVA 3V2UC 1URNA 4RJVA 2BA9A 2IRYA 1RGVA 4J5OA 4LF8F 2Y1RI 5BR8J 1ROFA 3D1HA 4RW7A 1VRQC 2HQDA 2LU1A 4ZS6A 1RBLA 1LKZA 1M5PC 3R97A 3MM5B 1F2HA 4ED6A 4CZCA 3CO0P 2YVSA 5E3AA 4RBTA 3RRHA 3LA0A 5E3QA 2NXNA 1RT2A 3OL8A 5FD1A 2FHJD 2NYIA 2XMTA 3D2WA 1ZPWX 1HMVB 3BN4A 2YX1A 1SI9A 2GO8A 5GADU 3ENQA 2AW0A 3SV3A 1WHYA 4ZJOA 3P3DA 3MF5A 5KT6A 1UP1A 4RWWA 4OQJA 3W9IA 2KB2A 2V4RA 1WTBA 4WCEQ 2WSFC 3KHGA 3OVAA 2AHOB 2IPOB 3TX0A 1OY9A 2PA3A 2FJWA 1YX2A 2J76E 3ISNC 3UVJB 4EZ6A 4DPWA 3V4IA 3VHQA 5JJBA 1U7LA 2CJBA 1F9FA 4DPXA 4DLEA 1OSCA 4AE5A 3BKUA 4ED5A 4X4VA 1WDTA 3MXHP 3DLJA 2VOPA 4GC6A 4EUVA 1NHVA 3RB4A 3MUMP 5KFSA 2QL7B 2MKSA 3G96A 2OPPB 4ILLA 3HT0A 2UUCJ 4OI1A 4ECQA 3VWSA 3LQVA 4CWBA 1TK8A 1H2UX 1KQSR 4X4QA 4NCGB 4WK1A 2R7QA 1HBMB 3D6TB 1S12A 4X64F 4V19J 3SQOP 5IT0A 1RKJA 2DVIA 1LFPA 2XMUA 5LSOA 1LW2A 1GXTA 4OYPA 2AX1A 3KJVB 2YXLA 2CZ9A 4KO0A 4WP8A 5KG0A 4OV6A 1DHMA 1G7CB 3IBCB 1UVNA 2Z8QA 3PZPA 1RTDA 3PX0A 3QJPA 4ETXA 1T9UA 2HHHF 2KYXA 4PR6A 3TUPA 2EVZA 1HR0F 4FYVB 4PXCA 4YB5A 1JLBB 3M2UB 4DG1B 4ALZA 2Y8WA 1QD1A 2VFUA 4QQBA 2HHQA 2HFOA 4ZCMA 4EWTA 4DX5A 3T1AA 2H4YB 1KC8T 3OSPA 5L38A 2D41A 2HNDB 1VBZA 2IAJB 2A3JA 2JNJA 3DOLB 4WBFA 3IBFB 1X0FA 2RF2B 2CQIA 3ETMA 2F9JA 1YJ9S 3RAQA 3I9ZA 1N8RT 3IMQJ 1XNRJ 5A6WA 4F3QA 2DHSA 3CTRA 3CCSS 1S77D 3EM1A 3DRRB 1VI7A 4B3RF 2CNLB 2XCAA 1FRIA 4IRDA 2ZBQA 3NAIA 2AP6A 3BO3A 3BQ1A 3B4DA 4A8SA 3BB5A 2J7UA 1XNQF 4B3SF 1EQMA 3U27A 4X66J 3FUYA 2NSBA 4ECWA 2BOAA 3ISND 4I69A 4F2SA 2YWFA 2ILZA 2HHTA 2CA9A 2A6MA 4X84A 5HLFB 1S9GB 4IO9Q 1TUVA 2B4PA 1KLMA 2V8DA 3MD1A 4LR8A 1JXLA 2RH3A 1LWCB 1B3TA 4PAAA 4RNFA 1D8YA 4KFBB 1FKOB 4Y28C 4LBIA 1FDNA 5FLXY 5ETOA 4DQRA 3HHEA 1JNZB 5L1LA 3A3NB 4Q2LA 3OTBA 3R6LB 4FBTA 4DI6A 2E29A 3L3CA 3SV4A 3TR5A 3D7SB 3QO9B 3KOAA 4IG3B 2VG6A 3AQOA 3BO2A 2R8KA 2AKWB 5L1JA 3RU0A 5EWFA 3IRXB 1MU2B 2FVSA 1EHWA 2CWKA 2CPFA 2PGCA 4CTAB 1OWXA 2FDNA 2ZDOA 4F3OA 4X65J 4USWA 8RUCA 2YQ0A 3I82A 5AXKA 1XR7A 4CI0B 1YRXA 4LRCA 1TKZB 1UCNA 2CZ4A 1DLOB 3H90A 2VPYB 2ZD1A 2R8GA 1VIOA 2JH3A 4HDHA 3SFUA 3R2DJ 1RT4A 1UW9A 4W90B 2K1RB 3PEHA 3ONQA 1VQMS 1U02A 5IC4B 4OZLA 5KFUA 3NCRA 2ZC3A 3DRPA 2A2CA 3SSQA 2OPRB 4P72A 4ZP7A 3C16B 3HSDA 4F50A 2E7VA 2HMIB 4P7VA 2DD8S 3EX7B 1LNQA 3LTOA 3L4BC 4R8UA 2GMJA 3OXFA 1R6VA 3U1LA 1VC5A 2M8DB 2Y0BB 4YDDB 1VQ5S 1L3SA 4DQPA 1Q4RA 2RHQB 4R5PA 2ACYA 3L7PA 4A47A 3PW4A 3CJ3A 3KK3A 2RAQA 1EIYB 3H7HB 5KFIA 3AJ2A 2RUGA 1GTEA 1H98A 4IRKA 1H72C 3PW0A 3HKWA 3KLGA 1OMSA 2G13A 1AZSA 3PJ9A 2YNFB 4PXEA 4DWIA 2J0WA 3JSMB 1VQOS 1TKTB 1T7PA 2QLBB 5DQGA 1GNKA 4HR2A 1XNRF 1SC6A 3D6MB 1L3TA 3AB2B 4M5MA 4C0HA 2ZJRQ 5T14A 4CH0S 3M2RA 2PI4A 3NBPB 4H4KA 1NPKA 3HD2A 3GZ7A 4ECYA 1IR0A 5HQ8A 2CVIA 2DH8A 3OFHA 1TUGB 3B8HA 1JXEA 1H0HB 3FMWA 4FF2A 4ZCIA 4F4ZA 2ZHAA 5ETTA 1Q5YA 4O23A 3BQ2A 4OLOA 4N56A 2BANA 3GSIA 4TU9A 5HP1A 4B3OB 1S0MA 1HHSA 1UWAA 3EICA 4TN2A 3QAEA 5EDWA 5B0FA 4MTPA 3K8VA 2K7JA 1UEUA 2J9DA 1PYSB 2IVFB 4RW7B 3OL6A 5HMZA 3Q8YA 1S97A 1Y10A 3AJ1A 3OJUA 1L3VA 1V3RA 4Q0BB 5AJ3J 4FVMA 2HBZB 3ADAC 4O44A 5I42B 4KGMA 3THPA 2DEJA 2YKOA 1DARA 4DR5F 1T9VA 1KLNA 2WW8A 4DZDA 1J2VA 2OEKA 3TZYA 4WZMA 3PACA 3T5JA 2DK2A 2PI5A 3H98A 2GA7A 4JUZA 1Q7YT 1RA6A 1Y5IB 2CPXA 2JZ5A 5C42A 2ATLA 4DFJA 1S79A 2AV5A 3V6HA 3DLGB 5J2NA 4ZDNA 1TK0A 4KH1B 4B9MA 1NSPA 1TKDA 1RHJB 3SBMA 2OPSA 3H2VE 2QMXA 4A46A 2CFXA 3QIPA 2LEPA 1WJ9A 3BGLA 3QIDA 4CO3A 1K47A 3V4IB 3LWLA 2VQFF 2IIHA 4RU2A 3DI6B 2C2DA 1DRZA 4X65F 4CLTA 5AXNA 2FJXA 3NNHA 1S6UA 3MM9A 2N82B 1AROP 5DDPC 4WWSA 2VFRA 3RW6A 3GIMA 3SIPB 2AQ4A 2GX8A 4F67A 4OIXA 2L3MA 2H5EA 1NH8A 2DNNA 4FXWA 1GH8A 4A8YA 3ZTRA 2JVOA 1PIEA 1UZHA 4RU9A 3TVZA 1NKCA 1CLFA 2WB4A 4A4JA 1T05A 1I6JA 4U8YA 1TVRA 3US5A 2XWYA 4K5RA 4DBQA 1RK8A 4M1KA 3M6UA 1LW2B 2ILYA 3VAJA 2MSSA 3TEHB 2BE9B 2UV8A 2XS2A 1Z2LA 4JI8J 4M5DA 1WD6A 3S8SA 4KO0B 1CEZA 2CAJA 4LSZB 3RRKA 3PFOA 1S1VA 1RTDB 4JI6J 2C3UA 3QLHB 4HVZA 4P6QA 4NOHA 3VVUA 3JQMA 2BE7D 1S57A 2B56A 2AMCB 2E1MC 3D28A 6FD1A 2HIYA 4PQAA 1SPBP 1N5VA 3E51A 3DN9A 3Q2TC 1A9NB 4ITSA 5DDRC 2I38A 4J9RA 4DR4F 5SUHA 1VGYA 2KO1A 1Q5VA 3PX6A 1UVMA 1H38A 5K14A 3K7RA 1BQNA 1X8DA 4Z2XA 1X5TA 4NA1A 1K8AT 3QRRA 3KLVA 3IR6B 3TZWA 5KFGA 2RE1A 3EDRB 4RNOA 1Y5NB 3P45B 3T6BA 4DS4A 1S76D 3CJRA 1RAJA 5IWAJ 3ENVA 2YNIA 1R31A 1X4DA 4B3MJ 1SC3B 2JFDA 3POTA 3CJ0A 2XG8A 4USHA 4IOCQ 4RZRA 2FJEB 3VGVA 4C8MA 4OYWA 2BW7A 4JI0F 2ZH7A 5CCMA 1V9OA 2WVCA 2CADA 2YKQA 2O1PA 1RAFB 3KG1A 3V6DB 2DNRA 2VFSA 5L46A 4U9RA 3ENAA 1FXLA 3J7A1 2P9GA 2HHUA 3GFXA 2DNHA 3OBIA 1Y9OA 4UUXA 1PJ7A 4GKJF 4NLVA 5CHCB 3GIRA 4Y00A 5AJ3F 3UW1A 5CYMB 1DQ8A 3W2WB 2X3DA 3IRWP 3UI3A 1TL4A 3G2XA 2KFNA 2L48A 4MFBA 5GMKa 4QOTA 1F5AA 4U67Q 2F65A 5BJRA 4N76A 2GZOA 3H40A 3DM2B 1YITS 2J8SA 4AD6A 4K7QA 2QA4S 1NB2A 1U1QA 5AT1B 3B54A 3LP0B 3LPEA 4MIWA 3T41A 1R7IA 1FNOA 1R8PA 2FVPA 3GPAA 1OO0B 2HQGA 3QGIA 3UCGA 4B3TJ 4B9SA 3DOKA 4OX9J 1MLAA 2CRLA 4EK2A 4YS2A 1FRHA 3IM8A 3GMGA 5CD4A 2OH2A 4URQU 3A13A 1IR1A 1HYSA 1WKJA 2Y1JA 2E66A 2KHCA 1MSWD 4X2BA 3FRZA 1IBMF 2EFQA 2C3OA 5CZXA 1FRKA 3CWJA 2HS0A 3PDNA 2QX0A 2VKZG 1HI0P 1VBYA 4DV7F 3BDPA 3DFEA 1O51A 2Q66A 4K2XA 4DX6A 2GVZA 2GIFA 1AFIA 2PD1A 2ZD1B 1V3SA 3UWTA 3A4TA 2K3IA 3MPWA 2PIIA 2LQ9A 2YNHA 4IKAA 4WFNQ 3SSSA 1Y0HA 4ID8A 1BC6A 2YTCA 1SV5A 3AA9A 1Q1KA 4I2PA 1OPIA 2R7VA 1ULRA 4ZKAA 1KQGB 1HI1A 1S9FA 2GFFA 1XBWA 1BD6A 3NOCA 4BC9A 2HURA 1M5HA 3ZTPA 1W26A 1HQEA 4FDFA 4JI8F 4JV2A 1VQNS 1NZAA 4Y2KA 4JV5J 2HBRB 3I56S 4C98A 3MMCB 1NB7A 3P5TL 2RKIA 4NPOA 1DJ0A 3CDBA 5D3GA 1WHXA 5IC6B 1U1LA 3GCWP 5DQIA 2WTFA 1D0EA 4J9LA 1M5OC 2AWZA 2J0SD 2QN6B 2ZJQQ 2XWXA 2DPIA 2JEGA 3CXCR 4CIOA 2Z57B 4ED7A 1MG7A 4R5PB 2QFJA 1JLCA 3TYTA 5H9FK 3M8ZA 4FNIA 3KK3B 1LXJA 2OEJA 2HVZA 1DTQB 4ECUA 4DSEA 3IGVA 1Y3JA 5KOXA 5C24A 2GIQA 3FEYB 3VCDA 3KTQA 2ZH3A 3CCWA 1N33J 2XMMA 2QTWA 5CYJA 3MM6A 1VQSA 2QLJB 1P6TA 2D1CA 1TL7A 2BBEA 3C6TA 5IQQA 1PGZA 4ZVFA 5I3UA 2NPIA 3AODA 4NEYA 3ELHA 1VQ9S 2EC2A 1KSPA 2OP5A 1NJXA 3BEGB 5B0EA 4RPFA 2DR6A 2YKAA 4DV5J 4FXVA 4DV1F 4RW4A 1JLGA 4KGVB 4USUA 2MDAA 3BREA 3SEOA 4ZPTR 4B3MF 2NS1B 1XR6A 1NHUA 3M2RB 5J1PA 5GAGI 2E9TA 3RZAA 2O01C 3GU0A 1UMJA 1ACMB 2UU9J 2EFPA 1KR4A 2OFHX 2GVDA 4BCAA 2KYZA 4WTYA 2FZCB 2BACA 3VQSA 3P96A 1TV6A 3M30A 1BQXA 3TWZA 2FY8A 4F4XA 1RT3B 4OZJA 3LWMA 3DOMA 5HP1B 2V94A 2G2OA 1IM4A 3EGVA 1VQ7S 1P1TA 4EU0A 4IO1A 1NDLA 3FMBA 3HDSA 1LOUA 1N52B 2L9NA 1IKVA 2XS5A 4M5IA 5AE1A 3SZ2A 3QT6A 1YJ7A 1JKHA 1RBAA 3FSYA 1JJ2R 1TQLA 3OD2A 4O44B 4PEOA 1KRPA 1BQMB 1EARA 2FHJA 3D0HE 2FC9A 1NJZA 2F8EX 4QR1A 2K2PA 3AA8A 4N5SA 3DLHA 2MEWA 3CMAS 4NLUA 3MWBA 2M3DA 1QSYA 4KHMA 4LBHA 1KEKA 1MMLA 2HQCA 4QW8A 5L9NA 1O8BA 1V5IB 2ASDA 3CDEA 3RR8A 5J2NB 3BGRA 3JQJA 1FJEB 4B3TF 4CO0A 4OX9F 1U09A 1AYEA 5HJXA 4LFCJ 1HD0A 1TK5A 4Q44A 5KT7A 4AXJA 2OPSB 2JDJA 1RT6B 2ZZMA 2YNGA 1M5SA 4L3NA 3QIPB 2FHOB 4FNHA 2V50A 3FKBA 1SC4B 3OTCA 5AE3A 3H5SA 4I68A 4U8VA 2ZH2A 1FHTA 4NXMF 2D7SA 3I87A 1RCOB 3BQ0A 3GWCA 2DR8A 4KSEB 3PKMA 5CH7B 3BGOP 2ZITA 4L72B 4WF9Q 2IY5B 3W5XA 2HHWA 1TUWA 4DF8A 4IDKA 4UT4A 3CT9A 5LSLA 4A48A 1MWQA 1AUSL 4LF9F 4OJHA 1LV5A 1TL1B 3D66A 3FEXB 3DXSX 1N32J 2GNKA 2Q1LA 3B4MA 1HNZJ 4RO0A 1QDUB 5EHHA 3HP6A 1MWYA 4MYTA 1FDBA 4QBUA 3GIIA 5EX3A 3RUBL 3AOAA 3UD5A 2DIVA 3ITHA 2W8KA 4JV5F 1SIWB 2VHGA 1WF0A 1JB0C 1H74A 3D9BA 4M5DB 4UW2A 3OUYA 2CG4A 1Q86T 5H9EJ 2FB0A 4LUBA 3J7AN 2GS8A 1F1BB 2RIJA 4DL7A 2PT0A 1LEOA 3HHLA 4F0KA 3RBEA 4JI7F 3G87A 2XQCA 2KZZA 4R0JA 3O5TB 1EP4A 3V5RA 3SQGA 2JEJA 4DOZA 3D4JA 1MN7A 2BJEA 5DG7A 1SJ1A 3AOBA 2LQJA 3CCTA 1GMUA 2FJVA 4MT1A 3MPVA 2AZ1A 3WHIA 3HHKA 1BQNB 2QSFA 2QMUB 4DV5F 1H6KX 3MOZA 1FRLA 2E5GA 4P7TA 4C4WA 1YBTA 1OIAA 4L6V3 3H59A 3W3SA 1ZZNA 3HSZA 2YNIB 3FCHA 1R27B 5KG1A 2HHPA 4L3KA 3ZTOA 2B5JA 3CUNA 1KKHA 2CWXA 2P9CA 2M8HA 2D9PA 4G1IA 3UDVA 3JB9k 4Y34A 5D0GA 1NH7A 5F9NA 2K3KA 3BPSP 2WOMB 3OL7A 1NUEA 2AJFE 4PKDB 4ZPAA 2UXCF 1ZTWA 1T3OA 3WDOA 4QPXA 1GMVA 4I2QA 2DGVA 3CSKA 1IBKJ 3PRVA 1ZM2A 4X4OA 4CH7A 2B8PA 3JXOA 4C8ZA 2GV1A 2R7SA 5U47A 4PXDA 3QZ8A 1JQGA 4YR3A 4NYPA 4C0BA 2YKNA 1IVZA 1UL3A 1RSCA 2VBXA 1RTIB 3GILA 5M2RA 2GAHC 3G8SA 1KVIA 3M7VA 3R7SB 1FJGF 4ZVHA 1S6QA 4OHWA 2I9SA 4MFBB 3LGMA 3I55S 4KBIA 4P2SA 3THTA 2MQQA 4DR2J 1OQ6A 2ZVSA 2DY1A 4ZCLA 2VF3A 3PW5A 1P1LA 4USKA 3E8OA 2V9KA 4G65A 1U6FA 1I3OB 1Y5LB 4OZ5A 2XMKA 2W25A 4RUHA 2IBKA 1RB0A 1CJTA 2LXUA 4LJMA 3DOKB 4LRAA 3NOGA 2AYMA 3JYTA 4C2MA 5LXRA 1REVA 1CC7A 5E3PA 1HYSB 4TQSA 1SUQB 5L1IA 3KHRA 3DHWC 3WZ0A 4HT5A 2HVIA 1F5CA 4J9UE 1WG1A 1UWBA 1RI7A 3NAHA 2C28A 3IC1A 2MSTA 4I64A 3FBFA 2VJUA 2KT3A 4I67A 1HNVA 4A8KA 2RDDA 3R5CA 1ZPVA 5JMNA 2Y9HA 3CDWA 5KFVA 3GYNA 2EKNA 1XJWB 1N32F 4NLDA 1E6VA 4Z7CA 2K7KA 5HQMA 2YWHA 2YNHB 2IDEA 4CNYA 1X0PA 3AFGA 1X5SA 4I2PB 2JLGA 4NLOA 1S59A 1RJJA 1JJ4A 3TUIC 1UPPA 2RJZA 2ZHOA 4DU8A 3UQSA 4DX8H 5ETNA 1I5OB 2DHAA 5F0WA 3L7UA 3C15A 1J5EF 3D3CJ 4DV4F 1S6PA 3H4BA 1FKPA 3T5HA 5J2MA 4NL5A 2XCPA 5D3GB 2OD4A 2YX4A 3SDEA 3BPDA 4DSKA 3ZZUA 3UN5A 4DCOB 1JLCB 3CJ4A 4IR1A 4DR7J 2CPIA 3HSGA 2J0QD 2VC0A 2Z4PA 1P27B 4QWBA 4YUDA 3AH6A 2QLFB 2B9XA 4QWAA 5C24B 5LM7E 4AL5A 1FKAF 2LVWA 4CLLA 1G6BA 1VRTA 2IJRA 3PW7A 2R7UA 3HD1A 1FJ7A 4LRFA 4LF1A 2HK2A 3DGPA 2DYAA 3CJKB 1EKSA 4KV8B 1M0SA 3Q8VA 2MHEA 3PHTA 2W4DA 5K9FA 3PIPQ 2C1EB 1SQFA 3J81Y 4KHPJ 4DR6F 4RW4B 2H5IB 5LL6d 1LW0A 2HRTA 4F4KA 4PUOB 1IKXA 2VBZA 5T7LB 1S5ZA 2ZKTA 3DLLQ 1FTRA 1X9WA 3SCJE 3RR7A 2ZZTA 4W4MA 2BJ8A 2ZM6F 1F0XA 2WSEC 4K59A 3U02A 2OAUA 2GVDB 2FVRA 2ZDPA 3WX8A 1B7YB 5HBMA 1TV6B 2A18A 3M30B 3KXDA 1RWPB 5D0HA 2VOOA 2HNZA 2OPQB 1NEEA 3E01B 2H9ZA 3I0SA 2EPIA 4ZIVA 4GKKF 2M88A 2N4DA 3BGUA 4NI2A 1P8GA 2HW3A 2YH0A 1URRA 1VDHA 2G1HA 2HVEA 3GFHA 4ZCKA 4RW9A 5KFKA 2HQFA 1WDDA 5CQGA 4MAKA 2P9EA 4P71A 1RLCL 3BSOA 2DKOB 2IYGA 4GVLA 1EX8A 1NU4A 4TY8A 2DNZA 4DR2F 3KDNA 3MEEA 2G0IA 3EGNA 4CP5A 2BKOA 1UEVA 2CQPA 3M8RA 1CULA 4B08A 1QAXA 2QGFB 1JLAB 4CLFA 3DLEB 2ZUGA 2V2VA 1VRUA 3K59A 5KFFA 2KTQA 3BGRB 2VASA 3DRSA 2H4WB 4M63A 3TARA 4YDXA 2YWKA 1R8AA 1HWJA 2QFIA 2QIFA 2QO3A 1KVJA 5KFOA 2YNGB 4CDIA 2M70A 4LMZA 1E6YB 1FTCA 1NNDA 1IKYA 4K50A 2FVQA 3QGGA 2V6AA 4CLKA 3K5OA 3KLEA 5JVGQ 2WHOA 3MPUB 3FDSA 4K4UA 3EYZA 3UFCX 3MTKA 1JLQA 3H0PA 3C6UA 1QUVA 3W9HA 4RLEA 3A12A 2JC0A 3QNWB 4OZ1A 5KT5A 1WC0A 2ZH5A 2D74B 2FD2A 2B8QA 2VIHA 2LP4A 4CLPA 2ADBA 1ITPA 2C3MA 2HSEB 2IMOA 2DO4A 5KFHA 3JTPA 4R0EA 5HROA 2DXDA 1AB8A 4YHHF 1RISA 3NNAA 1RE1B 1EETA 2FHMA 1C0UA 3ZZRA 3TOQA 1R6YA 2FUG9 4NXNJ 3M9MB 2AEFA 1TL5A 3CCZA 1SB6A 2ZE2A 2EXUA 2E7XA 3G82B 4F0HA 3OUYB 2FLOA 4F25A 5A8RB 2HHSA 2DNPA 1R8CA 2E9RX 2ZEJA 2MGZA 2HG4A 1CS4A 1F5BA 4JI3J 2A10A 2IM1A 3CULA 1YJRA 4PWWA 1X9SA 1S1WA 4DR7F 3SCIE 2EKYA 3MM7A 3UE2A 1WC1A 2HRUA 4LBPA 2BKNA 2XMAA 1APSA 2RSQA 3LW5C 2LDYA 4CO1A 1EP4B 1NK0A 1SVDA 5D77A 2DGWA 2WVFA 3SQGB 1XERA 4S0MA 3CDUA 3IGNA 2Y3YA 4PG4A 2VU5A 1HI8A 2LYVA 4YR0A 4Q8FA 4QWDA 2OO4A 4KQZA 2CNKB 4MH8A 3TUZC 2R7XA 4FPRA 3MR7A 2V8VA 5L9XA 3GR1A 1FK9B 1K73T 1S1TB 3HI9A 1KBRA 4LF2A 1L3UA 1FX2A 4KHPF 2EFVA 1U2RA 1FDDA 1WUUA 2W2QP 3KG0A 1N0UA 2OLWA 3X3UA 3A8JA 1FX4A 2HS3A 2AT1B 3IG1B 5KG2A 4WP3A 4EBEA 3UD3P 3OR2A 3KHHA 1TKXB 5IM0B 1DQAA 3PYEA 4KPCA 4ZITA 1HQUB 1D09B 3PXGa 3OLAA 2LDIA 2WVBA 1S1XB 3DU5A 2XY7A 2D3ZA 3W9JA 1C1BA 2MQMA 2F4VJ 3DKDA 4LVNP 3LGHA 4ID5B 3HJFA 2UUBJ 2JEIA 2NR0A 1RU2A 3ULHA 1S99A 4IFYA 5DDQC 3ICLA 4QYZK 2V2KA 1SJFA 2JLEA 3A8KA 5AXMA 3UR3C 2CNOB 2EBEA 3HLUA 1GXLA 3O8WA 3ILIA 1I94J 3SI8A 4F8RA 4DL0C 2I8EA 3R5DA 3MFHA 2AF6A 1BWEA 2R8IA 1S6QB 2W2PP 3CNQP 3TAMA 1R0AA 4HH0A 3MCOA 3I5CA 2OD6A 4UOCA 2H51B 3MM8B 1HNXJ 3RW7A 1D9FA 4F36A 4B17A 1KOOA 3V81A 3EGZA 2GAGC 2UP1A 2QRRA 3EVOA 3NS5A 4NLSA 1HPZB 1N6QA 1RHMB 2JRSA 3CMES 2VD3A 4EO6A 4ZLJA 1NAQA 4U7UK 1UPMB 1ELOA 1PKUA 4HH1A 4O3NA 4ECSA 4GVBA 3A8EA 4QIEA 2XGPA 3JYTB 2UUAF 3AXMA 4ZP9A 1N5YB 3PO5A 1REVB 2F9DA 4P2XA 2ACMA 2Z58B 2VA2A 1S49A 5EWGA 2CJYB 1HBNA 2ALZA 2KXFA 2HAFA 4W98A 1LWEA 3BSAA 4QW9A 1KP6A 1QAIA 2IM0A 4PABA 4OJ3A 4AQYF 4MKVA 2LKZA 1HNVB 1VISA 1UVLA 1NK6A 3QAUA 5BYQA 4DPTA 1EAYC 1D1UA 2F8MA 1RYSA 1NM2A 2B9EA 3HVAA 2IFXA 2KVQE 1F9EB 3BBBA 3GB0A 2WVDA 2BM1A 1Z2ZA 3AD8C 3QYYA 4F7VA 3PFEA 5DS7A 3FBCA 4NMLA 3FVYA 1HNIA 4FKYA 4OFZA 4ZHRA 4H4MA 2V8HA 3C15B 4DPUA 1Q16B 2E1AA 5CAAA 2C2OB 3ZNUA 1FKPB 2C2ZB 5J2MB 4K4YA 4RKUC 4NLGA 4TLQA 4ZLLA 4WFXA 4WXOA 2R2RA 3AQPA 3NMRA 1FEHA 1IQTA 3TJAA 5KT4A 2UXDJ 2E5JA 4YB6A 1Q8KA 2CPHA 4LRDA 3ZZ0A 4C7QA 5H9FJ 1JWWA 3PTWA 3F73A 1WEZA 2E5LJ 1ZETA 3KLHB 2BJ9A 2KT5A 1QLNA 1S9EA 4XO0A 1QE1A 2QV6A 5E2QA 3C2PA 3G8QA 2QZ8A 2C42A 4XIUA 2PC6A 2CXEA 3FQLA 3M32A 1VQYA 4K4WA 4NLWA 2MJNA 1GAOA 3KJNB 5MLCV 1KHWA 5DO2A 4NX9A 5CYQA 3OV7A 2J6TA 2YWEA 2XEXA 2MZ1A 3M8QA 3OJSA 1HBUB 4MK8A 5A0YA 2FTRA 3NWGA 1YG0A 2VDIA 2ZBPA 3ZC4A 2V0NA 5IFMA 3BR8A 1LW0B 3HM9A 5D4OA 1CSJA 4DUTA 4URGA 3PNIA 2B9YA 2NZ4A 4LQ3A 1KQFB 2KHDA 3F56A 1NHKL 3OFEA 3FSIA 5LT5A 3HCXA 4RR5A 4PG6A 1VIXA 1WOPA 3FCVA 1PAUB 5HBMB 4DQQA 3JSBA 2F4VF 5K8NA 2CQCA 1T9YA 4IG0A 2UUBF 2G2YA 2IC3A 2LXFA 3PV8A 3MUTP 3I0SB 4L73A 5DDOC 1NK4A 4PG7A 1NK8A 3N5BA 1VBKA 4QR2A 3DDKA 3O3LA 1P9QC 3TEGA 2CJKA 1PG5B 4RW9B 3VTIA 5IZHA 2EG2A 3MPDA 1FA0A 1I94F 2IVMA 4HTJA 3QZ7A 3K5NA 3AAWB 2CDRB 4C3KA 3I0RB 4TY8B 3HFKA 2HQ3A 1IR2A 3EVMA 3AT1B 1NK7A 1WORA 2CUYA 1DFDA 1HNXF 5KFWA 2I5JB 1T95A 1YIJS 5KT2A 2BZ2A 1HWIA 1S7IA 4AFFA 5GAHI 3CD0A 3JAMY 2W9BA 2XBPA 1UZDA 3R7BB 2X51A 3UR0A 2XLKA 4ZP8A 5CXTA 5D6GA 1BLUA 2GO9A 4X4SA 4OZNA 1VMBA 3CMQA 4RUAA 2ASYA 2RRNA 1IKYB 3H4DA 4DV6J 2OSRA 3GONA 2OMOA 3HVWA 5DG9A 4L74A 4DN0A 3TVYA 1UETA 3NWRA 1U26A 3EPIA 3MMAA 2CPYA 2XSJA 2R2TA 2A1BA 3C6UB 3T5KA 2IYIA 5HATA 2CPZA 2V67A 1FI4A 1DTTA 1WG4A 4FYDA 2APOA 3DLKB 5E3CA 1BE4A 5IT9U 5HN0A 2XI3A 3U1NA 5D0EA 1EETB 4IH6A 4KPYA 1C0UB 3W61A 3OR1B 1J5OA 1X4BA 2PEBA 3EWGA 3WIVA 1Q53A 2BJDA 2KT2A 4YP3A 2RQKA 1NXIA 2ZE2B 5CCLA 2XLJA 3HHLD 2QEXS 2OIHA 4KC5A 1SKWA 2DEIA 2MGZB 4BS2A 1CS4B 2GHVC 4Y2AA 4DL4A 3N28A 1RTHA 1S1UA 1GFWB 1WEYA 5K20B 2E5LF 3MMJA 2HNYA 2LFVA 3FCWA 4Q8EA 5LMNJ 1G1XA 4TQRA 2KRBA 1SKRA 1NJWA 3QQCD 3Q83A 4C9DA 7FDRA 3QGPA 2CQ3A 1SH0A 4WJBA 1WKLA 3HT3A 2ALYB 4X4UA 2UVUA 3Q8SB 3MR3A 2MKYA 1IN0A 3WBZA 3W1YC 1H2TZ 3ET6B 2DGTA 4EEYA 5KAKA 2JFKA 5FDLA 4EO8A 2ROEA 1XWLA 4A8OA 2OGUA 3LP2A 3KUGA 3PEJA 1K1SA 2HLUA 1T94A 1OPZA 4YB1P 2F40A 3J7YU 1JLFB 1QVFR 3MECA 2AU0A 3WC2A 2BE2A 3RJMB 2VA3A 1JLEA 2YKPA 2QL5B 4ICLB 1MROA 3T19A 1RABB 3EGWB 2AD9A 3EVWA 3KK2A 1C1CA 1VQPS 1EB0A 5BR8F 2VFTA 1C1BB 1C4AA 1WC5A 4ED0A 1RT1B 3JTOA 3G86A 1U45A 3JTNA 2J7KA 3BH7B 4ELTA 3HZEA 2P6TA 5CA5A 5C2GA 3KNAA 2BRLA 4WKYA 1FWKA 4EBCA 4A8MP 2G1DA 4IQMA 4BC7A 2RS2A 4QCLA 3CW2C 3CIZA 2YY3A 3PRDA 2XO7A 2PA8D 2WW4A 5ETKA 1IJEB 2DGOA 1M5KC 5D15A 3IAS9 3C14A 2B0GA 4NLQA 4CRJA 4NLYA 3I31A 2Y1IA 2R4FA 1ZA2B 1C0TB 1KWMA 1T9XA 2EFOA 2P2CB 2UVVA 3TAMB 3NGRA 5B09A 1N0VC 3MM5A 3DGVA 4OHVA 3BN7A 2FLNA 4USVA 4URSA 1CVJA 2PEHA 1UA0A 4JV0A 3PX4A 1TTHB 4NLTA 1RBOB 3P8BB 3PVXA 3AOCA 4QIFA 1N6QB 3Q8QB 4DJBA 4JV1A 4DV2J 1HMVA 2WBMA 4ELVA 5HANA 2KFZA 2E7WA 4U7CA 4LF7J 3HZGA 8AT1B 2ZVIA 2HGLA 1LQ9A 2LCWA 2U2FA 3HHDA 2KI2A 3UDCA 3NNCA 4OI0A 2Y8YA 1WF2A 4YN3B 3H5XA 1RDRA 2M0GB 4BLGA 5GAEI 1HBNB 3RG6A 3ILJA 1J27A 4DV6F 2NXCA 4X4TA 2HBQB 1TL3B 1U1MA 3MAHA 2MKHA 4CH1A 5J2PB 5DRKA 3UVJA 2UUCF 3GQCA 4E8UA 1YJTA 2Z56B 4KR0B 1NK9A 4F4AA 3OT9A 3KHLA 1WELA 2VPZB 1NBEB 3OXLA 2DNOA 3DDIA 1IBCB 3RRGA 1IM6A 1GEHA 3LAMA 3EE3A 2B9WA 4N8NA 4HACB 1RT5A 5D8HB 3BDEA 1FT8A 3BV8A 5CZVA 4NCBA 1FCAA 5ETMA 3W7BA 4QR0A 1YRUA 2IM2A 3VAKA 3IFEA 2RD5C 2L9DA 5K5MA 1HNIB 1OY6A 2UXBJ 2G4BA 4NCGA 3D1QA 2FYXA 4QWEA 1RADB 3IXQA 4QIWD 1M1HA 5KG7A 1SIZA 2DGQA 5HQLA 1BUXA 1NPPA 5CD4H 6FDRA 5IOLA 2W2OP 1ZAVA 2IA0A 2W24A 2VUGA 4HLBA 2HYIB 5LMNF 2ZH4A 4JYAJ 2BYCA 1F3FA 3NCPA 1QE1B 1X4HA 2PMZD 3QPIA 1U2CA 2DHHA 2UUTA 2P6SA 1UJ4A 2B7BB 4DV3J 1U1RA 3M1VA 3H42A 5EX0A 3G6XA 1X31C 1RXOB 2V8PA 3M32B 4RL1A 3IS9B 3ZTSA 4DDFA 3W5ZA 5DLFA 3QRPA 3PO4A 2Z30B 1H2VZ 3N6NA 4J91A 1RLDA 2G0JA 1T3NA 4KB7A 3VAFA 1XTZA 1U0HA 3DRYA 4O3SA 2LQ5A 2IHR1 4ZVEA 3CCVS 2P8IA 4ECZA 2HNDA 2W9CB 2IAJA 3V6JA 3MEDB 2NREA 5F8HA 2CQDA 2Y0SD 3DOLA 4CO2A 2XYGB 4ZVTB 2FGOA 2RF2A 1RAIB 3HFVA 1OQ3A 4LFAJ 5HVFA 4X66F 2YWGA 1HA1A 3MFIA 3UO0A 3RYLA 1L5UA 2Z2ZA 1MW7A 4U7UD 4K4XA 2CYYA 1QTMA 1RUSA 4IG0B 5KFZA 2XMVA 2VQEJ 2QG9B 1V5VA 3R9LA 4J9NA 2H65B 3TQEA 3I5BA 3KDOA 5HVGA 2R8JA 4P75A 3VAGA 4N7TA 1S72S 5BXIA 1RT2B 4NRUA 1VQLS 4QYRA 4LSLA 5HMYA 4USTA 4I4BA 4NRTA 3VGUA 1IXKA 2CQ1A 4I6AA 2BQRA 4LF8J 2GC8A 1XIQA 2DY9A 4RNNA 3K2YA 2CIMA 4ZVGA 5IQ6A 3CF5Q 3VF0B 1XMQJ 2WONA 3CJSA 1T8EA 1R8HA 3K57A 3N0VA 3KLFA 4KTQA 3IWNC 1RA7A 1U0SA 4CCHA 2KL8A 3N01A 5KG4A 2VPXB 1UKUA 2ROGA 2MHNA 2MY7A 4D3GA 2G2ZA 4KFBA 5KFBA 1FKOA 4TYBA 2W9BB 3OTOJ 3VR1A 3PG9A 4EMDA 5B0AA 4DV2F 5F8IA 1H7XA 1FE4A 4IUFA 2WSCC 1FNMA 4LF7F 2RHSB 3BGFA 2LQ8A 4Q2MA 4PYAA 1S48A 2VICA 3AXKA 1NDPA 1JJCB 4C3MA 1AFJA 2AEJA 5A6PA 4WFAQ 4O3OA 3PCOB 2B51A 4YB7A 4Q5VA 2DH7A 4WU2A 3K5LA 1VLOA 1X7VA 3IRXA 2ZBIA 3PYFA 4F04B 3ZFVA 1SH2A 1XC9A 2XSJB 1MU2A 1T0TV 1WHVA 2UUWA 4OHXA 1FVSA 4RX6A 4CTAA 1DBDA 3DXBA 2OTJS 4O3PA 3EZOA 3B82A 1FRXA 1KTVA 1TKZA 1GXUA 1SJQA 1LK7A 1NO8A 1UJ5A 1NJIT 2ZOMA 4I6WA 4YFUA 3CCLS 3LUYA 4IOBA 4OX7A 1TMJA 3SSRA 1J5OB 4R25A 5T41A 1X4AA 4ANCA 2W9AA 3MCMA 1X4FA 4RBUA 1Y11A 2RS8A 5DGAA 2KG0A 1F3VA 2OPRA 1X9MA 4K0KJ 1QTNB 3BF4A 3LPYA 1PSDA 2LMIA 2M2BA 1MNEA 2BABA 2HMIA 5FJ4A 1RTHB 5FLXU 2R2SA 2MB0B 2CQHA 5A8WA 3N5FA 5BYRA 3P49B 5JXSA 1RHKB 2MKCA 3PIOQ 1VYAA 4Z7YA 3WC0A 4YOEA 5KT3A 1NK5A 4DV3F 4PWDA 4DN9A 2F5GA 2HHHJ 4N77A 4USJC 2KM8C 1N34J 1LXNA 3NL0A 4ZMMA 1GX6A 3GG0A 4NLRA 3RGIA 3LOUA 5F8GA 4GRSA 2FHKA 3KG4A 2DNGA 1PBUA 5FDLB 2YNFA 2AYBA 2GCFA 3LP2B 3JSMA 3BSCA 2VC1A 3V4MA 2HIQA 4LREA 2GGPA 2IJNA 4BWJA 3MECB 5I4MA 5JUMA 4DPOA 3S01A 2BE2B 3MAAA 3R5GA 1JLEB 2GHPA 1W2IA 1YBUA 2ZFHA 2W7PA 4ANEA 3NBPA 4DCPB 2HZAA 3KK2B 2BX6A 3I9V9 1Q82T 4B3RJ 2GQCA 4WFYA 4KH0B 3QSYB 2VQEF 2XMJA 2Q79A 4DL6A 2RMLA 4TKTA 2CJAA 1JXVA 4J9PA 3HHNB 1IQZA 3O6QA 3TJ8A 2EEYA 2BV3A 2C3YA 1BY9A 1KLMB 4N47A 4B3OA 2HGNA 3UDEA 3BJYA 3S6EA 1HHTP 1XNQJ 4RW8A 1UFLA 2LEBA 4TVAB 3NKYA 1SH3A 4OX8A 1KFSA 3M2VA 1RP5A 4DMZA 1X5OA 5M2PA 3C14B 1MMNA 1YWXA 1CJUA 4TY9A 2V8GA 2HK3A 2GHWA 2JC1A 2GJ2A 1S0OA 3BKTA 1XMQF 2EI5A 4Q0BA 5KFDA 4FS1A 2D3O1 1JIHA 5I42A 2MY8A 4V19X 4NEZA 5F0UA 3TANA 2ZNZA 3DCAA 3TI0A 3OTOF 2VG6B 4B02A 4IQXA 3CCUS 4C8NA 4USIA 5KFCA 1OS5A 2WB1D 3CJ8A 3K89A 2O3DA 1FERA 1O0PA 2CQ2A 2W2MP 3FZ2A 4YY3J 3T5LA 5E7OB 1RHQB 2XULA 4QU7A 1GK8A 3DLGA 2J6SA 2V68A 4RWXA 3GV5B 1WKKA 1Q79A 2N7YA 2RRBA 5L8RC 1S4EA 4DSLA 3VAHA 2MKKA 3QATA 3S1TA 1REGX 4PQUA 3CJ5A 4X4RA 1PBAA 1WTFA 4DSIA 1RT4B 4Y3CA 2XSFA 3DI6A 4OI4A 3F0NA 3BYRA 3ZZTA 3CD7A 3DRPB 1B64A 4C8OA 1TMMA 4FF3A 4FZVA 3P6YC 3O2IA 2X3GA 1CBKA 1CQMA 4B9TA 2O67A 2XMWA 2P5VA 1RT5B 2E44A 5F41A 3R7NB 2RU3A 1O6XA 2QL9B 2MLYA 4E2FB 3MD3A 3BYPA 4R8UB 3CPWR 4OZ3A 1D9DA 2NQPA 1SCJB 1WC6A 4JI6F 4FN5A 4P74A 4K0KF 2RT3A 4ER8A 4UOGA 2RUSA 2DGUA 1AUDA 4XPCA 1HARA 4UF4A 2RQMA 4UZCA 1UVIA 5ETPA 4WYWA 4P73A 5LJ3Y 4CLUA 1VQ4S 1M5VC 1SKSA 3QWPA 4B9VA 4QPTA 2BRKA 2V4QA 1WG5A 2R7WA 4QIVA 2V9WA 5H9EK 3L09A 3T9ZA 3KLGB 3QLHA 2GJIA 4JI5J 1AZSB 4OI3A 3M1VB 3Q2SC 3H2UB 2GMHA 5B0DA 4OX6A 2RB7A 2JWNA 1N54B 1N34F 1R89A 1RKIA 1R43A 4XDCA 1KN6A 3MDFA 2MLZA 4CLZA 5IWAF 2FVCA 1HWKA 3MCSA 1U6BA 2C2MB 5C25A 1YQHA 2MTLA 4HI1A 4O0IA 3M8PA 1U0HB 3MPYA 2ZH8A 3T3FA 3D0IE 4JI1J 4MKBA 1VCTA 3CJ2A 3I5AA 2IRUA 5D4NA 1RWKB 4NWBA 2YPZA 3ISZA 2DRDA 2BANB 5I3QA 1U25A 1VFJA 2E5HA 2EG1A 4TXSA 4TU8A 3I6PA 2ZKUA 3D0GE 2B4UA 4FBUA 4X4NA 3I4HX 2KKHA 3R1LA 1UAWA 5ETSA 2DR9A 2NUHA 4DFKA 1Y3KA 2BUNA 2MQPA 5KG6A 2R7RA 3V6DA 1YHQS 1ZYQA 4FVCA 1RWMB 3IO1A 4DXLA 4B9LA 1AT1B 4BWMA 4LSLB 1FFGB 2QSWA 4IR9A 2EK6A 3T1HJ 2ZWPA 2M5YA 2G0CA 4B9UA 3CCRS 1PC5A 3M4XA 2ERRA 3C46A 3OFGA 4AT1B 2C3PA 5CYMA 3D5MA 1K0VA 1DURA 2I0XA 3TO8A 1LFWA 3W2WA 2WONB 1IJFB 4LQ9A 5C42B 3MEGA 2CNNB 3KLFB 1NZ8A 3CEDA 3RB3A 3ETOA 3GJSB 3M8SA 4DR5J 2B7CB 2AJ4A 4UQGA 3PR4A 1MMDA 2MZSA 4CYUA 2WZ1A 3CD5A 3EUNA 3TJ9A 1U1KA 3DM2A 2CPEA 2KN4A 4YY3F 2I6WA 4M5GA 5KOWA 4DPYA 3UCUP 3UPFA 3LP0A 3FEZA 2QE5A 3MM9B 2H54B 4I0WA 4ZN3A 1N5TA 2C22A 2J9CA 4PPZA 2LECA 3J80Y 1WC3A 3AD7C 1PYOB 3HKZD 4P9SA 3RB6A 4U6PA 1RWUA 2MLXA 4KGXB 4FS2A 1Q8IA 2W4CA 1UW4A 4H4OA 3VVTA 3FNNA 5E33A 4LF6J 3CJTA 2N3OA 2QJ3A 2VQFJ 3UCZP 1T05B 3CCES 3HXMA 4NMXA 2XC9A 4LFBJ 3FFIA 3DNCA 4OYXA 1VQKS 5AXLA 3Q24A 2BDPA 1V6HA 3MR5A 2BEFA 1TVRB 3IR5B 1T03A 2HBYB 4F2RA 3B6BA 2KJVA 4A8WA 4DL3A 2LQBA 3MURP 1YSJA 4EZ9A 5KFTA 3LO3A 2CJQA 3IR7B 1FEEA 4X4PA 1S1VB 2JSXA 1RAEB 2Z0GA 1Q0NA 4HYKA 2B4VA 2CZVC 4ZIWA 4DS5A 2KRRA 2JL9A 5KFXA 2AEMA 3QSIA 1K0TA 3MMCA 4CLYA 2RU9A 3LGNA 2DJWA 1N33F 5A8WB 2J9DE 2J8AA 3G71S 5KFAA 2KJWA 3BKFA 2IDLA 5G0RA 1XMOJ 4JI5F 2RVJA 1PCAA 5F8MA 1MN9A 2MYFA 5K14B 4WKRA 2MJUA 3NGTA 1WWHA 4ENOA 3KKFA 3GFYA 4PWDB 2HPUA 2WVEA 1Q8BA 1C2PA 3RAXA 1HBOA 1DTQA 3GR0A 3CB4A 4I6YA 3OQ2A 2BQ3A 1UVKA 2ATCB 4UOHA 1ZA1B 4P2MA 1FFWB 4CM2A 3N4WA 4FP9A 4DR4J 3VGSA 4JI1F 3POTB 1VR6A 1XEZA 2X1AA 2UU9F 1B0PA 3GIJA 4ZJQA 2DHXA 2BKPA 2XZDB 2V34A 1SQEA 3VAMA 1SJ3P 2GGPB 5DZ7A 3GV7B 1VLYA 2W01A 3TP2A 2MQ8A 3MAAB 2R2UA 4WYLA 2JOQA 3QWUA
chains in the Genus database with same CATH topology
1JLBA 4AFFA 3M2UA 2K3IA 1FF2A 3EZUA 4PG8A 5GAHI 3MPWA 1SJRA 3KLIB 3SCKE 4AL6A 2JVRA 2PIIA 4DG1A 1RQ0A 2LQ9A 2DRAA 5CYQB 5K8PA 2YNHA 1W2BR 4IKAA 3CD0A 3G9CA 5EWEA 1FRMA 3JAMY 4WFNQ 3SSSA 1Y0HA 4ID8A 2W9BA 1BC6A 2YTCA 4NYZA 4LVOP 1CQNA 3M6WA 5MAOA 1SV5A 2XBPA 3AA9A 1VQ8S 4O4GB 1Q1KA 2X51A 3M8QB 4I2PA 3UR0A 2XLKA 4AYBD 1OPIA 4ZP8A 1VQ6S 5CXTA 2CKWA 2R7VA 4GMKA 5KFYA 1ULRA 5D6GA 3T9NA 5A0YB 1BLUA 2GO9A 4ZKAA 4DV2F 1GT8A 2FIUA 3OVBA 4X4SA 1KQGB 1HI1A 1O5JA 1S9FA 5C5JA 2GFFA 1RT3A 3EXYA 3KWMA 1XBWA 1BD6A 2PO4A 4OZNA 4BC9A 3PY8A 1M5HA 1VMBA 3DYAB 1HQEA 2JHEA 3O44A 2L41A 4JI8F 4RW8B 2CQGA 2HFNA 2V4JB 4JV2A 4RUAA 2J6UA 2NSCA 2ASYA 1VQNS 2RQCA 2QLXA 2RRNA 1NZAA 2R7TA 4Y2KA 2KDOA 2QMWA 1IKYB 3T1HF 3K8WA 3I56S 4J9QA 3M2VB 4C98A 4EBDA 3H4DA 3MMCB 4CO5A 1NB7A 3P5TL 1V3ZA 2RKIA 4NPOA 1DJ0A 3CDBA 5D3GA 1WHXA 2MZTA 3G6ES 3LALA 1U1LA 2E9ZA 5DQIA 1W25A 4Y2IA 2WTFA 3KK1A 1D0EA 4J9LA 1M5OC 2AWZA 2J0SD 2OSRA 3BO4A 3IBWA 2OMOA 1ZZFA 3HVWA 3RTVA 5DG9A 2ZJQQ 2YH1A 3PRBA 2XWXA 3VZHA 2DPIA 2JEGA 3CXCR 4CIOA 1NRKA 4DN0A 3TVYA 1UETA 2QT7A 1FNXH 3DRRA 4ED7A 1U26A 4R5PB 4NLPA 2QFJA 3EPIA 3MMAA 2L9WA 1JLCA 2HFZA 2O66A 5D4PA 3TYTA 2CPYA 2XSJA 2R2TA 2A1BA 2B4OA 3IWXA 2HZCA 4FNIA 3KK3B 3C6UB 1LXJA 3SMZA 2HVZA 3M6XA 5HL7Q 4OLPA 3T5KA 4F26A 1QY7A 2IYIA 2IC3B 4I1TA 1DTQB 3GFZA 2WCXA 1BQMA 4ECUA 4DSEA 3IGVA 1R3NA 1JLFA 1Y3JA 2DIUA 2GW8A 2CPZA 2VBWA 5KOXA 2ASLA 3MI7X 5C24A 2E5IA 1Q7LB 3IAM9 3TAPA 2GIQA 2JEFA 4LFCF 3FEYB 1DTTA 5K8MA 3FSXA 2BQUA 2F7VA 2RILA 1WG4A 3VCDA 5J2QB 3KTQA 2ZH3A 1KTQA 2KVIA 4FYDA 3MOJB 3HVRA 2APOA 3CCWA 3DLKB 5E3CA 2ZH1A 2XB2D 1ZBTA 2N3LA 5B08A 2XMMA 1X5PA 4M95A 5CYJA 3MM6A 1UA1A 1VQSA 4ICLA 5HN0A 1VK8A 3X1LB 2MQNA 2XI3A 3U1NA 5KFLA 3PW2A 1U1NA 2HS4A 5G4DA 1EETB 2GQ2A 1P6TA 2D1CA 4IH6A 2HWIA 2BBEA 3C6TA 4KPYA 1C0UB 5IQQA 5KFNA 5I3PA 4ZVFA 1PGZA 2DB1A 5I3UA 3OR1B 1J5OA 1YBAA 2NPIA 1X4BA 2HWHA 3KYLA 5IT9Y 4OMFG 1Q53A 1RT1A 2BJDA 2KT2A 1JX4A 4YP3A 1VQ9S 3T6JA 1ZOTA 3VAIA 1KSPA 1C4CA 2AJ1A 2OP5A 2RQKA 4UQTA 5HMXA 3H5UA 2XZWA 3BEGB 2ZE2B 5B0EA 1NJXA 4NCAA 4HT7A 5D4LA 3JSRA 3ZZZA 2FPHX 5CCLA 2N7CA 2XLJA 2YKAA 1YRTA 1X4GA 4FXVA 4DV1F 4RW4A 1S7HA 5HLFA 5THWA 2QA4G 1S9GA 1JLGA 5KFRA 3HHLD 2QEXS 4WE1B 4C0OC 1ZM3A 2MDAA 4ED2A 2OIHA 3BREA 2XGQA 1RT6A 3LF0A 4KC5A 3SEOA 1U8SA 1SKWA 4MJKA 4ZPTR 2NS1B 1XR6A 1NHUA 3M2RB 5J1PA 5GAGI 2MGZB 4B3MF 4BS2A 2E9TA 2GHVC 3RZAA 4Y2AA 4DL4A 4LF6F 3N28A 2O01C 4I7FA 1RTHA 1S1UA 1LWCA 3GE9A 4E98A 2C2RA 1SXLA 1WNEA 4PQUB 1TFWA 1UMJA 1WEYA 2VONA 5F8LA 2NPFA 1HNZF 3I4PA 2E5LF 3OXGA 3MMJA 1RYRA 2EFPA 1VC0A 1KR4A 2HNYA 3E3XA 2OFHX 4Q8EA 1HW9A 2UVRA 3L7OA 1KD1T 4BCAA 2KYZA 1SV5B 4TQRA 4ECTA 4LFBF 4WTYA 2ZZNA 3MUVP 1G1XA 2KRBA 1C0TA 5J1EB 1SKRA 2XHWA 2YQ3A 1NJWA 2BACA 1Q78A 3VQSA 3P96A 2KG1A 1TV6A 4C9DA 5B0GA 4CNZA 3M30A 4HI2A 7FDRA 3NGKA 1BQXA 2ZH9A 4F4XA 1RT3B 3Q8RB 2XI2A 3QGPA 4OZJA 3LWMA 2CQ3A 3DOMA 5HP1B 1SH0A 3UDLA 4WJBA 4J9KA 3DRXA 1HQEB 1KS2A 1YJUA 2VPWB 2V94A 1A7GE 1IM4A 3HT3A 2YKMA 5F8JA 2EWHA 1VQ7S 1P1TA 1RTJA 3LANA 4EU0A 1JJHA 4OHYA 4X4UA 3QO9A 1U1OA 4DHVA 1WI8A 4IO1A 2FLLA 2UVUA 1TL1A 4IG3A 5DG8A 3Q8SB 1LK5A 3MR3A 1AXQA 3FMBA 3HDSA 1LOUA 1U47A 1N52B 2RKIB 1IN0A 2L9NA 1KFDA 3WBZA 1H2TZ 2A2DA 1ZM9A 3H25A 3DLBA 1IKVA 2XS5A 3KMSA 3MR2A 3SZ2A 5AE1A 2DGTA 2FGCA 4EEYA 3O1LA 5KAKA 1JKHA 2N4CA 3FSYA 3MMAB 5GADI 2BW2A 1U1PA 2JFKA 1JJ2R 5FDLA 4RNMA 4EO8A 4OHZA 1HW8A 2ROEA 1XWLA 4A8OA 3R5AA 3LP2A 1TQLA 4AUKA 2X1BA 3PEJA 4O44B 1K1SA 2HLUA 1T94A 2NXUA 1OPZA 4YB1P 1KRPA 3AB4B 4HHJA 2F40A 1ZAXA 1BQMB 2LA4A 3QJLA 3J7YU 4OL8A 1JLFB 2FHJA 3D0HE 1QVFR 1KONA 2FC9A 1NJZA 2F8EX 4QR1A 4Y0FA 3H8YA 2K2PA 3MECA 3AA8A 3TA1A 2DNYA 5DGBA 1DTTB 3MTJA 4N5SA 2AU0A 3DLHA 2KZMA 3CGIA 1YGYA 3WC2A 2Z2MA 3CMAS 2DT9A 2VG5A 4NLUA 4TU7A 4AL7A 2BE2A 3HK2A 4TLRA 3MWBA 2VA3A 2M3DA 1JLEA 5F8NA 1DLOA 1QSYA 4KHMA 2YKPA 1HD1A 4Q45A 1TL3A 1KEKA 1XMOF 1TR0A 3MM6B 3TW0A 4ICLB 1MMLA 1MROA 5J2PA 4PRFA 4DSFA 4QW8A 3T19A 3TUJC 5L9NA 3VALA 3EGWB 1A6LA 2AD9A 2WRMA 1O8BA 3KK2A 2ZC4A 3C6TB 1QAYA 1C1CA 1VQPS 5BR8F 5I3UB 2UXBF 2VFTA 4G3IA 1C1BB 1C4AA 1N5QA 3OHBA 4ED0A 1RT1B 3AY0A 3JTOA 2K1RA 3CDEA 4XDDA 2VBYA 3G86A 3THVA 2ASDA 1U45A 5A8KA 3C66A 3JTNA 3RR8A 2J7KA 4ELTA 2FC8A 4PWUA 3HZEA 1LWFB 2P6TA 4DL2A 5J2NB 5CA5A 3BGRA 4ECXA 4NLXA 3EPGA 4HEA9 3UD4P 1FJEB 4B3TF 2PE8A 3KNAA 2BRLA 4CO0A 4OX9F 4WKYA 1UFWA 1U09A 4EBCA 4ZOSA 1JLGB 4A8MP 1HD0A 2QA1A 1TK5A 1ZAWA 2KXHA 4Q44A 2G1DA 5KT7A 4IQMA 2HGMA 4NA3A 4AXJA 2OPSB 2JDJA 1RT6B 5C25B 2ZZMA 4OJ1A 2YNGA 1M5SA 4BC7A 4ZPDA 2XNQA 2RS2A 4L3NA 3K0JA 2OSQA 1QJHA 3QIPB 3TA2A 2FHOB 4QCLA 1VOMA 4MIBA 3M8PB 3CIZA 4FNHA 2YY3A 3PRDA 3H2LA 2XO7A 2PA8D 3OTCA 1S1UB 1VS3A 5GAHU