3R1ZA

Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : complex with l-ala-l-glu and l-ala-d-glu
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
362
structure length
362
Chain Sequence
VSKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATTAITGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKANSIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGADFNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEINKYSLNVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDNLKGFGFNLAENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enzyme of enolase superfamily
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Francisella philomiragia subsp. philomiragia
molecule tags Isomerase
total genus 121
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3r1zA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3r1zA01
3TWAA 3T9PA 2PMQA 4A6GA 4IL0A 2QJNA 4H2HA 1XPYA 2GSHA 3PK7A 2OVLA 3UJEA 3D47A 2GGEA 2PTZA 3H8AA 3CXOA 1RVKA 3OPSA 3EKGA 1ONEA 3PFRA 4GISA 3GO2A 2OQHA 2PP0A 2XH0A 3UCDA 4ZA0A 2OZ3A 3FYYA 1MUCA 3VC6A 3GD6A 2OZTA 1SJBA 3DDMA 1EBHA 1IYXA 2GDQA 4M0XA 2OLAA 4JHMA 2RDXA 3NO1A 3N4FA 1BQGA 1EC8A 3V3WA 3UJ2A 2OZ8A 1XS2A 3FVDA 4HNLA 3Q45A 3SBFA 2AL1A 3MKCA 5EU9A 3VA8A 5BOEA 3FXGA 2DW7A 3D46A 2FYMA 1L8PA 2P8CA 3QLDA 1EBGA 2GGHA 3CYJA 3RGTA 3DERA 2XH4A 4HYRA 1F9CA 2QVHA 2PGWA 2PPGA 4HCLA 2POZA 3K1GA 3SN1A 1BKHA 1FHUA 4GYPC 4K1WA 3UXLA 4A3RA 2QJJA 3N6HA 3QPEA 2P3ZA 1E9IA 3GY1A 4A35A 2XSXA 4X2PA 3JVAA 4HN8A 3V5FA 4FI4A 3PWGA 1EC9A 3UGVA 3OZMA 4IL2A 1PDZA 4Z1YA 3DESA 3RR1A 2XH7A 3RCYA 3DG6A 3S47A 3MY9A 2NQLA 3I6EA 1W6TA 4IT1A 3V5CA 2XH2A 4IP4A 2HXTA 2OPJA 2FKPA 4KPLA 3N6JA 2PODA 4GMEA 5IDZA 2ZADA 1KD0A 1JPDX 3H70A 4JN8A 3TW9A 2MNRA 4E4UA 2GGGA 2DW6A 1SJAA 2GGIA 4E5TA 3P0WA 1TE6A 4J3ZA 4DX3A 4GYPA 5FJTA 2PU1A 3OTRA 3DGBA 3PWIA 3JZUA 4MGGA 3TCSA 2OFJA 3P93A 3IJIA 3SQSA 2PP1A 3SN0A 3CK5A 4HCHA 5J04A 4DWDA 3H12A 3ZVHA 1JDFA 3IJQA 3UJSA 4KEMA 1NU5A 4HPNA 1OEPA 1FHVA 4K8GA 2PS2A 3TOYA 2OG9A 1EC7A 3DEQA 3ES7A 5FJOA 2P88A 2I5QA 1DTNA 4YWSA 3DIPA 3UJFA 3BOXA 2HNEA 2PP3A 3FJ4A 3T4WA 3OZYA 4M6UA 5ENLA 3ZVIA 3ZLHA 3TWBA 3TJ4A 3MWCA 2O56A 3OW1A 4MMWA 3HPFA 2AL2B 1TZZA 3N4EA 3SN4A 4GFIA 2PTWA 2OQYA 1ELSA 2ZC8A 1KKRA 3BSMA 4ZCWA 3NZGA 1JCTA 3S5SA 4HNCA 2PU0A 2PCEA 4KT2A 4FP1A 3TJIA 3B97A 2PGEA 4IP5A 5FJPA 3SSZA 2PTYA 3ZLGA 3ENLA 2QJMA 2QQ6A 2QDEA 2AL2A 3DG7A 4JN7A 2QDDA 3ES8A 4DN1A 3RRAA 4MKSA 3NFUA 1R0MA 4E8GA 3ZVHB 3BJSA 4E6MA 2PA6A 3MSYA 3QKEA 3FCPA 1MDRA 2HZGA 4G8TA 3OP2A 3DG3A 3FV9A 3VCNA 3GC2A 4DYEA 4H83A 5FJRA 3QTPA 3THUA 3DFYA 1KKOA 1MNSA 3VCCA 4DXKA 3ZLFA 4Z17A 4GGHA 2GL5A 3TQPA 4E4FA 3VDGA 4IHCA 3T6CA 1R6WA 3IK4A 3I6TA 3V4BA 4GGBA 3I4KA 1SJCA 3R10A 1KCZA 2CHRA 6ENLA 3VFCA 1TKKA 7ENLA 3P3BA 2AKMA 3H7VA 1MRAA 5FJUA 2P8BA 3CAWA 2OX4A 1NELA 4H19A 1YEYA 3UXKA 3DFHA 1ECQA 3NXLA 4IZGA 3VC5A 1JPMA 3IJLA 3QN3A 3R0UA 3RO6A 3CT2A 3JW7A 2XGZA 1PDYA 3R0KA 1P43A 2MUCA 4J1OA 2PSNA 3U4FA 1WUEA 2OO6A 4HCDA 4G7FA 4KWSA 3R25A 2AKZA 3MQTA 4DHGA 1P48A 1WUFA 3STPA 3TTEA 2ONEA 2HXUA 2QGYA 3UJRA 4ROPA 3U9IA 2OKTA 3MUCA 3SJNA 3EEZA 3RITA 4EWJA 3Q4DA 1MDLA 3T8QA 4K2SA 2GGJA 4H1ZA 2P0IA 1SJDA 3R1ZA 4ENLA 3UCCA 2PTXA 3MZNA 4GIRA 3CB3A 3R11A 4F4RA 5BOFA 3KUMA
chains in the Genus database with same CATH superfamily
4HNTA 1K7EA 4PCTA 2WHJA 1TMQA 5AHNA 1K8ZA 3WENA 1KBBA 4QP0A 3FHAA 3W53A 4CKQA 3BANA 2WNWA 2WKJA 2V6OA 3TC7A 4B90A 3NPUA 3W0KA 5A1AA 4HZ6A 3RU8X 3WLKX 2E5AA 3WLJA 1B54A 3EKGA 3SY8A 3K8LA 4WQ6A 2JFEX 5DMNA 4AWEA 3W2MA 2XSAA 3GYCA 4H6EA 4JHOA 3RDKA 3CQKA 5GPRA 4WR3A 3ZT6A 1WX0A 2X8GA 1UMLA 2E6YA 3L5AA 1AW2A 4IJCA 3KOYA 3ZQ9A 4B9ZA 2PBGA 4B16A 2X30A 1G7UA 3R12A 1SPQA 2V5CA 1RQEA 3K8KA 1UKQA 3L4UA 2RAGA 1UWUA 4O1CA 1OG0A 1RA5A 3WF0A 1LWHA 3OHIA 4XWUA 3LCIA 4RDVA 4AVOA 3FXGA 5CLWA 3K5XA 3VOCA 3ITCA 2D1ZA 3ZJ8A 1JEZA 3IGSA 3PJTA 2GOKA 3USBA 1JI1A 1QNSA 1XKJA 1PYMA 4NJKA 3TZNA 2PDNA 1E70M 5A8NA 4IG2B 2J27A 3QQ1A 4UFHA 3WBAA 1B5TA 2ODOA 2JIEA 4ERAA 2VHLA 1HP5A 1FHUA 4XKYA 3NURA 4MHBA 4O4WA 3URQA 2INEA 3NIYA 2BHUA 1ESWA 5D37A 4YU1A 4B92A 4XZBA 2PDUA 2ZA2A 3VD9A 2NX3A 2PDGA 2X50A 1UWAA 1V02A 5E9AA 5C6MA 4FI4A 2YCJA 3ARRA 1TB3A 3G1YA 4PMDA 3VCRA 3IAQA 5CBJA 2EKCA 3I6EA 1NHRA 2QCMA 1ZBVA 2ZZ1A 4WEVX 1E1CA 3O2LA 3MHUA 2GDUA 1F8WA 1Q6GA 4YTUA 4IMEA 3VNJA 1DPMA 2G3FA 3PZNA 4J3WA 1H50A 2GJPA 3NO3A 3M0ZA 1M5WA 3TW9A 2G3JA 2O9RA 1NDAA 2GGGA 4OJYA 3M5VA 3UXIA 3NRZB 1QNPA 1H5VA 3W1XA 4QBXA 3W73A 4U2ZA 1O12A 1EP2A 3F1QA 3KOXA 4MGGA 3USZA 1OB0A 4ZE5A 4TIMA 3CPRA 1YQ2A 5HJXA 3CK5A 2GJNA 1MW2A 1YNPA 2QCGA 3DC8A 3H12A 3EB4A 4AAJA 1J0IA 4WXYA 3WDPP 5A8MA 1L2UA 2FMOA 1V93A 1ZPTA 1XFCA 3C2FA 4R85A 5DT5A 1S38A 1LBFA 2QULA 2FB2A 2XWDA 1U22A 4B5UA 5A2CA 4HSHA 3H4GA 3VIMA 2WPBA 4MPKA 3MSRA 3T8LA 3UETA 1R87A 3LCGA 4GFIA 2OQYA 1FY6A 3FSUA 1FWCC 4ZOEA 2W62A 4ATLA 4BKNA 4DM2A 2HISA 2VQTA 3GFXA 4GJJA 1VZWA 3WLOA 4G1KA 5HK4A 5BU9A 4AMCA 3CMGA 2HBVA 4AZ7A 4DWSD 4M82A 3VUSA 3QRHA 4A3HA 3OQ8A 3XIMA 1E6XM 7ODCA 3TTOA 1UCWA 2A3EA 3SSZA 2VC5A 4HPJA 1V97A 1SFLA 3TYEA 7PTDA 5IXEA 2H90A 4RDZA 4W8AA 3SCTA 2WOWA 4N9EA 3RPDA 1P1XA 1GQNA 1XLGA 2PD5A 3E2VA 5E9XA 3QGAC 1SW7A 1AZ2A 3T0AA 5IHSA 3BOFA 1PKNA 3LU2A 5T26A 2FFIA 2WP6A 4W5ZA 5HUPA 3Q2DA 1AODA 1H7WA 1DWJM 1D9EA 4RLIA 4IOTA 5D9MA 3S2LA 1HF6A 3TYDA 3ITOA 1JGIA 2Q09A 1X39A 2PFHA 3GC2A 1Q4NX 1SMDA 5BXSA 2HVNA 1PUDA 3RMJA 3RM4A 4MWAE 3ONBA 2C3DA 1U5HA 4FLSA 3M7WA 1W1TA 1H11A 2NSOA 3DFSA 2FB3A 4PCFA 3WUFA 5CSYA 2GPTA 1OGGA 7REQB 3CUIA 4H4SA 1V3KA 3M0KA 3M43A 1Q2RA 3AHTA 2A0NA 4CEXC 2X40A 3NSMA 4NEWA 2OX4A 2XFYA 1NELA 1RP8A 4EAMA 3OLGA 3ABSA 4TU1A 1FWIC 3BK0A 1JPMA 1R7AA 2VZTA 1NIUA 3R8GA 3EF6A 1TZ9A 5AC8A 4LAUA 1GRGA 4OV9A 1YE4A 4JTFA 4YJ5A 4ZTYA 2VJXA 2VFHA 3CPGA 1UROA 2MUCA 3AHXA 1GHRA 1TPUA 5HAOA 1RLDA 4WY0A 3DK4A 5AOUA 3F2CA 3C56A 3GBDA 4FR1A 2A7RA 2P50A 2KX9A 3W2KA 4MLJA 3MUXA 3PG6A 1M68A 4N0RA 1OFBA 2AOSA 4F9JA 1P48A 2UV8G 3M64A 4AG0A 3QFBA 5D2YA 3G6LA 2BY0A 2NVAA 2O4QA 4K68A 1GVRA 2GR0A 3F7JA 3RHGA 2QUVA 1MDLA 3SCRA 4PB4A 1H09A 4UNLA 5CJ5A 1TMLA 2ZZCA 4EKJA 1IT7A 3PC0A 1EGZA 4NZJA 1WZKA 4US6A 1P7TB 1XGEA 2W4XA 4IG2A 5F1UA 1GONA 3NL6A 5FKYA 4LVBA 2CLIA 4ADTA 1G69A 2BNJA 1W91A 5D9NA 3TYZA 1TR1A 1GJPA 2IQDA 1N55A 2QJNA 4KGJA 4DRSA 4Y6GA 1QI0A 2WB5A 1I1XA 4XUGA 3SFKA 1PX3A 2PTZA 2W54A 4E2VA 5AYZA 5FF4A 4QTGA 3MB9A 4W84A 4IUOA 3RCMA 2Z29A 1RV8A 3PULA 2XWEA 5LIWX 1XSIA 4J9JA 4HK5A 1UB3A 3KLKA 4Z2LA 2INFA 1SFJA 4RE3A 4KGLA 2FH8A 2VD9A 2QAFA 5AHFA 2RDXA 2HEJA 3LRKA 4ZQMA 1Q6LA 1RQBA 3IVTA 4KEVA 3LV5A 4O15A 2RH9A 3RLVA 4GKLA 1JZ8A 2I9EA 1YQZA 5AHMA 3QHOA 1E3ZA 3ARQA 2V3GA 1BWVA 1JROA 2DZUA 2WZEA 1J93A 2PWDA 3NQBA 3LSBA 2DW7A 3N34A 4FNPA 3SRHA 2G3IA 3QLDA 2F6UA 1O95A 4H4RA 3KTCA 2WLZA 1YIXA 2W91A 2JEPA 3NA8A 3CL7A 3G0UA 4DQWA 3WNPA 4Z1DA 1XC6A 4HSOA 5FS8A 3IGUA 1EL3A 3TP4A 4HOXA 1TQJA 1IZJA 4W8LA 3P61A 3W81A 5CBIA 2ZZ3A 4NY2A 4DF2A 4AWUA 1EQCA 3RPTA 5E5CA 4HD5A 4EOUA 5HMFA 3DG6A 3OYZA 4LS1A 4XISA 5FF3A 3WD0A 3T44A 4O11A 1ZBKA 4JN6A 2FKPA 5I78A 2O9PA 2VRQA 2I17A 4GYKA 1YDNA 4QLKA 4TX8A 1OZQA 4H8UA 3MKKA 3UNTA 1Z48A 3WQEA 5CSSA 5JH2A 3CHCA 1RBLA 1VS1A 1OCQA 1SJAA 4LUTA 4IJRA 3NVVB 4E5TA 1VJIA 5C7HA 3PY2A 5FJTA 4P7NA 1YNYA 2CNCA 1YE6A 1T0OA 2W27A 2RFGA 3G1RA 3GG1A 1HKMA 4C6BA 1OCBA 2Y7DA 3SQSA 1XPGA 3LQLA 4OTKA 2OYMA 2EQ8A 3NZ1A 4PUEA 1KXVA 3QBUA 5ECUA 4HSNA 1HKIA 3SI9A 1KRCC 1OEPA 1ITQA 1BF6A 3W7HA 5D05A 3MC5A 1EC7A 5CEWA 3ES7A 1PHQA 2NQ9A 4J4KA 1JEHA 3SURA 4C1KA 1Y0EA 2X7WA 3CGCA 3BOXA 1LM1A 1W8SA 3L8KA 1NWUA 4ML4A 3KP0A 3S46A 4TV6A 2DJLA 2GK1B 1YBQA 4O1FA 3QTGA 1SMAA 4GY1A 3FJ6A 1TV3A 3TKFA 3WNOA 4NILA 3W88A 4C6MA 8TIMA 2V68A 3P60A 7REQA 3DJJA 3II4A 3AXHA 2AAAA 4OVXA 1HUVA 1V7AA 4EQXA 1EZWA 1W5PA 3E1F1 4KT2A 3WUBA 3A5VA 1OC7A 2CXEA 4DEFA 2NWSA 3VGDA 3AXMA 3CUHA 3ZLGA 1C7TA 1DJIA 3WFZA 2ZX5A 1A5LC 5FEPA 5CZJA 2V5BA 3NYZA 5LNWA 1LJYA 2IKJA 2XIJA 3AQUA 3KX6A 4KWVA 4DF0A 4Q8PA 4RKAA 4N9BA 5DRIA 1V3MA 3K4WA 1VRDA 5JRBA 4I9JA 3DHFA 4EP8C 1KWGA 3P8IA 3QOMA 3VYLA 4HOZA 3BJSA 2DZPA 4BI5A 4M24A 4WJXA 1D7KA 2QNEA 4MJMA 3MSYA 3NO5A 3NSNA 1Q13A 4V15A 3T09A 4KCWA 2DU2A 2I7GA 1V3JA 3MSGA 5I3IA 1OGSA 2CESA 3S5ZA 2R9RA 3M0JA 4GNVA 5D4YA 3BLDA 3R5EA 5CZKA 5FS6A 5DMLA 3QQWA 4CQDA 3I6TA 4P7QA 4TXEA 3CUFA 2C91A 5CJNA 3BXWA 1MNZA 1K9DA 1XICA 4WCJA 1E0UA 2JBMA 3CHFA 5EKYA 6ENLA 4GI8A 3FAXA 2DORA 4W9TA 1XC4A 3KCJA 2JQXA 4GQGA 1XSKA 1GOIA 1WBHA 5A8QA 3S2NA 1PKMA 2PDPA 2Y8KA 3M0HA 5HXMA 2B0MA 3LTYA 5M5DA 3E9AA 3ITVA 1A5OC 5AN7A 2FVLA 4PODA 1FH8A 2Z2AA 3WDQA 1XYBA 2YCKX 2FJUB 4LT9A 3IAPA 2Y0FA 2YXOA 4H8NA 2ZXDA 4PUUA 3SRKA 2PBOA 1OGBA 2J25A 5XINA 1FCVA 4J1OA 5KZ6A 2PSNA 2JKEA 4DYJA 3PUDA 1EQPA 1T3QC 1VFOA 3OG2A 3HIJA 3BAYA 1FA2A 4ZXOA 1U2YA 1B3VA 8CGTA 3E0FA 4UCFA 3FK4A 4DJEC 3MUCA 2CLFA 1Z6KA 2WBAA 4PR4A 3GIQA 5E70A 3VIFA 5PTDA 4H9XA 4MWAC 1JXJA 1U1UA 2E6AA 3BJFA 2ZYFA 1Q45A 3Q94A 1UQYA 4Z2HA 5LHFA 1XIDA 3BLKA 3GHTA 3T0DA 2GLKA 2XVPA 2FZNA 5DCEA 2XVGA 3EB2A 4GXWA 5HA7A 3CBWA 4O57A 1IXOA 3H4KA 1AJ0A 1VCVA 1E4MM 3NQMA 3UVAA 1EA9C 4ZQCA 1XF0A 4K7ZA 1BEUA 5EFFA 5F2IA 5M03A 2YBTA 1VEOA 5T8GA 1ZAIA 4W86A 3GTIA 5LIYX 4H6RA 1FECA 3W1LA 3STFA 4AW7A 2XH0A 3TXVA 4CU8A 2OZ3A 4QJ5B 1ZTVA 1FCQA 1TV2A 3CH9A 2ISFA 4JTDA 2QUTA 3GVVA 5AYYA 5CAHA 2ZRZA 1F8IA 2DZVA 1KM1A 1IYXA 4EQRA 3GDMA 1EJRC 2E3TA 3NO1A 3OIHA 3CL6A 3B0YA 3WL0A 4MAVA 3WF1A 1BQGA 1TWDA 1Y7VA 1E6RA 2E25A 3CUZA 1JOAA 4V1YA 3EMCA 3HPXA 4E3TA 2YFNA 1J01A 4XZLX 1BQCA 4N9CA 2ZZ6A 1RAKA 3SB0A 1WKYA 3AICA 5GJMA 2A21A 3A7AA 1KXTA 2OXNA 4GIAA 1XLDA 3AS1A 3NQ8A 3ZWSA 5A95A 4WRHA 3KE0A 2XISA 4Q22A 1M6JA 3T42A 2IMRA 2POZA 2X0HA 9XIAA 3NGJA 4XQ6A 2WSYA 3FAWA 4S3EA 3EZ4A 1L2QA 4PTNA 3DXIA 4K39A 3LS9A 2JEQA 3INPA 3GVQA 1E3XA 1IWPA 1R3TA 3VIKA 4JL2A 3RU6A 3CC1A 4J56A 1TJRA 3S1WA 1GK8A 2OPJA 4WOZA 4Q32A 3HJEA 1OYCA 3OGVA 4EPEC 3AYVA 3HOJA 1JF6A 1UP0A 2ISSA 1UD5A 5JCKA 3WH6A 4R27A 4E4UA 1IEWA 4HZ8A 3DX5A 4M6PA 1ZK7A 4AY8A 4D8ZA 4GYPA 1FUYA 3OA3A 1NF7A 1M41A 2F5ZA 3PWIA 1MUMA 5G4WA 5BW6A 3W84A 4OGZA 3UF9A 3WJSA 3S2MA 2BP1A 2GVEA 4YIWA 1YHTA 3M6YA 5J04A 5F7UA 1Z7AA 3O0FA 4LXFA 2FDSA 1WDPA 5A2AA 3TOYA 3CIWA 4P8UA 4S2BA 3M5YA 5XIAA 4DF1A 3L0KA 2ZRVA 4B5VA 4Z2IA 2CFFA 3KBWA 1Q1WA 1BYCA 3UYIA 3MI6A 2X05A 1XUZA 5BWAA 2ZDSA 1UH4A 3C2OA 2ASHA 4INFA 3SRFA 3S2JA 3OW1A 2YSWA 3GXPA 1SZFA 3LM7A 3PUOA 1ELSA 1OJXA 4ZO6A 3U2CA 1RY0A 4XUYA 3Q58A 1V6TA 1Z69A 3DHPA 3HG5A 3RN6A 6TAAA 3PZVA 4MY1A 2PDBA 1ZDLA 1F8MA 3NPVA 2J47A 1WDSA 4QJ3B 2VENA 4YCOA 2HV5A 3IGXA 1QVBA 5CPTA 4D6GA 3FA3A 3NDYA 3R79A 3PZ9A 4MKSA 2XU2A 3UY7A 4IIFA 2F8QA 4GE8A 1XLBA 3PNUA 2NQJA 4AVFA 4LQ1A 2PA6A 3W87A 3WLHA 4XAFA 3EYPA 5C9UA 4WGXA 3C5QA 1QRQA 1QHOA 4HPGA 2V3BA 1MNSA 2ADAA 2GVJA 2PD9A 1HL9A 1W3KA 2R91A 4KEZA 4O8RA 4GGHA 3LHVA 1I60A 1PTGA 4Y9AA 3L2LA 1UMYA 4IHCA 3T4CA 4NJIA 2CCRA 5FL0A 3RJXA 2XN1A 1TREA 3A9IA 4L9YA 4Q4MA 2RJHA 1GHSA 2ZUNA 5I0DA 1K8CA 1MEIA 4AH7A 4D6CA 3H7VA 4DPPA 1R8LA 1MRAA 3CUJA 4E0CA 4HYWA 3KL5A 4E2BA 1CXKA 3ARTA 4RNHA 4S3KA 1YEYA 2ISWA 4EX4A 1NOUA 2WPGA 3WF3A 2C8NA 3AMLA 4S1FA 3A21A 4BWLC 4WHBA 4KFNA 4XZHA 2IKHA 2OCZA 4D6HA 2PDKA 4LAKA 4Y8FA 2C13A 3WDRA 3ISIX 2DZBA 3BG3A 4IPLA 3B8WA 3B0XA 4AQLA 3HG3A 2OWXA 4U10A 3NL2A 3AHYA 2EG8A 4R7OA 1PAMA 3SDOA 1TA3B 4GZJA 3NPWA 3WJYA 3N9RA 1FWNA 3R25A 3PTDA 2Y85A 2GJRA 4BR1A 4R33A 1HG3A 1S3TC 1VCFA 3H54A 1ICQA 2JF7A 4ZSTA 4BV6A 1RALA 1WUFA 4JKKA 5KTLA 4D6FA 2QGYA 1X2GA 3KS5A 1QFEA 1DIOA 2OTDA 3W23A 3C3UA 2VZUA 5CZTA 2WM1A 3WD4A 3MI3A 1EO5A 2GVGA 5H6HA 4XAZA 3IV8A 4UMAA 1GRTA 4M5PA 4LVGA 5AHIA 4ENLA 2QKFA 3N3TA 4MZ8A 1LBMA 3PN8A 5K4XA 3ZFHA 2XIMA 1GTEA 5KINA 2QCNA 1G4TA 4LIIA 1NDYA 2DUAA 4NI3A 2WBGA 1LWIA 1XPYA 2GSHA 3ZT5A 3EOSA 3WLLA 4AZGA 3CXBA 1JPKA 4HU8A 4J35A 4I5XA 1KLYA 3TLQA 2W66A 1FKWA 1RVKA 3PFRA 3D6NA 4GISA 3ALFA 1R2TA 1A0EA 3CO4A 1K9TA 5C9RA 2E6FA 3H22A 1EEXA 1SZEA 4GZ7A 4AUBA 2V3FA 3AMZA 1SJBA 3A4XA 3GW0A 2PDLA 5I7GA 5TQLA 4AD5A 3THDA 3LCLA 3TSMA 3N2XA 3WQ4A 3WMSA 3UJ2A 2ZRYA 3BW2A 3G2GA 4WJ8A 5KETA 4IH3A 1OYBA 2QJGA 1WKFA 2VP8A 2XTKA 5GNXA 1Y5WA 1RK5A 4DZ5A 3W86A 2Y5SA 2RDWA 3AMKA 1TV4A 1OT2A 2P8CA 1XR2A 1YXCA 5REQB 1GOMA 3MV11 1WOBA 2NUXA 5I3FA 2BV9A 3DK8A 2AQOA 1PBGA 3KBJA 3P62A 1LQ0A 2PGWA 3A7RA 4DXXA 1G4EA 3L4YA 2OKOA 1YRRA 3VOFA 3M07A 1YMYA 1OCJA 4K1WA 4FNTA 3KRSA 3WLTA 3QPEA 3WMLA 2P3ZA 4BY3A 3AIRA 1UBSA 1GOQA 4HN8A 3CM4A 2E5BA 3UXDA 5K4ZA 3BO9A 4WGHA 3RR4A 5I79A 5EMMA 2WHMA 1BWCA 2Q6ZA 3ABRA 3S47A 2OJPA 1Y5XA 3BH4A 1JCYA 3I68A 3KWSA 3T7VA 4JX4A 2JIWA 3U2OA 1LWJA 3LCXA 4B3ZA 5FCZA 3LHWA 2EQDA 3N17A 4H4TA 4RV8A 2QPXA 3UU0A 3CAQA 1W3LA 4GUJA 1CECA 5BZAA 4UTMA 4I7VA 1ONWA 2EBNA 4BEUA 3QV6A 3OGRA 2RABA 4MJZA 1PZ1A 4HNUA 2C15A 2QCCA 3EAUA 3TH6A 4H00A 2C7FA 3ANVA 3B8IA 1YKWA 1S2AA 1W9UA 3IS4A 4HB7A 3IC9A 4DBDA 4HCHA 2G4JA 2AAQA 4GVIA 1PX4A 3A22A 4KEMA 1GT8A 1HZYA 3H2OA 5E6ZA 1LL6A 1L6FA 5CPQA 2OLSA 4S3FA 1NP2A 5F2GA 1A49A 4CU6A 2W61A 3GG7A 1UP3A 4GBUA 1BGGA 3QW4B 5CXPA 3W26A 1RCOB 1DJGA 2JK2A 3L0GA 4DIAA 1WO2A 1PWLA 1LRNA 1PIGA 4IPNB 3GHUA 4Y96A 3SN4A 4JIIX 2Y61A 3QM3A 2CBJA 4GH3A 1XYZA 1FWBC 3T0BA 4IQLA 2C19A 2BMBA 3GFZA 3N18A 4JTKA 3H2AA 3G24A 1VFLA 3VD4A 2JGYA 3PBWA 3QHMA 1U5JA 3FNDA 4HQVA 4LFYA 5CC3A 4W4QA 1GWJA 1OX4A 3K30A 1MFUA 1N8FA 1QPKA 4RZ4A 4AZCB 3PZIA 4HMNA 1OFDA 4HK6A 2ZC1A 1QU4A 5DF0A 5AB3A 2GJXA 2XINA 4JQ2A 4ZODA 3CQ0A 4L6DA 3TK7A 3THCA 2ACRA 1F3PA 2X09A 1IR2A 5LGXA 3GH4A 4FX9A 2R8WA 4EM3A 3UP8A 4X3ZA 4LV4A 2CKSA 3ZVHB 2A85A 1FWRA 4ERIA 1P0KA 1MXSA 3B8TA 4ZXLA 1BD0A 3EX6A 2G95A 1JFXA 1POKA 2QDHA 3IIXA 1ZJAA 1SO4A 4O54A 4F2TA 2YGYA 4GY0A 3OVQA 4IQEA 2NV1A 2XVNA 4GKTA 2L5HA 1CLKA 2QHAA 3EOOA 3T78A 3AHZA 2A79A 1WXJA 1I6NA 2W6RA 3TSBA 2WV8A 3T6CA 4OBSA 1X38A 2SFPA 1W1B1 1VFUA 1GJUA 4WX2A 1ITXA 3VE7A 1NPXA 4OZOA 1TUXA 3W6MA 2EQ6A 3EA3A 3IJDA 3QXBA 1H49A 1F3TA 4MB5A 1LG2A 1QPRA 3MBDA 4FAMA 3KVLA 5EBKA 3V1HA 3CT7A 1AMYA 1DQXA 3JU2A 1YXYA 4DUXA 4GXMA 2CERA 4IFKB 3VC5A 3EDEA 4PB3A 3A3XA 3ZWTA 2FTPA 2PLMA 5FIPA 4ZB0A 1FH9A 1K9EA 1PDYA 1LORA 2E40A 3UPMA 4D1JA 4W7WA 3VNZA 5J5RA 4WVXA 4X22A 4XVDA 3T55A 2GRTA 2BY1A 1WUEA 4CD7A 2C1GA 2XSBA 1TIWA 2A3BA 4LF1A 3SCNA 4RW5A 1XYCA 2YL5A 5I23A 1BYAA 3FYPA 2Z1XA 3W24A 3GZAA 3MTWA 4DBUA 5I06A 3UJRA 4E38A 5I3JA 4C60A 1W3NA 4UB9A 1FWDC 4N2YA 1IIGA 3LPOA 2OB3A 4JAWA 2PI6A 3ARXA 1DP0A 3Q4DA 3T8QA 1CYGA 3MBFA 2GGJA 5A8PA 3GC4A 2BOGX 5JCNA 5FAGA 1KXHA 2OO0A 3IANA 1GXFA 1LCOA 3TAKA 5REQA 4DBWA 4UTLA 1UUOA 2WBKA 4F4RA 4NVTA 1Q5MA 1UWRA 4S3CA 3LHUA 3UWUA 3UWVA 2CITA 1Z8AA 1KM3A 1F4HA 3NQEA 1IXNA 4RZ6A 4AX6A 3EX1A 2H8ZA 1R3QA 1VBJA 4LYPA 4K36A 3D9XA 4DVOA 3L2IA 4FZIA 4AEEA 4HJWA 1E6PA 3BSHA 3BG5A 2YKKA 1UUMA 3UERA 3A24A 4RXFA 2YA2A 3OPSA 3KLLA 3GX9A 1G4SA 2Z25A 5XIMA 3QFWA 3V75A 3AU6A 3OA5A 2PDWA 3F4WA 4GACA 2E9MA 3VC6A 2FGLA 1W56A 2JF6A 1U30A 5LNSA 1SW0A 4MLRA 1UOKA 4NNAA 4OUEA 3NVWB 4JY9A 3UWEA 1IQ8A 1JPHA 3W71A 3QKZA 4S23A 1WNOA 2YVFA 3M7SA 2O4MA 2CDUA 4H50A 1O5XA 5HMDA 3CMFA 3V3WA 3AIEA 2Q3OA 1VQZA 3O07A 1ICPA 1NHPA 3DENA 2IKIA 4YWOA 2WSPA 2HROA 3VM7A 4Q8OA 1DHPA 1L9WA 1A5MC 2ZUMA 3EAOA 1ICSA 3ARZA 5EU9A 3VKBA 1R5YA 2CHOA 1ZUAX 1BF2A 4ROQA 3U0HA 1DWIM 1NH6A 4IPIA 3CYJA 1CT5A 2XH4A 2E9BA 2QVHA 3E5PA 4NZ5A 1R3RA 4JOMA 1S5VA 5CJMA 3UXLA 1GKQA 3EWBX 2WLYA 4AWTA 3SM0A 4OWGA 4LW7A 4NG3A 5EFDA 1UR8A 4O17A 3GU9A 1V7YA 4GQRA 3B8DA 3NZQA 4QE4A 3TC6A 4V1XA 4XTDA 4MZYA 4I5RA 1RY8A 3R7MA 3WUEA 4Q4SA 1YTDA 2B7OA 3OODA 4H01A 2RJGA 4CD4A 4H4ZA 4R3UA 3ZJKA 3DYPA 4AD3A 4JCMA 4IP4A 1M7PA 2H9AB 5F2MA 1T40A 2OEKA 2X16A 2OWCA 2WQDA 3M0VA 3W2JA 1FWEC 2MNRA 5D03A 3PPFA 1AOGA 3P0WA 3IRDA 1ME8A 1KGUA 1PE1A 4ZO8A 5M1TA 1DWFM 4LANA 1XLEA 3ABOA 4P7RA 4BQ5A 4JTQA 2OFJA 1T6MA 1STZA 4LBSA 4UTTC 4QCFA 1CTNA 5A8GA 3OLDA 1JF5A 3M6DA 4MWAA 2YDSA 3ZVHA 1UR4A 3AAMA 5HWNA 3C3NA 4B9YA 4PZVA 5TF0A 1DQWA 1BTMA 2DZAA 4M81A 2B31A 4MZ1A 3NM1A 1LLZA 1SO5A 2J66A 3VAVA 3OU8A 1VKFA 4A22A 3EWCA 4IX2A 2ALRA 1IHIA 3STCA 1YYAA 2C6QA 1LLOA 4XZ9A 2J7GA 3M5XA 3PZQA 5ENLA 5AC6A 3KVKA 4NQ1A 3WK3A 1M04A 1FIQB 4HGXA 1R30A 3M47A 3MWCA 1P5BA 5HOSA 2HSAA 3LBCA 1GRHA 1AZ1A 4RR4A 4YXGA 3LENA 2Z1BA 1DOSA 2IPFA 5TR3A 2Y88A 3GG0A 4DUWA 2RGLA 3KBNA 3LYEA 1B9ZA 4AD0A 4G9PA 1NARA 3H4XA 3TQ0A 2PGEA 3UXAA 3WJZA 4IFKA 3UESA 1KCKA 3RIKA 2BOFX 3IWPA 4IMFA 3GVGA 2AL2A 4LBRA 3BURA 1QBAA 1WDRA 4UMCA 4PCSA 3BAWA 3ES8A 2PDCA 4A3YA 3N15A 3FA5A 2VRJA 2PC8A 4TTUA 2ZA1A 4P8XA 2VNCA 3EOLA 4AY1A 2YPIA 4PMZA 4E4PA 1LL7A 4I6VA 5B7YA 3K13A 1V0MA 5D04C 3VI2A 1RCXB 4MB1A 2QMJA 3U6WA 2O55A 3EXSA 2TAAA 4G8TA 3DG3A 1X6UA 3IJ6A 3TFXA 2E0PA 2QCFA 4US5A 1A47A 4ZQRA 3VCNA 1RBOB 4UBPC 4CCEA 2CLOA 3QTPA 2ZRUA 1TTJA 3VCCA 2NQZA 1UOZA 4O50A 1XLIA 3W70A 1FEBA 3EUB3 1NQKA 2CLMA 1JCJA 3K8MA 4JQ1A 5AYIA 1SJCA 1TFVA 3BARA 1VFTA 1WBJA 2DDXA 3G0XA 2GOUA 3BWWA 4XK2A 2V81A 3BC9A 2WVTA 1A4MA 3LMYA 1EHAA 1FHLA 4GQQA 1S2TA 4TMCA 2PDFA 3NQ6A 3PJXA 2DIKA 3CGBA 2BWGA 4RK8A 3G8RA 2X2YA 1YTEA 1XDIA 1UW9A 3HF3A 2XG9A 2VWTA 3QN3A 1GVOA 3SCVA 3EX4A 1S1PA 4GC4A 2XGZA 4F0RA 3DU0A 1OBAA 2G4FA 3DK9A 3NDZA 2E1WA 5KITA 1Q66A 4NNBA 2J7HA 3HU7A 4LCSA 3BAJA 2C1IA 4FB7A 3EEGA 3E3HA 3HPAA 4HNOA 2BVTA 4HCDA 4K7VA 4KWSA 2CETA 2QYGA 3R43A 4Z42C 4RNIA 1R85A 1XYFA 3G5EA 1I2RA 1DJHA 1V3IA 5FJIA 1QW7A 1B3WA 4UTWC 3TTEA 4HA4A 1TJ0A 1C8YA 6TIMA 2I1OA 4TOQA 5JU6A 2GYIA 1EYWA 2IW0A 1P0NA 1HXJA 2EO7A 4QQUA 4MYXA 3CNYA 2DY3A 2J7CA 4JTCA 3PS7A 5DT7A 4XD5A 4UFIA 1B3YA 3KRZA 5A6TC 3DOPA 4Y7EA 3EKLA 3AMDA 5C8BB 1ADSA 4KFOA 2AGKA 1UR3M 5D02A 3SCWA 1QNOA 3HTWA 2VEKA 4RE0A 3LA4A 4NI8A 1XCFA 1RPXA 3CH0A 3BL3A 2VDGA 3ONCA 4P2VA 4DLFA 2YZRA 4NIRA 1VHNA 3TLLA 2I57A 1AUSL 4Y2WA 5IHRA 3A9BA 1GG0A 4M1BA 5JCMA 4A8NA 1GPFA 2ZX6A 1VJZA 3VMOA 2E9LA 1LQAA 5DCBA 1DV7A 2BXVA 3CZJA 1UR2A 1E4IA 1R46A 2D24A 3REQB 2H9AA 3EWXA 2B7PA 3LSCA 4DAFA 1WQ5A 3NVTA 1H61A 1PV8A 3QZEA 3TMQA 2PDHA 3B9DA 4R5EA 2HQMA 4ZZ9A 5HR7A 3IJ7A 2OZ8A 1Q6FA 2WZTA 4HOWA 5EA9A 3R94A 3FX4A 4HTYA 1EHNA 1OZMA 1JAEA 3R07C 1CGWA 1EBGA 1SFSA 3U8GA 5HUOA 1CWYA 3NDOA 3QFEA 3DERA 3AYTA 2V6AA 4HYRA 2UY2A 2PPGA 4AHPA 4GO8A 4XZMX 3GHSA 3POCA 1KB3A 3UA4A 3VTRA 4KPRA 4A29A 4QXIA 2A6LA 1TMHA 3NG3A 4IM4A 3UZXA 3MUY1 4V27A 3H2CA 4EXQA 3NQDA 1ZP4A 4BWLA 4J3VA 4Z1YA 1HGYA 3RF9A 2OYKA 2OSYA 3ZR4A 3P8JA 4IT1A 3U7BA 3PBVA 4M29A 1EX1A 2EXOA 1FDYA 3NM3A 4MNLA 4L4LA 3N6JA 2PODA 3N2BA 3GYEA 5KMYA 1ZSXA 2ZADA 3GVWA 1RSCA 1CLVA 3N12A 1NTHA 1AA1B 3LMZA 1RUSA 1S5WA 5HPOA 1F3WA 1GEUA 4MADA 1WOAA 1E9LA 3AOFA 1VDVA 5FI8A 4DX3A 9CGTA 4ZOCA 3GIPA 4LVFA 1JZ2A 2EQ7A 5ABEA 1EOKA 1OX6A 3GAKA 5EY5A 2ZBTA 3G1SA 4JQAA 1Z41A 3AM9A 4CD8A 1WPCA 1M6IA 1HJQA 4N7QA 1GCYA 1JRPA 2YCLB 2BHZA 2BODX 4CNNA 3M46A 2PS2A 4MVAA 1M01A 1DXIA 1R9ZA 3L5OA 2CIPA 4HNNA 5JBEA 4MUZA 3BW4A 2FZBA 1A3XA 2VR2A 4WZHA 2FZMA 3R89A 2YB4A 5HBFA 3UJFA 1EDGA 3MMUA 3RMEA 4XZWA 1K8XA 1PCWA 2J75A 2ZDRA 1H0IA 1YTKA 4GJIA 2X8RA 2EAWA 5J8LA 3KL0A 3HPFA 2R1MA 2DSWA 5G1TA 2D23A 2G97A 5FJJA 5BMWA 3WJXA 4DZAA 4GQBA 1X1ZA 4RZBA 4FX6M 2UY4A 1U1JA 1SSDA 4Q4QA 4XAYA 3DBPA 1RH9A 2ZX9A 4N9DA 1LRQA 5G5HB 2DSUA 3H6OA 3QV7A 1BG9A 9XIMA 1Q6OA 4QNEA 4F0MA 3APYA 3ZR5A 3WX7A 3VNLA 4H9MA 1Q8JA 6CGTA 1V08A 3L67A 5D32A 1Y8BA 1PYFA 1B4EA 2IPWA 4OE7A 3L12A 2QJHA 2YYUA 1J12A 3NZRA 1ZY9A 5HQLA 3VIIA 3WDHA 4H4WA 3CWOX 1HJXA 4QE1A 3OP2A 2BS9A 2Y5EA 3PFMA 1EJSC 3CV2A 2NV2A 3LLXA 2G5WA 3W07A 1VFHA 4Q8QA 1CCWB 3WBEA 4DXKA 4MWAD 2I9UA 3FA4A 2DZWA 5AVHA 3SW6A 2GQAA 4JD4A 1JZ7A 4W89A 4G1NA 3GXIA 1LOLA 3E96A 3GDKA 1KRMA 3GIYA 3BPWA 4LU0A 5CGQA 3STEA 3LBOA 4LNCA 1DL3A 4RUBA 2Y8UA 4CD5A 1F5ZA 1BRLB 4LYQA 2ZWZA 3QC0A 3H55A 2WC7A 1E73M 1FH7A 3ZSTA 4A4AA 4U3CA 3KW3A 4PCNA 3J7HA 1K1DA 1MMFA 1R2RA 3ZSSA 1HO4A 3GDTA 3ATYA 3B03A 1HQTA 5LKYA 2Z1VA 5TD4A 3AIUA 3WD3A 2XIOA 1T96A 3MYOA 3U4FA 2QCHA 1V02E 1GEHA 3AIBA 3REQA 2OT0A 4G7FA 4A21A 1FDZA 1B3XA 5AHEA 5KVHA 4UUIA 2E5DA 3QGVA 3V0UA 3C61A 3IPWA 2OWWA 3BZJA 2F7FA 3OIXA 1PZ3A 4D71A 5TAOA 1P6CA 3UEQA 5BOOA 2VGFA 3SJNA 4GBDA 3EEZA 4EF9A 3WDJA 3FHQA 2VMFA 3VM5A 3QPYA 3DN5A 1KM2A 4RE4A 2OR2A 3HBLA 4Q7NA 4ORIA 4US5D 1M7JA 1XLHA 3H2MA 3RILA 4C6QA 4NAFB 2V30A 2CLPA 3AXXA 1KM4A 3BAXA 1KWKA 3LCHA 4K38A 2WK2A 2YL8A 3WQGA 4FX7A 5CZ0A 2FVMA 3CU2A 1E4LA 5K9XA 4LEQA 4H2HA 5A2BA 1BXCA 4CNTA 4QDWA 1TWZA 2EPHA 4PBFA 1YLVA 1H3GA 3RYSA 1F6YA 3QYQA 2HRWA 2X0YA 2W0UA 4PUNA 3EMZA 3MCNA 3DAQA 1QAPA 1NWTA 1FX6A 1I8JA 4C6FA 3L9CA 1MXDA 2VUNA 1SZGA 3W02A 3D0CA 3L4VA 3DDMA 1MO9A 4HA3A 3ZXWA 5E0CA 8XIAA 2BB0A 1UASA 4DWSC 1WCGA 5C7VA 2YX0A 2Y4SA 4EPDC 1VFMA 2J9XA 2QIWA 1HJVA 4O19A 3O05A 3V0SA 4XKYB 4JYFA 5G1MA 4EMJA 3AZRA 1GTHA 2V9DA 5I3KA 3GTNA 2P10A 3SBFA 3TU9A 3VA8A 4D8LA 1JD7A 1CXIA 2ABAA 4A2RA 3UZWA 3PTMA 5JIPA 4IQDA 2NVKX 4W88A 3IIPA 2NT1A 4TVWA 3B3DA 3QH2A 1H62A 3OG3A 1E1CB 1XRTA 3K1GA 3WY1A 2YW4A 1OIFA 3AS2A 4BQ3A 2QUMA 2Y62A 4EACA 4CVUA 1FWAC 4DUOA 1JUBA 3E0IA 1FWSA 1CPUA 3KFTA 2GQ3A 5JXQA 1MWOA 2FZ8A 4L80A 1IGSA 3O1NA 4YVXA 5JUVA 2YYTA 2IXUA 3K4DA 1XH1A 4P7OA 2NSXA 1UD3A 3W7EA 2Z7GA 2J7DA 3GQYA 3EB3A 4C6CA 3BV4A 1GW1A 4EVZA 1F3XA 5HQEA 2WJZA 1E0WA 1X97A 1XX1A 1FEAA 2XFRA 3DKLA 4DM1A 2CWXA 1CBGA 1QO2A 3B8VA 3G1XA 1Z89A 1TJPA 1PJ9A 3N19B 2Y5JA 4XO6A 2VC9A 2ZUWA 3GE7A 3W1NA 3MW7A 3WYZA 2AQVA 4ZQNA 1AL7A 1FBAA 1N63C 3K1DA 3DEQA 1IWAA 4JTSA 5I3GA 3OVGA 3GUWA 3UG5A 3LTSA 3GZ3A 4WKAA 2HNEA 2WWDA 2C1HA 1H2JA 1PPIA 4IGHA 4MFDA 2VC6A 3ZLHA 4BF7A 4QCEA 5EL1A 2J77A 4JKLA 4KCVA 1XLMA 3I65A 1NDVA 3SZ8A 4C7DA 4DB7A 3W7KA 2FIQA 3VIPA 2V67A 4RZ5A 3S9ZA 3UG3A 4S3BA 5FOOA 3ITYA 5DANA 2WVSA 3B9EA 1A3WA 3CZGA 3L4TA 2ZRWA 1O66A 1JCMP 3MVTA 4GX8A 3CGTA 4D72A 2QMKA 5HULA 4M8UA 3LG3A 3WNMA 4ZTXA 3M0LA 4PEEA 2W3ZA 4HZ7A 4I9TA 4ERGA 4I8YA 2F2HA 3W7PA 2Y1HA 3DG7A 5F1VA 1AJ2A 2W67A 1J8VA 4AZ6A 2ZTJA 4PSPA 1YDVA 1E6NA 1EPVA 3P82A 3EX2A 1BWKA 1RK6A 4QE5A 1HJWA 4UFJA 1ZAJA 1E1EA 3W01A 4I3GA 4JFVA 4F66A 3FW6A 4FMVA 3N9KA 3WBWA 2VR5A 2C14A 2POTA 2VFIA 3JS3A 5EYWA 2UWFA 1MZRA 3S4TA 3COTA 3GTXA 4DYEA 2G37A 4H83A 2GH5A 4A3UA 3THUA 4NX5A 2WOVA 3LBMA 4RCXA 3IIOA 1TCMA 3QPZA 1E6SM 5AYXA 2ZTKA 2ZQ0A 4XBSA 2QCLA 3W7OA 5C9ZA 2VEFA 3I4KA 3HGOA 5DFAA 3ATZA 1FXQA 2HDJA 4LX4A 3M4HA 2YVJA 2P3EA 4TMBA 3AIVA 1KBLA 2C3CA 1PCKA 4NAFA 2PLKA 3ORWA 6REQA 3GDLA 5CKSA 1DWAM 1V5XA 4WY0B 2TPSA 2P8BA 2WPFA 1F6PA 1KBKA 3URHA 1F76A 3O6CA 3UGRA 2VGGA 1KTBA 5DBTA 2PDXA 1HNYA 3W2LA 4QJ1A 3A4JA 4J3TA 3UXKA 3WBXA 1J0HA 2NXGA 3EMQA 4V28A 1GVSA 5I03A 4S3AA 3A13A 2VVSA 5IRPA 1EGVA 5CC5A 4L64A 2YBUA 1JRCA 1RD5A 2BASA 1PS9A 3SSJA 4MNMA 4FOKA 2W0HA 4UTTA 3EGJA 4MNKA 2BX7A 2VGIA 4M19A 1VBHA 2VT0A 1SSGA 3LCFA 4H2CA 5D9PA 2GUBA 4QG9A 3W38A 3EDJA 3K46A 3HPZA 1K6AA 1G1YA 1C9WA 1RP9A 3OLEA 3CMJA 3TQKA 3WQ6A 1D3GA 1UWTA 4CQ9A 4AC1X 2UZ9A 2UBPC 3RRXA 2OKTA 2F38A 4UXDA 1A5SA 2YL9A 5KVIA 2FZDA 4IPPA 1K9FA 2PWGA 1XGDA 1C92A 2DEPA 3VGBA 3VIJA 4JFWA 4QHRA 4D1IA 3PZTA 4CUCA 2E8ZA 4N42A 4MB3A 2INZA 1KGWA 4L7ZA 1XIIA 3UG4A 1EXPA 4WSHA 4X61A 4PMUA 1VFSA 4NF7A 3I7RA 2DUXA 4BHYA 1XGZA 4A6GA 5C54A 5RUBA 3IRSA 1B3OA 1OCNA 3WLIA 4KCTA 4I9MA 2OVLA 3TN5A 1XG3A 2YDQA 1KR1A 2YBVA 3T40A 3S9YA 1O5RA 4WDTA 4Y9MA 2QT3A 1W9VA 4GZEA 2Z7KA 4IICA 1XRVA 1LOQA 2D3LA 3ELFA 3THQA 1TVLA 2Z6IA 1D7YA 3NXFA 3VOJA 2BVWA 1F3EA 3FYYA 3GNPA 3F4VA 5LA1A 1GJWA 3G1DA 3GXNA 4L65A 1XXXA 2A3HA 3URBA 4Y8EA 3TTYA 4M0XA 1MYRA 3Q37A 4X9SA 3FIGA 2YQUA 4JHZA 3SO7A 2HE8A 5GNZA 2VELA 4LAMA 1BXNA 4IQJA 3Q45A 3T08A 1EBDA 2AL1A 1RXOB 3C0QA 3CS2A 1L6YA 4HU0A 4O10A 1ZP3A 3WDIA 1JCLA 3SGGA 1R2SA 3RCNA 4D6JA 3WIJA 4DO4A 4PCPA 3CEUA 5K3VA 1GREA 2O7SA 2FMNA 1F2JA 1XLJA 1F9CA 1FTXA 4LRSA 4N6EA 5EMLA 5HWJA 3W85A 4DI9A 2ZUTA 3RM8A 4AVNA 1DWGM 3CLWA 1XRSA 4LALA 2EPKX 4R7JA 3N6HA 2Y7FA 3UZJA 1ISWA 3SADA 4A35A 1J0YA 4QJ4B 4TTGA 1ENUA 1XINA 4LUTB 4FSAA 4NRRA 3HO8A 5A8OA 1GVYA 2JKAA 3EDKA 1FXPA 3TC3A 2AQWA 3BLFA 3CAVA 3GNDA 5FEZA 3L5MA 3BE7A 3E02A 2FHBA 5DBUA 1E51A 4OU1A 1OY0A 1UWIA 2CKRA 5AC7A 3NWRA 3H21A 1K4GA 3A4WA 1YPFA 3TN3A 5BRPA 3IACA 2ANUA 3MWAA 1PZ2A 1JPDX 5DY3A 2VTFA 3LEPA 3LCWA 1W2VA 2TSYA 1XKYA 3GG8A 5FF2A 3NOEA 4LVAA 3LRMA 5HANA 2BC0A 1O1HA 5K9DA 1GQKA 4UTWA 3FJLA 3CLMA 3W74A 3E0WA 4EF8A 4TQTA 3P93A 3W1MA 1YBQB 2R1PA 1IV8A 1CGYA 1NDWA 4M80A 4WXZA 4UMBA 1J18A 1DTUA 2Y7GA 2V5JA 3UJSA 1H7RA 3EDFA 1LYXA 4OQVA 5FACA 4AIBA 2DZXA 1UZ4A 3MO7A 4G7EB 2P88A 1EJVC 4DPQA 1WXYA 2WMKA 2B7QA 1OT1A 3L68A 2WOIA 4MSSA 5FA5A 1QBBA 1GKRA 4JICA 3BW3A 4OOUA 3T0TA 1XWYA 1JXKA 2J9ZA 3TJ4A 1K7FA 4LY8A 1XLAA 4LH8A 4GNKB 2HK1A 2X8HA 4QFUA 4JTIA 1ZJHA 2J7FA 1B3ZA 1LG1A 4XTIA 2C18A 3HZ3A 1S7MA 2VC7A 1KQYA 4G2DA 4UTUA 1GORA 2X1IA 2Z1KA 5HR6A 5EBAA 1ZCCA 4N4PA 5D2XA 1IEQA 1Q6QA 3BQ6A 4XZIA 1WA3A 1NQ6A 4UIOA 3DGRA 2G0WA 3TJIA 4PSRA 3PAOA 4PTWA 4JKMA 5DEZA 3HFYA 1JZ3A 3T2OA 3KBMA 3ME3A 4C6PA 4X60A 4JCLA 2QF8A 3S83A 4ACYA 1TO3A 2YZ5A 4J3UA 3G18A 3L5LA 4X9YA 3AN1A 3HN3A 4L6HA 2QUUA 1OX5A 3DFPA 3S1VA 2J8FA 1VPQA 5CPNA 4ALDA 4O13A 1JPIA 4DNMA 1GYMA 2J13A 3VK5A 3E0LA 2V69A 3N3MA 1UWQA 4O53A 2HZGA 3AZSA 3A12A 1UJQA 5CAKA 5HWMA 2P1FA 4LS2A 3VOHA 4JEJA 4B15A 1GOKA 2EPNA 4NNCA 3TN4A 3N04A 4H9UA 3YPIA 4P7LA 2WANA 3TNBA 3RLGA 2YXXA 4FXRA 3LPPA 4FALA 5DN1A 4G6CA 3R6IA 4AX7A 4NASA 3TOPA 3PANA 4C6EA 3UVIA 1S2WA 1QT1A 1H63A 1W3TA 3M44A 2WCAA 4GWEA 1UKTA 4FNRA 3QY6A 4IX0A 7ENLA 3P3BA 1UH3A 1XD0A 2Y2WA 1UD8A 1ISXA 3U5UA 2Z1WA 1TVNA 3KTSA 3PTKA 4DUVA 2HCVA 2HTMA 4CU7A 3QV8A 1R3YA 2ZIDA 3TUUA 3MMTA 4O8AA 1OFPA 7TAAA 4U3AA 4YVPA 3NL5A 2A8XA 1XP3A 1TCDA 1CX9A 1W1VA 4JFTA 1JDAA 2WYSA 3R58A 4MKVA 4PFHA 1XLLA 1KXQA 1EF3A 3LHTA 1QI2A 4F0HA 5KZMA 3BGGA 1RJPA 4L1XA 1MW1A 1F05A 3F03K 4B5SA 1J11A 4MDOA 3STPA 5AYBA 4ROPA 5A5WA 2V5LA 2VEPA 2FHCA 2WC3A 5G4EA 4GR1A 2W63A 4JR5A 3IARA 2ZUSA 4RPQA 4HPHA 4H4YA 3KBVA 1HO1A 1E40A 3TX9A 4PRRA 1XRFA 1V51A 3VKDA 1CXEA 2EHHA 4P8VA 1FVPA 4UOJA 1IIHA 4GI4A 4QDMA 1GG1A 2RHGA 3TDFA 2GWNA 2QV4A 2PRMA 3A64A 1K02A 5ABFA 3WSUA 1OFRA 1F73A 5B7ZA 1VPXA 5ER0A 1Z32X 1S39A 1TUFA 3GNXA 1FFRA 1GRFA 3CQJA 1G7VA 4GRSA 1JGMA 2BDQA 1QJWA 4PEKA 4E8DA 5CQ1A 4FR6A 1VD6A 4ICCX 2OODA 4NYUA 4PFMA 4UZSA 4YN5A 1RJQA 9RUBA 4K8HA 3UCDA 5E93A 4JTLA 1W0MA 2XN0A 3GD6A 3W1UA 3VGEA 4LJ3A 4WJEA 4CQ8A 3BJTA 3O3RA 3HM7A 3PZOA 1NWRA 3BZGA 4HK7A 2PF0A 3A7UA 5T91A 1V6UA 3JRKA 1NHSA 1E5NA 4ZFMA 3LGDA 3HMJG 3LXAA 2ZKMX 3N29A 1Q7ZA 1UA7A 4M7TA 3KCLA 3S5OA 2PDIA 5ABHA 3AXIA 3BICA 2X7VA 1SR9A 4FLOA 3WK1A 5DLCA 3HV8A 3QMTA 1QXLA 1QI3A 1G67A 2YR1A 2Z0IA 2QCDA 3IUDA 2DQXA 3JZEA 3APTA 4S3JA 4KQNA 4JNZA 4G7EA 4W93A 1XBYA 2E4TA 1JYWA 1V79A 1JAKA 1E9IA 3DYOA 3NTYA 2CWNA 2DH2A 2V5DA 4JIPA 1T99A 3BGJA 1X7FA 1EC9A 4XIAA 1BYDA 2X1RA 2ATSA 4WY0F 3VU2A 1YPIA 5J5DA 3FXYA 4KWOA 1RM6B 3NQ7A 4LEFA 1N62C 4H9TA 3IIZA 3NYDA 5DCDA 5IDZA 3B05A 1XIFA 5ABGA 5G2IA 4C1NB 1XH0A 1VHCA 4EPKA 5D30A 3EWUA 4IMDA 4C7GA 1EGMA 3VDBA 1D7FA 4FIRA 2BGQA 2F84A 4RDWA 2QS8A 3FEMA 4RW3A 4NP7A 2D69A 3E2SA 1TE6A 4J3ZA 1QW9A 3L4ZA 3WQFA 2PEVA 4POCA 4M52A 3F5JA 5CSRA 1BGAA 3PZGA 2DT3A 2PP1A 3H7UA 5HDRA 2W3RA 2C16A 4RNFA 1LZOA 1FCUA 5BCAA 1NU5A 2YCIX 3GKAA 2CFYA 4UQBA 3L65A 1SUXA 1EUAA 3TVAA 4L9XA 4YWIA 5BXTA 5LZLA 3BLPX 3T1GA 1GGOA 3IIVA 1Z9AA 3QSRA 1DTNA 2V3AA 2REQB 1UR1A 3G77A 2YA0A 1KFBA 3PBMA 1UZ1A 1NWSA 1TZ7A 1UKSA 2Q8XA 3C8NA 1J4EA 1QOXA 3LI1A 2O56A 5CG7A 4CNOA 1B31A 2Y7EA 3AXKA 1LT8A 1UR0A 3W27A 1TZZA 1N82A 1GYNA 1B30A 1EYEA 1EOMA 1MEWA 1KKRA 4ONVA 3ZJ7A 3HG4A 1N61C 1N7KA 1JCTA 2Y6ZA 2NUWA 1I2NA 4ZB5A 2Q71A 2W92A 1GKPA 1Q7MA 3MI2A 4FP1A 4YTTA 1HGWA 1XLCA 4LB4A 4WOQA 2ZXBA 3W7GA 1XL9A 1TJ2A 2VX4A 5EGRA 4CN1A 2QQ6A 3NS1B 1TVPA 2V8ZA 2QDDA 3P74A 4X2RA 3RRAA 2VEIA 3QSTA 3ITXA 1GVEA 1QWGA 1EO7A 1FWGC 3MO4A 1TPDA 4GH1A 2QXWA 1A0DA 4GFSA 3WELA 6XIMA 3FLUA 3PZUA 3A3HA 4M7SA 1MDRA 3D5HA 5A6JA 2X8CA 3GD3A 4S38A 5KZDA 4C5YA 2O7QA 5FJRA 3EPNA 1D3HA 3B40A 4HHLA 1XHGA 1OG6A 3O6YX 3EWWA 1SYTA 2QDGA 3DI0A 2GL5A 1F4AA 4MJ4A 3MCMA 3VDGA 1XLKA 2RDTA 2WVVB 1C8QA 1R6WA 3M41A 3MP5A 1VB9A 1XH2A 3O06A 4GUFA 4AZHA 1C90A 2Z2UA 3ITLA 2GJLA 4NJGA 3MSDA 2IQTA 3QR0A 1ZBWA 1TKKA 1ZCOA 4Q8MA 3DJGX 4AHOA 2FH6A 2WXDM 5FJUA 4ZMGA 3L4XA 2CC0A 1QWKA 1HN1A 4MYAA 2YOCA 3CV6A 1Q1RA 3QMSA 3VD7A 3E2RA 1DXLA 4ZB2A 4L6OA 4FNUA 4O18A 4IZGA 3UZYA 3W1RA 4GY7A 4NXKA 3RLHA 2ZX8A 3QOKA 3R0UA 1OVDA 2EGZA 4PULA 5HNNA 4U5KA 3UG8A 1TPFA 1W1PA 1TSIA 3EKZA 3U2EA 7A3HA 3W1QA 4HA1A 4JIEA 2CEQA 4KEUA 2X41A 1UIOA 1VBGA 3NUKA 4C5ZA 1KGXA 3V1PA 1QNQA 4J3SA 4CQCA 1XYMA 1LUCA 2PDJA 2CLEA 4ZBCA 2J62A 1H7OA 1KTCA 3PSWA 5D9OA 3BLIA 4K1GA 4LAZA 3RITA 2IPJA 4AYSA 4MIMA 3I7SA 2E1DA 4J57A 4A8LA 2Z2BA 2VQUA 3SUUA 1I9CB 2AMGA 5IOBA 1WKDA 5E1QA 1JDCA 1I0BA 3ARWA 3UCCA 2PTXA 2NXIA 1X6NA 4GIRA 4ECLA 1PTDA 1O6IA 2R1KA 2DT0A 3PM6A 3SRDA 2WMJA 1OSEA 5E0KA 3UR5A 4F9DA 4HJFA 3ARUA 3SJ3A 1QMLA 3W75A 2ISVA 2KAUC 5I6SA 4NAEA 1WV2A 3D47A 5JBDA 1Q6DA 1V4YA 4DJDA 4Z08A 3LK6A 1XSJA 3CXOA 4Q8UA 4Y9NA 4PUMA 4DLMA 3UR2A 1VF8A 1ONEA 4H9YA 1O5KA 1CGXA 2PB1A 5LXXA 1M9HA 3M16A 4LUSA 3WMCA 4CCZA 2FGBA 1S5NA 3LM3A 3W6LA 4C1NA 1XBVA 4JHMA 4PUDA 1EJ7L 4KIRA 3S42A 3WH5A 2Q02A 2Y63A 4OV4A 5LNUA 4RNJA 4AC7C 4MOZA 5DQPA 2WVUA 4UFKA 1IXPA 2W3SA 3BOLA 1VPYA 3BTNA 4FA3A 4C1LA 1UJPA 3B8SA 4UTKA 1E0XA 1H5YA 1E0VA 1GOWA 1KRAC 2UY5A 3RGTA 1UHVA 3ZOAA 1BKSA 4ZE4A 1EWDA 1PEZA 1NF0A 2W5FA 1E55A 1W3HA 1KBJA 3LX9A 4YVVA 1GQIA 3KP1A 3SN1A 3CV1A 1KC7A 3N11A 3R2GA 1WAUA 4GYPC 3GR8A 3TMLA 1VYSX 3KS6A 3L2MA 2R24A 3NVDA 1IF2A 3PB0A 3HQOA 3N4AA 4DI8A 2REQA 3PNZA 3W7QA 7TIMA 3D3AA 2XUCA 3TE9A 5FEWA 3ALGA 3JVAA 1ZKQA 1J79A 5G1YA 5KSWA 1OM0A 2FJKA 2HQAA 3CQIA 5FESA 4P61A 4GUGA 4FOJA 1UR9A 1W6TA 3VGFA 3PZMA 4A8RA 5I3DA 3KWXA 2TMDA 2XH2A 4H3DA 4JDRA 4WSKA 5LNRA 3PWAA 3DFTA 1X6LA 3TCEA 4QS5A 3TR9A 2OSWA 4ADWA 3C2YA 1EH9A 1W17A 3VX0A 1TYGA 3MDWA 2H6RA 1E4NA 4B5WA 1KFLA 2VYOA 4D6DA 3HURA 2PCQA 1R47A 3C0LA 1UPPA 2HNHA 2NT0A 5JIWA 4JTUA 3V0TA 3MDUA 1WYIA 4MTVA 1TE1A 1JZ6A 2PDYA 3GVRA 4EANA 1E43A 3R8RA 1IEVA 1OC6A 3WUGA 3SCOA 3IJQA 1C91A 1M3UA 3LD5A 4O1AA 1GRBA 1FHVA 1BYBA 1NJJA 4K3ZA 2F2KA 3MVIA 3BAIA 4CNUA 1POJA 2Z27A 1G5AA 2G50A 4K6AA 1DKWA 4XD4A 2ALDA 3HV9A 4LB3A 5CGMA 2PURA 3V35A 3V36A 4YYCA 4TX6A 2XM1A 1MSSA 1OX4B 4M1RA 1PZ0A 4RPPA 4E2DA 1PKLA 1ZMDA 3TWBA 3AIQA 3QGKC 3RJYA 1ZQ5A 3VIHA 1HVQA 2WVVA 2GJXB 4I90A 4PTXA 3N4EA 3B9NA 3RNDA 4IGMA 1YW1A 3H24A 1ZXIC 4ZOBA 3TZFA 4JTEA 1SVDA 3CZ8A 4ZCWA 4DZIA 2HS6A 4URIA 2PU0A 1BZLA 3LZ5A 3CZEA 1OD0A 2EJ1A 1D8CA 3I3BA 4FO4A 3THAA 1OFEA 4GG9A 5LNVA 3ZR6A 2A7PA 3QLLA 4D2JA 3TJXA 4XBKA 4XKMA 2PWFA 5HMSA 2AGTA 1Q8AA 1MUWA 4MM1A 1OIMA 3HQPA 3NFUA 3C0JA 1Q4WA 1W2PA 2VX7A 3DUGA 3GNOA 2OGYA 2WKLA 3FY1A 5CPMA 5D2VA 4NEVA 4UR9A 1EWEA 1TJ1A 2AAMA 5T9BG 3ZIZA 1G6CA 3EDDA 3IJ8A 1AQFA 1XI3A 4AD4A 4GLEA 1WAWA 3PUGA 3GWQA 1TWIA 3UZZA 3HRDC 1B90A 2ZCGA 1PKYA 4YLWA 1UG6A 4FHAA 3NCOA 4JXCA 3LGEA 4RL3A 3GXFA 3KZSA 4NKCA 3EX3A 1H1NA 1G4PA 1EKOA 2NPXA 3ECQA 4L4MA 4GGBA 3LN3A 2PWEA 3GRSA 2YXGA 3W7JA 2XVKA 3W6YA 2JE8A 1MVYA 2E5CA 3LXBA 1A0CA 2E77A 4OECA 5U1OA 2QPSA 4LTSA 1MFVA 3W2UA 3E12A 4H19A 2ZVRA 4BFAA 5B80A 1ALDA 2PTDA 1FFUC 3NXLA 4JFUA 4AEFA 3NNTA 4RJEA 1W1A1 2CW6A 1QUMA 1MW3A 2BTMA 2GZXA 3IJLA 3RO6A 1UYQA 3QYSA 1QI4A 5A6SA 1W5NA 3BLLA 4LOCA 3UYCA 5FL1A 2ZVIA 4K8DA 3H2NA 1WDWA 4QLLA 3NEVA 4Z0SA 4PMXA 1S46A 1V0NA 3SCSA 4Q6JA 4AD1A 4GD0A 3LZ3A 3ZMRA 1MEHA 3KDNA 1RLCL 4P8WA 1CLXA 3MJYA 2D22A 3N2CA 1S2UA 3SQMA 4IMCA 4Z1CA 1R9YA 4A2SA 3LNMA 1NFBA 2PLCA 3SGZA 4DO5A 3KOZA 2ZXQA 2ZZ7A 3NQCA 3U9IA 4C6DA 3T0CA 4D6IA 2VOMA 4C6OA 5ECVA 4UQCA 1KFJA 1KCXA 3HW2A 1VIZA 3SUWA 5K9CA 3VMNA 2OOGA 1XG4A 4IP7A 1VYRA 2ZX7A 1QNRA 5L9FA 3DECA 1L6GA 2PRHA 2Y89A 5K2ZA 3VDAA 3FSTA 3LTPA 3II1A 4BEQA 1FCBA 3GR4A 2WCGA 3ICJA 3PR2A 4A05A 1N2VA 3OZPA 3IK2A 2XFWA 4PMRA 5A6MA 1PB0A 1US2A 3AISA 3E49A 1S3HA 2DPEA 3LXCA 3GDBA 1HKVA 3MYPA 2QGHA 3L21A 1QI5A 3S1UA 4LC8A 5LIUX 4FNQA 3U7VA 4Z1AA 3N2MA 2YVGA 3WBYA 1DJNA 3CAKA 5BWFA 3W29A 2CZEA 4XD6A 1LOSA 3CHEA 2KZHA 2ISDA 5DMMA 3TN6A 2OQHA 3XINA 1SO3A 4ZA0A 2DSKA 1ZZMA 4IFRA 4E2OA 4HHMA 2E7FA 2A3CA 1EIXA 1P1MA 2EG6A 3T07A 3RNMA 3QF0A 2WJFA 2X42A 4H6QA 1HKJA 3GHRA 5FSDC 1AD4A 3BG9A 3C6CA 1J5SA 3NGFA 1Q6CA 8XIMA 1WP6A 4IIBA 1XANA 4NYYA 3GAYA 2WWCA 1XV8A 3UWZA 4DELA 1Z3NA 3KRUA 1XS2A 5JH1A 3VDCA 3LGGA 1J2WA 1WXZA 5M2FX 3GKFA 3OC4A 2DP3A 3DZ1A 3FG2P 3KHJA 1PHWA 5CBBA 4E3VA 1L8PA 1NHQA 3Q6JA 2Z00A 2J7EA 4ZVJA 2PWVA 1JDDA 3L66A 4CGTA 2VZSA 5LSMA 1VLIA 3HA1A 3UZ5A 3EWDA 1ME9A 2A2IA 5BU6A 5F2LA 3G22A 3N1AA 1TQXA 3OB8A 2VFDA 2ZWYA 4ML9A 1U33A 1XBXA 3D3FA 1RA0A 1Z44A 3EXTA 3PHAA 1JCXA 1QATA 5D2TA 1HW6A 3RLUA 1ITCA 1DYSA 3GXTA 3GY1A 4Q4RA 3E2QA 2YL6A 4X2PA 3CWHA 3AWOA 1H6VA 2J78A 3H23A 5JCLA 4IUGA 4I6KA 3W37A 1DJZA 4LF2A 5DXXA 4UTJA 4OT7A 1LPFA 1RR2A 3P80A 4Q8NA 1VEPA 2WJDA 2F61A 3V5CA 2PGFA 2EPMX 1H51A 1REQB 3W28A 3BVJA 5H2ZA 4FNSA 2QUNA 5HINA 4MWAB 3VINA 1SO6A 1AG1O 2A1YA 4DJDD 2H3BA 2PGRA 4NX0A 3H70A 3AC0A 1EP3A 4JN8A 3WF2A 4D9PA 1TV5A 1R9XA 2A4AA 1CGVA 3O9NA 4PC8A 1FHDA 1VLWA 1ZGDA 1XIHA 3I7QA 3SCQA 2HVOA 2DGAA 3DHUA 4P5UA 1TPEA 1JNDA 5H1WA 2JALA 1KFEA 3NEHA 3U48A 3P14A 3QVQA 4NRSA 2HPIA 3MS8A 1UD2A 3PJUA 1K03A 1TTQA 1FO4A 4I8DA 4PMVA 1V03A 1EX5A 2HS8A 3CUGA 1JVNA 1R3SA 3POHA 3WG6A 3SUTA 3QJAA 1DJWA 4JDYA 1ZU8A 4QX4A 1BXBA 2F6XA 3O0HA 3OZOA 4HIBA 3OZYA 1H1ZA 2Y8VA 4LSBA 1E15A 3BCFA 4DYKA 1NFGA 2GQWA 3S6OA 3DH9A 1G0CA 3MKVA 1JYVA 1TTPA 2AL2B 4Q4PA 4TR9A 4APNA 1PXGA 5CZSA 4I5UA 3CWNA 1B4KA 1B2YA 2WMGA 1DJYA 3B8UA 4XVEA 3URAA 4CNSA 3O16A 4QG8A 1JFHA 2PZNA 5EMKA 4H4IA 5DMYA 1B57A 3W7RA 4GYFA 4PN2A 2ZUUA 4ZGYA 3KVMA 4MFEA 3RG6A 4GCXA 3M0XA 1IE7C 4BK9A 3SECA 4Q6XA 2OEMA 4A8IA 1MQPA 3O15A 1XDLA 2LLEA 4H8VA 3MHFA 3BQ5A 3SFWA 2IPGA 2WW5A 2NZLA 2CBUA 4IPJA 2BLEA 1K6WA 3DFQA 2A3AA 3I4EA 5KZEA 1TX0A 2PF8A 4JY8A 4UQAA 2JGQA 3MJMA 2YA1A 5DY2A 2D0FA 2ICSA 4XV0A 2DQWA 3SAZA 4LRTA 2CU0A 3IK4A 4J27A 2ZFAA 3KL3A 2WMHA 5IFTA 3TYBA 3BMVA 1M65A 1UC5A 4F2BA 2WNQA 1GVIA 4LA1A 5U4NA 2V63A 5IDIA 1ZAHA 5E0FA 3PUEA 1KN0A 2D0HA 1PIIA 2NUYA 3R4IA 3DFHA 1W9XA 3KRBA 2F6KA 4UR7A 3M9YA 1PIFA 5FF7A 4G56A 2ZZBA 5CC6A 1E0TA 2VVNA 3IUHA 3AO0A 1JQVA 1EJXC 4AIEA 2XJ7A 4WF7A 4CCDA 1M03A 2PWUA 4Y90A 4HNVA 3U57A 4QIUA 4F0KA 5A69A 3CZKA 3PTQA 1F7BA 3VVGA 3MQTA 5E6YA 1GVQA 3MMWA 3AJXA 3NQ2A 5GQBA 1KA9F 2BZNA 5DXYA 1JYXA 2WMIB 4PYSA 1JUEA 1ONXA 4NUWA 1U1HA 4R9XA 4DXVA 2RKXA 4BI7A 3EPOA 5GJNA 3OBAA 2P0IA 2ON3A 3FN9A 5U25A 2BBFA 3MMDA 4PB5A 5LIXX 3CB3A 5BOFA 4UFMA 4C6KA 1YDOA 4AISA 4UQDA 3GH5A 3W7NA 3FDGA 4AMAA 3TW7A 4DJFC 3CJPA 4H6KA 3WQWA 4XSLA 4O12A 2A3LA 4D6EA 5LA0A 3PK7A 3KCOA 4HVXA 3DFNA 4JGDA 2GGEA 1ADOA 4K8EA 2VFGA 2V2HA 3B4YA 1KCLA 5H8UA 4W87A 4DJEA 3VFLA 3W83A 1TWSA 1P7TA 4JPGA 4F3HA 3ZJ6A 1REQA 4HYVA 4C6IA 4E8CA 3OGSA 4W85A 2UY3A 2DSZA 4OBRA 4K37A 3LERA 2NQ5A 4GVFA 4NZFA 1VAHA 1EJUC 3P67A 2YDAA 4KH2A 1EC8A 1JL8A 3PJWA 3QZAA 1A50A 2ACUA 2ZZ4A 4PH6A 3H26A 4LUIA 1IEXA 3QHNA 2OGJA 4S2CA 3MKCA 1DJQA 2GR2A 1K3UA 4J28A 1C9DA 2DV0A 3STGA 2GVLA 1FDJA 3VZXA 4FLRA 1LRTA 4WKHA 3S8HA 3ERPA 5CLTA 5T9CE 2GGHA 4EQSA 1US3A 1NVMA 1J6PA 4R7WA 5I02A 3T81A 1CW2A 1DHKA 4GIYA 3SR7A 4HP5A 3TFCA 1ZHAA 4O1EA 2BGNE 4WDWA 3W3OA 1KW1A 2XIIA 2Z26A 4A3RA 1DVJA 4Y9PA 3DI1A 1W3IA 4AWSA 1J5TA 2J6XA 1BLIA 2WZHA 4X63A 1N60C 4LCRA 1XM3A 3OZMA 4V33A 4S3DA 3RCYA 4DNAA 6ALDA 1W1YA 1A5BA 1HX0A 1W9PA 1M7XA 3CHVA 1FOBA 2NV9A 3B9OA 4FLQA 4FXSA 2IKGA 3G3MA 1F61A 1UKPA 3IJ9A 2XIQA 1SGJA 1GERA 5HMEA 3KZPA 1H7NA 5M17A 5AHLA 5MHBA 1NM9A 1Y65A 2BG5A 1UWSA 3VKKA 3WLRA 2EEXA 1RJRA 4UR8A 1GSNA 2X2GA 2B7NA 1ZB5A 4FEZA 5GNYA 4H4QA 2J7BA 4WDXA 3TCSA 4QITA 2VDIA 3GR7A 3SN0A 3GBEA 1N5XA 5HJYA 5SWUA 1XDMA 1BSIA 4I7WA 4ZQPA 3S3GA 5BMXA 1RHCA 3VKCA 4O14A 1ISYA 2FQIA 4YS1A 3MV01 1P0EA 1HIZA 5FJOA 4PMQA 3GRTA 1UZHA 3LADA 3CIVA 1QASA 1TR9A 4FX8A 3T4WA 3WLSA 4NZ3A 3WEMA 1EDTA 2VURA 1T8XA 3P2VA 4ES4A 1GV4A 7CGTA 1QK2A 4MMWA 1YNQA 3BUVA 3CIXA 4BA0A 3IGHX 1P0BA 1O4UA 2PLJA 3GU2A 3UWYA 1LTDA 2FGZA 3MHGA 1JI2A 4NU7A 3HPSA 1S2VA 5CPOA 5CPSA 1VBUA 2Q01A 3BSMA 3TW6A 4IIEA 3W2NA 3S1GA 2CLKA 3S5SA 3AUOA 1W31A 1K77A 3QY8A 2JK6A 4IXXA 1IEIA 4O28A 2H3DA 2QVNA 4BF9A 1Q63A 3BSGA 2WM0A 4W5UA 2GK1A 1PSCA 5AVNA 2QJMA 5I24A 4ATWA 1JR1A 1TWWA 3R13A 3CGEA 3UT0A 3CV7A 1QO5A 4E8GA 3E6EA 3VGHA 2O9OA 4LNYA 4YHGA 3PSVA 1JG9A 4KBXA 4YYFA 3LOTA 4HKPA 4O4VA 1Z42A 3FCPA 2GR1A 2E67A 3P0XA 4OHQA 3HJZA 3FV9A 3ARPA 2BVDA 4PMJA 1QPNA 1I2PA 2WMIA 1VP5A 3AFBA 1UC4A 1TX2A 4ZQOA 1XIBA 2HVMA 3R0DA 1J96A 1EPXA 2WMFA 4L4OA 1T8QA 3VNMA 4D8AA 2QAEA 3E5BA 1V59A 1EUNA 1ME7A 3W1AA 2NXHA 2VRKA 1NDZA 4O52A 2GR3A 3R10A 4IGNA 2CHRA 4REQB 3BLOA 5EMJA 1V8EA 4U2YA 1PTAA 3UR8A 4N4QA 2J74A 4KRZA 2DUZA 5CSUA 2C0AA 2FTYA 2V5KA 3AWNA 3TAOA 3GUGA 2G3NA 4M6QA 2WPCA 4YMZA 3WQVA 3WQOA 3S0CA 3PBGA 3E0VA 3CT2A 1NAL1 3V18A 4PUJA 4Q4KA 3KTXA 3UCQA 4JQ9A 3P81A 1YXDA 1KR0A 3ANUA 3E74A 3F5KA 3NVYB 4XBJA 3LUTA 5GVJA 1ZJBA 2OZ0A 3LV6A 4ZOHB 3QZ6A 2NWRA 4PUKA 5AZ0A 4DHGA 4FDCB 4BURA 3S5YA 4Q8WA 1V0KA 7XIMA 1CNVA 1FRBA 3S9IA 3W72A 3SGUA 3P7YA 1XIGA 4MJ2A 3UNDA 1OINA 4QM1A 1W9BM 2QV5A 1AH3A 3VZZA 5FS7A 1O7AA 3NQFA 3OVRA 3WNLA 4JFSA 1EEPA 3VKAA 3G1HA 1TPB1 1IWBA 2ZUVA 4EWND 2GVYA 3RX2A 1GOXA 3TWAA 1DIDA 3DYMA 2PMQA 3G3DA 3UR7A 1A4LA 1GVFA 3UJEA 4HPXA 4XZNX 1FFQA 2OEJA 3V7PA 3TTSA 1GYLA 5H8MA 2B81A 2QIIA 3OOQA 3VPLA 4Q4OA 3WZ0E 1JZ5A 2DT1A 1OABA 2J8GA 2JKPA 4HZMA 1TELA 3F4DA 4F48A 2F9RA 4LCQA 2YJQA 2ACQA 3QY7A 4GCAA 3MA8A 3MZ2A 2OLHA 3VILA 1ZMCA 3ARSA 4ORMA 3R8HA 1RCQA 5LHEA 4NJHA 2R1LA 2WSQA 3GM8A 1BSLA 4JNYA 4XAGA 4AZBA 4GJ1A 4ZR8A 1W8GA 3HGJA 1YDYA 3JR2A 1U5VA 4ICNA 4FXFA 3O0KA 3VZYA 4NSBA 4LPCA 3GTHA 2XPKA 3BLEA 2OT1A 4H9ZA 3HGRA 2OU4A 8RUCA 1QPQA 3NR0A 3N6QA 3HB9A 5BXPA 4JEQA 3RK8A 3U3HA 3T2PA 4HU3A 2DFAA 5FSEC 3GU1A 4UZUA 3EBVA 4HCLA 1J2BA 3GXMA 3WLPA 1WB0A 1SW3A 4HT3A 4B4HA 1BKHA 1N8IA 3UWQA 3O7UA 5CH9A 4B2DA 3WN6A 1KM0A 4YL2A 2NLYA 2XN2A 5K7JA 1FP9A 4PBGA 4EM4A 3BDKA 3V5FA 4Z2GA 4B5XA 2V38A 4PMYA 1PDZA 1FWJC 1Q7QA 4GA8A 3VNKA 3VO0A 1XJBA 4H41A 3G1AA 3FDKA 2ZE3A 4LAOA 1VRXA 4FPSA 1BWLA 2Z1SA 1R86A 5LGZA 3IV3A 1C29A 3N2TA 1CGTA 3RX4A 5C9XA 2PZ0A 2QAPA 5FD0A 2GDVA 4LC6A 3VNYA 1NSJA 2VI0A 8A3HA 2FFCA 1QOPA 2R6OA 1X98A 2FLIA 2GQ8A 3UPWA 4DJED 4TVUA 4WDUA 3UFYA 3OTRA 3WF4A 5AFDA 3DGBA 3LB0A 2BY2A 4TUFA 3ITGA 5G4HC 3TYAA 1VH7A 4MY9A 3UPBA 5FMHA 1E9ZB 3MUAA 5EMYA 2WO5A 2WSKA 3CPUA 4RE2A 1I2OA 3AROA 4NZ1A 3NOYA 3PP7A 4EXBA 1TPWA 2EQ9A 3QFAA 2Z24A 4Z2KA 2QF7A 1ONRA 1V6VA 3CTLA 2OG9A 3APGA 4GNJA 2WOQA 3N2OA 4KFPA 1FWHC 1UPMB 2BSLA 3QMRA 4S39A 3A4AA 5A6BA 3LXDA 4YWSA 5CG0A 4JYEA 1S5MA 2FPYA 3N73A 5E09A 3E38A 3IVSA 2BY3A 3FJ4A 4XAPA 2ZE0A 1AVAA 3L0NA 1NFPA 2Q8LA 3B0PA 4GI6A 3DC0A 3G1VA 1E1FA 3AJ7A 1DQUA 1GEQA 2CLLA 2YIHA 1NY1A 2VD8A 4XD3A 1RBAA 2PTWA 5JBFA 2CLHA 4REQA 2ZZ0A 2ESCA 4LBUA 3BV7A 1OADA 1HL2A 1OF6A 3TEVA 3RM9A 5TBOA 4RX0A 1OK4A 3O8AA 3DKJA 3OQEA 2IXVA 3NZGA 3TV8A 2OSXA 1UUQA 1UA3A 4AXKA 3B04A 2PCEA 3RAOA 4NL1A 3CUXA 1QTWA 4BZYA 4GZIA 2VCCA 1ZNNA 4IP5A 4DO7A 1DXFA 1ZRQA 3KHDA 3CZLA 1XW8A 4IFOA 1W9DM 4W8BA 4JN7A 2FPTA 4EK7A 3GXDA 2I5IA 3WLQA 4DNHA 1N5WC 4PUWA 1CZ1A 2VFFA 4X0NA 3ZYZA 4LGXA 1A5NC 4MY8A 3LB8A 1CB2A 1NOWA 4XB3A 1L0PA 5FS9A 4CLMA 4WIWA 4ATDA 3G8EA 4FXJA 1HTIA 3TONA 4PGLA 5MKGB 1XCWA 6REQB 4KMQA 2TODA 3RXZA 4DO6A 1UH2A 5C9WA 3DGHA 3V16A 1RZMA 4UNKA 4LY4A 4GXPA 4CEUC 5TNVA 3A23A 3DFOA 4Z17A 4BQ4A 5DELA 3WEZA 1PX8A 2WSRA 1KBIA 3NQAA 2Y70A 1KCZA 3KDOA 2A7NA 3HMCA 4PTVA 4H7VA 1W37A 3RX3A 5I5RA 3F2BA 1BVWA 3H53A 2P53A 1XIEA 4AU0A 1CDGA 1CEOA 1GUVA 3GFYA 2MANA 5G5IA 5HQMA 3CAWA 3G0SA 2NVCA 2VOTA 1W54A 1AH0A 1WZAA 2OQLA 2AMXA 2P5NA 1UP2A 4JZ5A 4F8XA 3H2FA 1VR6A 1ZS2A 1HJSA 2HK0A 2YCEA 4BCEA 5JQ9A 3MT1A 4C6LA 1XIJA 2X1UA 1JIBA 1H41A 4UTHA 3CEPA 3OO2A 3QQ0A 4ZOAA 2VXNA 4IWWA 3SR6B 3SIZA 3PBYA 1E9YB 2V2DA 4L1GA 2D2HA 4B91A 3BAKA 3QR1A 4QROA 1O5QA 1F07A 2AKZA 2CPUA 2Q3RA 1KV8A 4F2UA 5IBXC 3AS0A 2ZA3A 2J24A 3EOEA 4UNIA 3WQDA 3WQCA 1QR7A 2I14A 5D8ZA 5LA2A 2HXUA 1T7LA 2CZDA 2E3ZA 4GPNA 3P6LA 3C86A 4J40A 5C71A 4HMCA 4H1ZA 2DJXA 1Q65A 3KEHA 3R1ZA 3DCPA 2D3NA 1K7XA 1TA3A 4OKDA 1OYAA 1MOKA 3EANA 4BS0A 5I00A 4TV5A 4JTTA 2IQ0A 3B0VC 4KS0A 1X1NA 5D33A 4W7UA 3T9PA 4IIDA 4KWUA 4JTJA 1E6QM 5TIMA 5MF5A 1US0A 2VR4A 4QISA 2FVKA 4JIRA 1LT7A 3VX1A 4H04A 3FOKA 2ZOXA 4FF7A 3EWZA 3SY1A 4EXAA 1J0ZA 2I56A 4O0QA 4QR6A 3GO2A 4TVYA 2C3ZA 2BXYA 2PP0A 2R9ZA 2VZOA 4HA0A 3TYCA 4U4MA 1L6SA 1UD4A 4HU4A 1A5CA 1ZALA 5FEXA 2OZTA 1AFSA 4AF0B 2J8TA 1H4PA 1DIKA 4ADUA 4CNPA 2OLAA 3WLMA 1NOFA 4HMEA 5F4XA 3PPHA 3W7DA 1Q85A 3CGDA 1BG4A 3LNPA 3MU7A 1B1YA 2VCBA 1H60A 2C71A 4ICMA 4HHPA 3CHDA 2Q8ZA 3G6MA 2EG7A 2CZVA 2QPUA 3D46A 3EOUA 4GUHA 2PRLA 3LI0A 4I9AA 2YFOA 2H8XA 1WDDA 5C0QA 4ZL1A 1JRBA 3MP4A 1GOOA 4IF2A 1CXHA 3S6TA 3H7RA 3GRIA 3P5YA 1KM6A 2CZ5A 1I75A 3OBEA 3GNRA 1Q6RA 2D2JA 4KKXA 4M3PA 1DXEA 2ZXAA 1G01A 4UWMA 4R34A 2OX1A 1H0GA 4L5ZA 3LDVA 4GVHA 3ZT7A 1BVZA 3PWGA 4GYJA 2WAGA 4L61A 2PUZA 3MANA 4MNJA 4BF5A 3DESA 5G2HA 5BRBA 1ML1A 1S2CA 3WFAA 4FF5A 2WHLA 4UQEA 3WL1A 2EPLX 2PE4A 4QNWA 2W9MA 4AEOA 3FFSA 4GMEA 3LHZA 2XZ9A 1R38A 4QAWA 3WFLA 3LRLA 2YB1A 4M6VA 3RFAA 4C65A 4HHHA 3ANYA 1IXQA 5LXEA 2ATMA 3UY8A 4UCGA 4XIMA 3UA3A 3ABXA 3VXGA 5A6KA 2RDUA 2PU1A 4QRNA 4DBSA 3WJWA 3ZM8A 1C7SA 2HPMA 3C4UA 2E68A 3VE9A 1UZDA 3IJIA 1OQFA 4HN4A 4CCCA 4O0KA 4U31A 4H4PA 1EF2A 2X1SA 2QEZA 1E72M 2CYGA 2J9YA 1ZBCA 4JTGA 2J4GA 1JD9A 2NX9A 1SZNA 1K4QA 3QV9A 1K8YA 5MKGA