3R1LA

Crystal structure of the class i ligase ribozyme-substrate preligation complex, c47u mutant, mg2+ bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title The structural basis of RNA-catalyzed RNA polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 22
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3r1lA00
3G4SS 1H2UX 3OW2R 3EGZA 3G8TA 1Q7YT 3MUVP 2L41A 2LQ5A 2DNMA 2MJUA 2Q79A 2RQ4A 5HO4A 1DHMA 1U1KA 1KOOA 3NMRA 3CCQS 3UCGA 2EVZA 2CQ0A 1WHYA 2J76E 2MQQA 2NZ4A 1O0PA 3G71S 3BS9A 1OO0B 1HA1A 3MI7X 1WTBA 1FJEB 3TP2A 3D2WA 4TU9A 2G4BA 2CPHA 2DGSA 2CQPA 2DNRA 1D9AA 1A7GE 2PEHA 2DH7A 2MKSA 3SDEB 4C4WA 2G1DA 1WEXA 2HGLA 5DDRC 3LPYA 2M8HA 3L3CA 3I55S 1U1MA 1VQLS 3HHNB 1P27B 2MSTA 2MY7A 4UY8T 1SJFA 4QPTA 4QU7A 1SXLA 2KI2A 2L08A 2DHAA 2DNGA 1VBZA 4PR6A 2KXNB 1U1OA 4IOCQ 3VAGA 1UP1A 2DH8A 1U1QA 2CQ1A 2YWKA 5IM0A 3IRWP 2HGNA 2CQ3A 2RS8A 1YIJS 3NNCA 1FHTA 2B0GA 3NNHA 2MMYA 1U6FA 1X5PA 1X0FA 1SJQA 2MXYA 2I38A 3HI9A 1VQ9S 4LMZA 2MJNA 1FJCA 3IWNC 2N7CA 2DNNA 3CCRS 2DHSA 2CPFA 3NS6A 1NU4A 2JVRA 1FT8A 1OPIA 2HZCA 2RT3A 2RU3A 2CJKA 2MQNA 3PIPQ 5LSLA 1YWXA 4IOAQ 2X1AA 4FXVA 4CH1A 2CPEA 2DB1A 3RW7A 1X4DA 2KM8C 3Q2TC 2FC9A 1DRZA 5FJ4A 2M8DB 3CCES 4V19X 2XNQA 1NO8A 1UFWA 1VC0A 4CIOA 3VAHA 3G8SA 1PGZA 1M1KT 1WF2A 2E5JA 1YHQS 3CC4S 2DH9A 2KG0A 2MZJA 1VQPS 1SJ4P 1WF0A 1WG4A 1VQNS 1X5OA 2MY8A 4J5OA 3G9CA 5IM0B 1F9FA 4WFAQ 1Q82T 1VQ8S 2YKAA 2MSSA 3THPA 3MD3A 1RK8A 3CCLS 3Q2SC 3TO8A 1U1PA 4F02A 2XNRA 1VC6A 5LSOA 2FPHX 2LCWA 5IFMA 2MKCA 2GHPA 2DIUA 1R8HA 2GO9A 4OZ0A 2KU7A 1U1NA 1IQTA 1VQMS 2MKHA 3H2VE 2CPJA 3MURP 2CQBA 5MLCV 4P6QA 5DM6Q 3VAMA 1WG5A 1VQ5S 1ZZNA 3FEYB 4FXWA 1KC8T 2VOPA 2LXIA 5BJRA 2M52A 4TU8A 2AYMA 2J0QD 2D3OR 2DGVA 3S8SA 4F25A 2KYXA 1U1RA 1W2BR 3MUMP 4W90B 1S79A 1YTYA 3PIOQ 1G2EA 2DGTA 2ZJRQ 4IO9Q 2CQCA 2CPYA 3G96A 2M0GB 1X4BA 1WI8A 1NJIT 2V94A 2HGMA 3VAKA 2MZ1A 2DHXA 2LYVA 1S72S 2XS5A 1A9NB 5LJ5Y 3P3DA 2DGXA 2OJ3A 3MUTP 1OWXA 3CUNA 2O3DA 2A3JA 2DGQA 3RW6A 3VF0B 2LEAA 5GAGU 2M88A 2CPXA 2MYFA 1X5SA 4LJMA 1VQOS 1VQKS 3S01A 3U1MA 1CVJA 2CQGA 3UD4P 1X4FA 2ADCA 5CA5A 3CCJS 3UE2A 3FEXB 1Q86T 3P49B 2JVOA 2VONA 2DNKA 2DIVA 2D9OA 2G0CA 4CQ1A 1X4EA 2DNLA 3DXBA 4EGLA 2BZ2A 2FY1A 3CCMS 3P6YC 1BY9A 2LECA 2LEBA 4YOEA 2CQIA 4CH0S 1WWHA 2I2YA 2J8AA 1H2VZ 2FHOB 2HVZA 4ERDA 4Z2XA 4ZKAA 4TU7A 3V4MA 1JJHA 4TLQA 3U1LA 4LIRA 1DBDA 2XSFA 1M5PC 3CD6S 1VQ7S 1HL6A 5LXYA 2F9DA 2ERRA 2RUGA 5HL7Q 2DNYA 3SMZA 2MB0B 2XS2A 3MOJB 2ADBA 2DO0A 2QA4S 3B4MA 3I56S 2RRBA 1K9MT 1R8PA 5CXTA 1D8ZA 2KXFA 2CPDA 4W92B 3THTA 2N3OA 3BO4A 2MGZA 2X1GA 1UW4A 3CC7S 1WF1A 4C7QA 2MKKA 2X1FA 3CTRA 5DDOC 3US5A 3R1HA 2YTCA 2ZJQQ 2KM8B 3DLLQ 2QFJA 2CQ4A 2OTJS 1JJ2R 2KN4A 2HYIB 1X5TA 3CCVS 1X4CA 1FXLA 2CQ2A 3S7RA 4PRFA 3J7YU 3J7ZT 5ITHA 2VODA 3CF5Q 1YJWS 1M5VC 2E5IA 1ZH5A 4UQTA 1JJ4A 3CMAS 1QVGR 2KT5A 3NS5A 1L3KA 4YUDA 1WEZA 2E5GA 1U6BA 2VOOA 2M4MA 3CPWR 5EN1A 2MQMA 2MQLA 2FC8A 2MKIA 2OTLS 1WEYA 1SJRA 2PE8A 3CCUS 2WBRA 2X1BA 4Y0FA 1YJ9S 3VAJA 5H1SV 4OZ1A 2M2BA 4WFBQ 1VBXA 1Q81T 3K0JA 4WF9Q 4M5DB 3NNAA 2DNPA 3ZZZA 2L9WA 2RS2A 5LXRA 2MGZB 1N88A 2DISA 2LA6A 1M5OC 4A8XA 1FNXH 5DDPC 2YH0A 1WHVA 3R1LA 1U1LA 2AYGA 2LMIA 2M70A 4RU2A 4QQBA 2RVJA 1N54B 1U2FA 2DNHA 2U2FA 2KFYA 2DGOA 2RRAA 1HD0A 2CPZA 1H6KX 1WHXA 2F3JA 2DGWA 3JB9k 2KG1A 4Y00A 2MZSA 5GMKa 1WELA 2CPIA 2AYEA 3BEGB 1URNA 4F26A 2MKJA 2SXLA 4IUFA 1QM9A 3CCSS 3ZZYA 2ZJPQ 4ED5A 3R27A 3G6ES 3BO2A 2MQPA 3UCUP 1WG1A 5IQQA 2CQHA 5GAEU 4WFNQ 3CMES 5D77A 5DDQC 1M90T 1N8RT 2OSQA 2JWNA 4YB1P 2OSRA 5JVGQ 1VC5A 2AD9A 1JMTA 2M9KA 2DHGA 3VAIA 1UAWA 1WHWA 3P5TL 5D78A 1FO1A 2EK1A 2U1AA 5DETA 5DM7Q 1B7FA 2CQDA 2RQCA 1HD1A 2KH9A 2DGUA 1KQSR 1VQ6S 2LXUA 2N82B 2DO4A 4U67Q 1M5KC 2MHNA 2MZQA 1KD1T 2YH1A 2XB2D 3EGNA 1P1TA 4WCEQ 1X4GA 1ZZFA 5JVHQ 1AUDA 3CXCR 4BS2A 2KHCA 2M7SA 3VAFA 3CC2S 2OIHA 2MZTA 2EK6A 2DNQA 3N9UC 1PO6A 2JX2A 1FJ7A 3UD3P 1X4AA 5LJ3Y 3B4DA 2JRSA 4WIIA 2K3KA 2NLWA 1YI2S 2D9PA 3H2UB 1RKJA 1K73T 5GVQA 3UCZP 5GADU 3SDEA 5CYJA 1H2TZ 2DNOA 3S6EA 1YJNS 4C0OC 1OIAA 2KVIA 1YITS 3EX7B 3MXHP 3MD1A 2MZRA 1VBYA 2AYBA 1VQ4S 2KXHA 2F9JA 4PKDB 2DITA 2N3LA 2KRRA 2K8GA 5GAHU 1N52B 1XN9A 2DNZA 2E5HA 2MQOA 1SJ3P 2DK2A 1K8AT 2BOPA 3TYTA 1WI6A 2KRBA 2RNEA 3SXLA 1DZ5A 3UWTA 4QU6A 2LA4A 2J0SD 2XS7A 3MDFA 2UP1A 3BO3A 1QVFR 4WKRA 2E44A 2LKZA 3LQVA 3ULHA 1X4HA 2MPUA 3CULA 1KOHA 3VALA 2QEXS
chains in the Genus database with same CATH superfamily
1KONA 3GJSB 4URGA 3R9LA 2NXNA 4Q2LA 4DV7J 2VH7A 1D8YA 3ETMA 3QJLA 1FCAA 1K1SA 2C2OB 4RPFA 2ABYA 4E2FB 5I42B 2K3IA 4TLRA 5KFTA 3U02A 1BD6A 5AXLA 4C0BA 3JYTA 3DHXA 3HXMA 1YZ7A 3RB4A 4UOFA 3HHNB 1SC6A 4QU7A 1SXLA 1RA7A 4O44A 4ZPDA 2FJXA 4NYPA 1YRTA 1UTAA 1UVJA 2CQ1A 5KFDA 1QLNA 1VK8A 1HNIA 3NNCA 4FYWB 2QV6A 3HSGA 3M32B 1X0FA 2UVUA 3IWNC 3CCRS 1IKVA 2DHSA 3H42A 2RU3A 4X4TA 1FT8A 4YQWA 2E9TA 3P8BB 2UXBJ 3HVWA 4O4GB 3TZYA 1XQIA 4QYZJ 3D4JA 2XNQA 1TQLA 1EP4A 4ILLA 1SIWB 2QE5A 2XY6A 3C19A 2J6SA 5L1KA 2HRYA 4RLEA 1RXOB 3CJ2A 3DLHA 1EARA 2RDIA 1RSCA 2W7OA 3VR1A 3CCLS 3AH6A 2R7SA 4Q8EA 2LCWA 2XHWA 2AP6A 1R8HA 3VHQA 3QJJA 2FYXA 1VQMS 4JI8F 1VQ5S 1KC8T 2X3GA 2OPQA 2RB7A 5HMWA 3ET6A 4I6WA 4EEYA 4OV1A 1T9UA 1T9WA 3OTEA 4E98A 2XS5A 3P3DA 2VDHA 1KR4A 1YSJA 3A3PB 4XAKA 5GAGU 2CIMA 3OTOJ 3QIPB 3QJPA 4I6YA 2N4DA 2R2UA 2KJVA 3P49B 3QT6A 3DRSA 4XDCA 1UKUA 4OI1A 3GZ7A 4K0KJ 1RHKB 4NLYA 1U48A 3UQSA 1WSVA 2R7UA 5JJBA 1LKZA 3MMCA 5LXYA 4JI1J 4RW9A 4UY85 4J9SA 3BKUA 1OSCA 4H4KC 1EHWA 1T3NA 1IBLF 4KT0C 1L3TA 3BO4A 2B4OA 4IG3A 4MH8A 4KGKA 3GILA 2P2CB 4MTPA 2G2YA 3LGHA 2IRYA 4L73A 1E6YB 2HYIB 1X5TA 5LMNJ 3D0GE 3GV7B 3IC1A 4P74A 4ZIWA 2Q66A 3KYLA 1M5VC 1C1CB 1CG2A 5E3QA 4YUDA 2XSJA 1IM4A 3IA0A 2FC8A 4KKOB 4NLDA 3AODA 4PXBA 5H1SV 1XR5A 1Q81T 2VC0A 1N88A 4IDKB 4NCGB 4A8XA 2DEIA 1C0TA 2YH0A 1U1LA 2AYGA 2PGCA 3R2DJ 2R7OA 4RU2A 5DZ7A 1IR2A 4WP8A 2YVSA 2R8HA 5ETRA 5KFWA 4S0MA 4LVNP 2XLIA 2HWHA 4FKYA 4JI3F 1S1TA 1F3FA 1ELOA 4X65J 2BACA 2J8SA 1X9SA 1TK5A 4C8MA 3FSYA 1YVFA 3MFHA 1U2CA 2R8GA 3QAEA 4DV4F 1FJGF 1CJTB 2J9CA 3EGWB 2DHGA 1HKAA 5D78A 2QSWA 3AQPA 4YEAA 2H51B 4ZHRB 3Q8PB 4F04B 3LTOA 2U1AA 1RT7A 2HW3A 2ZOMA 2DPJA 4DR1F 2OMOA 2ZVSA 1WC6A 4KBIA 2C3OA 2OIHA 4F4XA 2VG7B 4ZS6A 2YKMB 4PG6A 3B4DA 2PI5A 3TRGA 1QE1A 5K14B 2C2MB 3CO9A 4USUA 1XMQF 4NI2A 1FX2A 4ECXA 4QWDA 2OPSA 5IXUA 3R7SB 2FZGB 3TYTA 7FDRA 3UWTA 3D67A 4OZ5A 4JI0F 2GGPB 1HNWF 2QEXS 3GR1A 2DNMA 3DLEA 3QSYB 3MMBB 5B0AA 4ZPVR 1VRTA 3UCGA 5L39A 2QYCA 3FMWA 2NR0A 1RAEB 3IR6B 2GQ2A 1CJKB 2VQFJ 5E41A 2BM0A 1D9AA 3IRXB 3KKFA 4LF6J 1CJUA 1C0UA 2WONB 2HHTA 2DRDA 2K2PA 3CMQA 1IR1A 1TVRB 5C25A 2L08A 2E9ZA 3DM2B 4UUWA 4IOCQ 1NK8A 4LR7A 5CYMB 1TL5A 3HZEA 1S9GA 2HK3A 1U6FA 1ZA1B 4J9NA 3HKZD 1ZTWA 3HI9A 2MJNA 4CLLA 1NZ8A 3NS6A 4MYTA 1IQZA 3H5YA 1NLKL 4DL6A 4FXVA 4I4BA 3DRXA 3MF5A 1CEZA 2MKYA 3JYTB 3PYGA 1UFWA 3LP0A 3VGUA 1NKEA 5DQHA 1XMOJ 2Y8WA 1F5CA 4O44B 4ZVSB 2UVRA 2MSSA 5IC4B 1HNIB 3BYPA 2KFZA 1F9HA 4XK8C 2PFDA 2D69A 2R2TA 4UUXA 1WKKA 3MPWA 1IKVB 3N4WA 2NYIA 4ZP9A 3PNIA 4YR0A 4YP3A 1PJ5A 1IKYA 3D28A 5A2QY 2LXIA 5B7WA 4DR6J 2D3OR 5F8IA 1S97A 4W90B 2UUBJ 1YZ6A 1YTYA 3DNCA 1EP4B 3ZZTA 2QL7B 1RI7A 5LJ5Y 1HQUA 4DV5J 2V4RA 2BKNA 4DR2F 3VF0B 2M88A 4F4WA 3J7AN 3ADAC 1TKDA 1PG5B 2C28A 3DLGA 2BW2A 5L46A 5F8LA 3PR4A 2VPYB 3DHWC 4B9MA 1FF2A 3Q8QB 1WC0A 2G0CA 3NWRA 1Q4RA 2HMIA 3MMJA 4IFYA 4F2SA 4FF1A 4EZ9A 4FNHA 3BH7B 4WYWA 1H2VZ 2OPQB 3GFHA 2KVQE 4NWBA 3V4MA 3ET6B 4ELUA 3D6HB 3I6PA 2V50A 3QFWA 1RDRA 2X51A 5HJYA 1CPZA 2J9EA 3SMZA 2QA4S 5GMEA 3CCTA 1N5TA 5H9FK 3EUNA 3NCRA 2KDOA 3TEGA 2HBQB 3BN7A 3KG0A 3I4HX 3M8WA 2CQ4A 1OYEA 3JSRA 3ZZPA 4N56A 3DRSB 3E01A 4NPOA 1NPPA 1UJ4A 2BBEA 2VODA 3CF5Q 1ZH5A 1TL3A 1EQMA 2HQGA 2FJWA 1U6BA 3EPIA 2Q6CA 2FTRA 3HK2A 4LR8A 3SQGA 2QL5B 2PMZD 2OO4A 3MMCB 2X1BA 2YBVA 4RW9B 3QPIA 3V81A 2M2BA 2AGQA 1PILA 4PWDA 2JOQA 4A8FA 1EZZB 4IG3B 5F8HA 2YY3A 4F4KA 4U96A 5LL6d 3CO0P 3O6QA 2LMIA 3T1AA 1KRPA 4U7CA 2CPZA 3RUBL 4F3MA 4CLSA 1GK8A 2MKJA 1PC5A 1BE4A 3RBZA 2O5DA 4F67A 3OLAA 2XSJB 5I3PA 4AQYF 2B8PA 1M90T 4RJVA 1ZPVA 2M9KA 5KFMA 2HRUA 4UQGA 3P96A 4DPXA 4F7VA 1C0TB 4JI8J 1FDDA 1FNMA 1VQ6S 1WC5A 5L9NA 1KD1T 4DX6A 1KFSA 3CE8A 2GJFA 3VWSA 3ZXWA 4P2XA 2IDLA 3DI6A 2XO7A 3ZC4A 1S1TB 4RUAA 2WCXA 1RT2A 3F44A 4EWTA 3KHRA 4IG0A 3R5JB 5B0EA 4X4OA 4Y2MA 2AJ2A 1K73T 4X4QA 3R5GA 4ZLLA 4ECYA 1GXUA 2IVMA 4D3HA 3QGIA 3LGNA 1YJNS 2KVIA 1T9VA 3MXHP 5U47A 3I0SA 4I68A 4ZVTB 4IOBA 1SJ3P 5H9EK 1RT7B 5DJBA 3H7HB 3AJDA 3OHAA 2E44A 2MPUA 5KG4A 4DHVA 4EK2A 3GPAA 3EYZA 3FJ2A 1WNEA 3G71S 4KHPF 4NMXA 2ZM6F 1SCJB 1ZAVA 3D2WA 3BREA 4TU9A 1QE1B 2DNRA 2YQ1A 1IBLJ 4OHZA 1A7GE 4NI2B 2HGLA 1S5ZA 4O0NA 5FLXU 5C5JA 3GIJA 2OPSB 1S10A 3QIDA 2ZITA 1K47A 1UP1A 2DH8A 3Q83A 3RRGA 1SC3B 3QWPA 2VASA 3DDIA 4DN0A 1RISA 4FPIA 1UA0A 3DLEB 1KP6A 2N7CA 2VA3A 1VRTB 5DG9A 1M1GA 2UZAA 4M95A 5F8NA 1LV5A 4YFUA 1HNZF 2OLWA 3MCSA 2DJWA 2XGQA 5KG0A 2NXJA 1S6PB 1CJUB 1C0UB 3JSYA 1NO8A 2PEBA 4ZA1A 2KFNA 1IWGA 1PGZA 4ID8A 2RE1A 2F8HA 4JI5F 4K5SA 3W9JA 5C25B 1W25A 4AUKA 4OZ3A 4DR3F 1VQNS 3PX6A 4USIA 4DCPB 4WFAQ 4JI3J 2QYGA 4J37A 1AROP 5LSOA 1S9GB 2GHPA 4Q8FA 1FD2A 4OZ0A 1QTMA 5EUHA 3SZ2A 4LSZB 2QJ3A 4DV4J 3GJTB 3GYXB 1FJGJ 1LW2A 1IJEB 2VOPA 3PJXA 3FCHA 4TU8A 2WW8A 3V6HA 1FRJA 4QZVB 4PG8A 2ZUGA 2Z8QA 3V5RA 5DLFA 2EG2A 3LP0B 2PMWA 3AOCA 2XWYA 4DR1J 1ZM3A 2IBOA 1KTVA 1OWXA 2JEGA 1YRXA 2RF2A 2DGQA 2CNLB 3DCAA 2L9NA 4B3RF 2CPXA 1YBAA 4P7TA 2CQGA 3UD4P 2EKNA 3KLHA 4Z7YA 2GMLA 2PC6A 1XMQJ 2QLJB 1IKYB 2AZ1A 1BY9A 1JXLA 4A4JA 1WWHA 5A0YA 5HVFA 1HBOA 3JXOA 5BR8F 4JI0J 3A3OB 4FZVA 1EX8A 2JL9A 1HNWJ 5ETSA 3TAPA 3AJ2A 3B4MA 1HQUB 2UV8A 2CPDA 4W92B 3AD7C 1JQGA 1OYDA 1S7IA 5DDOC 2RU9A 1OSDA 2J7WA 3DLGB 4QW8A 2QFJA 1WSRA 2WRMA 1TFYA 3S7RA 2HMIB 4IFYB 5ITHA 3TZWA 2RH3A 1HWUA 3KLFA 1L3KA 1FE0A 4G3IA 5D6GA 2IYGA 2K7JA 4K4YA 2OEJA 1D1UA 2HBRB 1S0NA 1FWKA 4HEA9 3CWJA 4CLKA 1YJ9S 2XMUA 3BBFA 1S1UA 3EMTA 3AOBA 4HTIA 3K0JA 5ADZA 4ZCIA 2AX1A 2QIFA 3HFZB 3D6TB 2J9DE 3Q8VA 1EETA 5KT6A 2M70A 4ZITA 2XLKA 3DYAA 1MNEA 3ZZUA 4OYMA 2F3JA 2NS1B 5L38A 1BMQB 1L3SA 3E01B 2ZH2A 5CQGA 1TL3B 4ED5A 4P71A 3BO2A 1QUPA 3O44A 3SQGB 2LFVA 2V2VA 2XI3A 2ILZA 4Y34A 4LQ9A 1N8RT 2HVIA 2D7SA 2HNYA 3BM7A 5JVGQ 4CP5A 2XMKA 2ZHBA 4WK3A 3Q8SB 3V81B 4PWDB 1RA6A 2QO3A 3V4IA 3SSRA 4F0MA 2GIFA 3AFGA 4YDXA 1PIEA 4EO6A 3E8OA 1DARA 1LK5A 2V4QA 4DZ6A 1XERA 2X3DA 3HFVA 1RQ0A 3CJ4A 2K3KA 2OPRA 4DR2J 3MD1A 3BDEA 2KXHA 3MM8A 4KPYA 2UUTA 1SH0A 3NKYA 1XBWA 2W4PA 3J81Y 2EWHA 4BBYA 3BSAA 4BCAA 3MGJA 2AMCB 1M5HA 4BWJA 3MAHA 4Q0BA 3MUVP 1HW8A 2MJUA 1VIXA 3IWLA 3DI6B 2J76E 4QW9A 4OHYA 1JLAA 1RT2B 2OMLA 1AB8A 3KFWX 4IG0B 1SC4B 3BGUA 1KQFB 5LM7E 4Q5VA 3Q23A 4F0KA 2YX1A 2Z2LA 9RUBA 1T03A 3FVYA 4J9LA 3I0SB 4CO0A 3POTA 1ROFA 5DGAA 3RJMB 2DNGA 4DR7F 2YWKA 1J2VA 4B9SA 2CQ3A 1GQEA 3NNHA 3DU5A 2OKQA 3BH6B 3NAIA 4LRCA 1FDNA 2CPFA 1APSA 2JVRA 4B9NA 3K7RA 2MQNA 3W61A 2DXFA 1WKJA 2ZC3A 1M1HA 1MSWD 4TY9A 4DQPA 4W98A 1H38A 1YQHA 4TYBA 2R9LA 3IR5B 3NLCA 2HNZA 1WF2A 1WG4A 2BE7D 1UVMA 1EAYC 2YKAA 2HK2A 2ZH4A 4AT1B 1H73A 3RZAA 3OBIA 4ZPTR 2GNKA 1SUQA 2GQCA 2OGUA 2MKCA 2F4VF 2JC1A 3EZ5A 4CLPA 2EFNA 2F65A 2NUHA 3PO4A 4AQYJ 4EO8A 2BJ1A 3FSXA 5BJRA 2CWXA 2J0QD 2W9BB 2V6AA 4AD6A 3S8SA 3IGVA 2C2ZB 4YMEA 4I0WA 1WD6A 3PYDA 2VZ9A 3E2EA 3Q8YA 5KT3A 4KSEB 2Q6BA 5HMXA 1P9QC 5DS7A 2Q43A 1LEOA 1EB0A 1SH2A 2CNOB 1X5SA 3S01A 2WAQD 3KMSA 4F4YA 2GV1A 4HHHA 1T94A 2ZE2A 3FEXB 2JVOA 3LAKA 4DLEA 4CQ1A 3DXBA 4LFAF 1O5JA 1RACB 1RGVA 1LW2B 3DGVA 4L74A 1MN7A 1BWEA 4LIRA 3ZTRA 4U6PA 2W2QP 1YLXA 2YPYA 3JTOA 3OTBA 5E2QA 3Q8RB 2LQ8A 4M5DA 4GRSA 2RF2B 2YNHA 4A47A 3CJKA 1VRUA 4HACA 4UTGA 1OPZA 2EXUA 2IFXA 2YTCA 4KHPJ 2COLA 3DLLQ 2ZM6J 4ECWA 2NXCA 3EDQB 3CCZA 8ATCB 1DQAA 5KFEA 4DDFA 3C16A 1QVGR 2HQ3A 2ZKTA 5A0YB 3RGIA 2E5GA 2DY9A 1HBOB 4NMLA 5HMZA 1WEYA 3MEGA 1KN6A 2ROPA 1DQ9A 1N34F 2AZ3A 5J2MA 3TA2A 1FDAA 3NGKA 1XNRF 5E3PA 1FFGB 4IKAA 4QQBA 4LF2A 1I3OB 1U0SA 1HNZJ 3I5BA 3A4TA 3VZHA 4D3GA 1WELA 1TFWA 4TNOA 3U1NA 4ZVPB 1YRUA 5CZVA 4JI5J 3KLFB 4RNNA 4DR3J 2ZD1A 4DZDA 2Z0GA 4HVZA 5HSPA 4WFNQ 3P5BP 3FBCA 1S1UB 2W2PP 4BC9A 4R5PA 1A0OB 4L76A 2W7AA 1EETB 4KR0B 3WC2A 5IWAF 3DYAB 2NCKL 1J27A 3EPGA 2MZTA 4ED1A 4UOGA 5B0DA 5DQGA 3C6UA 2WSFC 1V5VA 2JHEA 2QRRA 3TUJC 2XWXA 1S4FA 3PKMA 3LWMA 3M05A 2HFVA 3DXSX 1H72C 1RYSA 3UCZP 3AOAA 5CYJA 3D1QA 2EFPA 4B3RJ 4Q7AA 2ZH9A 2MZRA 2AYBA 2HNYB 3GE9A 3HVRA 3HVAA 2KRRA 3SCJE 1IVZA 3FUYA 5E3AA 1LWFA 3JQKA 3OXGA 4HI1A 3CIZA 3OL8A 3V4IB 3SXLA 9ATCB 1N48A 4P2MA 4WTOB 3H0PA 2YNIB 2HIYA 1BQMA 4F8RA 3NOCA 4GKJF 2DBBA 1DAXA 3D0IE 5HO4A 1DHMA 3MAAA 1U1KA 1T05A 4K2XA 3X1LB 5BR8J 4GC6A 1X0PA 4Y2KA 4OL8A 3TUZC 3HF5A 5E0OA 3F41A 4DWIA 2C42A 5KFNA 4B9UA 4MIAA 2OPRB 3U27A 2IA6A 2OUGA 3L3CA 1BWVA 3MM8B 4ZVUB 3CJ5A 2W4DA 3L9ZA 3R97A 2OH2A 1UEUA 3DRPA 3KLVA 1YIJS 3N6LA 5HP1A 4Q0BB 2XYGB 1SJQA 4UOCA 2MXYA 5JUMA 4EBEA 4M5KA 3ENQA 4NLPA 4J9MA 1I1GA 3OL9A 3GIIA 1JLAB 3TVKA 3CCWA 4B08A 1NRKA 2FGOA 1PBAA 3UFCX 4NL5A 3PV8A 2ASLA 5KFHA 2D3UA 1TKXA 1H7WA 2H1YA 1T03B 2E5JA 1YHQS 1TV6A 4ZK7M 3POTB 4F4ZA 1HWKA 5D0EA 1Q16B 2J5AA 3T1YF 1S57A 3ZZ0A 4ID5A 2HIQA 3Q2SC 3EXCX 2IJRA 3SV4A 1U1NA 4I6AA 2Y1RI 2J0XA 5MLCV 2EFGA 2V8DA 1WOPA 3L7PA 3EE3A 2NSCA 3LO3A 2P5VA 2BOAA 1FKPB 2KYXA 2E1CA 5ETNA 4BDPA 2XMJA 4LRFA 2IC3A 4LQ3A 4R0JA 2M0GB 2HNZB 4B9TA 2DHXA 1DLOA 4GMKA 2NYHA 3HMJG 3PW2A 3RBDA 1VQOS 4OFZA 3M9MB 2ADCA 1CQNA 4QR0A 1SUQB 4EZ6A 1REVA 3J7YI 5F0WA 2D9OA 4MKAA 4ZN3A 1P6TA 1VHFA 1B64A 1XK8A 2IPOB 4CH0S 2ZZMA 2GJIA 2J8AA 2FHOB 1FWLA 1LNQA 2HG4A 1M5PC 4PG7A 2E5LF 3CD6S 4DN9A 2ERRA 2DT9A 5HL7Q 3C46A 1AFJA 1UJ5A 4K4UA 1W2IA 3J7A1 4YS2A 4NCBA 3W9IA 1T0TV 4B3SF 2DXDA 3HHLC 2ZJQQ 2KM8B 2HKEA 3RAQA 4LBHA 2ZE2B 2VIHA 2GZOA 4X64F 3PM9A 3M9NB 4X84A 1PYTA 5K8NA 3IFEA 4LUBA 4DR7J 5LT5A 4CDIA 3EGVA 3KXDA 2UVVA 4ES3A 4WFBQ 3CNQP 4M5DB 5T14A 2YNHB 2GIQA 1U45A 3CJKB 1VRUB 4HACB 2DISA 2LA6A 5KFIA 2QLXA 3GG0A 2ALYB 5CD4H 2R42A 4LRBA 3WIUA 1IKWA 4HLBA 2XMMA 3W9HA 2W01A 2WB4A 1KLMA 4WU2A 3M6XA 3C16B 3UN3A 4FBUA 1VFJA 4IH7A 1PC4A 3CMES 5D77A 1G1XA 3C14A 3MEGB 2F4FA 1X60A 2YXLA 2QMUB 2QLFB 2F4VJ 2BXJA 4GO7X 3KJVA 5J2MB 2DGUA 1DY3A 4DL2A 1FNOA 3MCMA 2JZ5A 5HROA 3H4DA 2M7SA 3H20A 7AT1B 4OZJA 4K5RA 4DQRA 4V1Ak 1NM2A 5KFBA 1NB7A 2ZD1B 4C6AA 3CDAA 1H2TZ 4QPXA 2RKIA 4ECQA 3BQ2A 2X7IA 1VQ4S 5CZXA 1FA0A 4CO5A 2JH3A 4R5PB 2DK2A 5D4PA 3QSIA 2RNEA 2ROEA 4DV2F 1JKHA 3H59A 4LFAJ 3T5KA 4OZLA 1JX4A 2LKZA 3NAHA 3ULHA 1VCTA 2B56A 1Q53A 4PUOA 3NMRA 5CH7B 6FD1A 3NY0A 2YWEA 4FNIA 3TWZA 1O0PA 3C6UB 3KDOA 1ZM4A 2G4BA 2XYHB 4QJVA 1OJ4A 1P1LA 2FJAB 1VQLS 1IBMF 5A8RA 3CD5A 4PEOA 1U25A 1LWFB 2RD5C 1YJ7A 3GG1A 1U1QA 1YK9A 4ER8A 3GYNA 1B70B 1BQMB 3FFIA 2ZBQA 2Z2MA 2GMHA 1NH7A 3MAAB 2XCPA 1T05B 2PA8D 1SPBP 1NJWA 2HRTA 1YWXA 3Q22A 3WBZA 5L1JA 3SCIE 3J80U 1N34J 3D54A 4HH1A 1GMWD 2CJ9A 2P6TA 1XNRJ 4NRTA 2B4VA 1G3OA 2V34A 2C22A 2Z58B 1PCAA 3O3LA 1LWXA 4HDHA 4G1IA 1QSYA 3OVSA 4J5OA 1RADB 4J7CA 4WP9A 2NXEA 3DRPB 4LREA 2H5EA 4HTJA 3N79A 4FN5A 3VTIA 5KFAA 4F02A 1GXTA 5HP1B 2FPHX 1UEKA 3MEEA 4JV0A 3RR8A 2IJNA 4MAKA 1T7PA 2H65B 2RHQB 2B9YA 1MWZA 2AF6A 4IQMA 2CQBA 4P6QA 5IS2A 3KWMA 4I2QA 1WDDA 3TVYA 2AT1B 2BUNA 3GMGA 1TKXB 5K8MA 1X4BA 3IAM9 5IWAJ 3MR6A 3MUTP 4WWSA 3RW6A 3IO1A 2DR5A 1VQKS 1TKTA 1FVSA 4ID5B 4KQZA 1TMMA 3HD2A 4R25A 2W9CA 5KFZA 3I9ZA 2KKHA 2CAJA 3IR7B 3N0VA 2A2DA 3M9OB 2HFNA 4KHMA 1IUJA 2CJAA 2K1RA 4RBUA 3BQ1A 5EDWA 4LF1A 3WZ0A 2LEBA 3KNGA 4ANCA 4O4RA 1UPPA 4NLXA 4NLTA 3RAXA 1JJHA 3AD8C 4CI0B 1TAUA 4CT9A 2IC3B 3M30A 2RUGA 1MU2A 3TJ8A 1DLOB 4GKJJ 5AXKA 3RG6A 3GIMA 4K4ZA 3D6MB 3DDNA 4RWWA 2HS3A 3PFEA 3MHYA 4C8OA 2B4PA 1Y3KA 4MIWA 5ETPA 3CJ8A 5KFQA 2QX0A 2HQDA 1JJ2R 3KLGA 4A8SA 1REVB 2WB1D 5F8GA 1X4CA 4WU3A 1AT1B 3M8YA 4ZVRB 2ZUAA 1DFDA 4F2RA 4ANEA 3M6UA 4JI6F 1FEEA 4FF3A 3NS5A 3SIPB 5CCLA 4DFMA 1WEZA 2VOOA 4RO0A 4K50A 4XO0A 2HWIA 2PE8A 3T5JA 3BR9A 5J1EA 1OQ3A 4DPTA 4OZ1A 1ICEB 2BQUA 4NA1A 1U49A 2DNPA 1FWPA 3HSZA 4CLWA 5E33A 1HMVA 2BE9B 4ZVOB 3TUIC 1L3UA 1UA1A 2DNHA 3DC2A 1LFWA 2XZTB 2RRAA 1OY6A 1RZMA 4ZLJA 1Z1ZA 3PG9A 4USWA 3T41A 2BRKA 3CCSS 3HSJA 2ZJPQ 3MECA 5BYSA 2ZBCA 3G6ES 2MQPA 4PZVA 3T6BA 2VC1A 3THVA 3W3SA 5KG7A 3T1YJ 3MR7A 2OFGX 3KNAA 2OSRA 2R3VA 3FZBA 3HO1A 3UR0A 1WHWA 1I5OB 2CYYA 1RWOB 2IM0A 4EYHB 2BEFA 1B7FA 4FXDA 4O3SA 1HD1A 2R7XA 2HHPA 1FXDA 1IKWB 2FHJD 3MEDA 1RT3A 4BS2A 4N7TA 2J7KA 1KLMB 2VDIA 3UD3P 5F8MA 1N4LA 1SQGA 2OAUA 2DHHA 2KT2A 1PJ6A 3OD2A 3H2UB 2ZZNA 3C14B 2FJEB 1S1XA 5HK4A 4DS5A 3M8ZA 3NCQA 3MFIA 2BOPA 4DV1F 4FS2A 3KJVB 2DR7A 4DS4A 3NG8A 1B3TA 1KOHA 1F3VA 1FXRA 1OY8A 1PYOB 1KOOA 5HROB 1FRXA 2JEIA 2E5LJ 4ED8A 4FF2A 1OO0B 1U6ZA 4MMOA 4RNOA 2MKSA 2RKIB 3I31A 4B3SJ 5IC6B 2DR8A 5G4DA 3H5XA 1KHVA 2EC2A 3FBBA 1TP7A 4X64J 5HMYA 2KZZA 1LXJA 1VISA 2XI2A 1JKHB 3K5NA 3A8IA 3HX9A 2GAHC 2VQEF 4ZCLA 4LMZA 4PUOB 4WZQA 3MTJA 2HZCA 2V9WA 4ECRA 2CJKA 4NEZA 4IOAQ 3QGHA 2B9WA 4CH1A 3H8YA 2KM8C 4OI6A 2HBZB 2VQFF 5FJ4A 2HHVA 4NRUA 1S59A 3ILOA 3PHTA 2PT0A 3R6LB 2HNDA 3CW2C 5A8RB 2AEFA 4WFXA 4K4VA 4DU8A 5D8HB 2QZ8A 2R8IA 4M5MA 3NL0A 4ZLPA 3BGLA 2FB0A 2YNFA 3FFIB 3T5HA 5ETTA 2XNRA 2DIUA 1CBKA 4C97A 5B0BA 3WX8A 2CUYA 4C8YA 1HIYA 2XULA 2BANA 4B9LA 2LQBA 3HLUA 2I8EA 4CO4A 3J7Z5 1R3NA 2A10A 2V8PA 4IYQA 1S72S 1NH8A 4DFKA 1LQ9A 1IN0A 4AFFA 3FMBA 3CEDA 4F4AA 1NNDA 1B4SA 4LF5F 4RWXA 5EWEA 1X4FA 3O5TB 3MEEB 1Q86T 1QY7A 3W63A 2CZ4A 4FBTA 1RWUA 1FVQA 4K4XA 5F41A 4PABA 4I2QB 5HJXA 1DTTA 4DV2J 1G7CB 1U8WA 2UUBF 2K7KA 4M8LA 1S1VA 2XS2A 3I56S 4EI2A 2FY8A 1IJFB 2V69A 5CXTA 1Q8BA 5AE1A 4NZ0A 1F1BB 5HI7A 1E6VA 1TKTB 2QSFA 2W9CB 3DOLA 4JV5F 3PO5A 2P8IA 3NBPA 3BPDA 1FXLA 4JP8A 3ZTQA 3J7ZT 2K1RB 1IBMJ 2HZVA 2PI4A 2BABA 2ZVIA 3BSNA 3CMAS 3RBXA 3N6NA 2VG6A 3DKDA 3DOKA 2QGFB 1N36F 4OYXA 5AXNA 1VQSA 3M30B 3CCUS 2WBRA 4Y0FA 1MU2B 2YKPA 3VAJA 1Y3JA 3HULA 3V6JA 5F0UA 4KY3A 2RS2A 5LXRA 4RU9A 2ZH7A 3V6DA 5DDPC 3BQ0A 4QOTA 1LXNA 1NK4A 5DLGA 1UEVA 2EI5A 2KFYA 2C3MA 4J91A 1TU0B 3I5CA 3PEJA 3KLGB 2KG1A 1XTZA 1JLEA 1UWBA 5GMKa 3R7NB 3KK3A 2CPIA 3MM7A 4IUFA 4LR9A 1RWPB 3ZZYA 4YR3A 3MPDA 4C3MA 1MROA 4RKUC 1OS5A 1VQYA 4EBDA 5DDQC 3T6JA 1IKXA 5J1EB 4CLFA 3VGVA 1FEHA 4ZJOA 4I2PA 3SCKE 3I5AA 2EK1A 2Z56B 3VVUA 5JMNA 4PXEA 1HMVB 2R8KA 1NDKA 4ZPBA 1AUSL 4ETZA 3OFEA 3D3BJ 4H4OA 3G8QA 4N76A 1T9YA 4ES1A 2KHCA 2VF3A 4FDFA 1FJ7A 3MECB 5I3QA 2VPXB 3QNWB 3S6EA 2BRLA 5A8WA 3V6KA 2E1AA 2HHXA 3W5ZA 1VBYA 2F9JA 1S6OA 4DX7A 4LF4F 1HBMA 2G0IA 1HBUA 2DEJA 1MMLA 2WHOA 4NE9C 2LA4A 4JI4F 3BO3A 1VLYA 4ZOSA 3EVWA 5KFXA 4OYWA 2KZMA 3MEDB 1RT3B 3MM6A 1Q8KA 1YJVA 1RAOA 2EVZA 4CLYA 2HQIA 1NDCA 2NZ4A 4LFBF 2ATCB 3MMAA 2V9KA 1WTBA 1NHUA 1FJEB 2DRBA 1TL1A 4K7QA 4J9UE 2HFSA 4PXCA 3Q86A 4DV3F 1S1XB 3PW4A 3MM5B 3PEHA 4QWBA 4CRJA 4ALZA 4LF8F 2Y1JA 3VAGA 3ISZA 1RT4A 1RHRB 3GB0A 2CKWA 2B0GA 3MPYA 5F9NA 4JI6J 5I3UB 4G1QA 3BSCA 4WTYA 1LOUA 1GFWB 2CDRB 3PIPQ 3MTKA 3MWBA 1QAYA 3BKTA 3OV7A 2CPEA 3RW7A 2FC9A 3LWLA 3RYLA 1FD8A 2B7BB 4DI6A 3GONA 2VFSA 2DH9A 4TN2A 1SJ4P 4GO5X 5B08A 5IT9Y 3G9CA 5J2PA 1H3DA 2XG8A 4GC7A 4ZMMA 3T1HF 2CJXB 3AAWB 3M2UA 3PYFA 1TL7A 2ZNYA 1IQTA 2MKHA 2POKA 3AB4B 5ETKA 1WACA 2CPJA 3MURP 4O23A 2Y1LB 3MPUB 3BBBA 4PG4A 3O1LA 1S6UA 3OTDA 4OHVA 5ETOA 1R7IA 4F25A 1FTCA 5ETLA 4J9PA 3LGMA 1TMJA 3HHLD 1X9WA 1S1WA 2OELA 2CJYB 4QWAA 2HNDB 2BW7A 1SKWA 4DPOA 1REGX 3B54A 2O3DA 1RABB 2EBEA 4NA3A 1NSQA 3CDWA 3UN5A 5A76A 3ETOA 1C2PA 1DURA 2QG9B 4LJMA 2YNFB 4OX6A 4ECSA 1NMEB 3NGTA 4MT1A 2VONA 2J6UA 5L1LA 4E0DA 2CQIA 2H5JB 3HPOA 3DGPA 3OFGA 3T3FA 3H25A 4DV1J 3L7UA 4WBFA 1S76D 4KTQA 1W7WA 4OX9F 3TZZA 2WTFA 4CCHA 1D8ZA 1WF1A 1RBLA 5EWFA 4Q44A 3R5DA 2OTJS 2OD6A 3KLEA 3CCVS 2UVWA 5B0FA 1WC1A 3J7YU 1AA1B 1YJWS 3UDEA 2R4FA 3PY8A 1NXIA 2A2CA 1ITPA 4N47A 1DTTB 1MWQA 3NMAA 2FVCA 3QQCD 1SJRA 1SL1A 1VBKA 4OJ1A 1NZAA 1VBXA 2VQEJ 5KFFA 2VICA 1R43A 3JAMU 3HHEA 2CNNB 1M5OC 3TAMA 4ED0A 1N0UA 5KTQA 1E6VB 4MFBA 4OI0A 4OYOA 1OY9A 4WXWA 5CD4A 2DGOA 3PW5A 1HD0A 3DOLB 3T19A 2OD4A 4Y00A 3QAUA 1RB0A 4CZCA 3NBPB 5HLFA 4USVA 1NHKL 1X8DA 2VL1A 1QM9A 2YKOA 3BPSP 2VG6B 1WG1A 3UDVA 3DOKB 3IBFB 2R2SA 1N0VC 1SL2A 3EZUA 1HR0J 4ZVHA 3C66A 4ED4A 5RUBA 2E7WA 3QT5A 3V6DB 3VV2B 1UPMB 2KH9A 5DRKA 2IRXA 1Q8LA 2GC8A 1BGXT 1H74A 3DLJA 1RTZA 3ZTPA 1Z2LA 3BR8A 1JLEB 1UWBB 4C9DA 3KK3B 2UXDF 5THWA 3C2PA 1WDTA 3MM7B 3W1YC 1RHQB 5LJ3Y 3NGRA 2XYPB 3PYEA 3DN9A 1TL4A 4DUTA 1QAJA 1MROB 3HHDA 1AXQA 1OIAA 5A8KA 2ZH3A 4ANDA 2I1RA 4LF5J 1CS4A 1IKXB 4NYOA 2B8QA 1XN9A 4I2PB 3MCNA 2W2MP 2AV5A 1U8SA 2IA0A 1H2UX 4KE5A 4ITSA 4H4OB 2FJDB 5SUHA 2D3ZA 4RX6A 3CGIA 3ICLA 3EJMA 2BR0A 3BS9A 1U4BA 3LA0A 2DGSA 5ETMA 2HWTA 5J1NA 5A8WB 2WVCA 3I55S 2VD3A 4ECVA 3TZXA 1HBMB 1HBUB 2KHDA 2P6SA 5IQ6A 4JV5J 1GH8A 2O1PA 3BSOA 1SBRA 1RTDA 2Z2YB 4CTAA 2DY1A 4IO1A 4J9OA 5K9FA 1X5PA 4ZLNA 2I38A 2DNNA 3MM6B 1N36J 1IM6A 1VMBA 4FYVB 1DQ8A 1MMDA 3MMAB 2NSBA 1TL1B 3IGNA 1SQEA 4KPCA 1RAGB 1UVKA 2WVEA 3F56A 2YKNA 2UUAF 3QRPA 2EKYA 4LFCF 3TNVA 4RR5A 1U47A 3Q0AA 1PSDA 5DO2A 2L9DA 1SKUB 4OQJA 1WF0A 2NXUA 2MY8A 3D0HE 1RT4B 4DL4A 4YB6A 4K4TA 3QT7A 3T9ZA 3TO8A 3W5XA 4G1QB 2CFXA 4LSNA 3VGTA 5K5MA 1LK7A 1F6TA 3HJFA 2G13A 2ALZA 3ENVA 2M52A 2DKOB 2MTLA 5KFJA 1JB0C 4HHJA 4X4UA 4KGVB 2XMTA 1FESA 2HGMA 1XNQF 2GX8A 3TR5A 2IDEA 2A3JA 3GWCA 4PYAA 2AQ4A 5J2PB 3KG1A 3MOZA 1NSKL 4U7UD 4NLVA 4U9RA 4O3OA 3M2UB 4N8NA 3H4BA 1TL7B 3NWGA 3ISNC 4EGLA 3CCMS 4BLGA 1DTQA 3ENAA 4YOEA 1J5OA 1VRQC 4LF4J 5D4NA 3QZ7A 4QYRA 4TU7A 1Y0HA 4RL1A 3U1LA 1NB2A 2WW4A 1S9EA 2PN6A 4JI4J 3ZNJ1 1S1WB 1KDNA 5L8RC 5E3CA 4GKKF 2DNYA 3RTVA 2BDPA 2RRNA 4PCQA 2IM2A 1R8PA 2X1GA 4DLGA 2X1FA 3CTRA 3R1HA 4LFBJ 1Q5YA 2FVQA 2JDJA 1R31A 3R6GB 4LBPA 3QZ8A 4IH5A 1EKRA 3SI8A 4DV6J 1Z2ZA 1JLBA 1S48A 2GJ2A 4DV3J 5GAEI 2BKOA 3DGPB 4X4RA 2C3UA 4LF8J 3A13A 5EN1A 2RDJA 5KG2A 1GMVA 2RHSB 1R0AA 3UPFA 4B3MF 4CT8A 1SB6A 1ZOTA 3NNAA 2DPIA 2L9WA 1QDUB 2V63A 3D9BA 1NEEA 4MKBA 5AJ3F 7FD1A 3DLKA 4EBCA 2HHHF 4DJBA 3GR0A 4RW4A 2HURA 2E7VA 2JSXA 1RP5A 2EFOA 4ED3A 2F8MA 2DGWA 1K0TA 3OQ2A 2PA3A 3KLEB 2V2KA 2VFTA 1KVIA 1MN9A 2BE2A 2XQCA 2NQPA 3TI0A 3CJTA 2V67A 1FK9A 1S9FA 3AA8A 3G86A 5GAHI 1TUVA 2AD9A 3T1HJ 4WFYA 1PJ7A 3CIMA 3TEHB 2KJWA 4M5GA 4RNHA 2ZOGA 1NAQA 3TAMB 3G6YA 4X4PA 2XBPA 4MFBB 1NPRA 3GSDA 2MDAA 4WCEQ 1X4GA 1R8BA 1B0VA 3FC9A 2ILYA 2YQ0A 2V8VA 3CC2S 1HBNA 2EK6A 5HLFB 1B7YB 4HT7A 3ILLA 3PR5B 3OVBA 1X4AA 4FYYB 1YI2S 3M6WA 3NGDA 1D09B 3RAMA 4BHQA 2I5JA 2AIRB 4ZPCA 3SDEA 5KFYA 2DITA 3WQPA 1GMWA 2G0JA 2DNZA 2E5HA 2MQOA 1K8AT 4DPUA 3I4PA 2KRBA 1Y7PA 1UVNA 1FRKA 3CULA 3OW2R 2L41A 4CLZA 2RAQA 2HFUA 1KSPA 4QBUA 2BJ8A 4OX9J 4Y65A 3UVJA 2R7VA 1H0HB 3FEZA 2GS8A 3RBEA 2PMHA 4ETXA 2M8HA 1Y00A 5A8KB 1SL0A 4LRAA 5K14A 4J9KA 2FQQB 2MY7A 1CS4B 1MMNA 1VLOA 1S4EA 1ZA2B 1HNVA 3NRBA 4JYAF 1Q5VA 5IM0A 3CJSA 1FKOA 1S0OA 3C8YA 2H9ZA 5HVHA 3CJQA 3KUEA 1JNZB 3DLBA 1V3ZA 1GEHA 5KG1A 2HHUA 1RT6A 3MAQA 1TAQA 1M5SA 2KB2A 4QIVA 1DRZA 3CCES 3IBCB 4PQAA 3WIVA 5HANA 4UF4A 1QJHA 2F40A 1X5OA 3A8KA 3VZIA 2D1CA 4TKTA 1Q82T 1F9FA 1RTDB 2HAIA 1PKUA 2PSZA 2VB6A 4CTAB 1JXVA 4AL7A 5M2RA 5KT4A 4ZIVA 3TOQA 1CJVA 2XTJP 2E7XA 1NK9A 3FSIA 1VJQA 3VAMA 4PPDA 3FEYB 1RHMB 5IZHA 2ZH5A 3M2RA 4UW2A 2W24A 4DF8A 3IS9A 3MUMP 2YKNB 2ZJRQ 2CQCA 5IOLA 1WI8A 4X62F 4ZN1A 2LYVA 2FVSA 3W64A 3I0RA 2VPWB 2UXDJ 4PG5A 3U1MA 1RE1B 3DU6A 8AT1B 1Y10A 3FCWA 4F3OA 4KGMA 4Q2MA 3H2LA 4LSNB 1UVLA 2HHSA 4KGXB 4OMFG 2E9RX 2VU5A 2LQ9A 2LECA 1WJ9A 4L3KA 2FZCB 1UFKA 2HHQA 3DDKA 1S6QA 4R8UA 2YWFA 2B6AA 4ZJQA 3FRYA 2FLOA 5CCMA 3N01A 1F5AA 3HD1A 3SEOA 5MAOA 3MOJB 3G6VA 1XR7A 1UFLA 4L72B 2V4JA 4B3TF 5D15A 2ZH6A 4PXDA 2VHGA 3U7JA 2MKKA 4A8OA 2VBWA 2ZDOA 2JLEA 2YKQA 4CM2A 2AJQA 2R8JA 3OVAA 2XZDB 3KHHA 5A2QU 2FHJA 2DXEA 5J1PA 1WKLA 3P45B 1DTQB 2V8HA 1J5OB 1YBUA 3B82A 2EPIA 2KT5A 2G1HA 3NXZA 1B0TA 4DG1A 2XCAA 1GNKA 3AT1B 1S9EB 2JC0A 1CC7A 3GFYA 2AGPA 3MZIA 4I7FA 4RW7A 4DOZA 2I6WA 4F0HA 1T02A 3TA1A 2ZWPA 4Y28C 3R5CA 3OFHA 1WHXA 2AWZA 3PRDA 1EJ7L 3B78A 1HYSA 4MYUA 3TARA 2UUAJ 2CVEA 2FLPA 1JLBB 4F26A 2GA7A 1QAIA 3IAS9 4LFCJ 3AJ1A 1GTHA 3OHBA 4DX5A 5KT5A 1RT5A 1EKSA 1U24A 2AHOB 3LF0A 3O8WA 4DXLA 4P52A 2XY5A 2OSQA 2IRUA 3MM9A 4WP3A 1R0AB 3PJ9A 2MQ8A 1UAWA 2VBYA 3P5TL 5FLXY 4JI2F 2BMBA 2LDIA 2VBZA 3P4UB 3EM1A 3RRHA 3DLKB 4XPCA 4RUBA 4RW4B 3MR5A 1UWAA 2IAJA 4NASA 2C2KB 2JX2A 3NEKA 5HVGA 1YJTA 3LW5C 2V2ZA 1XNQJ 2BE2B 2GAGC 2D9PA 2PIIA 4DUZF 3IM8A 3IMQJ 1FK9B 2N4CA 3FBEA 3HP6A 3M8SA 1Q78A 4X66F 2CXEA 5FIIA 2R7RA 1V3SA 3GYGA 1L3VA 5M2PA 2V2QA 1Q7YT 3PJWA 2RQ4A 4DL3A 3LH2S 4DU7A 4LIWA 1HBNB 2A18A 1MW7A 3BB5A 3ZTSA 1I94F 4P72A 4N41A 4GKKJ 1TELA 3CDBA 2LDYA 4OJ3A 2QC3A 2CPHA 3BBCA 5B09A 1B0PA 2MEWA 2EW9A 2I5JB 4GVBA 4FP9A 3SDEB 4EUVA 3QO9A 2G1DA 2A1BA 5D3GA 3KK1A 4UY8T 1NJZA 1T8EA 2RJZA 1RLCL 4OYPA 4QPTA 3OSPA 2HQCA 4N5SA 3IG1A 1VK3A 3IBWA 1JXEA 3FZ2A 3ZTOA 3EVMA 3Q89A 1FHTA 3BV8A 4C8KA 4OHXA 5HATA 3LANA 3AD9C 2J7UA 1QSSA 1FJCA 3OUYA 3OTCA 3HCXA 1NSPA 1RWNB 4B3MJ 5D0RA 5LSLA 4O3PA 2X1AA 4O3NA 3L95X 1KKHA 2CDQA 4NX9A 5HAOA 3UVJB 2ZHAA 1HLWA 4V19X 2BM1A 5AJ3J 2HHHJ 3CC4S 3QWUA 3Q24A 1HNVB 1C1BA 3LALA 4IH6A 3HT0A 1RWKB 5IM0B 1FKOB 3KLHB 2BVZA 2MHEA 2WVBA 4B02A 3GJRB 2JEJA 5M2UA 1WG5A 4LVOP 1Q0NA 1RT6B 1NJYA 1LWCA 1KTQA 2P9EA 4M1KA 4ZCKA 3TX8A 1OMSA 2HLTA 5LMUF 4KO0A 3M1VA 3DFEA 1SC1B 1G6BA 1A9NB 1S6PA 1UETA 4OI4A 3CUNA 3H90A 5KFRA 1HWLA 3W8GA 4A48A 1VGYA 2OPPA 4WPAA 4WKYA 4J90A 1CJVB 5LSRA 1UL3A 2JFDA 5CYQA 4X4SA 1Y11A 3M2RB 1GXLA 3IS9B 4ZKAA 4KH1B 1VQ7S 4G1PA 1HL6A 2XGPA 3DOMA 2MB0B 2ADBA 1RU1A 2VPZB 1JWWA 3I0RB 2KXFA 1TKZA 2N3OA 1NKCA 1BQNA 2AU0A 3HDSA 1RU2A 4MK8A 4DR4F 5F3TA 5KFUA 2ZWOA 1SVDA 4CH7A 2N7YA 1N6QA 4NXMF 1RBOB 3JQJA 1NBEB 2CQ2A 5KFGA 1I6JA 4UQTA 1JJ4A 1S6QB 3K58A 2WOMA 3C15A 4R8UB 4YY3F 2APOA 2ZKUA 4JYAJ 2B6AB 2H4YB 2MKIA 2J6TA 4HI2A 2QA2A 1D3WA 4P75A 3UD5A 2QLBB 1U0HA 3TA0A 3AHPA 4WF9Q 4RBVA 3K8WA 2V4JB 2ZZTA 3CD7A 3R1LA 2IY5B 4KHRA 1U2FA 2C3YA 3R7BB 4AL5A 4ZP8A 5KT7A 2QT7A 4QR1A 2V8GA 4YB5A 1JLFA 1FI4A 2KT3A 3SBMA 2MLYA 4YN3B 3PTWA 3BYRA 1N32F 4Y6IA 3QGPA 4DG1B 1IR0A 1MLAA 2DD8S 3PCOB 2BJEA 3A3NB 3K8VA 1NK6A 4YB1P 4QIGA 3OSNA 4OX7A 1S49A 5HQ8A 2Y3YA 3GQCA 4I7FB 4RW7B 4HL9A 5GADI 3JQMA 4OI3A 3C3LA 1KQSR 3IM9A 2J0WA 2RDDA 4FS1A 1P1TA 1UZDA 2H5IB 4P7VA 1HYSB 1TUWA 4Z7CA 1ZETA 2FUG9 1D0EA 1PO6A 3UI3A 3RB6A 2JFKA 2M5YA 4X62J 5LOQA 3H5SA 1RT5B 1J5EF 1NK5A 3MM9B 2BJ3A 2ZOFA 4L3NA 4K4WA 5KFVA 1PYSB 2F8EX 5IT0A 1NUEA 2NUUG 3OXLA 1NSAA 3MDFA 2LEPA 2W7PA 2YNGA 1X31C 3VALA 2E1MC 1LWEA 3EGZA 5CHCB 3I96A 4U7UK 2LQ5A 4TYAA 3QATA 3W60A 1KHWA 2IAJB 3JTNA 3TW0A 5H9FJ 3ENWA 3JSMA 2BJ9A 3OJUA 4JB8B 2VUGA 4URSA 3TP2A 4F36A 6FDRA 5DG7A 1RHJB 4C4WA 2CZ9A 3M2VA 4B3TJ 2HVEA 4USKA 1SJFA 3GCXP 3HHLA 1W26A 2KXNB 1HHTP 2VKZG 2UUWA 1R6YA 2G9OA 3W65A 3ZZOA 4JI7F 2XO6A 4URQU 3AA9A 1SKSA 4CYUA 3GIRA 2WSEC 2HZAA 4HHUA 3QGGA 2GVZA 1NU4A 1HHQA 3ILJA 2PDAA 3EICA 3HJVA 1Q7LB 3RU0A 2BQRA 2P9GA 2YPZA 4DUYF 3SCLE 4LT6A 1X4DA 3PW7A 3Q2TC 1Y5LB 4GVBB 3QO9B 1HI8A 1JJCB 4DCJB 3VAHA 3G8SA 5D3GB 1NDLA 3KK1B 4G6VB 2KG0A 3J81U 1HARA 3IG1B 1BHNA 3ISND 3M8PA 2IBKA 4LF9F 2F7VA 4OLOA 4RBTA 3FCVA 5J2QA 1U1PA 1U26A 1P8GA 4MK7A 1C4CA 4I69A 3GP9A 2GHVC 1V3RA 3N28A 3OUYB 5DM6Q 4Z37A 1YX2A 2E1RA 3GLJA 3CDUA 4NEYA 2B43A 4JI2J 1XJWB 4E8UA 1G2EA 1M0SA 4DPYA 4IO9Q 4XPEA 2V94A 1O6XA 2MZ1A 5HBMA 2QN6B 2GCFA 4C8ZA 2ZEJA 3A8JA 1C1BB 3LPEA 3PRVA 5C42A 1L5UA 2C3PA 1LW0A 2IMOA 2LLZA 2FJVA 3HHKA 4KH0B 3CCJS 4DUZJ 2F5GA 1X4EA 2ZDPA 2AGOA 1QD1A 1VDHA 3PFOA 5H9EJ 3P6YC 3GCWP 1RWWB 2VJVA 1LWCB 1AFIA 1XEZA 2HVZA 2LU2A 3KHLA 4X66J 4LRDA 1NPKA 2W2OP 4KO0B 4LF7F 3M1VB 2W9BA 2H3EB 1CLFA 2F9DA 4MJKA 4KIAA 2PD1A 2DR9A 4NLQA 3OJSA 1UW4A 4C7QA 1FRIA 2BJ7A 2IM1A 2OPPB 2DRAA 5D0HA 1I94J 5KFKA 5G0RA 3OR2A 4YDDB 4K2JA 4X2BA 3N5BA 4WZMA 2D3O1 2Z57B 5CYQB 1PAUB 4PPZA 2E5IA 2OFHX 3G82A 2HHWA 4TQSA 1XIQA 3CPWR 2MQMA 3TQEA 2MQLA 5KOWA 3DOMB 4M5LA 2W1BA 1SQFA 1TKZB 1BQNB 4L75A 1XR6A 1N54B 2KL8A 4P73A 5CABA 1KQKA 2W8LA 4TY8A 3QMQA 1FRLA 2DVIA 3HKWA 1KS2A 2YWWA 1N6QB 4M5HA 3LP1A 4OV6A 3LOUA 3CVKA 3D5MA 5T7LA 1HNXF 1HQEA 1HWIA 2WOMB 3C15B 5FDLA 2CQHA 5GAEU 4IQXA 1HI0P 1S77D 1RTJA 4B3OA 1JNRB 1U0HB 1K1QA 2XMVA 4K8RA 3VVTA 4O3RA 3KLIA 3IP0A 4K59A 3I32A 2NZCA 4EU0A 2Y0BB 2RQCA 2LXFA 2DO4A 3KOAA 1JLGA 1M5KC 4NLSA 1ZTTA 1MWYA 3CXCR 1KVKA 5LMUJ 3N9UC 4RZRA 4RNMA 2Z2ZA 2W9AA 1JLFB 3DRRA 3KUGA 2LP4A 4HKQA 2XEXA 4LSLA 2JRSA 3NCPA 2XY7A 2NLWA 1ZBTA 1FX4A 1BQXA 2QLWA 5E3RA 5DG8A 5T41A 4XIUA 2MLXA 4IR1A 3VGSA 1YITS 2B7CB 2FD2A 2ACYA 4PKDB 5GAHU 4ECTA 4ES2A 2J0SD 3K59A 2AEJA 1A6LA 3QRQA 4K4SA 1IBKF 1Y5NB 1FRMA 1JIHA 3PX4A 1NDPA 2NPFA 2CQ0A 4I67A 4NXNF 3IWXA 2QMXA 3ONQA 1CQMA 1SJ1A 3MR2A 4YR2A 3BGRA 1TV6B 4FVMA 2A0FB 3W2WA 2DH7A 2RUSA 5EGYA 3PKYA 4DR4J 4DSLA 2OEKA 2L48A 4NXMJ 4IR9A 2GVDA 3GJQB 2YNGB 1LWEB 2I9SA 1EQ0A 2YNIA 4YY3J 4A8WA 1FTRA 2RT3A 3LAMA 1FKAF 2ZBPA 1UCNA 3JSMB 2V0NA 5K20B 1RCOB 3FQLA 4IRCA 2CADA 2M8DB 3UDCA 4CO2A 3M2VB 4ED2A 1M1KT 4YB7A 4ZVQB 2O01C 3F73A 3HHLB 1TZ0A 1AZSA 2GFFA 1EIYB 2BJDA 4JV2A 2YX4A 3IXQA 3CJ3A 4KV8A 4HT5A 4CNZA 5IFMA 4CYUB 1N32J 3H2VE 2GVZB 1CC8A 1ZZNA 4C0HA 1QTNB 2YWGA 2BV3A 1U1RA 4USHA 3PIOQ 3D1HA 5IV4A 2VA2A 1NJIT 2RQMA 3NOGA 1QUVA 3M8PB 2RSQA 2MYFA 4OYZA 3C6TA 1NHVA 5J2QB 4ELVA 3R8YA 1GX5A 4DX8H 2O66A 1J5EJ 2BZ2A 1HHSA 1NK0A 4DR5F 2G2ZA 3EVOA 3NGUA 3SYZA 4Z2XA 2QMWA 1DBDA 2R2RA 5KG6A 3B8HA 1FKPA 2GHWA 2LVWA 5HBMB 3KK2A 2L3MA 5EX3A 2EEYA 2LU1A 5DQIA 5C42B 4PYDA 5E7OB 1LW0B 1VOMA 2HVDA 3BGOP 4KC5A 2W2NP 2F1FA 1RAAB 2DYAA 5B0CA 2AJFE 4DBQA 4PRFA 3S1TA 2OI2A 4Y3CA 1YG0A 5F8JA 1Q1KA 2XLJA 2W4CA 1YJRA 2CWKA 4B17A 1BC6A 1D9FA 1JK9B 4JI7J 3OR1A 2AEMA 4NCAA 3LP2A 1X7VA 2JEFA 2GW8A 2HS0A 2CA9A 2Q1LA 4WFZA 1GMUA 4G65A 3VCDA 3PX0A 5G0RB 3OR2B 4DUYJ 1K0VA 3NGSA 3K5LA 1URNA 2CVIA 2KO1A 2SXLA 3CJRA 2V68A 3EXYA 3A1YG 3G82B 4KFBA 4DPWA 5A6PA 4QIEA 4NOHA 4C3LA 4LF9J 4DFJA 1RT1A 1PBUA 4EMDA 1JMTA 3QFHA 5J2NA 1C4AA 5C7PA 5KAKA 5KG5A 2QTWA 2JLFA 1FO1A 4FYDA 5DM7Q 4BC7A 3WDOA 3JSBA 2FVRA 2XB2D 3K5MA 3EGNA 3OLBA 4TY8B 1RUSA 4CWBA 3AQOA 2DNQA 3LP1B 4ZP7A 2PO4A 2XC9A 5T7LB 5ETQA 1HQEB 3UR3C 4U8YA 2LQJA 4XTTA 5FDLB 3OPKA 3D6FB 5BXIA 1F0XA 4NA2A 3DRYA 2DNOA 4C0OC 4FYXB 1UJ6A 4P10A 5SZTA 1RTJB 1UZHA 4F50A 4B3OB 2JNJA 3E51A 3J80Y 1Y4ZB 2K8GA 4A8KA 1N5YA 1HR0F 3KJFB 1WI6A 2B51A 1VR6A 3HZGA 2R7QA 2B3TB 3KG4A 3KLIB 2XS7A 2O67A 1X4HA 4Y2IA 2ZFHA 3G4SS 4HYKA 2Z4PA 5L1IA 1RKIA 1JLGB 1RWMB 1NKBA 2WVFA 1HFEL 4EFAC 3CCQS 2MQQA 4LF7J 3BDPA 3DRRB 2CNKB 1R8CA 3D1OA 1HA1A 4LSLB 1O8BA 3GIKA 2FHMA 4DEZA 1BLUA 4DL0C 2PEHA 1JLQA 4DSFA 4USTA 4DFPA 2AKWB 1P9YA 2C2EA 1SIZA 2YX7A 4WYLA 2A6MA 5KOXA 4PR6A 5F9LA 1U1OA 2HBYB 3K5OA 2HGNA 2I0XA 1R0CB 2FZKB 1GTEA 3SFUA 3G2XA 5D4LA 1OPIA 4J9VA 1Z4UA 4RUCA 1TUGB 3O2IA 3I82A 2DB1A 3BGRB 3W2WB 3D3CJ 2FVPA 5DZ6A 2C2RA 2B5JA 1N56A 5GAGI 2MZJA 4C11A 4NLUA 3MEKA 2GVDB 3THPA 1RK8A 2ZH8A 3I87A 4KGZB 1HNXJ 2ASJA 3SV3A 1URRA 3RB0A 5AT1B 2W8KA 4DF4A 4WE1A 2JJ4D 2IYIA 1R0BG 4Q43A 3KMQA 1FE4A 2HVHA 3SSQA 2AYMA 4NYZA 1TK0A 1WC3A 1ACMB 2BYCA 2XMAA 4ZPAA 2VKRA 4M63A 3B6BA 3G96A 1R27B 4OYIA 2D41A 2FJBB 4Y2CA 1Q95G 2DGXA 5CAAA 1WOSA 4QYZK 1AZSB 4ZVFA 2LEAA 4N77A 2BKPA 1H7XA 1HWJA 4DSEA 4KV8B 5CA5A 4ZP6A 2DIVA 1RJJA 3FRZA 1T95A 3AB2B 3OT9A 2VG5A 4FKXA 2FY1A 2E66A 3SSSA 1RBAA 4ZPWR 2ASDA 4OI2A 1T9XA 3V2UC 1RAJA 2ZC4A 4ZDNA 4TLQA 3TJAA 3K17A 3MPVA 4DV0F 4KRWA 1FERA 1JLCA 2RRBA 1YGYA 1IBKJ 3FNNA 2MGZA 3PACA 1VYAA 3GFZA 1HPZA 4NXNJ 2UUCF 3US5A 3C6TB 1Q79A 4AYBD 4DQIA 2PFFB 2KN4A 4A8MP 4C98A 4OZ2A 3VQTA 5BYRA 4NLRA 3KJQB 4P2SA 2RQKA 4MKYA 4ZVEA 2DCLA 3BF4A 3TJ9A 2KYZA 2E1PA 3OL7A 2EBGA 4MIBA 1ZS6A 4JOUA 2C2NA 1B99A 2UV8G 2UU9F 4OHWA 3KK2B 3JTPA 4WK1A 5HQLA 1KWMA 4C2MA 4YHHF 1FNXH 1WHVA 3ZNUA 3T5LA 1RAHB 4M5JA 3R3TA 4JUZA 1G4CA 2MZSA 2CRLA 4C3KA 4H4KA 4OYBA 4TVAB 1CULA 4DV6F 3ITHA 3R27A 1S7HA 5D0GA 5IQQA 1HQ2A 3HVTA 2R7TA 3HT3A 1D9DA 3OR1B 2JWNA 1VC5A 3LP2B 4PWWA 1S99A 4OLPA 2RIJA 4NLGA 1ZPWX 5FD1A 1N33F 1V5IB 3FKBA 3D7SB 2QA4G 2LXUA 4CM0A 5KFCA 2MHNA 2MZQA 2VV5A 3WC0A 4ED7A 1N5VA 5JVHQ 1AUDA 2XM3A 3VAFA 4PQUA 4DSJA 5C24A 1TR0A 4U8VA 3EDRB 4KFBB 4M94A 1GAOA 3W66A 4EYIB 3DMJA 2XZWA 4H54A 2IMWP 1RT1B 3M8QA 3CDEA 4RW8A 5J2NB 2HSEB 3KHGA 2DR6A 5L9XA 1ZM2A 1WORA 2UP1A 4MKVA 4WKRA 4WIQA 5GADU 1Y5IB 4DR5J 2B9EA 4RW6A 2UXCF 1NJXA 4R0EA 2Q79A 3CJ0A 1RWXB 2EC0A 3BZQA 1WHYA 4J9RA 4ILRA 3MI7X 2CJBA 5I4MA 4C48A 4BWMA 4JV1A 2R7WA 2YWHA 2FIUA 4IFVA 1WEXA 5DDRC 1KLNA 1DJ0A 1U1MA 6AT1B 4O3QA 1P27B 2MSTA 3FDSA 1AW0A 5EX0A 4M5NA 2DHAA 2HFOA 3HFKA 5AE3A 1N5YB 3GU0A 3VQSA 3GV5B 3X3UA 4N8OA 3IRWP 2RS8A 3A12A 4NZ7A 5IT4A 4HH0A 3IN5A 3N5FA 3RRKA 3F0NA 2ASYA 2AJ0A 4L6V3 3E3XA 1VQ9S 3EZOA 2CG4A 4ZCMA 2BANB 4ED6A 3QLHA 3SQOP 2QL9B 4Y2AA 3RB3A 4ECUA 4X4NA 2OHDA 1VIOA 2H48B 1FFSB 2EG1A 4OX8A 3W2VA 1JLQB 1Q8IA 2H4WB 1LFPA 3D68A 1WUUA 1VQPS 2F63A 4I1TA 2EFVA 1RWVB 2M3DA 4ECZA 1RLDA 4OZNA 3MD3A 2VFRA 1VC6A 1IXKA 5HQMA 1XC9A 2GO9A 5KFSA 4P2FA 3GFXA 4C8NA 3R2CJ 1ZM9A 2V5HG 4WJBA 1KNZA 1S1VB 2DGVA 1S79A 2CJQA 4USMA 2DGTA 4UZBA 8RUCA 1RTIA 2B5JB 2Y9HA 1BXNA 3I9V9 3BN4A 3CB4A 1R6VA 1F5BA 4C11B 2P9CA 4I56A 5A6WA 1HI1A 2QA1A 3A8EA 3L4BC 4WE1B 5EHHA 3H40A 1R89A 3BJYA 1VI7A 2GQQA 1F60B 3PW0A 2A6OA 2DNLA 4JBCA 3W7BA 2I2YA 1V6HA 3L09A 4RNFA 3PRBA 4ERDA 4DL7A 4DV7F 3K2YA 3AXMA 4KAIA 1KEKA 3TVZA 2XSFA 3BGFA 2VBXA 3QBCA 2C2DA 5KFOA 3TAQA 1K9MT 2ZBRA 1VHIA 5EWGA 1S0VA 3CC7S 4QWCA 1BUXA 2NREA 3FK4A 1WC4A 2ZNZA 1K44A 3OXFA 4QIWD 4TQRA 3ILIA 2VG5B 2MLZA 1SV5A 2XHCA 4H4MA 2FDNA 2WBMA 2ZH1A 1RHUB 4FPRA 2YQ3A 4KB7A 3BKFA 2M4MA 3M6VA 2IJFA 4UZCA 1NCLA 4WXOA 2XMWA 2OTLS 4Q45A 2D74B 4QR2A 2AJ4A 4CO1A 2UXBF 4A8QA 1JLCB 3QRRA 2VFVA 2GIRA 1CSJA 3ZZZA 4J9QA 3RR7A 2MGZB 1ZAXA 5GMDA 1HPZB 1RTHA 3TANA 2RVJA 2IIHA 1H6KX 4DQQA 2DTJA 3JB9k 1KVJA 3BEGB 3ZZRA 4HR2A 3FBFA 2RMLA 2RILA 1KBRA 2ATLA 3UCUP 4ICLA 2WSCC 5AXMA 1YBTA 2IVYA 4KYZA 3VAIA 5JXSA 2BA9A 1ZYQA 5KFLA 4IRKA 3PZPA 2N82B 4NLWA 3UNGC 2NPIA 2HFZA 2K06A 5K8PA 3OTOF 2Q3PA 4OIXA 4TXSA 4CLUA 1CULB 2B9XA 3J81j 5I42A 4WIIA 3NS7B 4FF4A 5DGBA 3ITHB 1QAXA 1N5QA 3K89A 5IV3A 3HVTB 3TQ1A 5C2GA 4K0KF 3FGVA 1I51B 3Q8UA 3EX7B 1UVIA 2N3LA 4CNYA 3H98A 3UDLA 4DSKA 4UT4A 1KFDA 2G2OA 1AYEA 1DZ5A 3T9NA 1N5SA 1XMBA 1QVFR 2Z30B 4O0IA 4JI1F 1SH3A 1NK7A 2J9DA 3D66A 3M32A 3G8TA 4DSIA 1SKRA 3KJNB 3EWGA 4AL6A 1YDLA 4B9VA 4PAAA 2HQFA 2VJUA 3UNYA 4PQUB 4DV0J 4OYAA 5C24B 3M8RA 3K57A 4HDGA 2AW0A 5KG3A 2BQ3A 2IM3A 3WX4A 2HS4A 4O4GA 2CQPA 1FRHA 4QCLA 1RYRA 1UMJA 5LMNF 3DMJB 3LPYA 2E29A 2KTQA 1SI9A 2UUCJ 3M8QB 4ELTA 2KI2A 5C2CA 4OJHA 1T9TA 4RW8B 1VBZA 2QFIA 1YJUA 4OJGA 1KQGB 2FLLA 3W8PA 2MMYA 4DQSA 3GTYX 3M4XA 4RW6B 1O51A 3G87A 4PWUA 2ROGA 2ZHOA 3ZO7A 2UU9J 2JLGA 1ZAWA 3UO0A 3TX0A 4YHHJ 4IFVB 3QT8A 1VC0A 1U2RA 4CIOA 4X65F 3L7OA 4A8YA 3OL6A 5F3ZA 4QWEA 1VQ8S 3MM5A 2ACMA 3QIPA 3TUPA 4FVCA 4RUHA 3CSKA 2HEKA 2KU7A 3ZFVA 2FGCA 4ZJLA 5I3UA 1OQ6A 4DCOB 3QLHB 4FXWA 2WVDA 2H54B 1W2BR 3AXKA 1N33J 4IRDA 3CT9A 3W2VB 2CPYA 2HLUA 1RAIB 3UW1A 3VAKA 2OJ3A 3NP5A 4M5IA 2VFUA 1FFWB 1U02A 2Y1IA 3JAMY 1ULRA 4DMZA 4C8LA 1VJWA 1CVJA 5K8OA 1E6YA 3UE2A 4P9SA 2DNKA 3R5AA 3KDNA 1GX6A 4MK9A 3H5UA 1C1CA 3MR3A 2ZBIA 2AX0A 4AE5A 2CG8A 2FLNA 3OFFA 1T3OA 3PDNA 2IVFB 4KKOA 3QYYA 2W25A 1RTIB 1IWAA 2CZVC 2DO0A 4CO3A 5IT9U 3W5YA 1X9MA 2UXCJ 5ETVA 4LF6F 3THTA 2B4UA 4IDKA 2EFQA 4NCGA 2DCUB 3UN2A 1RCXB 3PXGa 2OP5A 1PAEX 2GMJA 2IHR1 5BYQA 5KFPA 1WTFA 2C1EB 1MG7A 1T11A 1TTHB 3K5PA 3W62A 4F3QA 4KJIA 3N6MA 4NZ6A 4V19J 4UOHA 2WK4A 4QIFA 4NLOA 1IBCB 4AXJA 1F9EB 1CJTA 2GO8A 3MCOA 1Y9OA 2AJ1A 3GV8B 2OEMA 4ZHRA 2Y8YA 3PVXA 1UW9A 5D4OA 3M7VA 1XMOF 4ZVGA 2U2FA 4W4MA 1H98A 1VS3A 4X4VA 2VG7A 2YKMA 1S12A 2AYEA 4I64A 1TK8A 3HSDA 1F2GA 1SV5B 4H4MB 1V9OA 3R5BA 5KT2A 4USJC 4DL5A 2FHKA 1HW9A 4ENOA 3ELHA 5HN0A 4AXIA 1R8AA 4DR6F 3FQKA 2HPUA 1U09A 2Y0SD 3KUHA 5DETA 3SFGA 3JS9A 2CQDA 4CLTA 2GGPA 3G6XA 1F2HA 1RTHB 4ATNA 4U67Q 4DV5F 2YH1A 5B0GA 4LBIA 3LUYA 4ILMA 1ZZFA 3MMBA 3WHIA 1RAFB 1S0MA 2BX6A 3PHEA 1CJKA 3KTQA 1RKJA 3IRXA 5GVQA 4ICLB 1FDBA 1GT8A 2WONA 4GVLA 2HAFA 1WOOA 4XDDA 1TVRA 5AE2A 3AY0A 1QSLA 1N52B 4A46A 3DM2A 1XWLA 2WZ1A 4QU6A 5CYMA 1U7LA 3GSIA 4U95A 1YKWA 3HM9A 3LQVA 3CD0A 5E5NA
chains in the Genus database with same CATH topology
1KONA 4K4SA 1H2UX 4KE5A 4GKJF 1IBKF 2DBBA 4ITSA 1DAXA 4URGA 4H4OB 4Q2LA 3D0IE 1Y5NB 2FJDB 5SUHA 5HO4A 1DHMA 1FRMA 2D3ZA 1U1KA 4RX6A 1JIHA 1T05A 3PX4A 2VH7A 4K2XA 1D8YA 3CGIA 3X1LB 4GC6A 2NPFA 3QJLA 2CQ0A 4I67A 1FCAA 4NXNF 1K1SA 3ICLA 1X0PA 3IWXA 2QMXA 3ONQA 4Y2KA 1CQMA 3BS9A 2BR0A 1SJ1A 4OL8A 3TUZC 2ABYA 5I42B 3HF5A 2K3IA 5E0OA 3F41A 4DWIA 1U4BA 2C42A 4TLRA 3MR2A 5KFTA 3U02A 2DGSA 4YR2A 1BD6A 3BGRA 5KFNA 4B9UA 4MIAA 1TV6B 2HWTA 4FVMA 3W2WA 5AXLA 2DH7A 4C0BA 2OPRB 3U27A 2IA6A 3JYTA 3DHXA 5J1NA 3HXMA 5A8WB 3L3CA 3I55S 3RB4A 3HHNB 5EGYA 2VD3A 3PKYA 4ECVA 1SC6A 3MM8B 4DSLA 4QU7A 1SXLA 3CJ5A 1RA7A 4O44A 1HBMB 1HBUB 2KHDA 2W4DA 4ZPDA 2FJXA 2P6SA 4NYPA 5IQ6A 1YRTA 1UVJA 1GH8A 2CQ1A 2O1PA 2L48A 5KFDA 1QLNA 1VK8A 1SBRA 3BSOA 1RTDA 1UEUA 2OH2A 3DRPA 3KLVA 1YIJS 1HNIA 4IR9A 3NNCA 3N6LA 4CTAA 2YNGB 2QV6A 4IO1A 1LWEB 5HP1A 2I9SA 3M32B 4J9OA 4Q0BB 5K9FA 1X5PA 1X0FA 1SJQA 2YNIA 4UOCA 2MXYA 2I38A 2UVUA 5JUMA 4EBEA 3IWNC 3ENQA 4A8WA 2DNNA 3MM6B 1IKVA 4NLPA 3CCRS 1FTRA 2DHSA 4J9MA 1I1GA 2RT3A 3LAMA 1FT8A 4X4TA 2RU3A 3OL9A 3GIIA 1FKAF 1JLAB 3TVKA 3CCWA 1VMBA 3JSMB 1DQ8A 4B08A 4YQWA 2V0NA 1MMDA 1NRKA 3MMAB 2FGOA 2E9TA 3UFCX 3HVWA 4O4GB 2NSBA 1TL1B 4NL5A 3IGNA 1SQEA 3PV8A 1UVKA 4QYZJ 2ASLA 5KFHA 3FQLA 2D3UA 4IRCA 2M8DB 3F56A 2YKNA 2XNQA 3UDCA 4CO2A 2UUAF 3M2VB 1TKXA 4ED2A 1TQLA 1H7WA 1EP4A 1T03B 2R8JA 2EKYA 1M1KT 4YB7A 1SIWB 2QE5A 4LFCF 4ILLA 2E5JA 3TNVA 1YHQS 1TV6A 1U47A 2XY6A 4ZK7M 3POTB 2O01C 3F73A 3HHLB 3Q0AA 1PSDA 2J6SA 5DO2A 1TZ0A 2L9DA 4OQJA 4F4ZA 1WF0A 2NXUA 5L1KA 2HRYA 4RLEA 1HWKA 2MY8A 2GFFA 3CJ2A 3D0HE 3DLHA 1Q16B 1RT4B 2J5AA 2RDIA 4DL4A 3T1YF 2W7OA 4YB6A 3ZZ0A 2BJDA 4ID5A 2YX4A 3IXQA 4K4TA 4JV2A 3VR1A 3CJ3A 3T9ZA 3CCLS 4KV8A 3AH6A 2HIQA 3Q2SC 4HT5A 3TO8A 2R7SA 3EXCX 2LCWA 4CNZA 5IFMA 2XHWA 4Q8EA 2AP6A 4G1QB 2CFXA 4LSNA 1R8HA 3SV4A 1U1NA 4I6AA 3QJJA 5K5MA 1LK7A 1VQMS 3H2VE 2Y1RI 2J0XA 1CC8A 5MLCV 4JI8F 2EFGA 3HJFA 1VQ5S 1ZZNA 1KC8T 2G13A 2V8DA 4C0HA 3L7PA 2ALZA 2X3GA 3ENVA 2M52A 2YWGA 2OPQA 2RB7A 2BV3A 2NSCA 3LO3A 2P5VA 1FKPB 2KYXA 5HMWA 1U1RA 2E1CA 4USHA 4I6WA 4EEYA 4OV1A 5KFJA 2XMJA 3PIOQ 4BDPA 3D1HA 2IC3A 4LQ3A 1JB0C 4R0JA 4HHJA 4X4UA 2VA2A 2M0GB 2HNZB 1NJIT 2XMTA 1FESA 4B9TA 2HGMA 1XNQF 2DHXA 2RQMA 3OTEA 4E98A 2XS5A 1DLOA 2GX8A 3P3DA 3TR5A 1KR4A 1YSJA 2A3JA 1QUVA 3GWCA 4GMKA 3M8PB 4XAKA 5GAGU 2AQ4A 2RSQA 5J2PB 2CIMA 2MYFA 3HMJG 3KG1A 3PW2A 3RBDA 1VQOS 3MOZA 3C6TA 1NHVA 4OFZA 3QIPB 5J2QB 3QJPA 4I6YA 4NLVA 4U9RA 1CQNA 4QR0A 3M9MB 1SUQB 2N4DA 2R2UA 2ADCA 4ELVA 4EZ6A 4O3OA 2KJVA 3M2UB 1GX5A 1REVA 3J7YI 3P49B 4N8NA 4DX8H 3H4BA 3DRSA 5F0WA 2D9OA 3NWGA 3ISNC 2O66A 4XDCA 4EGLA 1UKUA 4OI1A 4MKAA 3GZ7A 1P6TA 2BZ2A 1VHFA 1B64A 4NLYA 3CCMS 1HHSA 1XK8A 1NK0A 4DR5F 1DTQA 4YOEA 1J5OA 4CH0S 2ZZMA 2GJIA 2J8AA 1U48A 3SYZA 5D4NA 2FHOB 4QYRA 3QZ7A 4Z2XA 2QMWA 4TU7A 1Y0HA 3UQSA 3U1LA 1DBDA 2R2RA 5KG6A 2HG4A 1S9EA 4PG7A 3B8HA 2PN6A 1M5PC 2E5LF 5JJBA 3CD6S 2R7UA 1LKZA 1S1WB 5L8RC 3MMCA 5E3CA 4DN9A 4GKKF 5LXYA 2ERRA 2DT9A 2DNYA 5HL7Q 1FKPA 2GHWA 3RTVA 3C46A 2BDPA 2LVWA 2RRNA 4RW9A 4PCQA 4J9SA 5HBMB 3KK2A 4UY85 2IM2A 1OSCA 2L3MA 4H4KC 1AFJA 1R8PA 5EX3A 1T3NA 1IBLF 1UJ5A 4KT0C 1L3TA 4K4UA 2LU1A 5DQIA 3BO4A 1W2IA 2B4OA 2X1GA 4IG3A 4DLGA 3J7A1 4MH8A 4NCBA 5C42B 5E7OB 2X1FA 3CTRA 4B3SF 4KGKA 3GILA 1LW0B 4MTPA 3R1HA 3HHLC 1VOMA 2ZJQQ 2KM8B 4KC5A 2IRYA 2FVQA 1E6YB 3RAQA 2F1FA 2ZE2B 2HYIB 2JDJA 1R31A 1X5TA 5B0CA 4X64F 3QZ8A 4IH5A 3SI8A 3PM9A 3M9NB 2AJFE 4DBQA 1Z2ZA 4PRFA 3D0GE 1JLBA 3IC1A 4X84A 3S1TA 3GV7B 4Y3CA 2Q66A 1YG0A 3KYLA 1S48A 5F8JA 1Q1KA 1M5VC 2GJ2A 5K8NA 1C1CB 1CG2A 3IFEA 2XLJA 5GAEI 2W4CA 5E3QA 1YJRA 4LUBA 4X4RA 2C3UA 4B17A 4YUDA 1BC6A 5EN1A 1D9FA 2RDJA 2XSJA 1IM4A 1JK9B 3IA0A 2FC8A 4KKOB 4NLDA 5KG2A 5LT5A 3OR1A 1R0AA 3UPFA 2UVVA 4B3MF 4NCAA 3LP2A 1X7VA 4CT8A 4ES3A 2JEFA 4PXBA 1SB6A 5H1SV 1XR5A 4WFBQ 2GW8A 1Q81T 1ZOTA 2HS0A 4M5DB 5T14A 2VC0A 3NNAA 2Q1LA 2DPIA 4WFZA 2YNHB 2GIQA 1U45A 3CJKB 2L9WA 1VRUB 1N88A 4MKBA 1NEEA 2DISA 4IDKB 4NCGB 2LA6A 5KFIA 2QLXA 4A8XA 7FD1A 5AJ3F 1C0TA 2YH0A 3DLKA 3GG0A 5CD4H 1U1LA 2AYGA 2PGCA 4EBCA 2R7OA 2HHHF 4RU2A 4DJBA 3GR0A 4RW4A 3VCDA 1IKWA 4HLBA 2YVSA 3PX0A 2JSXA 5G0RB 2R8HA 5KFWA 1RP5A 2EFOA 2XMMA 3OR2B 4ED3A 2F8MA 2DGWA 4LVNP 2XLIA 2HWHA 1K0TA 1K0VA 2WB4A 3OQ2A 2PA3A 3K5LA 3KLEB 2V2KA 4JI3F 1S1TA 1URNA 1KLMA 2CVIA 2VFTA 1KVIA 2KO1A 2SXLA 4WU2A 3M6XA 1ELOA 3EXYA 4TU8A 2BE2A 3A1YG 2BACA 4FBUA 4KFBA 1X9SA 1TK5A 4C8MA 5A6PA 2NQPA 3FSYA 4QIEA 3TI0A 1YVFA 1VFJA 4NOHA 3MFHA 4C3LA 4IH7A 1PC4A 2R8GA 3QAEA 1FK9A 4DV4F 3AA8A 5D77A 4DFJA 3G86A 1S9FA 3CMES 1G1XA 5GAHI 1RT1A 1FJGF 3MEGB 2J9CA 1TUVA 2AD9A 1JMTA 3EGWB 2DHGA 5J2NA 1C4AA 4WFYA 3CIMA 5KAKA 5KG5A