3R26A

Perrhenate binding to molybdate binding protein
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
231
structure length
231
Chain Sequence
GKITVFAAASLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTLLGNSLVVVAPKASVQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPVAVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of ReO(4) (-) with an engineered MoO (4) (2-)-binding protein: towards a new approach in radiopharmaceutical applications.
pubmed doi rcsb
molecule keywords Molybdate-binding periplasmic protein
molecule tags Protein binding
source organism Escherichia coli
total genus 76
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2011-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3r26A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3r26A02
4KPTA 4G8HA 1ZTYA 4JDFA 4C1UA 4U1OA 1IXHA 1LFGA 5H8SA 1UTBB 1MXUA 3R6UA 4FIMA 3A3CA 1Q1KA 1B1XA 1FTMA 3GLBA 3VLUA 2ZYOA 1OMPA 2UYEA 2O7UA 4WKMA 4F1UA 4ESWA 1LSTA 3RTFB 3I5OA 1BKAA 3C34A 3MAMA 3TTKA 2P0SA 1LB9A 2XXUA 3E9XA 4KD5A 4XKNA 5HPQA 1MQHA 4RA1A 4GD5A 4F18A 3HCQA 1AIVA 2QPQA 1QUIA 3FJGA 4KYSA 4NF4A 1M5EA 4IO7A 4ND9A 4GXAA 3UK4A 2W7YA 4H8JA 2XX7A 4MFIA 2DWHA 4FATA 1MQDA 1I69A 2H9BA 4RJZA 3WAEA 1US5A 4GL8A 3IOUA 4YICA 4F39A 1Y4TA 3T9VA 4M1VA 4OMBA 5CMBA 3R7XA 5KDTA 1A8FA 3VXBA 4KFQA 3D4CA 1H43A 1XT8A 3UP9A 4NF4B 1LCFA 1JEUA 1QJMA 2RKMA 3DM0A 3B7DA 4LUBA 2ZMBA 4RNSA 4C0RA 1A55A 3H03A 4F3PA 1RYXA 5B7DA 1DOTA 4RK9A 3PPQA 2O68A 3AXFA 3ONMA 5KDTB 1DMBA 3K6WA 3PPRA 2G29A 3QUJA 1B5HA 1P1QA 3BFUA 3F11A 4XKPA 3CI8A 3ECRA 2Q2CA 4I9DA 3MVXA 3PPNA 3O9PA 1D4NA 2Z8EA 1FTLA 3KFMA 1Y20A 1O64A 3T96B 4OXVA 2Y7WA 3ILTB 5B70A 3SDFA 2I48A 3K1NA 4H6DA 3T93B 3TCFA 1JETA 2XXHA 1UIVA 2X7PA 1PBPA 2ABHA 2Z8DA 1I6QA 1UQWA 5I56A 4G4PA 3HPIA 4LA9A 1HSLA 2H25A 3TODA 3ZKKA 1Y3PA 4MLQA 4FAJA 4R6HA 1S7YA 2DE2A 1O7TA 4PFYA 4ZZAA 2PT2A 3RQTA 2HAUA 2V3UA 3DLNA 4LP2B 4U1ZA 4OFLA 1GGGA 5DEXA 4OYVA 1EZPA 3CVGA 4ZEKA 3JV9A 1B32A 5I56B 1M5DA 4UACA 2AYSA 1PBQA 4F3BA 1BTJA 1N7XA 1UIUA 3CG1A 3PV0E 3SEWA 1WODA 3UN6A 1HSJA 1NNFA 3O66A 3IR1A 4GFRA 3FXRA 1XVXA 3SEVA 1QVSA 1B7ZA 1BLFA 1ELJA 5DEXB 3MJNA 3PGFA 4MLVA 1IXIA 5M2VA 3M3LA 3TKDA 4OZ9A 1H3DA 3KN7A 3GBAA 5ITPA 3S4UA 2ANJA 3FVNA 2B3FA 4F2OA 4EXLA 1LAXA 1FQDA 5I57A 4N13A 3RY3A 3O29A 3DELB 3U93A 2IEEA 5AA4A 4WEDA 4QF9A 4QFPA 1Y9UA 1FTOA 3TELA 2ESNA 3EHUA 3QIMA 2FYIA 4XIGQ 2HQ0A 2OBGA 3M8UA 2UVHA 4IO5A 3CFLA 5FTIA 2ONSA 2ZNTA 3H7MA 3TMGA 3RN8A 3TAJA 3GZGA 5I57B 1LLSA 1EH3A 3MW0A 2GHBA 1RKMA 5H8FA 5FHMA 5AA4B 3MVWA 2XXIA 1MRPA 1UTHA 4F22A 4OQOA 2DSFA 1Y1ZA 2XXWA 1QULA 4OWDA 3IAZA 3TYHA 2NVUB 5CI5A 3T9UA 4YB7A 3IB1A 1NKXA 4EUOA 3EHSA 3IO6A 2QRYA 4JWXA 5H8FB 1AH5A 4G68C 4RY1A 3V8XB 3G3FA 3N94A 2UYFA 2Q8JA 4ZEDA 5L9SA 3S2VA 3OEMA 2REJA 5BWJA 1UTHB 3VDFA 3M3FA 5L8DA 2F6PA 5HM4B 3E13X 4R72A 1J1NA 3DP8A 4FECA 3S9MC 3DP4A 4NF8A 4I1DA 2HZKA 2OJTA 4JWYA 3KZGA 4AB5A 4C1TA 2UVJA 4ECFA 4QSDA 3R26A 4PE5B 4G2ZA 1MY2A 5F7VA 1SW2A 4YKPA 2VGQA 4YB5A 2LAOA 3T66A 3U94A 1VSOA 1TWYA 3QYTA 3V83A 4NF8B 3BKIB 3UA8A 1DTGA 4LZ5A 1Y3NA 5CBRA 3GBBA 4XKRA 4R6KA 4XXUA 2NWJA 4O3CA 4ZZEA 4Q5TA 4KYDA 3ZKLA 4E0WA 3OO8A 3CFXA 1MPCA 3HO7A 2X7QA 2I6EA 4ZECA 2QS2A 2B65A 4FJPA 4ELQA 4QSEA 4QFLA 3UGWA 4THIA 3OELA 2HFBA 1SI0A 4O3BA 3TTRA 3U8QA 1MPBA 1A54A 1ANFA 1II5A 4N07A 2DVZA 3SETA 1FQFA 3TUSA 5DVIA 1M5FA 2V84A 3G3IA 2RCAA 1B5IA 1P99A 1SW4A 1B0LA 3HV1A 4DIGA 4QRZA 1D9VA 3P7IA 5DTBA 4RPOA 5L9MA 4YZZA 3KSJA 3FXUA 5I2NA 2I4CA 1MDQA 4U2RA 3FV2A 3PU5A 4LONB 4NF5A 1FTKA 3H6WA 3LBSA 2F78A 4ZEIA 4F1VA 4G8MA 3KGCA 3IOTA 4NF6A 4IO4A 2PYYA 2RCBA 1ZIUA 1GVCA 1YAEA 5CRYA 1SBPA 3PUWE 2VD3A 2E0SA 3M3KA 5I2NB 1NNKA 2FA7A 4LATA 3HN0A 3RLFE 1SYHA 4NF5B 1B4HA 2F35A 5K2XA 3SERA 4NF6B 5A5XA 5JEIA 2I0BA 1F9BA 4YKKA 3LSLA 4U23A 1CE2A 4GLIA 2P1SA 3S9NC 5I59A 1LFHA 5CBSA 4HCYA 3U1OA 5FHOA 3FV1A 4OHNA 3A09A 1QKAA 3HSTA 1LBCA 3QK6A 3OENA 4DZ1A 4ELPA 1PEBA 5A5XB 1Q35A 1TXFA 3SEUA 3MZBA 4PFWA 1USYE 3I6VA 5I59B 2BJJX 5ITOA 3H4ZA 2E1SA 4FEDA 4GWOA 2FNCA 5I2KA 1GV8A 4PQJA 2I58A 1ZJLA 3TQLA 4GRKA 4AQ4A 4KR5A 5IAIA 5DVJA 2I0CA 3FZVA 3I3VA 3DP6A 3C33A 1IZ1A 3ODBA 1NL5A 1VFDA 3KG2A 1OIBA 1R1NA 3VVFA 1IIWA 2ZNUA 3B6TA 4H1XA 5I2KB 1P1UA 2X26A 4RK2A 4UA8A 3MWBA 3K2DA 4R6YA 1NMUA 5AE4A 1MQGA 4DE8A 1TT1A 4R9FA 3RUMA 1NH7A 3WAFA 2QL3A 2Y84A 3TEPA 3TTMA 3RNNA 5JK4A 2F7AA 1ZLQA 3IOWA 1JW1A 1I6BA 2NUVA 3Q29A 4LZ7A 3VXCA 1MY0A 4IGTA 4GOTA 4MH5A 1R9LA 4IB2A 2CMOA 4X48A 3VFJA 4R9GA 4TLMB 4HCWA 3QXMA 3G3GA 1VE4A 5H8QA 4ELRA 1JVYA 2DXRA 2XD2A 1OLCA 1ZKBA 3S9EA 1ZBMA 4POXA 1KWHA 1Z7NE 1H76A 3IX1A 4JBZA 4F2QA 4LZ8A 4KYEA 3E4RA 1EU8A 5H8QB 1T0KA 3TCHA 2KLFA 1FQCA 2R9JA 2Q89A 4I8CA 1MY3A 5J1DA 2D21A 4N6PA 1JVXA 3KOSA 3JYRA 2AIXA 4YB6A 2DWAA 5AA3A 3IOVA 1MQJA 1YPNA 1DPEA 4R74A 3PD9A 4P0GA 1JQFA 4F3SA 1DSNA 4DDDA 3K6VA 2VOZA 3JZJA 4YMBA 4KHZE 4ZE8A 1BIYA 1FTJA 1RYOA 5H8HA 2RC9A 1YTVA 2QJEA 1A8EA 4P11A 3HHGA 4ZS9A 3FJMA 3S9LC 1MXWA 1LAHE 3IJXB 1NH8A 4Q0CA 3KBRA 2OK2A 3IB0A 3K0VA 2F97A 3EPEA 3V89B 2GFEA 4BDMA 3K4UA 1N76A 4WEPA 5H8HB 2XX9A 4BLAA 2F8DA 5KZTA 1M5CA 3PUZE 2QS4A 4H5FA 4QHQA 4ELOA 4JSOA 3K02A 2XXPA 2ZXTA 4JWOA 3MQ9A 2XXTA 4R2FA 4FORA 1L5TA 1SW5A 3TDJA 2DS9A 3G7WA 3G3JA 2GHAA 2Y7IA 4I62A 4ISUA 1N7WA 1NNPA 3OO6A 1NFTA 3CRBA 4KCDA 4HTGA 4MBPA 2QMXA 1B3FA 4IO3A 3UIFA 4F19A 4OEUA 1QUKA 4EXKA 5EHSA 1MXVA 4POWA 4QFOA 1OVBA 1B3EA 3OMBA 1OQGA 2A5TA 4DXBA 3GXAA 3MBPA 2XHDA 4PFTA 4NEDA 1MM7A 4H8IA 4U21A 4Q30B 1SYIA 2OLBA 3CG3A 1N3XA 3L6GA 3Q27A 3OXNA 1URGA 4KI0E 1Z7ME 2Y7KA 3TCGA 4PP0A 1QKBA 3LSFB 3RT8A 5JTYA 1ZMGA 4U4SA 1P1NA 1ATGA 1LAFE 4IGRA 2A5TB 1D3KA 4NMYA 3FGSA 1OLAA 3ILUB 2V3TA 3C9HA 4JSDA 2ALUA 3B6WA 4F29A 3KEIA 4H5GA 2H99A 1IQ7A 3MPKA 4ZE9A 4GXSB 4EQ9A 4GF8A 2XD3A 2DXYA 5JTYB 3PPOA 4GVOA 1P1OA 3PUYE 4GL0A 2ZYNA 3MC2A 2O51A 2YJPA 1N04A 5H8NA 3E3KA 2F6GA 4RYAA 4HW8A 3Q26A 3U92A 3C35A 2O1MA 1FW0A 5BUUA 5TP9A 3MPLA 1GTKA 3FD3A 2Y7PA 2CZLA 3O6HA 2UXAA 3PPPA 4DXCA 4R2BA 4LQ5A 2RC8A 4F3GA 1LCTA 1LGBC 5CMCA 5H8NB 1N84A 2D3IA 3VVDA 4RXLA 1IUDA 3OO9A 2QMWA 2R71A 5I58A 1MQIA 3CR9A 5DVFA 5TP9B 2O7IA 3SEYA 3TTLA 4GIZA 2H5YA 1MY1A 1B1HA 3MVYA 4OVJA 1GR2A 2ONKE 3T9HB 3FIRA 3SKPA 4G8NA 2VHAA 4ESXA 3ZS6A 1JW5A 3LUYA 1XS5A 2H98A 3H6UA 2HEUA 1B3LA 1VR5A 3O6GA 3C36A 1B7HA 4DLDA 1FQAA 5I58B 2XXXA 1N3WA 2DWJA 3VLWA 2ONRA 4L17A 3OSQA 5K2YA 1AMFA 2DE4A 1B51A 3QUFA 4TQUQ 2QSXA 1MPDA 2QS3A 3SESA 3A3UA 3K6UA 3C32A 4P0IA 3IK6B 3PMVA 3KN3A 3TZAA 4BDLA 4H65A 2O84X 3W15C 1SI1A 5TU0A 2D5WA 1US4A 3FUZA 2HZLA 2HCAA 1XOCA 1MH4A 2OWSA 4OENA 2DVCA 2GRVA 4NTLA 4H67A 4QFNA 1MM6A 2DP8A 4NWCA 3O97A 2Z22A 2O69A 3LSWA 4PFUA 1B5JA 5AA2A 5ICTA 4IY5A 1SDXA 5TPAA 4GQOA 3KSXA 2YPNA 1LFIA 1B9JA 1BP5A 5ISUA 1JW4A 1H44A 4YMAA 3K1PA 3THIA 3TPAA 4KQPA 3N5LA 3RGYA 2B3BA 3BFTA 3TFLA 4OETA 2THIA 1XC1A 4F1YA 2Z23A 2PT1A 3EHTA 2I3WA 1B7UA 4IO2A 3H06B 4LQ2A 1A40A 1PB8A 1B2HA 5AA2B 1NNTA 5TPAB 4QSCA 4X1BA 3KJ7A 4H0WA 2PBWA 2RC7A 3G3HA 2M8CA 1TFDA 4WXJA 4ZEBA 5CMKA 2XXRA 1PDAA 4ZEFA 4DXUA 4K3FA 4ZDMA 1QW0A 5EHMA 4NE4A 4QFKA 4EQ7A 4PETA 3FXQA 1URSA 4MF3A 4XKQA 3V5AA 3KJTA 3EQ1A 2F7CA 3N26A 4BDRA 2F36A 2GH9A 3PMXA 3FJ7A 1SVXB 3RPWA 1EZOA 2PVUA 1LB8A 3QAXA 3MP1A 2Z8FA 4DCYA 1MDP1 5IKBA 3IL1B 1SW1A 4JB7A 1IITA 1M5BA 4R75A 2DE3A 1B3HA 2ZNSA 3T9XB 1JNFA 1PC3A 1MY4A 3IB2A 4YU0A 1Y1MA 2F7BA 3IORA 1AL3A 1LBBA 1B40A 1B6HA 4Z7EA 4YKJA 1B4ZA 3B6QA 5F1QA 2I3VA 3W9VA 1MS7A 1JEVA 4Q8RA 5FTHA 3PD8A 1A7LA 3K6XA 3CSGA 5EYFA 2RINA 3H6VA 3TTNA 4JXIA 3FVGA 5DT6A 4YKIA 2VP1A 3K01A 2OCUA 3VVEA 1O63A 1B05A 3ZSFA 1WDNA 5LOMA 2NXOA 4G77A 3LC8A 5KCJA 2O1LA 1TFAA 1MXZA 3MP8A 4IO6A 1URDA 1HSEA 1Y4CA 1FQBA 4KCCA 1N0TA 2DQVA 4E0XA 2WKYA 3Q28A 1QUJA 1B46A 1DTZA 3KOTA 3UORA 2NOOA 3C31A 2Q2AA 3MVZA 1IXCA 1B58A 4O3AA 2VD2A 1USYH 4AB6A 4M4GA 1P1WA 3OD7A 3G3KA 4YAHX 2V3QA 1PB7A 5ICQA 1H45A 4G68A 3FVKA 3W9WA 5KCJB 1XVYA 4X9TA 3BBRA 3U72A 1IEJA 4F31B 1B52A 3LSXA 3K00A 1POY1 4OEVA 3MZ1A 1SD3A 5HBCA 3VLVA 4TOZA 2RF1A 5L9OA 4X1DA 1FQEA 2ZYKA 2A5SA 2I49A 3EF7A 3IO4A 2UVIA 3C4MA 3N6TA 3PMWA 1FCKA 4OTEA 4G68B 3SEXA 3OEKA 3K1MA 3L6HA 4R73A 2DYXA 3TQWA 2UVGA 3MP6A 1XHYA 3O28A 3CIJA 3CFZA 3FVOA 4XTCQ 5CC2A 3OSRA 2AL4A 5CMMA 1WVJA 2OZZA 3IJOB 3T22A 3D4GA 5AA2D 1MXYA 2XXVA 4U4XA 4RPNA 5FHNA 1LAGE 4FE8A 2HAVA 2Q9TA 4EF2A 3FASA 1CB6A 1MH3A 5ELVA 1SQYA 4BDOA 1MXXA 1AOVA 4TLLB 4DCXA 1MG1A 4EF1A 1POTA 2XXYA 3PUVE 3OOAA 4OERA 3LR1A 3RT6B 2Q88A 3VV5A 2G93A 3FATA 3USDA 3VE1B 2I4BA 1VFEA 1S9TA 2PMSA 5DYHA 1ZU0A 1B0HA 1R9QA 2ZYMA 3PUXE 4U22A 4NWDA 3RTWB 4FEBA 3OO7A 2PX1A 2REGA 5AA1A 4OESA 1OQHA 3O6IA 2HXWA 2O6AA 5I84A 4LVQA 2P2AA 2XXQA 4BDNA 4ONYA 1YCJA 4OFOA 4Z0IA 3QSLA 1DPPA 1OVTA 3MZ9A 3N6UA 1R6ZA 2QS1A 2YLNA 1I6AA 3MUQA 1S50A 1Y3QA 2DWIA 4IY6A 1PB9A 4EDPA 1UTBA 3O2AA 2IA4A 3EN3A 1EZ9A 2R6GE 2DOJA 1IXGA 3KN8A 3CSBA 4OFJA 5CM6A 2AL5A 2V25A 1B3GA 2OWTA 3H6TA 1D9YA 2XX8A 1A99A 4BDQA 2Y7RA 2F34A 2F5XA 4EQBA 4HS7A 2H4IA 3Q25A 3H3GA 3HHFA 2V93A
chains in the Genus database with same CATH superfamily
4KPTA 4G8HA 1ZTYA 4JDFA 4C1UA 4U1OA 1IXHA 4MIJA 1LFGA 5H8SA 1UTBB 1MXUA 3R6UA 4FIMA 3A3CA 1Q1KA 1B1XA 1FTMA 3GLBA 3VLUA 2ZYOA 1OMPA 2UYEA 2O7UA 4WKMA 4F1UA 4OVRA 4ESWA 1LSTA 3RTFB 3I5OA 1BKAA 3C34A 3MAMA 3TTKA 2P0SA 1LB9A 2XXUA 3E9XA 4KD5A 4XKNA 5HPQA 1MQHA 4RA1A 4GD5A 4F18A 3HCQA 1AIVA 2QPQA 3E79A 1QUIA 3FJGA 4KYSA 4NF4A 1M5EA 4IO7A 4ND9A 3B50A 4GXAA 3UK4A 2W7YA 4H8JA 2XX7A 4MFIA 2DWHA 4FATA 1MQDA 1I69A 1NUZA 2H9BA 4RJZA 3WAEA 1US5A 4GL8A 3IOUA 4YICA 4F39A 1Y4TA 3T9VA 4M1VA 4OMBA 1KA1A 5CMBA 3R7XA 5KDTA 1A8FA 3VXBA 4KFQA 3D4CA 4MNCA 1H43A 1XT8A 4NX1A 2KQZA 3UP9A 4NF4B 1LCFA 1JEUA 3SZPA 1QJMA 2RKMA 3DM0A 3B7DA 4LUBA 2ZMBA 4RNSA 4GBVA 4C0RA 1A55A 4GWXA 3H03A 4F3PA 1BK4A 1RYXA 5B7DA 1DOTA 4O8MA 4PTKA 4N91A 4RK9A 3PPQA 2O68A 3AXFA 3ONMA 5KDTB 1NUWA 1DMBA 3K6WA 3PPRA 5EQ8A 2G29A 5T3JA 3QUJA 1B5HA 1P1QA 1IMDA 3BFUA 4NGUA 3F11A 4XKPA 3CI8A 3ECRA 4OVTA 2Q2CA 4I9DA 4GWZA 3MVXA 3PPNA 3O9PA 4PAIA 2PCRA 1EYIA 1D4NA 2Z8EA 1FTLA 3KFMA 1Y20A 1O64A 3T96B 4OXVA 4N17A 2P3VA 2CZKA 4NAPA 2Y7WA 3ILTB 5B70A 3SDFA 2I48A 2MKZA 3K1NA 4H6DA 3T93B 4PAKA 3TCFA 1JETA 2XXHA 4MJOA 1UIVA 2X7PA 3HFUA 1PBPA 2ABHA 2Z8DA 1I6QA 1UQWA 5I56A 4N6KA 4G4PA 3HPIA 2JJKA 4I3EA 4O94A 3ISPA 4LA9A 1HSLA 2H25A 3TODA 3ZKKA 1Y3PA 4MLQA 4FAJA 4R6HA 1S7YA 4MAGA 2DE2A 1O7TA 1IMAA 4PFYA 4ZZAA 2PT2A 3RQTA 2HAUA 2V3UA 3DLNA 4LP2B 4U1ZA 3BIHA 4OFLA 4PF8A 1GGGA 5DEXA 4OYVA 1EZPA 3CVGA 4ZEKA 5DW8A 4MNPA 3JV9A 1B32A 5I56B 1M5DA 4UACA 2AYSA 1PBQA 4F3BA 1BTJA 1N7XA 1UIUA 4HE2A 3CG1A 3PV0E 3SEWA 1WODA 3UN6A 1HSJA 1NNFA 3O66A 3IR1A 4GFRA 3FXRA 1XVXA 3SEVA 1FBEA 1QVSA 1B7ZA 1BLFA 1ELJA 5DEXB 1K9YA 3MJNA 3PGFA 4MLVA 1IXIA 5M2VA 3M3LA 3TKDA 4OZ9A 1LBVA 1H3DA 3KN7A 3GBAA 5ITPA 3S4UA 2ANJA 3FVNA 2B3FA 3PTYA 4F2OA 4EXLA 1LAXA 1NV5A 1FQDA 5I57A 4N13A 3RY3A 4PFRA 3O29A 3DELB 3U93A 2IEEA 5AA4A 4WEDA 4QF9A 4QFPA 1Y9UA 5EYHA 1FTOA 3TELA 2ESNA 3EHUA 5ET7A 3QIMA 2FYIA 4XIGQ 2HQ0A 2OBGA 3M8UA 2UVHA 4IO5A 3CFLA 5FTIA 2ONSA 2ZNTA 3H7MA 3TMGA 3RN8A 3TAJA 3KC0A 3GZGA 5I57B 1LLSA 1EH3A 3MW0A 2GHBA 1RKMA 5H8FA 5FHMA 5AA4B 3BIGA 3MVWA 2XXIA 3D1RA 1MRPA 1UTHA 4F22A 4OQOA 2DSFA 1Y1ZA 2ZZXA 2XXWA 1QULA 2QVVA 4OWDA 3IAZA 3TYHA 2NVUB 5CI5A 3T9UA 4JVIA 4MEVA 4YB7A 3IB1A 1NKXA 4EUOA 3EHSA 3IO6A 2QRYA 4P8BA 4JWXA 5H8FB 1AH5A 4G68C 4RY1A 3V8XB 3G3FA 3N94A 2UYFA 2Q8JA 4ZEDA 5L9SA 3S2VA 3OEMA 2REJA 5BWJA 1UTHB 3VDFA 3M3FA 5L8DA 2F6PA 5HM4B 3E13X 4R72A 1J1NA 3DP8A 4FECA 3S9MC 3DP4A 4NF8A 1NV3A 4I1DA 1SPIA 2HZKA 2OJTA 4JWYA 3KZGA 4AB5A 4C1TA 2UVJA 5IZ1A 4ECFA 4QSDA 2XWVA 3R26A 4PE5B 4G2ZA 1MY2A 5F7VA 1SW2A 2FHYA 4YKPA 2VGQA 4YB5A 2LAOA 4PGPA 3T66A 3NOHA 3U94A 1VSOA 1TWYA 3QYTA 3V83A 4NF8B 3BKIB 3ROJA 3UA8A 1DTGA 2FIXA 4LZ5A 1Y3NA 2R8TA 5CBRA 3GBBA 4XKRA 4R6KA 4I40A 4XXUA 2NWJA 4O3CA 4ZZEA 4Q5TA 2CEXA 4KYDA 3ZKLA 4GX4A 4E0WA 3OO8A 3CFXA 1DK4A 1MPCA 3HO7A 2X7QA 2I6EA 4ZECA 2QS2A 2B65A 4FJPA 4ELQA 2XWIA 4QSEA 4QFLA 3UGWA 4THIA 3OELA 2HFBA 1SI0A 4O3BA 3TTRA 3U8QA 2XWOA 1MPBA 1ANFA 1A54A 1II5A 4N07A 2DVZA 3SETA 1FQFA 3TUSA 2CZIA 5DVIA 1M5FA 2V84A 3G3IA 2RCAA 1B5IA 1P99A 1SW4A 1B0LA 3HV1A 4DIGA 4QRZA 1D9VA 4KXPA 3P7IA 5DTBA 4RPOA 5L9MA 1FPEA 5ET8A 4YZZA 3KSJA 3FXUA 5I2NA 2I4CA 1MDQA 4U2RA 3FV2A 3PU5A 4LONB 4NF5A 5ET6A 1FTKA 3H6WA 3LBSA 2F78A 4ZEIA 4F1VA 4G8MA 1LBXA 3KGCA 3IOTA 4NF6A 2FIEA 4IO4A 2PYYA 2RCBA 1ZIUA 1GVCA 1YAEA 5CRYA 1SBPA 3PUWE 2VD3A 2E0SA 3M3KA 5I2NB 1NNKA 2FA7A 4LATA 3HN0A 3RLFE 1SYHA 4NF5B 1B4HA 2F35A 5K2XA 1RDYA 3SERA 4NF6B 5A5XA 5JEIA 1NV7A 2I0BA 5ESYA 2VPNA 1F9BA 4YKKA 3LSLA 4U23A 2VT5A 1CE2A 4GLIA 2P1SA 3S9NC 5I59A 3B8BA 1LFHA 5CBSA 2Q8MA 4HCYA 3U1OA 4AS4A 5FHOA 4N8GA 3FV1A 4OHNA 1LBYA 3A09A 1QKAA 3HSTA 1LBCA 5ET5A 4H46A 3QK6A 3OENA 4DZ1A 1KZ8A 4ELPA 1PEBA 5A5XB 4JVDA 1Q35A 1TXFA 3SEUA 3MZBA 4PFWA 1USYE 3I6VA 5I59B 4NN3A 2BJJX 5ITOA 3H4ZA 1JP4A 2E1SA 4FEDA 4GWOA 4GWSA 2FNCA 5I2KA 1GV8A 4PQJA 2I58A 1ZJLA 3TQLA 4GRKA 4AQ4A 1NI9A 4KR5A 5IAIA 2Y5LA 5DVJA 2I0CA 3FZVA 3I3VA 3DP6A 3C33A 1IZ1A 3ODBA 1NL5A 1VFDA 3KG2A 1OIBA 1R1NA 3VVFA 4PDHA 1IIWA 2ZNUA 3B6TA 4H1XA 5I2KB 1P1UA 2X26A 4RK2A 4UA8A 3MWBA 3K2DA 4R6YA 1NMUA 5AE4A 1MQGA 4DE8A 1TT1A 4R9FA 3RUMA 1NH7A 3WAFA 2QL3A 2Y84A 4XF5A 4PCDA 3TEPA 3TTMA 3RNNA 1YZ0A 1NV1A 5JK4A 2F7AA 1ZLQA 2OWZA 3IOWA 4NHBA 4G61A 1JW1A 1I6BA 2NUVA 5LDZA 3Q29A 2Q74A 4LZ7A 3VXCA 1MY0A 2XXKA 4IGTA 4GOTA 2B4MA 4MH5A 1R9LA 4IB2A 3IFAA 3FXBA 2CMOA 4X48A 3VFJA 4R9GA 4TLMB 4HCWA 3QXMA 3G3GA 1VE4A 5H8QA 4ELRA 5IZ3A 1JVYA 4GX6A 2DXRA 2XD2A 1EYKA 1OLCA 1ZKBA 3S9EA 1ZBMA 4POXA 1KWHA 1Z7NE 1NV2A 5IM2A 1FJ9A 1H76A 3IX1A 4JBZA 4F2QA 4LZ8A 1DBZA 5I3SA 4KYEA 3E4RA 1EU8A 2GQ1A 5H8QB 1T0KA 3TCHA 2KLFA 1FQCA 4PFIA 5IZ3B 2R9JA 1FPIA 2Q89A 4I8CA 1MY3A 5J1DA 2D21A 4N6PA 1JVXA 2OX3A 3KOSA 3JYRA 3E78A 2AIXA 4YB6A 2DWAA 4OANA 5AA3A 2ZZWA 4PDDA 3IOVA 1MQJA 1YPNA 1DPEA 4R74A 3PD9A 4P0GA 4AS5A 1JQFA 4F3SA 1CNQA 1DSNA 4DDDA 3K6VA 1FPJA 2VOZA 3JZJA 4YMBA 1IMCA 4KHZE 4ZE8A 1BIYA 1FTJA 1RYOA 5H8HA 2RC9A 1YTVA 4GWWA 2QJEA 1A8EA 3RYDA 4P11A 1RDXA 1NV0A 3HHGA 4ZS9A 3FJMA 3S9LC 1MXWA 1LAHE 3IJXB 1NH8A 4Q0CA 3KBRA 2OK2A 3IB0A 3K0VA 3RPLA 1IMEA 2F97A 3EPEA 3V89B 4N8YA 2GFEA 4BDMA 3K4UA 1N76A 4WEPA 5H8HB 2XX9A 4BLAA 2F8DA 5KZTA 1M5CA 3PUZE 3FBPA 2QS4A 4H5FA 4QHQA 4ELOA 4JSOA 3EKIA 3K02A 2XXPA 4NQ8A 2ZXTA 4JWOA 3MQ9A 2XWKA 3LUZA 2XXTA 4R2FA 4FORA 1L5TA 1SW5A 3TDJA 2DS9A 3RPLB 1FSAA 3G7WA 2FBPA 3G3JA 2GHAA 2Y7IA 4I62A 2XA5A 4ISUA 1N7WA 1NNPA 4MCOA 1K9ZA 3OO6A 1NFTA 3CRBA 4KCDA 4HTGA 2HPGA 4MBPA 2QMXA 1B3FA 4IO3A 3UIFA 4F19A 4OEUA 1QUKA 4EXKA 5EHSA 1MXVA 4POWA 4QFOA 1OVBA 1B3EA 3OMBA 1OQGA 2A5TA 4DXBA 3GXAA 3MBPA 2XHDA 4PFTA 4O7IA 4NEDA 1EYJA 1MM7A 4P3LA 2PFZA 4H8IA 5A5LA 4U21A 4Q30B 4PE3A 1SYIA 2OLBA 3CG3A 1N3XA 3L6GA 2L5VA 3Q27A 3OXNA 1URGA 2ZZVA 4KI0E 1Z7ME 2Y7KA 3TCGA 4PP0A 1QKBA 3LSFB 3RT8A 4HE1A 5JTYA 1ZMGA 4U4SA 1P1NA 1ATGA 1LAFE 4IGRA 2A5TB 1FPLA 1D3KA 4NMYA 3FGSA 1OLAA 3ILUB 2V3TA 4N6DA 3C9HA 4JSDA 2ALUA 3B6WA 4F29A 3KEIA 4H5GA 2H99A 1IMBA 1IQ7A 4N81A 4NF0A 3MPKA 4ZE9A 4GXSB 4HXVA 4EQ9A 4GF8A 2XD3A 2DXYA 5JTYB 5I7IA 3PPOA 4GVOA 1P1OA 3PUYE 4GL0A 2ZYNA 1NV6A 3MC2A 2F3BA 2O51A 2YJPA 1FRPA 5IGAA 1N04A 5H8NA 3E3KA 1AWBA 2F6GA 4RYAA 4HW8A 3Q26A 3U92A 3C35A 2O1MA 1FW0A 5TP9A 5BUUA 3MPLA 1GTKA 3FD3A 2Y7PA 2CZLA 3O6HA 2UXAA 4X8RA 2CZHA 3PPPA 4DXCA 4R2BA 4LQ5A 2WEFA 2RC8A 4F3GA 3GYYA 4PBQA 1LCTA 1LGBC 4P1LA 5CMCA 5H8NB 1N84A 2D3IA 3VVDA 1FBCA 4RXLA 1LBZA 1IUDA 1NV4A 4GWYA 3OO9A 2Y5KA 2WYKA 2QMWA 2R71A 5I58A 1MQIA 3CR9A 5DVFA 4I3YA 5TP9B 2O7IA 3SEYA 3TTLA 1NUYA 1FPFA 4GIZA 2H5YA 1MY1A 3T0JA 3T1BA 1B1HA 3MVYA 4OVJA 1GR2A 2ONKE 3T9HB 1INPA 3FIRA 3SKPA 4G8NA 2VHAA 1FBDA 4ESXA 3ZS6A 1JW5A 1VDWA 3LUYA 1XS5A 2H98A 4MHFA 3H6UA 2HEUA 1B3LA 1VR5A 1RDZA 3O6GA 3C36A 1B7HA 4DLDA 2CEYA 1FQAA 5I58B 2P3NA 2XXXA 1N3WA 2DWJA 3VLWA 2ONRA 4L17A 3OSQA 1FPDA 5K2YA 1AMFA 1KA0A 2DE4A 1B51A 3QUFA 4TQUQ 2QSXA 4QBAA 1MPDA 2QS3A 3SESA 3A3UA 3K6UA 3C32A 4P0IA 3IK6B 3PMVA 3KN3A 1FBPA 3TZAA 4BDLA 4H65A 2O84X 3W15C 1SI1A 5TU0A 2D5WA 5EQ7A 1US4A 3FUZA 2HZLA 4OVSA 2HCAA 1XOCA 1MH4A 2OWSA 4OENA 4P1EA 2DVCA 2GRVA 5EYGA 4NTLA 3KC1A 4H67A 4QFNA 1FPBA 1MM6A 3IFCA 4HE0A 2DP8A 4NWCA 2B4LA 3O97A 2Z22A 2O69A 3LSWA 2WX9A 4PFUA 2VPOA 1B5JA 4DI4B 5AA2A 5ICTA 4IY5A 1SDXA 3KBZA 5TPAA 4GQOA 3KSXA 2YPNA 4GBWA 1LFIA 1B9JA 1BP5A 5ISUA 1JW4A 1H44A 5I5PA 4YMAA 3K1PA 3THIA 3TPAA 4KQPA 4PGNA 3N5LA 3RGYA 2B3BA 3BFTA 3TFLA 4OETA 2THIA 1XC1A 3MSTA 4F1YA 2Z23A 2PT1A 3EHTA 4H45A 2I3WA 1B7UA 4IO2A 3H06B 4LQ2A 1A40A 1PB8A 1B2HA 5AA2B 1FTAA 1NNTA 5TPAB 4QSCA 4MMPA 4N15A 4X1BA 3KJ7A 5EQAA 4H0WA 2PBWA 2RC7A 5F24A 3G3HA 2M8CA 1TFDA 4WXJA 4ZEBA 4DI3D 5CMKA 2XXRA 1PDAA 4ZEFA 4DXUA 4K3FA 1G0IA 4ZDMA 1QW0A 2V4CA 5EHMA 4NE4A 4QFKA 4EQ7A 4PETA 3FXQA 1URSA 4UABA 4MF3A 2WBDA 4XKQA 3V5AA 3KJTA 3EQ1A 2F7CA 1QGXA 3N26A 4BDRA 2F36A 2GH9A 3PMXA 3FJ7A 2WYPA 1LEVA 1SVXB 3RPWA 1EZOA 2PVUA 1LB8A 3QAXA 3MP1A 2Z8FA 4DCYA 2FVZA 1MDP1 5IKBA 3IL1B 1SW1A 5EQ9A 4JB7A 1IITA 1M5BA 4R75A 2DE3A 1B3HA 2ZNSA 3T9XB 1JNFA 1PC3A 1NUXA 1MY4A 3IB2A 4MNIA 4YU0A 1FJ6A 1Y1MA 2F7BA 1G0HA 3IORA 1AL3A 1LBBA 1B40A 2QVUA 1YXIA 1B6HA 4Z7EA 4YKJA 1B4ZA 3CHGA 3B6QA 5F1QA 2I3VA 3W9VA 1MS7A 1JEVA 4Q8RA 1XI6A 5FTHA 3PD8A 1A7LA 3K6XA 1Q9DA 3CSGA 5EYFA 2RINA 3H6VA 3TTNA 4JXIA 3FVGA 5DT6A 4YKIA 2VP1A 3K01A 4GX3A 5J16A 2OCUA 1DCUA 3VVEA 1O63A 1B05A 3ZSFA 4P47A 4JVCA 1WDNA 5IZZA 5LOMA 2QFLA 2NXOA 2WBBA 4G77A 3LC8A 5KCJA 2O1LA 2HHMA 1TFAA 1MXZA 1YYZA 3MP8A 4IO6A 1URDA 1HSEA 4XFEA 1Y4CA 1FQBA 4OVPA 2PFYA 4KCCA 1N0TA 2DQVA 4E0XA 2WKYA 3Q28A 1QUJA 1B46A 1DTZA 3KOTA 3UORA 2NOOA 3C31A 2Q2AA 3MVZA 1IXCA 1B58A 2KR0A 4O3AA 2VD2A 1USYH 4AB6A 4M4GA 4PC9A 1P1WA 3OD7A 3G3KA 4YAHX 2V3QA 1PB7A 5ICQA 1H45A 4G68A 3FVKA 3W9WA 5KCJB 1XVYA 4X9TA 4NG7A 1IMFA 3BBRA 3U72A 1IEJA 4F31B 1B52A 3LSXA 3K00A 1POY1 4OEVA 3MZ1A 1SD3A 5HBCA 3VLVA 4TOZA 2RF1A 2DDKA 1FPGA 5L9OA 4X1DA 1FQEA 2ZYKA 2A5SA 2I49A 3A29A 3EF7A 4OVQA 4O7MA 3IO4A 2UVIA 3C4MA 3N6TA 3PMWA 1FCKA 4OTEA 4G68B 3SEXA 1FBFA 3OEKA 3K1MA 3L6HA 4R73A 2DYXA 4GWUA 3TQWA 2UVGA 3MP6A 1XHYA 4MX6A 3O28A 3CIJA 3CFZA 3FVOA 4XTCQ 4FBPA 5CC2A 3OSRA 2AL4A 4P9KA 5CMMA 1D9QA 4OA4A 4PFBA 1WVJA 3LV0A 2OZZA 3IJOB 2F3DA 3T22A 3D4GA 1FBGA 5AA2D 1MXYA 2XXVA 4U4XA 5LTCA 4RPNA 5FHNA 1LAGE 4XEQA 4FE8A 2HAVA 3QMFA 2Q9TA 4N4UA 4PF6A 4EF2A 3FASA 1CB6A 1MH3A 5ELVA 1SQYA 4BDOA 1MXXA 1AOVA 4TLLB 4DCXA 1MG1A 4EF1A 1POTA 2XXYA 3PUVE 3OOAA 4OERA 3LR1A 3RT6B 4QXDA 2Q88A 3VV5A 2G93A 3FATA 3USDA 3VE1B 2I4BA 1VFEA 1S9TA 2PMSA 5DYHA 1ZU0A 1B0HA 4LN5A 1R9QA 2ZYMA 3PUXE 4U22A 4NWDA 3RTWB 4FEBA 3OO7A 2PX1A 2REGA 4IR8A 5AA1A 4OESA 1FPKA 1OQHA 3O6IA 3MYUA 2HXWA 2O6AA 5I84A 4LVQA 2P2AA 2XXQA 4BDNA 4ONYA 3U65A 1YCJA 4OFOA 4Z0IA 3QSLA 1DPPA 1OVTA 2HXRA 3MZ9A 2BJIA 3N6UA 1R6ZA 2QS1A 2YLNA 5FBPA 1I6AA 4P56A 3MUQA 1S50A 1Y3QA 2DWIA 4IY6A 1PB9A 4EDPA 1UTBA 4PBHA 3O2AA 2IA4A 3EN3A 1EZ9A 4X04A 2R6GE 2DOJA 1IXGA 4PAFA 3KN8A 3CSBA 4OFJA 5CM6A 2AL5A 1LBWA 2V25A 1B3GA 2OWTA 3H6TA 1D9YA 1FBHA 2XX8A 1A99A 4BDQA 2Y7RA 2F34A 2F5XA 4EQBA 4HS7A 2QVRA 2H4IA 3Q25A 3H3GA 3HHFA 2V93A
chains in the Genus database with same CATH topology
4KPTA 4G8HA 1ZTYA 4JDFA 4C1UA 4U1OA 1IXHA 1LFGA 5H8SA 1UTBB 1MXUA 3R6UA 4FIMA 3A3CA 1Q1KA 1B1XA 1FTMA 3GLBA 3VLUA 2ZYOA 1OMPA 2UYEA 2O7UA 4WKMA 4F1UA 4ESWA 1LSTA 3RTFB 3I5OA 1BKAA 3C34A 3MAMA 3TTKA 2P0SA 1LB9A 2XXUA 3E9XA 4KD5A 4XKNA 5HPQA 1MQHA 4RA1A 4GD5A 4F18A 3HCQA 1AIVA 2QPQA 1QUIA 3FJGA 4KYSA 4NF4A 1M5EA 4IO7A 4ND9A 4GXAA 3UK4A 2W7YA 4H8JA 2XX7A 4MFIA 2DWHA 4FATA 1MQDA 1I69A 2H9BA 4RJZA 3WAEA 1US5A 4GL8A 3IOUA 4YICA 4F39A 1Y4TA 3T9VA 4M1VA 4OMBA 5CMBA 3R7XA 5KDTA 1A8FA 3VXBA 4KFQA 3D4CA 1H43A 1XT8A 3UP9A 4NF4B 1LCFA 1JEUA 1QJMA 2RKMA 3DM0A 3B7DA 4LUBA 2ZMBA 4RNSA 4C0RA 1A55A 3H03A 4F3PA 1RYXA 5B7DA 1DOTA 4RK9A 3PPQA 2O68A 3AXFA 3ONMA 5KDTB 1DMBA 3K6WA 3PPRA 2G29A 3QUJA 1B5HA 1P1QA 3BFUA 3F11A 4XKPA 3CI8A 3ECRA 2Q2CA 4I9DA 3MVXA 3PPNA 3O9PA 1D4NA 2Z8EA 1FTLA 3KFMA 1Y20A 1O64A 3T96B 4OXVA 2Y7WA 3ILTB 5B70A 3SDFA 2I48A 3K1NA 4H6DA 3T93B 3TCFA 1JETA 2XXHA 1UIVA 2X7PA 1PBPA 2ABHA 2Z8DA 1I6QA 1UQWA 5I56A 4G4PA 3HPIA 4LA9A 1HSLA 2H25A 3TODA 3ZKKA 1Y3PA 4MLQA 4FAJA 4R6HA 1S7YA 2DE2A 1O7TA 4PFYA 4ZZAA 2PT2A 3RQTA 2HAUA 2V3UA 3DLNA 4LP2B 4U1ZA 4OFLA 1GGGA 5DEXA 4OYVA 1EZPA 3CVGA 4ZEKA 3JV9A 1B32A 5I56B 1M5DA 4UACA 2AYSA 1PBQA 4F3BA 1BTJA 1N7XA 1UIUA 3CG1A 3PV0E 3SEWA 1WODA 3UN6A 1HSJA 1NNFA 3O66A 3IR1A 4GFRA 3FXRA 1XVXA 3SEVA 1QVSA 1B7ZA 1BLFA 1ELJA 5DEXB 3MJNA 3PGFA 4MLVA 1IXIA 5M2VA 3M3LA 3TKDA 4OZ9A 1H3DA 3KN7A 3GBAA 5ITPA 3S4UA 2ANJA 3FVNA 2B3FA 4F2OA 4EXLA 1LAXA 1FQDA 5I57A 4N13A 3RY3A 3O29A 3DELB 3U93A 2IEEA 5AA4A 4WEDA 4QF9A 4QFPA 1Y9UA 1FTOA 3TELA 2ESNA 3EHUA 3QIMA 2FYIA 4XIGQ 2HQ0A 2OBGA 3M8UA 2UVHA 4IO5A 3CFLA 5FTIA 2ONSA 2ZNTA 3H7MA 3TMGA 3RN8A 3TAJA 3GZGA 5I57B 1LLSA 1EH3A 3MW0A 2GHBA 1RKMA 5H8FA 5FHMA 5AA4B 3MVWA 2XXIA 1MRPA 1UTHA 4F22A 4OQOA 2DSFA 1Y1ZA 2XXWA 1QULA 4OWDA 3IAZA 3TYHA 2NVUB 5CI5A 3T9UA 4YB7A 3IB1A 1NKXA 4EUOA 3EHSA 3IO6A 2QRYA 4JWXA 5H8FB 1AH5A 4G68C 4RY1A 3V8XB 3G3FA 3N94A 2UYFA 2Q8JA 4ZEDA 5L9SA 3S2VA 3OEMA 2REJA 5BWJA 1UTHB 3VDFA 3M3FA 5L8DA 2F6PA 5HM4B 3E13X 4R72A 1J1NA 3DP8A 4FECA 3S9MC 3DP4A 4NF8A 4I1DA 2HZKA 2OJTA 4JWYA 3KZGA 4AB5A 4C1TA 2UVJA 4ECFA 4QSDA 3R26A 4PE5B 4G2ZA 1MY2A 5F7VA 1SW2A 4YKPA 2VGQA 4YB5A 2LAOA 3T66A 3U94A 1VSOA 1TWYA 3QYTA 3V83A 4NF8B 3BKIB 3UA8A 1DTGA 4LZ5A 1Y3NA 5CBRA 3GBBA 4XKRA 4R6KA 4XXUA 2NWJA 4O3CA 4ZZEA 4Q5TA 4KYDA 3ZKLA 4E0WA 3OO8A 3CFXA 1MPCA 3HO7A 2X7QA 2I6EA 4ZECA 2QS2A 2B65A 4FJPA 4ELQA 4QSEA 4QFLA 3UGWA 4THIA 3OELA 2HFBA 1SI0A 4O3BA 3TTRA 3U8QA 1MPBA 1A54A 1ANFA 1II5A 4N07A 2DVZA 3SETA 1FQFA 3TUSA 5DVIA 1M5FA 2V84A 3G3IA 2RCAA 1B5IA 1P99A 1SW4A 1B0LA 3HV1A 4DIGA 4QRZA 1D9VA 3P7IA 5DTBA 4RPOA 5L9MA 4YZZA 3KSJA 3FXUA 5I2NA 2I4CA 1MDQA 4U2RA 3FV2A 3PU5A 4LONB 4NF5A 1FTKA 3H6WA 3LBSA 2F78A 4ZEIA 4F1VA 4G8MA 3KGCA 3IOTA 4NF6A 4IO4A 2PYYA 2RCBA 1ZIUA 1GVCA 1YAEA 5CRYA 1SBPA 3PUWE 2VD3A 2E0SA 3M3KA 5I2NB 1NNKA 2FA7A 4LATA 3HN0A 3RLFE 1SYHA 4NF5B 1B4HA 2F35A 5K2XA 3SERA 4NF6B 5A5XA 5JEIA 2I0BA 1F9BA 4YKKA 3LSLA 4U23A 1CE2A 4GLIA 2P1SA 3S9NC 5I59A 1LFHA 5CBSA 4HCYA 3U1OA 5FHOA 3FV1A 4OHNA 3A09A 1QKAA 3HSTA 1LBCA 3QK6A 3OENA 4DZ1A 4ELPA 1PEBA 5A5XB 1Q35A 1TXFA 3SEUA 3MZBA 4PFWA 1USYE 3I6VA 5I59B 2BJJX 5ITOA 3H4ZA 2E1SA 4FEDA 4GWOA 2FNCA 5I2KA 1GV8A 4PQJA 2I58A 1ZJLA 3TQLA 4GRKA 4AQ4A 4KR5A 5IAIA 5DVJA 2I0CA 3FZVA 3I3VA 3DP6A 3C33A 1IZ1A 3ODBA 1NL5A 1VFDA 3KG2A 1OIBA 1R1NA 3VVFA 1IIWA 2ZNUA 3B6TA 4H1XA 5I2KB 1P1UA 2X26A 4RK2A 4UA8A 3MWBA 3K2DA 4R6YA 1NMUA 5AE4A 1MQGA 4DE8A 1TT1A 4R9FA 3RUMA 1NH7A 3WAFA 2QL3A 2Y84A 3TEPA 3TTMA 3RNNA 5JK4A 2F7AA 1ZLQA 3IOWA 1JW1A 1I6BA 2NUVA 3Q29A 4LZ7A 3VXCA 1MY0A 4IGTA 4GOTA 4MH5A 1R9LA 4IB2A 2CMOA 4X48A 3VFJA 4R9GA 4TLMB 4HCWA 3QXMA 3G3GA 1VE4A 5H8QA 4ELRA 1JVYA 2DXRA 2XD2A 1OLCA 1ZKBA 3S9EA 1ZBMA 4POXA 1KWHA 1Z7NE 1H76A 3IX1A 4JBZA 4F2QA 4LZ8A 4KYEA 3E4RA 1EU8A 5H8QB 1T0KA 3TCHA 2KLFA 1FQCA 2R9JA 2Q89A 4I8CA 1MY3A 5J1DA 2D21A 4N6PA 1JVXA 3KOSA 3JYRA 2AIXA 4YB6A 2DWAA 5AA3A 3IOVA 1MQJA 1YPNA 1DPEA 4R74A 3PD9A 4P0GA 1JQFA 4F3SA 1DSNA 4DDDA 3K6VA 2VOZA 3JZJA 4YMBA 4KHZE 4ZE8A 1BIYA 1FTJA 1RYOA 5H8HA 2RC9A 1YTVA 2QJEA 1A8EA 4P11A 3HHGA 4ZS9A 3FJMA 3S9LC 1MXWA 1LAHE 3IJXB 1NH8A 4Q0CA 3KBRA 2OK2A 3IB0A 3K0VA 2F97A 3EPEA 3V89B 2GFEA 4BDMA 3K4UA 1N76A 4WEPA 5H8HB 2XX9A 4BLAA 2F8DA 5KZTA 1M5CA 3PUZE 2QS4A 4H5FA 4QHQA 4ELOA 4JSOA 3K02A 2XXPA 2ZXTA 4JWOA 3MQ9A 2XXTA 4R2FA 4FORA 1L5TA 1SW5A 3TDJA 2DS9A 3G7WA 3G3JA 2GHAA 2Y7IA 4I62A 4ISUA 1N7WA 1NNPA 3OO6A 1NFTA 3CRBA 4KCDA 4HTGA 4MBPA 2QMXA 1B3FA 4IO3A 3UIFA 4F19A 4OEUA 1QUKA 4EXKA 5EHSA 1MXVA 4POWA 4QFOA 1OVBA 1B3EA 3OMBA 1OQGA 2A5TA 4DXBA 3GXAA 3MBPA 2XHDA 4PFTA 4NEDA 1MM7A 4H8IA 4U21A 4Q30B 1SYIA 2OLBA 3CG3A 1N3XA 3L6GA 3Q27A 3OXNA 1URGA 4KI0E 1Z7ME 2Y7KA 3TCGA 4PP0A 1QKBA 3LSFB 3RT8A 5JTYA 1ZMGA 4U4SA 1P1NA 1ATGA 1LAFE 4IGRA 2A5TB 1D3KA 4NMYA 3FGSA 1OLAA 3ILUB 2V3TA 3C9HA 4JSDA 2ALUA 3B6WA 4F29A 3KEIA 4H5GA 2H99A 1IQ7A 3MPKA 4ZE9A 4GXSB 4EQ9A 4GF8A 2XD3A 2DXYA 5JTYB 3PPOA 4GVOA 1P1OA 3PUYE 4GL0A 2ZYNA 3MC2A 2O51A 2YJPA 1N04A 5H8NA 3E3KA 2F6GA 4RYAA 4HW8A 3Q26A 3U92A 3C35A 2O1MA 1FW0A 5BUUA 5TP9A 3MPLA 1GTKA 3FD3A 2Y7PA 2CZLA 3O6HA 2UXAA 3PPPA 4DXCA 4R2BA 4LQ5A 2RC8A 4F3GA 1LCTA 1LGBC 5CMCA 5H8NB 1N84A 2D3IA 3VVDA 4RXLA 1IUDA 3OO9A 2QMWA 2R71A 5I58A 1MQIA 3CR9A 5DVFA 5TP9B 2O7IA 3SEYA 3TTLA 4GIZA 2H5YA 1MY1A 1B1HA 3MVYA 4OVJA 1GR2A 2ONKE 3T9HB 3FIRA 3SKPA 4G8NA 2VHAA 4ESXA 3ZS6A 1JW5A 3LUYA 1XS5A 2H98A 3H6UA 2HEUA 1B3LA 1VR5A 3O6GA 3C36A 1B7HA 4DLDA 1FQAA 5I58B 2XXXA 1N3WA 2DWJA 3VLWA 2ONRA 4L17A 3OSQA 5K2YA 1AMFA 2DE4A 1B51A 3QUFA 4TQUQ 2QSXA 1MPDA 2QS3A 3SESA 3A3UA 3K6UA 3C32A 4P0IA 3IK6B 3PMVA 3KN3A 3TZAA 4BDLA 4H65A 2O84X 3W15C 1SI1A 5TU0A 2D5WA 1US4A 3FUZA 2HZLA 2HCAA 1XOCA 1MH4A 2OWSA 4OENA 2DVCA 2GRVA 4NTLA 4H67A 4QFNA 1MM6A 2DP8A 4NWCA 3O97A 2Z22A 2O69A 3LSWA 4PFUA 1B5JA 5AA2A 5ICTA 4IY5A 1SDXA 5TPAA 4GQOA 3KSXA 2YPNA 1LFIA 1B9JA 1BP5A 5ISUA 1JW4A 1H44A 4YMAA 3K1PA 3THIA 3TPAA 4KQPA 3N5LA 3RGYA 2B3BA 3BFTA 3TFLA 4OETA 2THIA 1XC1A 4F1YA 2Z23A 2PT1A 3EHTA 2I3WA 1B7UA 4IO2A 3H06B 4LQ2A 1A40A 1PB8A 1B2HA 5AA2B 1NNTA 5TPAB 4QSCA 4X1BA 3KJ7A 4H0WA 2PBWA 2RC7A 3G3HA 2M8CA 1TFDA 4WXJA 4ZEBA 5CMKA 2XXRA 1PDAA 4ZEFA 4DXUA 4K3FA 4ZDMA 1QW0A 5EHMA 4NE4A 4QFKA 4EQ7A 4PETA 3FXQA 1URSA 4MF3A 4XKQA 3V5AA 3KJTA 3EQ1A 2F7CA 3N26A 4BDRA 2F36A 2GH9A 3PMXA 3FJ7A 1SVXB 3RPWA 1EZOA 2PVUA 1LB8A 3QAXA 3MP1A 2Z8FA 4DCYA 1MDP1 5IKBA 3IL1B 1SW1A 4JB7A 1IITA 1M5BA 4R75A 2DE3A 1B3HA 2ZNSA 3T9XB 1JNFA 1PC3A 1MY4A 3IB2A 4YU0A 1Y1MA 2F7BA 3IORA 1AL3A 1LBBA 1B40A 1B6HA 4Z7EA 4YKJA 1B4ZA 3B6QA 5F1QA 2I3VA 3W9VA 1MS7A 1JEVA 4Q8RA 5FTHA 3PD8A 1A7LA 3K6XA 3CSGA 5EYFA 2RINA 3H6VA 3TTNA 4JXIA 3FVGA 5DT6A 4YKIA 2VP1A 3K01A 2OCUA 3VVEA 1O63A 1B05A 3ZSFA 1WDNA 5LOMA 2NXOA 4G77A 3LC8A 5KCJA 2O1LA 1TFAA 1MXZA 3MP8A 4IO6A 1URDA 1HSEA 1Y4CA 1FQBA 4KCCA 1N0TA 2DQVA 4E0XA 2WKYA 3Q28A 1QUJA 1B46A 1DTZA 3KOTA 3UORA 2NOOA 3C31A 2Q2AA 3MVZA 1IXCA 1B58A 4O3AA 2VD2A 1USYH 4AB6A 4M4GA 1P1WA 3OD7A 3G3KA 4YAHX 2V3QA 1PB7A 5ICQA 1H45A 4G68A 3FVKA 3W9WA 5KCJB 1XVYA 4X9TA 3BBRA 3U72A 1IEJA 4F31B 1B52A 3LSXA 3K00A 1POY1 4OEVA 3MZ1A 1SD3A 5HBCA 3VLVA 4TOZA 2RF1A 5L9OA 4X1DA 1FQEA 2ZYKA 2A5SA 2I49A 3EF7A 3IO4A 2UVIA 3C4MA 3N6TA 3PMWA 1FCKA 4OTEA 4G68B 3SEXA 3OEKA 3K1MA 3L6HA 4R73A 2DYXA 3TQWA 2UVGA 3MP6A 1XHYA 3O28A 3CIJA 3CFZA 3FVOA 4XTCQ 5CC2A 3OSRA 2AL4A 5CMMA 1WVJA 2OZZA 3IJOB 3T22A 3D4GA 5AA2D 1MXYA 2XXVA 4U4XA 4RPNA 5FHNA 1LAGE 4FE8A 2HAVA 2Q9TA 4EF2A 3FASA 1CB6A 1MH3A 5ELVA 1SQYA 4BDOA 1MXXA 1AOVA 4TLLB 4DCXA 1MG1A 4EF1A 1POTA 2XXYA 3PUVE 3OOAA 4OERA 3LR1A 3RT6B 2Q88A 3VV5A 2G93A 3FATA 3USDA 3VE1B 2I4BA 1VFEA 1S9TA 2PMSA 5DYHA 1ZU0A 1B0HA 1R9QA 2ZYMA 3PUXE 4U22A 4NWDA 3RTWB 4FEBA 3OO7A 2PX1A 2REGA 5AA1A 4OESA 1OQHA 3O6IA 2HXWA 2O6AA 5I84A 4LVQA 2P2AA 2XXQA 4BDNA 4ONYA 1YCJA 4OFOA 4Z0IA 3QSLA 1DPPA 1OVTA 3MZ9A 3N6UA 1R6ZA 2QS1A 2YLNA 1I6AA 3MUQA 1S50A 1Y3QA 2DWIA 4IY6A 1PB9A 4EDPA 1UTBA 3O2AA 2IA4A 3EN3A 1EZ9A 2R6GE 2DOJA 1IXGA 3KN8A 3CSBA 4OFJA 5CM6A 2AL5A 2V25A 1B3GA 2OWTA 3H6TA 1D9YA 2XX8A 1A99A 4BDQA 2Y7RA 2F34A 2F5XA 4EQBA 4HS7A 2H4IA 3Q25A 3H3GA 3HHFA 2V93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KPT A;  4G8H A;  1ZTY A;  4JDF A;  4C1U A;  4U1O A;  1IXH A;  1LFG A;  5H8S A;  1UTB B;  1MXU A;  3R6U A;  4FIM A;  3A3C A;  1Q1K A;  1B1X A;  1FTM A;  3GLB A;  3VLU A;  2ZYO A;  1OMP A;  2UYE A;  2O7U A;  4WKM A;  4F1U A;  4ESW A;  1LST A;  3RTF B;  3I5O A;  1BKA A;  3C34 A;  3MAM A;  3TTK A;  2P0S A;  1LB9 A;  2XXU A;  3E9X A;  4KD5 A;  4XKN A;  5HPQ A;  1MQH A;  4RA1 A;  4GD5 A;  4F18 A;  3HCQ A;  1AIV A;  2QPQ A;  1QUI A;  3FJG A;  4KYS A;  4NF4 A;  1M5E A;  4IO7 A;  4ND9 A;  4GXA A;  3UK4 A;  2W7Y A;  4H8J A;  2XX7 A;  4MFI A;  2DWH A;  4FAT A;  1MQD A;  1I69 A;  2H9B A;  4RJZ A;  3WAE A;  1US5 A;  4GL8 A;  3IOU A;  4YIC A;  4F39 A;  1Y4T A;  3T9V A;  4M1V A;  4OMB A;  5CMB A;  3R7X A;  5KDT A;  1A8F A;  3VXB A;  4KFQ A;  3D4C A;  1H43 A;  1XT8 A;  3UP9 A;  4NF4 B;  1LCF A;  1JEU A;  1QJM A;  2RKM A;  3DM0 A;  3B7D A;  4LUB A;  2ZMB A;  4RNS A;  4C0R A;  1A55 A;  3H03 A;  4F3P A;  1RYX A;  5B7D A;  1DOT A;  4RK9 A;  3PPQ A;  2O68 A;  3AXF A;  3ONM A;  5KDT B;  1DMB A;  3K6W A;  3PPR A;  2G29 A;  3QUJ A;  1B5H A;  1P1Q A;  3BFU A;  3F11 A;  4XKP A;  3CI8 A;  3ECR A;  2Q2C A;  4I9D A;  3MVX A;  3PPN A;  3O9P A;  1D4N A;  2Z8E A;  1FTL A;  3KFM A;  1Y20 A;  1O64 A;  3T96 B;  4OXV A;  2Y7W A;  3ILT B;  5B70 A;  3SDF A;  2I48 A;  3K1N A;  4H6D A;  3T93 B;  3TCF A;  1JET A;  2XXH A;  1UIV A;  2X7P A;  1PBP A;  2ABH A;  2Z8D A;  1I6Q A;  1UQW A;  5I56 A;  4G4P A;  3HPI A;  4LA9 A;  1HSL A;  2H25 A;  3TOD A;  3ZKK A;  1Y3P A;  4MLQ A;  4FAJ A;  4R6H A;  1S7Y A;  2DE2 A;  1O7T A;  4PFY A;  4ZZA A;  2PT2 A;  3RQT A;  2HAU A;  2V3U A;  3DLN A;  4LP2 B;  4U1Z A;  4OFL A;  1GGG A;  5DEX A;  4OYV A;  1EZP A;  3CVG A;  4ZEK A;  3JV9 A;  1B32 A;  5I56 B;  1M5D A;  4UAC A;  2AYS A;  1PBQ A;  4F3B A;  1BTJ A;  1N7X A;  1UIU A;  3CG1 A;  3PV0 E;  3SEW A;  1WOD A;  3UN6 A;  1HSJ A;  1NNF A;  3O66 A;  3IR1 A;  4GFR A;  3FXR A;  1XVX A;  3SEV A;  1QVS A;  1B7Z A;  1BLF A;  1ELJ A;  5DEX B;  3MJN A;  3PGF A;  4MLV A;  1IXI A;  5M2V A;  3M3L A;  3TKD A;  4OZ9 A;  1H3D A;  3KN7 A;  3GBA A;  5ITP A;  3S4U A;  2ANJ A;  3FVN A;  2B3F A;  4F2O A;  4EXL A;  1LAX A;  1FQD A;  5I57 A;  4N13 A;  3RY3 A;  3O29 A;  3DEL B;  3U93 A;  2IEE A;  5AA4 A;  4WED A;  4QF9 A;  4QFP A;  1Y9U A;  1FTO A;  3TEL A;  2ESN A;  3EHU A;  3QIM A;  2FYI A;  4XIG Q;  2HQ0 A;  2OBG A;  3M8U A;  2UVH A;  4IO5 A;  3CFL A;  5FTI A;  2ONS A;  2ZNT A;  3H7M A;  3TMG A;  3RN8 A;  3TAJ A;  3GZG A;  5I57 B;  1LLS A;  1EH3 A;  3MW0 A;  2GHB A;  1RKM A;  5H8F A;  5FHM A;  5AA4 B;  3MVW A;  2XXI A;  1MRP A;  1UTH A;  4F22 A;  4OQO A;  2DSF A;  1Y1Z A;  2XXW A;  1QUL A;  4OWD A;  3IAZ A;  3TYH A;  2NVU B;  5CI5 A;  3T9U A;  4YB7 A;  3IB1 A;  1NKX A;  4EUO A;  3EHS A;  3IO6 A;  2QRY A;  4JWX A;  5H8F B;  1AH5 A;  4G68 C;  4RY1 A;  3V8X B;  3G3F A;  3N94 A;  2UYF A;  2Q8J A;  4ZED A;  5L9S A;  3S2V A;  3OEM A;  2REJ A;  5BWJ A;  1UTH B;  3VDF A;  3M3F A;  5L8D A;  2F6P A;  5HM4 B;  3E13 X;  4R72 A;  1J1N A;  3DP8 A;  4FEC A;  3S9M C;  3DP4 A;  4NF8 A;  4I1D A;  2HZK A;  2OJT A;  4JWY A;  3KZG A;  4AB5 A;  4C1T A;  2UVJ A;  4ECF A;  4QSD A;  3R26 A;  4PE5 B;  4G2Z A;  1MY2 A;  5F7V A;  1SW2 A;  4YKP A;  2VGQ A;  4YB5 A;  2LAO A;  3T66 A;  3U94 A;  1VSO A;  1TWY A;  3QYT A;  3V83 A;  4NF8 B;  3BKI B;  3UA8 A;  1DTG A;  4LZ5 A;  1Y3N A;  5CBR A;  3GBB A;  4XKR A;  4R6K A;  4XXU A;  2NWJ A;  4O3C A;  4ZZE A;  4Q5T A;  4KYD A;  3ZKL A;  4E0W A;  3OO8 A;  3CFX A;  1MPC A;  3HO7 A;  2X7Q A;  2I6E A;  4ZEC A;  2QS2 A;  2B65 A;  4FJP A;  4ELQ A;  4QSE A;  4QFL A;  3UGW A;  4THI A;  3OEL A;  2HFB A;  1SI0 A;  4O3B A;  3TTR A;  3U8Q A;  1MPB A;  1A54 A;  1ANF A;  1II5 A;  4N07 A;  2DVZ A;  3SET A;  1FQF A;  3TUS A;  5DVI A;  1M5F A;  2V84 A;  3G3I A;  2RCA A;  1B5I A;  1P99 A;  1SW4 A;  1B0L A;  3HV1 A;  4DIG A;  4QRZ A;  1D9V A;  3P7I A;  5DTB A;  4RPO A;  5L9M A;  4YZZ A;  3KSJ A;  3FXU A;  5I2N A;  2I4C A;  1MDQ A;  4U2R A;  3FV2 A;  3PU5 A;  4LON B;  4NF5 A;  1FTK A;  3H6W A;  3LBS A;  2F78 A;  4ZEI A;  4F1V A;  4G8M A;  3KGC A;  3IOT A;  4NF6 A;  4IO4 A;  2PYY A;  2RCB A;  1ZIU A;  1GVC A;  1YAE A;  5CRY A;  1SBP A;  3PUW E;  2VD3 A;  2E0S A;  3M3K A;  5I2N B;  1NNK A;  2FA7 A;  4LAT A;  3HN0 A;  3RLF E;  1SYH A;  4NF5 B;  1B4H A;  2F35 A;  5K2X A;  3SER A;  4NF6 B;  5A5X A;  5JEI A;  2I0B A;  1F9B A;  4YKK A;  3LSL A;  4U23 A;  1CE2 A;  4GLI A;  2P1S A;  3S9N C;  5I59 A;  1LFH A;  5CBS A;  4HCY A;  3U1O A;  5FHO A;  3FV1 A;  4OHN A;  3A09 A;  1QKA A;  3HST A;  1LBC A;  3QK6 A;  3OEN A;  4DZ1 A;  4ELP A;  1PEB A;  5A5X B;  1Q35 A;  1TXF A;  3SEU A;  3MZB A;  4PFW A;  1USY E;  3I6V A;  5I59 B;  2BJJ X;  5ITO A;  3H4Z A;  2E1S A;  4FED A;  4GWO A;  2FNC A;  5I2K A;  1GV8 A;  4PQJ A;  2I58 A;  1ZJL A;  3TQL A;  4GRK A;  4AQ4 A;  4KR5 A;  5IAI A;  5DVJ A;  2I0C A;  3FZV A;  3I3V A;  3DP6 A;  3C33 A;  1IZ1 A;  3ODB A;  1NL5 A;  1VFD A;  3KG2 A;  1OIB A;  1R1N A;  3VVF A;  1IIW A;  2ZNU A;  3B6T A;  4H1X A;  5I2K B;  1P1U A;  2X26 A;  4RK2 A;  4UA8 A;  3MWB A;  3K2D A;  4R6Y A;  1NMU A;  5AE4 A;  1MQG A;  4DE8 A;  1TT1 A;  4R9F A;  3RUM A;  1NH7 A;  3WAF A;  2QL3 A;  2Y84 A;  3TEP A;  3TTM A;  3RNN A;  5JK4 A;  2F7A A;  1ZLQ A;  3IOW A;  1JW1 A;  1I6B A;  2NUV A;  3Q29 A;  4LZ7 A;  3VXC A;  1MY0 A;  4IGT A;  4GOT A;  4MH5 A;  1R9L A;  4IB2 A;  2CMO A;  4X48 A;  3VFJ A;  4R9G A;  4TLM B;  4HCW A;  3QXM A;  3G3G A;  1VE4 A;  5H8Q A;  4ELR A;  1JVY A;  2DXR A;  2XD2 A;  1OLC A;  1ZKB A;  3S9E A;  1ZBM A;  4POX A;  1KWH A;  1Z7N E;  1H76 A;  3IX1 A;  4JBZ A;  4F2Q A;  4LZ8 A;  4KYE A;  3E4R A;  1EU8 A;  5H8Q B;  1T0K A;  3TCH A;  2KLF A;  1FQC A;  2R9J A;  2Q89 A;  4I8C A;  1MY3 A;  5J1D A;  2D21 A;  4N6P A;  1JVX A;  3KOS A;  3JYR A;  2AIX A;  4YB6 A;  2DWA A;  5AA3 A;  3IOV A;  1MQJ A;  1YPN A;  1DPE A;  4R74 A;  3PD9 A;  4P0G A;  1JQF A;  4F3S A;  1DSN A;  4DDD A;  3K6V A;  2VOZ A;  3JZJ A;  4YMB A;  4KHZ E;  4ZE8 A;  1BIY A;  1FTJ A;  1RYO A;  5H8H A;  2RC9 A;  1YTV A;  2QJE A;  1A8E A;  4P11 A;  3HHG A;  4ZS9 A;  3FJM A;  3S9L C;  1MXW A;  1LAH E;  3IJX B;  1NH8 A;  4Q0C A;  3KBR A;  2OK2 A;  3IB0 A;  3K0V A;  2F97 A;  3EPE A;  3V89 B;  2GFE A;  4BDM A;  3K4U A;  1N76 A;  4WEP A;  5H8H B;  2XX9 A;  4BLA A;  2F8D A;  5KZT A;  1M5C A;  3PUZ E;  2QS4 A;  4H5F A;  4QHQ A;  4ELO A;  4JSO A;  3K02 A;  2XXP A;  2ZXT A;  4JWO A;  3MQ9 A;  2XXT A;  4R2F A;  4FOR A;  1L5T A;  1SW5 A;  3TDJ A;  2DS9 A;  3G7W A;  3G3J A;  2GHA A;  2Y7I A;  4I62 A;  4ISU A;  1N7W A;  1NNP A;  3OO6 A;  1NFT A;  3CRB A;  4KCD A;  4HTG A;  4MBP A;  2QMX A;  1B3F A;  4IO3 A;  3UIF A;  4F19 A;  4OEU A;  1QUK A;  4EXK A;  5EHS A;  1MXV A;  4POW A;  4QFO A;  1OVB A;  1B3E A;  3OMB A;  1OQG A;  2A5T A;  4DXB A;  3GXA A;  3MBP A;  2XHD A;  4PFT A;  4NED A;  1MM7 A;  4H8I A;  4U21 A;  4Q30 B;  1SYI A;  2OLB A;  3CG3 A;  1N3X A;  3L6G A;  3Q27 A;  3OXN A;  1URG A;  4KI0 E;  1Z7M E;  2Y7K A;  3TCG A;  4PP0 A;  1QKB A;  3LSF B;  3RT8 A;  5JTY A;  1ZMG A;  4U4S A;  1P1N A;  1ATG A;  1LAF E;  4IGR A;  2A5T B;  1D3K A;  4NMY A;  3FGS A;  1OLA A;  3ILU B;  2V3T A;  3C9H A;  4JSD A;  2ALU A;  3B6W A;  4F29 A;  3KEI A;  4H5G A;  2H99 A;  1IQ7 A;  3MPK A;  4ZE9 A;  4GXS B;  4EQ9 A;  4GF8 A;  2XD3 A;  2DXY A;  5JTY B;  3PPO A;  4GVO A;  1P1O A;  3PUY E;  4GL0 A;  2ZYN A;  3MC2 A;  2O51 A;  2YJP A;  1N04 A;  5H8N A;  3E3K A;  2F6G A;  4RYA A;  4HW8 A;  3Q26 A;  3U92 A;  3C35 A;  2O1M A;  1FW0 A;  5BUU A;  5TP9 A;  3MPL A;  1GTK A;  3FD3 A;  2Y7P A;  2CZL A;  3O6H A;  2UXA A;  3PPP A;  4DXC A;  4R2B A;  4LQ5 A;  2RC8 A;  4F3G A;  1LCT A;  1LGB C;  5CMC A;  5H8N B;  1N84 A;  2D3I A;  3VVD A;  4RXL A;  1IUD A;  3OO9 A;  2QMW A;  2R71 A;  5I58 A;  1MQI A;  3CR9 A;  5DVF A;  5TP9 B;  2O7I A;  3SEY A;  3TTL A;  4GIZ A;  2H5Y A;  1MY1 A;  1B1H A;  3MVY A;  4OVJ A;  1GR2 A;  2ONK E;  3T9H B;  3FIR A;  3SKP A;  4G8N A;  2VHA A;  4ESX A;  3ZS6 A;  1JW5 A;  3LUY A;  1XS5 A;  2H98 A;  3H6U A;  2HEU A;  1B3L A;  1VR5 A;  3O6G A;  3C36 A;  1B7H A;  4DLD A;  1FQA A;  5I58 B;  2XXX A;  1N3W A;  2DWJ A;  3VLW A;  2ONR A;  4L17 A;  3OSQ A;  5K2Y A;  1AMF A;  2DE4 A;  1B51 A;  3QUF A;  4TQU Q;  2QSX A;  1MPD A;  2QS3 A;  3SES A;  3A3U A;  3K6U A;  3C32 A;  4P0I A;  3IK6 B;  3PMV A;  3KN3 A;  3TZA A;  4BDL A;  4H65 A;  2O84 X;  3W15 C;  1SI1 A;  5TU0 A;  2D5W A;  1US4 A;  3FUZ A;  2HZL A;  2HCA A;  1XOC A;  1MH4 A;  2OWS A;  4OEN A;  2DVC A;  2GRV A;  4NTL A;  4H67 A;  4QFN A;  1MM6 A;  2DP8 A;  4NWC A;  3O97 A;  2Z22 A;  2O69 A;  3LSW A;  4PFU A;  1B5J A;  5AA2 A;  5ICT A;  4IY5 A;  1SDX A;  5TPA A;  4GQO A;  3KSX A;  2YPN A;  1LFI A;  1B9J A;  1BP5 A;  5ISU A;  1JW4 A;  1H44 A;  4YMA A;  3K1P A;  3THI A;  3TPA A;  4KQP A;  3N5L A;  3RGY A;  2B3B A;  3BFT A;  3TFL A;  4OET A;  2THI A;  1XC1 A;  4F1Y A;  2Z23 A;  2PT1 A;  3EHT A;  2I3W A;  1B7U A;  4IO2 A;  3H06 B;  4LQ2 A;  1A40 A;  1PB8 A;  1B2H A;  5AA2 B;  1NNT A;  5TPA B;  4QSC A;  4X1B A;  3KJ7 A;  4H0W A;  2PBW A;  2RC7 A;  3G3H A;  2M8C A;  1TFD A;  4WXJ A;  4ZEB A;  5CMK A;  2XXR A;  1PDA A;  4ZEF A;  4DXU A;  4K3F A;  4ZDM A;  1QW0 A;  5EHM A;  4NE4 A;  4QFK A;  4EQ7 A;  4PET A;  3FXQ A;  1URS A;  4MF3 A;  4XKQ A;  3V5A A;  3KJT A;  3EQ1 A;  2F7C A;  3N26 A;  4BDR A;  2F36 A;  2GH9 A;  3PMX A;  3FJ7 A;  1SVX B;  3RPW A;  1EZO A;  2PVU A;  1LB8 A;  3QAX A;  3MP1 A;  2Z8F A;  4DCY A;  1MDP 1;  5IKB A;  3IL1 B;  1SW1 A;  4JB7 A;  1IIT A;  1M5B A;  4R75 A;  2DE3 A;  1B3H A;  2ZNS A;  3T9X B;  1JNF A;  1PC3 A;  1MY4 A;  3IB2 A;  4YU0 A;  1Y1M A;  2F7B A;  3IOR A;  1AL3 A;  1LBB A;  1B40 A;  1B6H A;  4Z7E A;  4YKJ A;  1B4Z A;  3B6Q A;  5F1Q A;  2I3V A;  3W9V A;  1MS7 A;  1JEV A;  4Q8R A;  5FTH A;  3PD8 A;  1A7L A;  3K6X A;  3CSG A;  5EYF A;  2RIN A;  3H6V A;  3TTN A;  4JXI A;  3FVG A;  5DT6 A;  4YKI A;  2VP1 A;  3K01 A;  2OCU A;  3VVE A;  1O63 A;  1B05 A;  3ZSF A;  1WDN A;  5LOM A;  2NXO A;  4G77 A;  3LC8 A;  5KCJ A;  2O1L A;  1TFA A;  1MXZ A;  3MP8 A;  4IO6 A;  1URD A;  1HSE A;  1Y4C A;  1FQB A;  4KCC A;  1N0T A;  2DQV A;  4E0X A;  2WKY A;  3Q28 A;  1QUJ A;  1B46 A;  1DTZ A;  3KOT A;  3UOR A;  2NOO A;  3C31 A;  2Q2A A;  3MVZ A;  1IXC A;  1B58 A;  4O3A A;  2VD2 A;  1USY H;  4AB6 A;  4M4G A;  1P1W A;  3OD7 A;  3G3K A;  4YAH X;  2V3Q A;  1PB7 A;  5ICQ A;  1H45 A;  4G68 A;  3FVK A;  3W9W A;  5KCJ B;  1XVY A;  4X9T A;  3BBR A;  3U72 A;  1IEJ A;  4F31 B;  1B52 A;  3LSX A;  3K00 A;  1POY 1;  4OEV A;  3MZ1 A;  1SD3 A;  5HBC A;  3VLV A;  4TOZ A;  2RF1 A;  5L9O A;  4X1D A;  1FQE A;  2ZYK A;  2A5S A;  2I49 A;  3EF7 A;  3IO4 A;  2UVI A;  3C4M A;  3N6T A;  3PMW A;  1FCK A;  4OTE A;  4G68 B;  3SEX A;  3OEK A;  3K1M A;  3L6H A;  4R73 A;  2DYX A;  3TQW A;  2UVG A;  3MP6 A;  1XHY A;  3O28 A;  3CIJ A;  3CFZ A;  3FVO A;  4XTC Q;  5CC2 A;  3OSR A;  2AL4 A;  5CMM A;  1WVJ A;  2OZZ A;  3IJO B;  3T22 A;  3D4G A;  5AA2 D;  1MXY A;  2XXV A;  4U4X A;  4RPN A;  5FHN A;  1LAG E;  4FE8 A;  2HAV A;  2Q9T A;  4EF2 A;  3FAS A;  1CB6 A;  1MH3 A;  5ELV A;  1SQY A;  4BDO A;  1MXX A;  1AOV A;  4TLL B;  4DCX A;  1MG1 A;  4EF1 A;  1POT A;  2XXY A;  3PUV E;  3OOA A;  4OER A;  3LR1 A;  3RT6 B;  2Q88 A;  3VV5 A;  2G93 A;  3FAT A;  3USD A;  3VE1 B;  2I4B A;  1VFE A;  1S9T A;  2PMS A;  5DYH A;  1ZU0 A;  1B0H A;  1R9Q A;  2ZYM A;  3PUX E;  4U22 A;  4NWD A;  3RTW B;  4FEB A;  3OO7 A;  2PX1 A;  2REG A;  5AA1 A;  4OES A;  1OQH A;  3O6I A;  2HXW A;  2O6A A;  5I84 A;  4LVQ A;  2P2A A;  2XXQ A;  4BDN A;  4ONY A;  1YCJ A;  4OFO A;  4Z0I A;  3QSL A;  1DPP A;  1OVT A;  3MZ9 A;  3N6U A;  1R6Z A;  2QS1 A;  2YLN A;  1I6A A;  3MUQ A;  1S50 A;  1Y3Q A;  2DWI A;  4IY6 A;  1PB9 A;  4EDP A;  1UTB A;  3O2A A;  2IA4 A;  3EN3 A;  1EZ9 A;  2R6G E;  2DOJ A;  1IXG A;  3KN8 A;  3CSB A;  4OFJ A;  5CM6 A;  2AL5 A;  2V25 A;  1B3G A;  2OWT A;  3H6T A;  1D9Y A;  2XX8 A;  1A99 A;  4BDQ A;  2Y7R A;  2F34 A;  2F5X A;  4EQB A;  4HS7 A;  2H4I A;  3Q25 A;  3H3G A;  3HHF A;  2V93 A; 
#chains in the Genus database with same CATH topology
 4KPT A;  4G8H A;  1ZTY A;  4JDF A;  4C1U A;  4U1O A;  1IXH A;  4MIJ A;  1LFG A;  5H8S A;  1UTB B;  1MXU A;  3R6U A;  4FIM A;  3A3C A;  1Q1K A;  1B1X A;  1FTM A;  3GLB A;  3VLU A;  2ZYO A;  1OMP A;  2UYE A;  2O7U A;  4WKM A;  4F1U A;  4OVR A;  4ESW A;  1LST A;  3RTF B;  3I5O A;  1BKA A;  3C34 A;  3MAM A;  3TTK A;  2P0S A;  1LB9 A;  2XXU A;  3E9X A;  4KD5 A;  4XKN A;  5HPQ A;  1MQH A;  4RA1 A;  4GD5 A;  4F18 A;  3HCQ A;  1AIV A;  2QPQ A;  3E79 A;  1QUI A;  3FJG A;  4KYS A;  4NF4 A;  1M5E A;  4IO7 A;  4ND9 A;  3B50 A;  4GXA A;  3UK4 A;  2W7Y A;  4H8J A;  2XX7 A;  4MFI A;  2DWH A;  4FAT A;  1MQD A;  1I69 A;  1NUZ A;  2H9B A;  4RJZ A;  3WAE A;  1US5 A;  4GL8 A;  3IOU A;  4YIC A;  4F39 A;  1Y4T A;  3T9V A;  4M1V A;  4OMB A;  1KA1 A;  5CMB A;  3R7X A;  5KDT A;  1A8F A;  3VXB A;  4KFQ A;  3D4C A;  4MNC A;  1H43 A;  1XT8 A;  4NX1 A;  2KQZ A;  3UP9 A;  4NF4 B;  1LCF A;  1JEU A;  3SZP A;  1QJM A;  2RKM A;  3DM0 A;  3B7D A;  4LUB A;  2ZMB A;  4RNS A;  4GBV A;  4C0R A;  1A55 A;  4GWX A;  3H03 A;  4F3P A;  1BK4 A;  1RYX A;  5B7D A;  1DOT A;  4O8M A;  4PTK A;  4N91 A;  4RK9 A;  3PPQ A;  2O68 A;  3AXF A;  3ONM A;  5KDT B;  1NUW A;  1DMB A;  3K6W A;  3PPR A;  5EQ8 A;  2G29 A;  5T3J A;  3QUJ A;  1B5H A;  1P1Q A;  1IMD A;  3BFU A;  4NGU A;  3F11 A;  4XKP A;  3CI8 A;  3ECR A;  4OVT A;  2Q2C A;  4I9D A;  4GWZ A;  3MVX A;  3PPN A;  3O9P A;  4PAI A;  2PCR A;  1EYI A;  1D4N A;  2Z8E A;  1FTL A;  3KFM A;  1Y20 A;  1O64 A;  3T96 B;  4OXV A;  4N17 A;  2P3V A;  2CZK A;  4NAP A;  2Y7W A;  3ILT B;  5B70 A;  3SDF A;  2I48 A;  2MKZ A;  3K1N A;  4H6D A;  3T93 B;  4PAK A;  3TCF A;  1JET A;  2XXH A;  4MJO A;  1UIV A;  2X7P A;  3HFU A;  1PBP A;  2ABH A;  2Z8D A;  1I6Q A;  1UQW A;  5I56 A;  4N6K A;  4G4P A;  3HPI A;  2JJK A;  4I3E A;  4O94 A;  3ISP A;  4LA9 A;  1HSL A;  2H25 A;  3TOD A;  3ZKK A;  1Y3P A;  4MLQ A;  4FAJ A;  4R6H A;  1S7Y A;  4MAG A;  2DE2 A;  1O7T A;  1IMA A;  4PFY A;  4ZZA A;  2PT2 A;  3RQT A;  2HAU A;  2V3U A;  3DLN A;  4LP2 B;  4U1Z A;  3BIH A;  4OFL A;  4PF8 A;  1GGG A;  5DEX A;  4OYV A;  1EZP A;  3CVG A;  4ZEK A;  5DW8 A;  4MNP A;  3JV9 A;  1B32 A;  5I56 B;  1M5D A;  4UAC A;  2AYS A;  1PBQ A;  4F3B A;  1BTJ A;  1N7X A;  1UIU A;  4HE2 A;  3CG1 A;  3PV0 E;  3SEW A;  1WOD A;  3UN6 A;  1HSJ A;  1NNF A;  3O66 A;  3IR1 A;  4GFR A;  3FXR A;  1XVX A;  3SEV A;  1FBE A;  1QVS A;  1B7Z A;  1BLF A;  1ELJ A;  5DEX B;  1K9Y A;  3MJN A;  3PGF A;  4MLV A;  1IXI A;  5M2V A;  3M3L A;  3TKD A;  4OZ9 A;  1LBV A;  1H3D A;  3KN7 A;  3GBA A;  5ITP A;  3S4U A;  2ANJ A;  3FVN A;  2B3F A;  3PTY A;  4F2O A;  4EXL A;  1LAX A;  1NV5 A;  1FQD A;  5I57 A;  4N13 A;  3RY3 A;  4PFR A;  3O29 A;  3DEL B;  3U93 A;  2IEE A;  5AA4 A;  4WED A;  4QF9 A;  4QFP A;  1Y9U A;  5EYH A;  1FTO A;  3TEL A;  2ESN A;  3EHU A;  5ET7 A;  3QIM A;  2FYI A;  4XIG Q;  2HQ0 A;  2OBG A;  3M8U A;  2UVH A;  4IO5 A;  3CFL A;  5FTI A;  2ONS A;  2ZNT A;  3H7M A;  3TMG A;  3RN8 A;  3TAJ A;  3KC0 A;  3GZG A;  5I57 B;  1LLS A;  1EH3 A;  3MW0 A;  2GHB A;  1RKM A;  5H8F A;  5FHM A;  5AA4 B;  3BIG A;  3MVW A;  2XXI A;  3D1R A;  1MRP A;  1UTH A;  4F22 A;  4OQO A;  2DSF A;  1Y1Z A;  2ZZX A;  2XXW A;  1QUL A;  2QVV A;  4OWD A;  3IAZ A;  3TYH A;  2NVU B;  5CI5 A;  3T9U A;  4JVI A;  4MEV A;  4YB7 A;  3IB1 A;  1NKX A;  4EUO A;  3EHS A;  3IO6 A;  2QRY A;  4P8B A;  4JWX A;  5H8F B;  1AH5 A;  4G68 C;  4RY1 A;  3V8X B;  3G3F A;  3N94 A;  2UYF A;  2Q8J A;  4ZED A;  5L9S A;  3S2V A;  3OEM A;  2REJ A;  5BWJ A;  1UTH B;  3VDF A;  3M3F A;  5L8D A;  2F6P A;  5HM4 B;  3E13 X;  4R72 A;  1J1N A;  3DP8 A;  4FEC A;  3S9M C;  3DP4 A;  4NF8 A;  1NV3 A;  4I1D A;  1SPI A;  2HZK A;  2OJT A;  4JWY A;  3KZG A;  4AB5 A;  4C1T A;  2UVJ A;  5IZ1 A;  4ECF A;  4QSD A;  2XWV A;  3R26 A;  4PE5 B;  4G2Z A;  1MY2 A;  5F7V A;  1SW2 A;  2FHY A;  4YKP A;  2VGQ A;  4YB5 A;  2LAO A;  4PGP A;  3T66 A;  3NOH A;  3U94 A;  1VSO A;  1TWY A;  3QYT A;  3V83 A;  4NF8 B;  3BKI B;  3ROJ A;  3UA8 A;  1DTG A;  2FIX A;  4LZ5 A;  1Y3N A;  2R8T A;  5CBR A;  3GBB A;  4XKR A;  4R6K A;  4I40 A;  4XXU A;  2NWJ A;  4O3C A;  4ZZE A;  4Q5T A;  2CEX A;  4KYD A;  3ZKL A;  4GX4 A;  4E0W A;  3OO8 A;  3CFX A;  1DK4 A;  1MPC A;  3HO7 A;  2X7Q A;  2I6E A;  4ZEC A;  2QS2 A;  2B65 A;  4FJP A;  4ELQ A;  2XWI A;  4QSE A;  4QFL A;  3UGW A;  4THI A;  3OEL A;  2HFB A;  1SI0 A;  4O3B A;  3TTR A;  3U8Q A;  2XWO A;  1MPB A;  1ANF A;  1A54 A;  1II5 A;  4N07 A;  2DVZ A;  3SET A;  1FQF A;  3TUS A;  2CZI A;  5DVI A;  1M5F A;  2V84 A;  3G3I A;  2RCA A;  1B5I A;  1P99 A;  1SW4 A;  1B0L A;  3HV1 A;  4DIG A;  4QRZ A;  1D9V A;  4KXP A;  3P7I A;  5DTB A;  4RPO A;  5L9M A;  1FPE A;  5ET8 A;  4YZZ A;  3KSJ A;  3FXU A;  5I2N A;  2I4C A;  1MDQ A;  4U2R A;  3FV2 A;  3PU5 A;  4LON B;  4NF5 A;  5ET6 A;  1FTK A;  3H6W A;  3LBS A;  2F78 A;  4ZEI A;  4F1V A;  4G8M A;  1LBX A;  3KGC A;  3IOT A;  4NF6 A;  2FIE A;  4IO4 A;  2PYY A;  2RCB A;  1ZIU A;  1GVC A;  1YAE A;  5CRY A;  1SBP A;  3PUW E;  2VD3 A;  2E0S A;  3M3K A;  5I2N B;  1NNK A;  2FA7 A;  4LAT A;  3HN0 A;  3RLF E;  1SYH A;  4NF5 B;  1B4H A;  2F35 A;  5K2X A;  1RDY A;  3SER A;  4NF6 B;  5A5X A;  5JEI A;  1NV7 A;  2I0B A;  5ESY A;  2VPN A;  1F9B A;  4YKK A;  3LSL A;  4U23 A;  2VT5 A;  1CE2 A;  4GLI A;  2P1S A;  3S9N C;  5I59 A;  3B8B A;  1LFH A;  5CBS A;  2Q8M A;  4HCY A;  3U1O A;  4AS4 A;  5FHO A;  4N8G A;  3FV1 A;  4OHN A;  1LBY A;  3A09 A;  1QKA A;  3HST A;  1LBC A;  5ET5 A;  4H46 A;  3QK6 A;  3OEN A;  4DZ1 A;  1KZ8 A;  4ELP A;  1PEB A;  5A5X B;  4JVD A;  1Q35 A;  1TXF A;  3SEU A;  3MZB A;  4PFW A;  1USY E;  3I6V A;  5I59 B;  4NN3 A;  2BJJ X;  5ITO A;  3H4Z A;  1JP4 A;  2E1S A;  4FED A;  4GWO A;  4GWS A;  2FNC A;  5I2K A;  1GV8 A;  4PQJ A;  2I58 A;  1ZJL A;  3TQL A;  4GRK A;  4AQ4 A;  1NI9 A;  4KR5 A;  5IAI A;  2Y5L A;  5DVJ A;  2I0C A;  3FZV A;  3I3V A;  3DP6 A;  3C33 A;  1IZ1 A;  3ODB A;  1NL5 A;  1VFD A;  3KG2 A;  1OIB A;  1R1N A;  3VVF A;  4PDH A;  1IIW A;  2ZNU A;  3B6T A;  4H1X A;  5I2K B;  1P1U A;  2X26 A;  4RK2 A;  4UA8 A;  3MWB A;  3K2D A;  4R6Y A;  1NMU A;  5AE4 A;  1MQG A;  4DE8 A;  1TT1 A;  4R9F A;  3RUM A;  1NH7 A;  3WAF A;  2QL3 A;  2Y84 A;  4XF5 A;  4PCD A;  3TEP A;  3TTM A;  3RNN A;  1YZ0 A;  1NV1 A;  5JK4 A;  2F7A A;  1ZLQ A;  2OWZ A;  3IOW A;  4NHB A;  4G61 A;  1JW1 A;  1I6B A;  2NUV A;  5LDZ A;  3Q29 A;  2Q74 A;  4LZ7 A;  3VXC A;  1MY0 A;  2XXK A;  4IGT A;  4GOT A;  2B4M A;  4MH5 A;  1R9L A;  4IB2 A;  3IFA A;  3FXB A;  2CMO A;  4X48 A;  3VFJ A;  4R9G A;  4TLM B;  4HCW A;  3QXM A;  3G3G A;  1VE4 A;  5H8Q A;  4ELR A;  5IZ3 A;  1JVY A;  4GX6 A;  2DXR A;  2XD2 A;  1EYK A;  1OLC A;  1ZKB A;  3S9E A;  1ZBM A;  4POX A;  1KWH A;  1Z7N E;  1NV2 A;  5IM2 A;  1FJ9 A;  1H76 A;  3IX1 A;  4JBZ A;  4F2Q A;  4LZ8 A;  1DBZ A;  5I3S A;  4KYE A;  3E4R A;  1EU8 A;  2GQ1 A;  5H8Q B;  1T0K A;  3TCH A;  2KLF A;  1FQC A;  4PFI A;  5IZ3 B;  2R9J A;  1FPI A;  2Q89 A;  4I8C A;  1MY3 A;  5J1D A;  2D21 A;  4N6P A;  1JVX A;  2OX3 A;  3KOS A;  3JYR A;  3E78 A;  2AIX A;  4YB6 A;  2DWA A;  4OAN A;  5AA3 A;  2ZZW A;  4PDD A;  3IOV A;  1MQJ A;  1YPN A;  1DPE A;  4R74 A;  3PD9 A;  4P0G A;  4AS5 A;  1JQF A;  4F3S A;  1CNQ A;  1DSN A;  4DDD A;  3K6V A;  1FPJ A;  2VOZ A;  3JZJ A;  4YMB A;  1IMC A;  4KHZ E;  4ZE8 A;  1BIY A;  1FTJ A;  1RYO A;  5H8H A;  2RC9 A;  1YTV A;  4GWW A;  2QJE A;  1A8E A;  3RYD A;  4P11 A;  1RDX A;  1NV0 A;  3HHG A;  4ZS9 A;  3FJM A;  3S9L C;  1MXW A;  1LAH E;  3IJX B;  1NH8 A;  4Q0C A;  3KBR A;  2OK2 A;  3IB0 A;  3K0V A;  3RPL A;  1IME A;  2F97 A;  3EPE A;  3V89 B;  4N8Y A;  2GFE A;  4BDM A;  3K4U A;  1N76 A;  4WEP A;  5H8H B;  2XX9 A;  4BLA A;  2F8D A;  5KZT A;  1M5C A;  3PUZ E;  3FBP A;  2QS4 A;  4H5F A;  4QHQ A;  4ELO A;  4JSO A;  3EKI A;  3K02 A;  2XXP A;  4NQ8 A;  2ZXT A;  4JWO A;  3MQ9 A;  2XWK A;  3LUZ A;  2XXT A;  4R2F A;  4FOR A;  1L5T A;  1SW5 A;  3TDJ A;  2DS9 A;  3RPL B;  1FSA A;  3G7W A;  2FBP A;  3G3J A;  2GHA A;  2Y7I A;  4I62 A;  2XA5 A;  4ISU A;  1N7W A;  1NNP A;  4MCO A;  1K9Z A;  3OO6 A;  1NFT A;  3CRB A;  4KCD A;  4HTG A;  2HPG A;  4MBP A;  2QMX A;  1B3F A;  4IO3 A;  3UIF A;  4F19 A;  4OEU A;  1QUK A;  4EXK A;  5EHS A;  1MXV A;  4POW A;  4QFO A;  1OVB A;  1B3E A;  3OMB A;  1OQG A;  2A5T A;  4DXB A;  3GXA A;  3MBP A;  2XHD A;  4PFT A;  4O7I A;  4NED A;  1EYJ A;  1MM7 A;  4P3L A;  2PFZ A;  4H8I A;  5A5L A;  4U21 A;  4Q30 B;  4PE3 A;  1SYI A;  2OLB A;  3CG3 A;  1N3X A;  3L6G A;  2L5V A;  3Q27 A;  3OXN A;  1URG A;  2ZZV A;  4KI0 E;  1Z7M E;  2Y7K A;  3TCG A;  4PP0 A;  1QKB A;  3LSF B;  3RT8 A;  4HE1 A;  5JTY A;  1ZMG A;  4U4S A;  1P1N A;  1ATG A;  1LAF E;  4IGR A;  2A5T B;  1FPL A;  1D3K A;  4NMY A;  3FGS A;  1OLA A;  3ILU B;  2V3T A;  4N6D A;  3C9H A;  4JSD A;  2ALU A;  3B6W A;  4F29 A;  3KEI A;  4H5G A;  2H99 A;  1IMB A;  1IQ7 A;  4N81 A;  4NF0 A;  3MPK A;  4ZE9 A;  4GXS B;  4HXV A;  4EQ9 A;  4GF8 A;  2XD3 A;  2DXY A;  5JTY B;  5I7I A;  3PPO A;  4GVO A;  1P1O A;  3PUY E;  4GL0 A;  2ZYN A;  1NV6 A;  3MC2 A;  2F3B A;  2O51 A;  2YJP A;  1FRP A;  5IGA A;  1N04 A;  5H8N A;  3E3K A;  1AWB A;  2F6G A;  4RYA A;  4HW8 A;  3Q26 A;  3U92 A;  3C35 A;  2O1M A;  1FW0 A;  5TP9 A;  5BUU A;  3MPL A;  1GTK A;  3FD3 A;  2Y7P A;  2CZL A;  3O6H A;  2UXA A;  4X8R A;  2CZH A;  3PPP A;  4DXC A;  4R2B A;  4LQ5 A;  2WEF A;  2RC8 A;  4F3G A;  3GYY A;  4PBQ A;  1LCT A;  1LGB C;  4P1L A;  5CMC A;  5H8N B;  1N84 A;  2D3I A;  3VVD A;  1FBC A;  4RXL A;  1LBZ A;  1IUD A;  1NV4 A;  4GWY A;  3OO9 A;  2Y5K A;  2WYK A;  2QMW A;  2R71 A;  5I58 A;  1MQI A;  3CR9 A;  5DVF A;  4I3Y A;  5TP9 B;  2O7I A;  3SEY A;  3TTL A;  1NUY A;  1FPF A;  4GIZ A;  2H5Y A;  1MY1 A;  3T0J A;  3T1B A;  1B1H A;  3MVY A;  4OVJ A;  1GR2 A;  2ONK E;  3T9H B;  1INP A;  3FIR A;  3SKP A;  4G8N A;  2VHA A;  1FBD A;  4ESX A;  3ZS6 A;  1JW5 A;  1VDW A;  3LUY A;  1XS5 A;  2H98 A;  4MHF A;  3H6U A;  2HEU A;  1B3L A;  1VR5 A;  1RDZ A;  3O6G A;  3C36 A;  1B7H A;  4DLD A;  2CEY A;  1FQA A;  5I58 B;  2P3N A;  2XXX A;  1N3W A;  2DWJ A;  3VLW A;  2ONR A;  4L17 A;  3OSQ A;  1FPD A;  5K2Y A;  1AMF A;  1KA0 A;  2DE4 A;  1B51 A;  3QUF A;  4TQU Q;  2QSX A;  4QBA A;  1MPD A;  2QS3 A;  3SES A;  3A3U A;  3K6U A;  3C32 A;  4P0I A;  3IK6 B;  3PMV A;  3KN3 A;  1FBP A;  3TZA A;  4BDL A;  4H65 A;  2O84 X;  3W15 C;  1SI1 A;  5TU0 A;  2D5W A;  5EQ7 A;  1US4 A;  3FUZ A;  2HZL A;  4OVS A;  2HCA A;  1XOC A;  1MH4 A;  2OWS A;  4OEN A;  4P1E A;  2DVC A;  2GRV A;  5EYG A;  4NTL A;  3KC1 A;  4H67 A;  4QFN A;  1FPB A;  1MM6 A;  3IFC A;  4HE0 A;  2DP8 A;  4NWC A;  2B4L A;  3O97 A;  2Z22 A;  2O69 A;  3LSW A;  2WX9 A;  4PFU A;  2VPO A;  1B5J A;  4DI4 B;  5AA2 A;  5ICT A;  4IY5 A;  1SDX A;  3KBZ A;  5TPA A;  4GQO A;  3KSX A;  2YPN A;  4GBW A;  1LFI A;  1B9J A;  1BP5 A;  5ISU A;  1JW4 A;  1H44 A;  5I5P A;  4YMA A;  3K1P A;  3THI A;  3TPA A;  4KQP A;  4PGN A;  3N5L A;  3RGY A;  2B3B A;  3BFT A;  3TFL A;  4OET A;  2THI A;  1XC1 A;  3MST A;  4F1Y A;  2Z23 A;  2PT1 A;  3EHT A;  4H45 A;  2I3W A;  1B7U A;  4IO2 A;  3H06 B;  4LQ2 A;  1A40 A;  1PB8 A;  1B2H A;  5AA2 B;  1FTA A;  1NNT A;  5TPA B;  4QSC A;  4MMP A;  4N15 A;  4X1B A;  3KJ7 A;  5EQA A;  4H0W A;  2PBW A;  2RC7 A;  5F24 A;  3G3H A;  2M8C A;  1TFD A;  4WXJ A;  4ZEB A;  4DI3 D;  5CMK A;  2XXR A;  1PDA A;  4ZEF A;  4DXU A;  4K3F A;  1G0I A;  4ZDM A;  1QW0 A;  2V4C A;  5EHM A;  4NE4 A;  4QFK A;  4EQ7 A;  4PET A;  3FXQ A;  1URS A;  4UAB A;  4MF3 A;  2WBD A;  4XKQ A;  3V5A A;  3KJT A;  3EQ1 A;  2F7C A;  1QGX A;  3N26 A;  4BDR A;  2F36 A;  2GH9 A;  3PMX A;  3FJ7 A;  2WYP A;  1LEV A;  1SVX B;  3RPW A;  1EZO A;  2PVU A;  1LB8 A;  3QAX A;  3MP1 A;  2Z8F A;  4DCY A;  2FVZ A;  1MDP 1;  5IKB A;  3IL1 B;  1SW1 A;  5EQ9 A;  4JB7 A;  1IIT A;  1M5B A;  4R75 A;  2DE3 A;  1B3H A;  2ZNS A;  3T9X B;  1JNF A;  1PC3 A;  1NUX A;  1MY4 A;  3IB2 A;  4MNI A;  4YU0 A;  1FJ6 A;  1Y1M A;  2F7B A;  1G0H A;  3IOR A;  1AL3 A;  1LBB A;  1B40 A;  2QVU A;  1YXI A;  1B6H A;  4Z7E A;  4YKJ A;  1B4Z A;  3CHG A;  3B6Q A;  5F1Q A;  2I3V A;  3W9V A;  1MS7 A;  1JEV A;  4Q8R A;  1XI6 A;  5FTH A;  3PD8 A;  1A7L A;  3K6X A;  1Q9D A;  3CSG A;  5EYF A;  2RIN A;  3H6V A;  3TTN A;  4JXI A;  3FVG A;  5DT6 A;  4YKI A;  2VP1 A;  3K01 A;  4GX3 A;  5J16 A;  2OCU A;  1DCU A;  3VVE A;  1O63 A;  1B05 A;  3ZSF A;  4P47 A;  4JVC A;  1WDN A;  5IZZ A;  5LOM A;  2QFL A;  2NXO A;  2WBB A;  4G77 A;  3LC8 A;  5KCJ A;  2O1L A;  2HHM A;  1TFA A;  1MXZ A;  1YYZ A;  3MP8 A;  4IO6 A;  1URD A;  1HSE A;  4XFE A;  1Y4C A;  1FQB A;  4OVP A;  2PFY A;  4KCC A;  1N0T A;  2DQV A;  4E0X A;  2WKY A;  3Q28 A;  1QUJ A;  1B46 A;  1DTZ A;  3KOT A;  3UOR A;  2NOO A;  3C31 A;  2Q2A A;  3MVZ A;  1IXC A;  1B58 A;  2KR0 A;  4O3A A;  2VD2 A;  1USY H;  4AB6 A;  4M4G A;  4PC9 A;  1P1W A;  3OD7 A;  3G3K A;  4YAH X;  2V3Q A;  1PB7 A;  5ICQ A;  1H45 A;  4G68 A;  3FVK A;  3W9W A;  5KCJ B;  1XVY A;  4X9T A;  4NG7 A;  1IMF A;  3BBR A;  3U72 A;  1IEJ A;  4F31 B;  1B52 A;  3LSX A;  3K00 A;  1POY 1;  4OEV A;  3MZ1 A;  1SD3 A;  5HBC A;  3VLV A;  4TOZ A;  2RF1 A;  2DDK A;  1FPG A;  5L9O A;  4X1D A;  1FQE A;  2ZYK A;  2A5S A;  2I49 A;  3A29 A;  3EF7 A;  4OVQ A;  4O7M A;  3IO4 A;  2UVI A;  3C4M A;  3N6T A;  3PMW A;  1FCK A;  4OTE A;  4G68 B;  3SEX A;  1FBF A;  3OEK A;  3K1M A;  3L6H A;  4R73 A;  2DYX A;  4GWU A;  3TQW A;  2UVG A;  3MP6 A;  1XHY A;  4MX6 A;  3O28 A;  3CIJ A;  3CFZ A;  3FVO A;  4XTC Q;  4FBP A;  5CC2 A;  3OSR A;  2AL4 A;  4P9K A;  5CMM A;  1D9Q A;  4OA4 A;  4PFB A;  1WVJ A;  3LV0 A;  2OZZ A;  3IJO B;  2F3D A;  3T22 A;  3D4G A;  1FBG A;  5AA2 D;  1MXY A;  2XXV A;  4U4X A;  5LTC A;  4RPN A;  5FHN A;  1LAG E;  4XEQ A;  4FE8 A;  2HAV A;  3QMF A;  2Q9T A;  4N4U A;  4PF6 A;  4EF2 A;  3FAS A;  1CB6 A;  1MH3 A;  5ELV A;  1SQY A;  4BDO A;  1MXX A;  1AOV A;  4TLL B;  4DCX A;  1MG1 A;  4EF1 A;  1POT A;  2XXY A;  3PUV E;  3OOA A;  4OER A;  3LR1 A;  3RT6 B;  4QXD A;  2Q88 A;  3VV5 A;  2G93 A;  3FAT A;  3USD A;  3VE1 B;  2I4B A;  1VFE A;  1S9T A;  2PMS A;  5DYH A;  1ZU0 A;  1B0H A;  4LN5 A;  1R9Q A;  2ZYM A;  3PUX E;  4U22 A;  4NWD A;  3RTW B;  4FEB A;  3OO7 A;  2PX1 A;  2REG A;  4IR8 A;  5AA1 A;  4OES A;  1FPK A;  1OQH A;  3O6I A;  3MYU A;  2HXW A;  2O6A A;  5I84 A;  4LVQ A;  2P2A A;  2XXQ A;  4BDN A;  4ONY A;  3U65 A;  1YCJ A;  4OFO A;  4Z0I A;  3QSL A;  1DPP A;  1OVT A;  2HXR A;  3MZ9 A;  2BJI A;  3N6U A;  1R6Z A;  2QS1 A;  2YLN A;  5FBP A;  1I6A A;  4P56 A;  3MUQ A;  1S50 A;  1Y3Q A;  2DWI A;  4IY6 A;  1PB9 A;  4EDP A;  1UTB A;  4PBH A;  3O2A A;  2IA4 A;  3EN3 A;  1EZ9 A;  4X04 A;  2R6G E;  2DOJ A;  1IXG A;  4PAF A;  3KN8 A;  3CSB A;  4OFJ A;  5CM6 A;  2AL5 A;  1LBW A;  2V25 A;  1B3G A;  2OWT A;  3H6T A;  1D9Y A;  1FBH A;  2XX8 A;  1A99 A;  4BDQ A;  2Y7R A;  2F34 A;  2F5X A;  4EQB A;  4HS7 A;  2QVR A;  2H4I A;  3Q25 A;  3H3G A;  3HHF A;  2V93 A; 
#chains in the Genus database with same CATH homology
 4KPT A;  4G8H A;  1ZTY A;  4JDF A;  4C1U A;  4U1O A;  1IXH A;  1LFG A;  5H8S A;  1UTB B;  1MXU A;  3R6U A;  4FIM A;  3A3C A;  1Q1K A;  1B1X A;  1FTM A;  3GLB A;  3VLU A;  2ZYO A;  1OMP A;  2UYE A;  2O7U A;  4WKM A;  4F1U A;  4ESW A;  1LST A;  3RTF B;  3I5O A;  1BKA A;  3C34 A;  3MAM A;  3TTK A;  2P0S A;  1LB9 A;  2XXU A;  3E9X A;  4KD5 A;  4XKN A;  5HPQ A;  1MQH A;  4RA1 A;  4GD5 A;  4F18 A;  3HCQ A;  1AIV A;  2QPQ A;  1QUI A;  3FJG A;  4KYS A;  4NF4 A;  1M5E A;  4IO7 A;  4ND9 A;  4GXA A;  3UK4 A;  2W7Y A;  4H8J A;  2XX7 A;  4MFI A;  2DWH A;  4FAT A;  1MQD A;  1I69 A;  2H9B A;  4RJZ A;  3WAE A;  1US5 A;  4GL8 A;  3IOU A;  4YIC A;  4F39 A;  1Y4T A;  3T9V A;  4M1V A;  4OMB A;  5CMB A;  3R7X A;  5KDT A;  1A8F A;  3VXB A;  4KFQ A;  3D4C A;  1H43 A;  1XT8 A;  3UP9 A;  4NF4 B;  1LCF A;  1JEU A;  1QJM A;  2RKM A;  3DM0 A;  3B7D A;  4LUB A;  2ZMB A;  4RNS A;  4C0R A;  1A55 A;  3H03 A;  4F3P A;  1RYX A;  5B7D A;  1DOT A;  4RK9 A;  3PPQ A;  2O68 A;  3AXF A;  3ONM A;  5KDT B;  1DMB A;  3K6W A;  3PPR A;  2G29 A;  3QUJ A;  1B5H A;  1P1Q A;  3BFU A;  3F11 A;  4XKP A;  3CI8 A;  3ECR A;  2Q2C A;  4I9D A;  3MVX A;  3PPN A;  3O9P A;  1D4N A;  2Z8E A;  1FTL A;  3KFM A;  1Y20 A;  1O64 A;  3T96 B;  4OXV A;  2Y7W A;  3ILT B;  5B70 A;  3SDF A;  2I48 A;  3K1N A;  4H6D A;  3T93 B;  3TCF A;  1JET A;  2XXH A;  1UIV A;  2X7P A;  1PBP A;  2ABH A;  2Z8D A;  1I6Q A;  1UQW A;  5I56 A;  4G4P A;  3HPI A;  4LA9 A;  1HSL A;  2H25 A;  3TOD A;  3ZKK A;  1Y3P A;  4MLQ A;  4FAJ A;  4R6H A;  1S7Y A;  2DE2 A;  1O7T A;  4PFY A;  4ZZA A;  2PT2 A;  3RQT A;  2HAU A;  2V3U A;  3DLN A;  4LP2 B;  4U1Z A;  4OFL A;  1GGG A;  5DEX A;  4OYV A;  1EZP A;  3CVG A;  4ZEK A;  3JV9 A;  1B32 A;  5I56 B;  1M5D A;  4UAC A;  2AYS A;  1PBQ A;  4F3B A;  1BTJ A;  1N7X A;  1UIU A;  3CG1 A;  3PV0 E;  3SEW A;  1WOD A;  3UN6 A;  1HSJ A;  1NNF A;  3O66 A;  3IR1 A;  4GFR A;  3FXR A;  1XVX A;  3SEV A;  1QVS A;  1B7Z A;  1BLF A;  1ELJ A;  5DEX B;  3MJN A;  3PGF A;  4MLV A;  1IXI A;  5M2V A;  3M3L A;  3TKD A;  4OZ9 A;  1H3D A;  3KN7 A;  3GBA A;  5ITP A;  3S4U A;  2ANJ A;  3FVN A;  2B3F A;  4F2O A;  4EXL A;  1LAX A;  1FQD A;  5I57 A;  4N13 A;  3RY3 A;  3O29 A;  3DEL B;  3U93 A;  2IEE A;  5AA4 A;  4WED A;  4QF9 A;  4QFP A;  1Y9U A;  1FTO A;  3TEL A;  2ESN A;  3EHU A;  3QIM A;  2FYI A;  4XIG Q;  2HQ0 A;  2OBG A;  3M8U A;  2UVH A;  4IO5 A;  3CFL A;  5FTI A;  2ONS A;  2ZNT A;  3H7M A;  3TMG A;  3RN8 A;  3TAJ A;  3GZG A;  5I57 B;  1LLS A;  1EH3 A;  3MW0 A;  2GHB A;  1RKM A;  5H8F A;  5FHM A;  5AA4 B;  3MVW A;  2XXI A;  1MRP A;  1UTH A;  4F22 A;  4OQO A;  2DSF A;  1Y1Z A;  2XXW A;  1QUL A;  4OWD A;  3IAZ A;  3TYH A;  2NVU B;  5CI5 A;  3T9U A;  4YB7 A;  3IB1 A;  1NKX A;  4EUO A;  3EHS A;  3IO6 A;  2QRY A;  4JWX A;  5H8F B;  1AH5 A;  4G68 C;  4RY1 A;  3V8X B;  3G3F A;  3N94 A;  2UYF A;  2Q8J A;  4ZED A;  5L9S A;  3S2V A;  3OEM A;  2REJ A;  5BWJ A;  1UTH B;  3VDF A;  3M3F A;  5L8D A;  2F6P A;  5HM4 B;  3E13 X;  4R72 A;  1J1N A;  3DP8 A;  4FEC A;  3S9M C;  3DP4 A;  4NF8 A;  4I1D A;  2HZK A;  2OJT A;  4JWY A;  3KZG A;  4AB5 A;  4C1T A;  2UVJ A;  4ECF A;  4QSD A;  3R26 A;  4PE5 B;  4G2Z A;  1MY2 A;  5F7V A;  1SW2 A;  4YKP A;  2VGQ A;  4YB5 A;  2LAO A;  3T66 A;  3U94 A;  1VSO A;  1TWY A;  3QYT A;  3V83 A;  4NF8 B;  3BKI B;  3UA8 A;  1DTG A;  4LZ5 A;  1Y3N A;  5CBR A;  3GBB A;  4XKR A;  4R6K A;  4XXU A;  2NWJ A;  4O3C A;  4ZZE A;  4Q5T A;  4KYD A;  3ZKL A;  4E0W A;  3OO8 A;  3CFX A;  1MPC A;  3HO7 A;  2X7Q A;  2I6E A;  4ZEC A;  2QS2 A;  2B65 A;  4FJP A;  4ELQ A;  4QSE A;  4QFL A;  3UGW A;  4THI A;  3OEL A;  2HFB A;  1SI0 A;  4O3B A;  3TTR A;  3U8Q A;  1MPB A;  1A54 A;  1ANF A;  1II5 A;  4N07 A;  2DVZ A;  3SET A;  1FQF A;  3TUS A;  5DVI A;  1M5F A;  2V84 A;  3G3I A;  2RCA A;  1B5I A;  1P99 A;  1SW4 A;  1B0L A;  3HV1 A;  4DIG A;  4QRZ A;  1D9V A;  3P7I A;  5DTB A;  4RPO A;  5L9M A;  4YZZ A;  3KSJ A;  3FXU A;  5I2N A;  2I4C A;  1MDQ A;  4U2R A;  3FV2 A;  3PU5 A;  4LON B;  4NF5 A;  1FTK A;  3H6W A;  3LBS A;  2F78 A;  4ZEI A;  4F1V A;  4G8M A;  3KGC A;  3IOT A;  4NF6 A;  4IO4 A;  2PYY A;  2RCB A;  1ZIU A;  1GVC A;  1YAE A;  5CRY A;  1SBP A;  3PUW E;  2VD3 A;  2E0S A;  3M3K A;  5I2N B;  1NNK A;  2FA7 A;  4LAT A;  3HN0 A;  3RLF E;  1SYH A;  4NF5 B;  1B4H A;  2F35 A;  5K2X A;  3SER A;  4NF6 B;  5A5X A;  5JEI A;  2I0B A;  1F9B A;  4YKK A;  3LSL A;  4U23 A;  1CE2 A;  4GLI A;  2P1S A;  3S9N C;  5I59 A;  1LFH A;  5CBS A;  4HCY A;  3U1O A;  5FHO A;  3FV1 A;  4OHN A;  3A09 A;  1QKA A;  3HST A;  1LBC A;  3QK6 A;  3OEN A;  4DZ1 A;  4ELP A;  1PEB A;  5A5X B;  1Q35 A;  1TXF A;  3SEU A;  3MZB A;  4PFW A;  1USY E;  3I6V A;  5I59 B;  2BJJ X;  5ITO A;  3H4Z A;  2E1S A;  4FED A;  4GWO A;  2FNC A;  5I2K A;  1GV8 A;  4PQJ A;  2I58 A;  1ZJL A;  3TQL A;  4GRK A;  4AQ4 A;  4KR5 A;  5IAI A;  5DVJ A;  2I0C A;  3FZV A;  3I3V A;  3DP6 A;  3C33 A;  1IZ1 A;  3ODB A;  1NL5 A;  1VFD A;  3KG2 A;  1OIB A;  1R1N A;  3VVF A;  1IIW A;  2ZNU A;  3B6T A;  4H1X A;  5I2K B;  1P1U A;  2X26 A;  4RK2 A;  4UA8 A;  3MWB A;  3K2D A;  4R6Y A;  1NMU A;  5AE4 A;  1MQG A;  4DE8 A;  1TT1 A;  4R9F A;  3RUM A;  1NH7 A;  3WAF A;  2QL3 A;  2Y84 A;  3TEP A;  3TTM A;  3RNN A;  5JK4 A;  2F7A A;  1ZLQ A;  3IOW A;  1JW1 A;  1I6B A;  2NUV A;  3Q29 A;  4LZ7 A;  3VXC A;  1MY0 A;  4IGT A;  4GOT A;  4MH5 A;  1R9L A;  4IB2 A;  2CMO A;  4X48 A;  3VFJ A;  4R9G A;  4TLM B;  4HCW A;  3QXM A;  3G3G A;  1VE4 A;  5H8Q A;  4ELR A;  1JVY A;  2DXR A;  2XD2 A;  1OLC A;  1ZKB A;  3S9E A;  1ZBM A;  4POX A;  1KWH A;  1Z7N E;  1H76 A;  3IX1 A;  4JBZ A;  4F2Q A;  4LZ8 A;  4KYE A;  3E4R A;  1EU8 A;  5H8Q B;  1T0K A;  3TCH A;  2KLF A;  1FQC A;  2R9J A;  2Q89 A;  4I8C A;  1MY3 A;  5J1D A;  2D21 A;  4N6P A;  1JVX A;  3KOS A;  3JYR A;  2AIX A;  4YB6 A;  2DWA A;  5AA3 A;  3IOV A;  1MQJ A;  1YPN A;  1DPE A;  4R74 A;  3PD9 A;  4P0G A;  1JQF A;  4F3S A;  1DSN A;  4DDD A;  3K6V A;  2VOZ A;  3JZJ A;  4YMB A;  4KHZ E;  4ZE8 A;  1BIY A;  1FTJ A;  1RYO A;  5H8H A;  2RC9 A;  1YTV A;  2QJE A;  1A8E A;  4P11 A;  3HHG A;  4ZS9 A;  3FJM A;  3S9L C;  1MXW A;  1LAH E;  3IJX B;  1NH8 A;  4Q0C A;  3KBR A;  2OK2 A;  3IB0 A;  3K0V A;  2F97 A;  3EPE A;  3V89 B;  2GFE A;  4BDM A;  3K4U A;  1N76 A;  4WEP A;  5H8H B;  2XX9 A;  4BLA A;  2F8D A;  5KZT A;  1M5C A;  3PUZ E;  2QS4 A;  4H5F A;  4QHQ A;  4ELO A;  4JSO A;  3K02 A;  2XXP A;  2ZXT A;  4JWO A;  3MQ9 A;  2XXT A;  4R2F A;  4FOR A;  1L5T A;  1SW5 A;  3TDJ A;  2DS9 A;  3G7W A;  3G3J A;  2GHA A;  2Y7I A;  4I62 A;  4ISU A;  1N7W A;  1NNP A;  3OO6 A;  1NFT A;  3CRB A;  4KCD A;  4HTG A;  4MBP A;  2QMX A;  1B3F A;  4IO3 A;  3UIF A;  4F19 A;  4OEU A;  1QUK A;  4EXK A;  5EHS A;  1MXV A;  4POW A;  4QFO A;  1OVB A;  1B3E A;  3OMB A;  1OQG A;  2A5T A;  4DXB A;  3GXA A;  3MBP A;  2XHD A;  4PFT A;  4NED A;  1MM7 A;  4H8I A;  4U21 A;  4Q30 B;  1SYI A;  2OLB A;  3CG3 A;  1N3X A;  3L6G A;  3Q27 A;  3OXN A;  1URG A;  4KI0 E;  1Z7M E;  2Y7K A;  3TCG A;  4PP0 A;  1QKB A;  3LSF B;  3RT8 A;  5JTY A;  1ZMG A;  4U4S A;  1P1N A;  1ATG A;  1LAF E;  4IGR A;  2A5T B;  1D3K A;  4NMY A;  3FGS A;  1OLA A;  3ILU B;  2V3T A;  3C9H A;  4JSD A;  2ALU A;  3B6W A;  4F29 A;  3KEI A;  4H5G A;  2H99 A;  1IQ7 A;  3MPK A;  4ZE9 A;  4GXS B;  4EQ9 A;  4GF8 A;  2XD3 A;  2DXY A;  5JTY B;  3PPO A;  4GVO A;  1P1O A;  3PUY E;  4GL0 A;  2ZYN A;  3MC2 A;  2O51 A;  2YJP A;  1N04 A;  5H8N A;  3E3K A;  2F6G A;  4RYA A;  4HW8 A;  3Q26 A;  3U92 A;  3C35 A;  2O1M A;  1FW0 A;  5BUU A;  5TP9 A;  3MPL A;  1GTK A;  3FD3 A;  2Y7P A;  2CZL A;  3O6H A;  2UXA A;  3PPP A;  4DXC A;  4R2B A;  4LQ5 A;  2RC8 A;  4F3G A;  1LCT A;  1LGB C;  5CMC A;  5H8N B;  1N84 A;  2D3I A;  3VVD A;  4RXL A;  1IUD A;  3OO9 A;  2QMW A;  2R71 A;  5I58 A;  1MQI A;  3CR9 A;  5DVF A;  5TP9 B;  2O7I A;  3SEY A;  3TTL A;  4GIZ A;  2H5Y A;  1MY1 A;  1B1H A;  3MVY A;  4OVJ A;  1GR2 A;  2ONK E;  3T9H B;  3FIR A;  3SKP A;  4G8N A;  2VHA A;  4ESX A;  3ZS6 A;  1JW5 A;  3LUY A;  1XS5 A;  2H98 A;  3H6U A;  2HEU A;  1B3L A;  1VR5 A;  3O6G A;  3C36 A;  1B7H A;  4DLD A;  1FQA A;  5I58 B;  2XXX A;  1N3W A;  2DWJ A;  3VLW A;  2ONR A;  4L17 A;  3OSQ A;  5K2Y A;  1AMF A;  2DE4 A;  1B51 A;  3QUF A;  4TQU Q;  2QSX A;  1MPD A;  2QS3 A;  3SES A;  3A3U A;  3K6U A;  3C32 A;  4P0I A;  3IK6 B;  3PMV A;  3KN3 A;  3TZA A;  4BDL A;  4H65 A;  2O84 X;  3W15 C;  1SI1 A;  5TU0 A;  2D5W A;  1US4 A;  3FUZ A;  2HZL A;  2HCA A;  1XOC A;  1MH4 A;  2OWS A;  4OEN A;  2DVC A;  2GRV A;  4NTL A;  4H67 A;  4QFN A;  1MM6 A;  2DP8 A;  4NWC A;  3O97 A;  2Z22 A;  2O69 A;  3LSW A;  4PFU A;  1B5J A;  5AA2 A;  5ICT A;  4IY5 A;  1SDX A;  5TPA A;  4GQO A;  3KSX A;  2YPN A;  1LFI A;  1B9J A;  1BP5 A;  5ISU A;  1JW4 A;  1H44 A;  4YMA A;  3K1P A;  3THI A;  3TPA A;  4KQP A;  3N5L A;  3RGY A;  2B3B A;  3BFT A;  3TFL A;  4OET A;  2THI A;  1XC1 A;  4F1Y A;  2Z23 A;  2PT1 A;  3EHT A;  2I3W A;  1B7U A;  4IO2 A;  3H06 B;  4LQ2 A;  1A40 A;  1PB8 A;  1B2H A;  5AA2 B;  1NNT A;  5TPA B;  4QSC A;  4X1B A;  3KJ7 A;  4H0W A;  2PBW A;  2RC7 A;  3G3H A;  2M8C A;  1TFD A;  4WXJ A;  4ZEB A;  5CMK A;  2XXR A;  1PDA A;  4ZEF A;  4DXU A;  4K3F A;  4ZDM A;  1QW0 A;  5EHM A;  4NE4 A;  4QFK A;  4EQ7 A;  4PET A;  3FXQ A;  1URS A;  4MF3 A;  4XKQ A;  3V5A A;  3KJT A;  3EQ1 A;  2F7C A;  3N26 A;  4BDR A;  2F36 A;  2GH9 A;  3PMX A;  3FJ7 A;  1SVX B;  3RPW A;  1EZO A;  2PVU A;  1LB8 A;  3QAX A;  3MP1 A;  2Z8F A;  4DCY A;  1MDP 1;  5IKB A;  3IL1 B;  1SW1 A;  4JB7 A;  1IIT A;  1M5B A;  4R75 A;  2DE3 A;  1B3H A;  2ZNS A;  3T9X B;  1JNF A;  1PC3 A;  1MY4 A;  3IB2 A;  4YU0 A;  1Y1M A;  2F7B A;  3IOR A;  1AL3 A;  1LBB A;  1B40 A;  1B6H A;  4Z7E A;  4YKJ A;  1B4Z A;  3B6Q A;  5F1Q A;  2I3V A;  3W9V A;  1MS7 A;  1JEV A;  4Q8R A;  5FTH A;  3PD8 A;  1A7L A;  3K6X A;  3CSG A;  5EYF A;  2RIN A;  3H6V A;  3TTN A;  4JXI A;  3FVG A;  5DT6 A;  4YKI A;  2VP1 A;  3K01 A;  2OCU A;  3VVE A;  1O63 A;  1B05 A;  3ZSF A;  1WDN A;  5LOM A;  2NXO A;  4G77 A;  3LC8 A;  5KCJ A;  2O1L A;  1TFA A;  1MXZ A;  3MP8 A;  4IO6 A;  1URD A;  1HSE A;  1Y4C A;  1FQB A;  4KCC A;  1N0T A;  2DQV A;  4E0X A;  2WKY A;  3Q28 A;  1QUJ A;  1B46 A;  1DTZ A;  3KOT A;  3UOR A;  2NOO A;  3C31 A;  2Q2A A;  3MVZ A;  1IXC A;  1B58 A;  4O3A A;  2VD2 A;  1USY H;  4AB6 A;  4M4G A;  1P1W A;  3OD7 A;  3G3K A;  4YAH X;  2V3Q A;  1PB7 A;  5ICQ A;  1H45 A;  4G68 A;  3FVK A;  3W9W A;  5KCJ B;  1XVY A;  4X9T A;  3BBR A;  3U72 A;  1IEJ A;  4F31 B;  1B52 A;  3LSX A;  3K00 A;  1POY 1;  4OEV A;  3MZ1 A;  1SD3 A;  5HBC A;  3VLV A;  4TOZ A;  2RF1 A;  5L9O A;  4X1D A;  1FQE A;  2ZYK A;  2A5S A;  2I49 A;  3EF7 A;  3IO4 A;  2UVI A;  3C4M A;  3N6T A;  3PMW A;  1FCK A;  4OTE A;  4G68 B;  3SEX A;  3OEK A;  3K1M A;  3L6H A;  4R73 A;  2DYX A;  3TQW A;  2UVG A;  3MP6 A;  1XHY A;  3O28 A;  3CIJ A;  3CFZ A;  3FVO A;  4XTC Q;  5CC2 A;  3OSR A;  2AL4 A;  5CMM A;  1WVJ A;  2OZZ A;  3IJO B;  3T22 A;  3D4G A;  5AA2 D;  1MXY A;  2XXV A;  4U4X A;  4RPN A;  5FHN A;  1LAG E;  4FE8 A;  2HAV A;  2Q9T A;  4EF2 A;  3FAS A;  1CB6 A;  1MH3 A;  5ELV A;  1SQY A;  4BDO A;  1MXX A;  1AOV A;  4TLL B;  4DCX A;  1MG1 A;  4EF1 A;  1POT A;  2XXY A;  3PUV E;  3OOA A;  4OER A;  3LR1 A;  3RT6 B;  2Q88 A;  3VV5 A;  2G93 A;  3FAT A;  3USD A;  3VE1 B;  2I4B A;  1VFE A;  1S9T A;  2PMS A;  5DYH A;  1ZU0 A;  1B0H A;  1R9Q A;  2ZYM A;  3PUX E;  4U22 A;  4NWD A;  3RTW B;  4FEB A;  3OO7 A;  2PX1 A;  2REG A;  5AA1 A;  4OES A;  1OQH A;  3O6I A;  2HXW A;  2O6A A;  5I84 A;  4LVQ A;  2P2A A;  2XXQ A;  4BDN A;  4ONY A;  1YCJ A;  4OFO A;  4Z0I A;  3QSL A;  1DPP A;  1OVT A;  3MZ9 A;  3N6U A;  1R6Z A;  2QS1 A;  2YLN A;  1I6A A;  3MUQ A;  1S50 A;  1Y3Q A;  2DWI A;  4IY6 A;  1PB9 A;  4EDP A;  1UTB A;  3O2A A;  2IA4 A;  3EN3 A;  1EZ9 A;  2R6G E;  2DOJ A;  1IXG A;  3KN8 A;  3CSB A;  4OFJ A;  5CM6 A;  2AL5 A;  2V25 A;  1B3G A;  2OWT A;  3H6T A;  1D9Y A;  2XX8 A;  1A99 A;  4BDQ A;  2Y7R A;  2F34 A;  2F5X A;  4EQB A;  4HS7 A;  2H4I A;  3Q25 A;  3H3G A;  3HHF A;  2V93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...